2KRMA

Rdc refined solution structure of the first sh3 domain of cd2ap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krmA00
4OMOA 1EFNA 1QWFA 3VRYA 4X1VA 4CC7A 4AFQC 1NEBA 5GJWB 1VYTA 2I0NA 1AD5A 2MIOA 2NWMA 1YWPA 3U23A 2BZYA 1SEMA 3EGUA 5I22A 2KRMA 4LE9A 2IIMA 2CH4A 1PNJA 1X27A 2BTTA 2OAWA 1AOJA 1W6XA 1WYXA 3EG2A 4RTYA 2AZVA 2EGEA 4HVUA 2H8HA 1KSWA 2JS2A 1AZEA 2DE0X 2L0AA 3TSWA 2K79A 1SHFA 4F16A 1WFWA 1ZSGA 2RMOA 2AKLA 2DILA 1JXMA 4RTVA 1E7OA 2KYMA 1I07A 4J9CA 4D8DA 2PZ1A 1N5ZA 1UHCA 2DF6A 1ZBJA 2NUZA 2JW4A 4J9GA 1H8KA 2A37A 4JJCA 3VRZA 1AWJA 2EGCA 2JMCA 1X69A 2EKHA 1QWEA 2KRSA 2P4RA 1NYGA 1E6GA 2CUDA 2FG0A 2AK5A 2V1QA 2MCNA 3NHNA 1AVZC 4IIOA 3M0UA 1KJWA 1LCKA 2ECZA 4CC4B 2LQWA 4LUEA 1ARKA 1M3BA 2BZXA 1X2QA 3GBQA 3RBBB 4ESRA 2JMAA 4JJDA 1AZGB 1SSHA 2RQWA 2B86A 4RTZA 2CDTA 2V1RA 1OPLA 2RN8A 2C0OA 3NMZC 1GRIA 2JTEA 3VS0A 2O88A 1WXUA 1Z9QA 1ZX6A 4AFZC 4RTWA 1OPKA 2OJ2A 1YN8A 2YUPA 1AWXA 1JO8A 2D1XA 3ZL7C 1ZUKA 2EPDA 2F2VA 1J3TA 1H3HA 2D0NA 3QWXX 3REBB 2L3SA 4Z89A 2KBTA 2DL3A 2KXDA 2L3QA 3EHQA 1YWOA 3PE0A 2KROA 1HD3A 1Y57A 3M0SA 2DNUA 1UFFA 3VS3A 1JEGA 1K76A 2DRMA 1UDLA 2KNBB 2HSPA 3SEMA 2LQNA 1GCQA 3C0CA 1GBRA 1ABOA 2DMOA 1X2KA 2G6FX 5IHIA 2GBQA 2CUBA 4IIMA 1KFZA 1TG0A 1I1JA 2K9GA 1X6BA 2DBMA 2A28A 1SPKA 4OMNA 1PHTA 4JZ4A 2DX1A 3VS2A 3UATA 3VS4A 4RUGA 4K11A 1PRLC 2J7IA 3H0FA 2GTOA 2DL7A 2FPFA 1PKTA 1VA7A 1UG1A 1WA7A 4J9DA 1X43A 1CKBA 2C0TA 2RF0A 3I9QA 1WX6A 1NYFA 4EIKA 1UTIA 5EC7A 2CSIA 2J05A 3NPFA 1M8MA 2CREA 4J9EA 1ZUUA 4AG2C 1GFCA 3M0PA 4Y92A 4AFSC 1MV0B 1M27C 1K0SA 1JU5C 1NM7A 2O9SA 2W0ZA 2KXCA 1K4US 1G2BA 1VYUA 2FO0A 1SRLA 2RNAA 4ZNXA 1MV3A 5FWCA 4OMLA 3UA6A 2AKKA 3UF4A 2DA9A 2ROTA 4A63B 2EW3A 2YUNA 2KRNA 1BK2A 2J06A 4LNPA 2CT3A 2E5KA 1GFDA 1T0JA 3REAB 2D8JA 1FYNA 1RI9A 2YSQA 2EVRA 2QDLA 1PKSA 2MOXA 4JZ3A 3O5ZA 4RTUA 4DEYA 1GCPA 1JXOA 3A98A 3THKA 1NG2A 2L3PA 1S1NA 1U3OA 2FPEA 2K2MA 2FPDA 1JQQA 1M30A 3EG0A 4HXJA 1QLYA 2M51A 2KT1A 2YT6A 5IH2A 2J6OA 2A36A 2W10A 1WXBA 1ZLMA 4Z8AA 1AWWA 4LN2A 2HEQA 1WXTA 2SEMA 5HCKA 3PVQA 3KFVA 1SRMA 2PTKA 4OMQA 3I5SA 4CC2A 2EBPA 1OV3A 5IXBA 1U5SA 2AZSA 1UUEA 2ED0A 3ULRB 2DM1A 2LJ0A 2LJ1A 2DYBA 3QWYA 3PVLA 2YDLA 2L2PA 1QKWA 2JT4A 4M4ZA 4J9IA 5GJVB 2RQTA 2KE9A 2DBKA 2O31A 1ABQA 1Z9ZA 2YUQA 1K0XA 1B3QA 1WLPB 2EYWA 2JM9A 2CSQA 2C0IA 2CT4A 2LNHB 2A08A 3M0RA 2EQIA 3TVTA 2ABLA 1WIEA 2D8HA 2X3XD 1GBQA 4J9BA 2PNIA 4WCIA 5L23A 1T0HA 1KIKA 1BB9A 1U06A 2RQUA 1VYVA 2K6DA 2SRCA 3FJ5A 2FEIA 3UA7A 4F14A 2VWFA 4J9HA 5FW9A 2GNCA 4R0KA 5IHNA 3H41A 4LUDA 1W1FA 2DL4A 2GTJA 5FWBA 2JS0A 1ZUYA 1IO6A 1WDXA 3TSZA 2HCKA 1X6GA 2O9VA 4JPBW 1UE9A 2EGAA 1QCFA 1A0NB 1UHFA 1UJ0A 4JJBA 3R6NA 4DEXA 1T3SA 3EG3A 2J6KA 3I5RA 3EHRA 4HCKA 3VS1A 2F2XA 1AEYA 1RLQC 5IXFA 4AFUC 1TUDA 1I0CA 1SHGA 2DL8A 4KRTA 2K7AA 4J9FA 1T3LA 1UGVA 1K1ZA 4HVVA 4CC3A 2EYYA 3SHWA 2VVKA 2HBWA 3NGPA 2CH4W 2J6FA 2F2WA 1RUWA 1TUCA 2GGRA 1B07A 2KGTA 4OMPA 1GCQC 1BU1A 4OMMA 4Z88A 1MUZA 4AG1C 2ED1A 2ESWA 1UJYA 3CQTA 1CKAA 2YUOA 2LJ3A 1HSQA 1UECA 3IQLA 1Y0MA 1HJDA 2EYXA 2O2OA 1W70A 2KR3A 2KT8A 1G83A 1XOVA 4GBQA 1M3CA 2JXBA 1V1CA 3M0TA 2LCSA 4GLMA 3VS5A 1OOTA 2VKNA 3H0IA 2RPNA 1FMKA 1BBZA 2DLPA 2RQVA 2FRWA 2LX7A 4E6RA 4D8KA 1AWOA 2XMFA 4QT7A 1NLOC 2DVJA 1QKXA 1PWTA 2BZ8A 4RTTA 4ORZA 2KYBA 3VS6A 2ROLA 1YCSB 3EG1A 1H92A 3VS7A 1OEBA 1RLPC 2LMJA 4HVWA 4F17A 5ECAA 1M3AA 2RQRA 1NLPC 1GL5A 2X3WD 2ENMA 1NEGA 2M0YA 2EYZA 3RNJA 4RTXA 1WI7A 2KEAA 2GQIA 3JV3A 2OI3A 2HDAA 3M0QA 1YNZA 2DJQA 2LZ6B 2DRKA 2K3BA 3LH5A 1PRMC 1CSKA 4FSSA 2JM8A 2FRYA 1YP5A 2DL5A 5IHKA 2LP5A 5I11A 3I35A 1E6HA 3H0HA 1K9AA
chains in the Genus database with same CATH superfamily
4OMOA 4AFQC 5GJWB 3X24B 1MNEA 1VYTA 4J8OA 1YI2A 2YLBA 1BI1A 1YWPA 3U23A 3CPWA 1N8RR 4MDXA 4M7AG 2ZPBB 2KRMA 2DPPB 2L5QA 4LE9A 1VQPA 2IIMA 2QEXQ 4F7UE 2DYIA 2AZVA 3HFNA 2FB7A 1SSFA 3GF5A 4BI4A 2PVGB 1UGPB 1RAIB 2K79A 4C92E 3CCMT 2QQAA 1SHFA 1ZSGA 4ZGEB 2MF2A 1N27A 1E7OA 1NBEB 1YITT 3A8HB 2ZPHB 3CMEQ 2RI5A 3M9QA 4KGZB 4JJCA 3OMCA 4PJOD 4M7DG 4GY5A 1X69A 1QWEA 3HRTA 3H6ZA 1NYGA 2YRDA 1X6OA 2E64A 2KMTA 4RCCA 4KH1B 3MKDA 4KULA 3NHNA 1VQ7A 5CIUA 5GMKl 2VXFA 1KJWA 4E47A 2Y4XA 3OW2S 1VQ4Q 2ECZA 3G6ET 4CC4B 1VQLT 1M3BA 4HKEA 3PGGA 4KH0B 2DEUA 2MWOA 3EFSA 2ATCB 3GBQA 4JJDA 1G8XA 2XIDA 1OQKA 7AT1B 3OSVA 3RMSA 1N8RU 2RQWA 2B86A 1JRIA 4PL6A 2V1RA 2RN8A 1Q95G 1RAEB 2C0OA 2DTHA 2CP5A 3L2VA 2DO3A 3CMET 3CBPA 2YUPA 3LWHA 3GLXA 1AWXA 3CC4T 1OULA 1PC0A 1B34A 1BKBA 3CCLT 3CCMQ 1H3HA 1N6AA 1KQSS 2D0NA 4X9CA 3QWXX 5IAYA 4FT4A 4Z89A 2BUDA 2L3QA 4M75E 1IXDA 2MAMA 5LJ5f 1OZ3A 2COYA 2MPXC 4EMKA 3JCMQ 1FMWA 2KNBB 3KBGA 1Y7XA 3BDLA 5FU6C 2D0QB 5LJ3g 4J6XA 2M16A 1ZA2B 2CUBA 4IIMA 2NUPB 3E19A 1KFZA 4C0ZA 3JCMX 2IVWA 1Q82C 1OZ2A 3BY7A 4J83A 2DBMA 8AT1B 4LDUA 4PLIA 3UATA 3EGXB 2VB6A 1NPRA 1VQ6Q 2F5TX 3M53A 3JCMW 1OI1A 2D6FA 2VGMA 4LDYA 2FPFA 1NJIU 1VQMQ 2DETA 3CCSQ 4F7UF 1CKBA 3I9QA 4JRQA 4J5YA 2OAUA 4C8QD 1UGRB 1NYFA 1UTIA 2DEQA 3CCSA 3I55Q 2CSIA 2J05A 3EH1A 5KYYB 3A1PA 3RESA 1NJIC 2AT1B 5KYYA 4M78F 1BCOA 3EGDB 1MV0B 5LJ3d 5GMKj 3L2QA 1M90R 1NZ9A 4O5VA 3CMEA 4KBMB 2KXCA 4C0DC 4F04B 3ER0A 1GXIE 1G2BA 2HL3A 1SRLA 2F69A 2E12A 5FWCA 4PJJA 3OS5A 2AKKA 4XU2A 4BE0A 1QP3A 1K9MC 4FYVB 8ATCB 2EW3A 2YUNA 2J06A 1Q86C 1F1BB 4II1A 3R6OA 3LX7A 1RI9A 3RMQA 3CCRQ 1RADB 3O5ZA 4DEYA 3HSBA 4V2SA 1JXOA 3EFOB 4C8QF 3CD6A 3JSCA 4M77F 5A0LA 1VQOA 4HXJA 4NOYA 2HQHA 3S3OA 1QLYA 2YHTA 1NJIR 2M51A 4FW1A 4JRPA 1WNLA 4WTOB 4ZGJB 4DBHA 2A36A 2EJGA 2W10A 4MZMA 5HCKA 2PTKA 4OMQA 1VQ5A 4A54A 1BYMA 2AZSA 3ULRB 3MO8A 4JLIA 1LJOA 2GCXA 2E3IA 2LJ0A 3UDCA 5FRMA 5J26A 1KD1U 2L2PA 5CKHA 4J9IA 3V7RA 3S3NA 3HHTB 1QVFA 2FYKA 1ABQA 2YUQA 1PCXA 1VIEA 1VQ6T 1VQ8T 4FT2A 1Q86U 1U1SA 1WIEA 2D8HA 1GBQA 4PJOF 3GNGA 1C0MA 2JN0A 4OP0A 2A3LA 1KIKA 1U06A 4M75B 4HCBA 5CQYA 3EGXA 1LOJA 3X26B 1VYVA 3V8LA 1KC8U 1VQPQ 4F14A 4J9HA 5FW9A 4C92D 4NL3A 1Y71A 3MP1A 3OYKA 4LUDA 2JVVA 4M7AA 1EIFA 2JS0A 1ZUYA 3JB9G 1BIBA 3META 2EGAA 1QCFA 1UHFA 4E7HA 4JJBA 3R6NA 2FHDA 2DTIA 3I5RA 3EHRA 5GANd 2LX9A 1VQOT 3CCVQ 5HK0A 2ZPIB 2FZKB 3G71Q 3JCMJ 4CC3A 2OX7A 3NGPA 2CH4W 4JLGA 2F2WA 5C0MA 1JJ2A 2YWWA 4M75C 2X4JA 1VQ8A 4OMMA 4Z88A 2L89A 1VQ4A 3CEYA 4E7KA 1UJYA 4C92F 1IHVA 2WSCE 2RHUA 1CKAA 1YI2Q 2YUOA 1UECA 3E9GA 3G1JA 3IQLA 5CK9A 2XD0A 2LRQA 2PVDB 2EYXA 1WHGA 4DBQA 5M9OA 2Z0WA 3CCJT 2RA2A 3FIFA 2E4HA 1XOVA 3HP9A 2LCSA 4GLMA 3H0IA 2RPNA 2E6NA 1TS9A 4XTZA 2DLPA 2FRWA 4E6RA 3BE3A 4FCYA 2NUPA 5CQXA 2KY9A 1WHLA 3VS7A 2XDPA 1I4K1 4QQDA 2LMJA 2P0PA 1YBYA 2HD0A 1GL5A 1N9RA 4ATOA 3QUIA 2M0YA 4JS5A 3Q1JA 4HT9A 1IZ6A 2GQIA 1MMAA 2DFUA 4IUVA 2L8DA 2XI9A 2DXCA 4FSXA 1YP5A 2QAZA 2DL5A 2LP5A 3GIBA 2QQSA 1QVGA 1K9AA 2YXYA 2O01E 4C92C 1EFNA 1KD1R 2V8JA 3VRYA 4ZTFA 4A4EA 4DOWA 3CCQT 3HPWA 3CCLA 3KXTA 1AD5A 1UGQB 2EWNA 2CZ0B 2MIOA 2RHYA 3CD6Q 2NWMA 4X9DA 4J6YA 3EGUA 1SF9A 5GAOm 1PG5B 4LDVA 4PK4A 4FYXB 2OAWA 1W6XA 1G5VA 3EG2A 2ZPFB 1BIAA 2H8HA 2JS2A 2DE0X 4ZGDB 3INZA 3HFOA 3RDVA 3CCJA 4J6WA 5LJ5j 3N5BB 1JXMA 2KYMA 1I07A 3G4ST 1UHCA 1EZZB 1ZBJA 3GNFB 2H3JA 2JW4A 1H8KA 1Q7YC 1MHNA 5GAN3 4N4GA 4Y28E 3JB9J 2RHXA 2P4RA 3A5ZB 1D09B 2G3RA 1YFNA 1H641 2CUDA 3EFRA 1M2VA 5LJ3e 5LJ5e 5GAOr 1P92A 1AVZC 5FU7B 3M0UA 2LQWA 4M7AD 1TWBA 3RBBB 1SG5A 1VQ6A 1QQJA 1KQSP 1SSHA 1HXDA 2BE9B 2DVEA 2LCLA 3NMZC 1VQNT 2JTEA 2X35A 3VS0A 2PUOB 1M5Q1 3MP8A 2KQWA 3JB9D 5LJ5d 1KHCA 4M78A 2OTJQ 2ZGWA 2QA4T 2V8IA 2D1XA 4DBFA 2EPDA 2R5AA 3C94A 3JB9I 4EMHA 2CYZB 3MEUA 2KBTA 2OTJT 2KROA 4XTUA 4JRIA 2CGHA 1HD3A 3P8DA 1Y57A 3O8VA 1O9SA 1D0XA 4BDZA 1IHWA 5GAMe 1GBRA 1VQNQ 1YIJA 1ZQ1A 2G6FX 2XKOC 2GBQA 2E1HA 3H8ZA 1M2OA 1D3BB 4EMKC 5CCAA 1G3SA 1Y96A 5L8RE 2NUTA 3OYJA 4P5NA 4B6MA 2NUTB 5KCHA 4OMNA 1M90U 3CC7Q 2DX1A 3VS2A 3VS4A 1WGSA 2RH2A 5LJ5g 1W2BP 2QI2A 4BACA 4NL2A 5GANf 3V7CA 1PKTA 1WA7A 1UG1A 3VV0A 4ZTJA 5D6YA 2GFAA 2RF0A 3CC4A 1TH7A 5CR2A 3ZBDA 4LD9K 1Q81C 4RKUE 1VQ9A 3VUBA 1M8MA 3TREA 1M9SA 1RABB 4J9EA 4AG2C 1GFCA 5GAMf 4ZN3A 1MNDA 2X4WA 3NTIA 4Y92A 3SFMA 3WXMB 1KQ1A 1M27C 1YHQT 2KI7A 1K0SA 1OYXA 2O9SA 3UWNA 4YTLA 2RB6A 2W0ZA 5GMKh 2E65A 2DXBA 1VYUA 1WJQA 4QQ6A 2FO0A 3S6WA 6AT1B 4QW2A 1MV3A 3DB4A 3UA6A 2I2LA 3CC7T 1PD0A 2ZAEA 3X28B 3UF4A 2ROTA 4QQGA 1BK2A 4LNPA 1GFDA 1T0JA 4PNOA 3BFMA 4M78B 1FYNA 4QKUA 5GAN4 2DIGA 2PVOB 2YSQA 2EVRA 4C8QC 2ZPGB 5GAMh 4OB1B 1EX4A 4RTUA 1GCPA 5GAOl 1G3TA 4LD6A 3QZ9B 3THKA 2Y4YA 4EMKB 3SD4A 2OTLA 1JJ2P 2BIVA 1S1NA 5KYWA 2FPEA 2K2MA 2RHZA 4C8QG 2DZ9A 2M02A 1C6VX 2BKDN 2J6OA 5A0DA 1WXBA 1B7TA 1ZLMA 3CC2A 4M7DB 2DXUA 1AWWA 4X34A 2HEQA 4WF2A 1M1KR 3PVQA 3L2WA 1G3YA 2LNVA 4HCCA 5FRNA 1SRMA 2QA4Q 3BDUA 2DZCA 2B8AA 3I5SA 3G71A 4CC2A 2EJFA 1Q82U 1U5SA 2KK4A 2E3HA 1UUEA 2ED0A 1S72Q 1K8AR 2QQRA 1UEBA 2YDLA 1D1CA 2CZ7B 2RQTA 4OGCA 2O31A 3OQ5A 2CP2A 2EQMA 3PMTA 4M75F 5FU6B 2EYWA 2JM9A 2CSQA 1IB8A 4C8QA 2E41A 2K5LA 2EQIA 2HQXA 3TVTA 1M1GA 1M1KU 4IURA 3CMAT 5L23A 4XTVA 3CXCA 4FYYB 2E6ZA 3OYIA 4M7AE 2SRCA 3H9NA 2DTOA 2EKOA 3FJ5A 4PFOA 4Z02A 4E7SA 2VWFA 2LVMA 3AT1B 1OU8A 3VJPA 1W1FA 2GTJA 1WDXA 2AIRB 2DK3A 3G4SQ 4FIBA 1YJWA 4JPBW 4E7JA 2OTJA 3G71T 3L2ZA 3V7SA 2CS7A 4M77E 3QKJA 1UJ0A 1VQOQ 1YJWQ 3QIIA 4DEXA 2HL5C 1RLQC 5IXFA 3L2UA 4AFUC 1SHGA 1TOVA 4OB0B 1V29B 4J9FA 4OMFB 4A4FA 5I21A 2L3RA 1UGVA 4HVVA 5GANh 3KUFA 2VVKA 1WJSA 3JCMd 3TQ7P 2J6FA 3X25B 4BUGA 2GGRA 4IUPA 4MMLA 3CCQQ 2P84A 1VQPT 4AG1C 2ED1A 2NLUA 3WVEB 3CQTA 4DA4A 2FZCB 3TU4K 1ZSZC 2CP7A 1HSQA 1HJDA 2LQKA 3OYBA 4M75A 3JCMP 2LQ8A 3L42A 3FB9A 3M0TA 5KYUB 4FYWB 2O4XB 1W2BA 2R5MA 3F70A 1Q7YU 4OB3B 1BBZA 2RQVA 1K8AC 1U1TA 2XMFA 2QK0A 5AT1B 2PUKB 4MMKA 5KH6A 5KYNA 1O75A 4PFPA 1YCSB 1KQSA 2EYQA 1RLPC 3CPWP 3UT1A 5ECAA 1AT1B 2IG0A 2LCCA 3G6EA 2LTOA 3E9FA 3PT9A 2ENMA 1NEGA 2EYZA 2EQUA 1M1KC 2VGNA 2RI3A 2HDAA 3OYEA 3M0QA 2DJQA 1HYOA 3QXEB 5LJ3j 3CCJQ 2RI2A 4C5GA 2FRYA 3CC2Q 1KG1A 1X75C 5IHKA 4DBRA 5I11A 2DIQA 2QGGA 2MK5A 3I35A 1LPLA 2P0KA 4J7IA 2QEXA 4BD3A 3CCRT 4CC7A 3CC7A 3EFOA 1MMDA 1ZSZB 2I0NA 3RR6A 1YJ9A 2EQJA 2MMPA 1D3BA 4EDUA 3OYAA 2BZYA 1Y96B 4FU6A 1SEMA 2DD5A 2XDDA 3NTKA 3QG1A 2YRVA 4C92G 1R0CB 2K2VA 1X27A 2BTTA 4RTYA 5IN1A 2EIFA 3OYDA 1KSWA 3CCVT 1BI2A 1R77A 2DERA 2XK0A 1VQ9Q 1XQHA 3TSWA 4F7UG 2RMOA 2DILA 4RTVA 4JRKA 4M77A 4J9CA 4D8DA 2PZ1A 5AYFA 5LL6S 4BY6B 3FC3A 3FRNA 4XTYA 4J9GA 4C5IA 1LVKA 2A37A 1X01A 1AWJA 1Q81R 3LWIA 2HAXA 4E7LA 2EKHA 2KRSA 4C0DB 5GAN5 1E6GA 1MMGA 2FG0A 2AK5A 2V1QA 1YIJT 2DJZA 1RAGB 3PMIA 4IIOA 2VV5A 1WPYA 1N8RC 4M7DE 3L1AA 1X2QA 4M7DD 4ESRA 1YJ9T 4F7UB 4XTXA 2NYSA 2QDYB 2VUBA 2X51A 3PFSA 2CDTA 2JZ2A 1OPLA 4IUTA 1GRIA 1Q81U 3JCMh 2O88A 3OYFA 3FJPA 4RTWA 1OPKA 2X4YA 3JCMg 3M4YA 1YN8A 5A0GA 2HZYA 3EGDA 1ZHIA 4M75G 1KC8R 3PIOA 2FZGB 1JO8A 1ZUKA 2WSEE 2F2VA 1J3TA 2CZ6B 3HRSA 4XQ3A 3GP8A 4RMOA 1QVGS 3MP6A 1VQ9T 2L3SA 3I56A 4C0FA 2DL3A 2KXDA 3V8KA 5CVIA 3EHQA 1YWOA 2IPOB 1TTHB 3M0SA 2DNUA 3CC4Q 1JEGA 2JJ9A 2DRMA 1YJNT 1W2BS 3VYGA 2LQNA 1GCQA 1ABOA 2COZA 1X2KA 5IHIA 5DM7R 3OYLA 3FLGA 3CCEA 1RAAB 1WQ7A 2R57A 5D7UA 3CXCP 2K9GA 1X6BA 4BDYA 2VC8A 4C92A 2OTLQ 1I81A 1ZSZA 1SPKA 2RJEA 1PHTA 2YRCA 3G6EQ 3DKMA 4TVRA 4XU0A 1H3ZA 2RK2A 1PRLC 5LJ5h 3A8OB 1WHHA 3OY9A 1WQWA 1ZA1B 2J7IA 3H0FA 4XAXB 3PIPA 1VA7A 4J9DA 1X43A 2C0TA 3OW2P 4CI0C 4B9XA 4QVCA 1WX6A 4EIKA 5GANj 3MEVA 1I5OB 3I55T 1YITQ 3LW5E 1Y07A 1TUGB 2K3XA 3QJ6A 1W4SA 3JCMe 1VQNA 5A2QE 1B34B 1VQMT 3OYYA 4AT1B 2COWA 3VU3C 1JU5C 1NM7A 5CKEA 4C0GA 4PJOG 4KT0E 1OX8A 3A8LB 3JCMc 2WSFE 2QEXT 4FW2A 1D1BA 3SB2A 2QA4A 1K73U 2KSSA 2JOYA 1QVGP 1DJ7B 3HL8A 2CT3A 5FLXE 5GAN2 2E5KA 5CKFA 3REAB 2P4TA 3OS1A 2XDBA 2XU8A 2XG8D 2ZZDA 4JZ3A 4M77C 3WVDB 4FL6A 2X9HA 1RL2A 2GF7A 1MGQA 1JQQA 1M30A 2M9UA 3PNWC 3EG0A 3CCUQ 3MPUB 3OYNA 2YT6A 5IH2A 5CKDA 2HBPA 4PFZA 3EG9A 4Z8AA 4LN2A 4M7AB 4XTWA 5KYXB 1M4ZA 3CCLQ 2QTXA 2LT1A 2C06A 2EBPA 2HNIA 5IXBA 4ELZC 4OGEA 2QYZA 1OU9A 2K5IA 1JJ2S 1QVFP 2DM1A 2LJ1A 3CCMA 2JT4A 4M4ZA 5GJVB 4XK8E 2DBKA 2VASA 3CXCS 2LT4A 4A4GA 1M8VA 1WLPB 2HQEA 2C0IA 2CT4A 1IGUA 2AHJB 5GAOp 4RG2A 3CMAQ 5GAMg 1VQLQ 2ABLA 1VQ4T 3M57A 5GAOq 2PNIA 2OTLT 4WCIA 1T0HA 4L59A 1K8AU 1BB9A 2RQUA 5GMKi 5FU7C 2FEIA 2P0QA 3OSSC 2GNCA 4R0KA 3OYHA 4JJNK 5I2MA 5IHNA 3H41A 3LGLA 2A7YA 2WACA 2HKQB 5FWBA 4RG8A 1YJNQ 2HCKA 1X6GA 1RAFB 1UE9A 5C6SA 3RUXA 3OB9A 1XTDA 2V26A 4M7DF 3X20B 1T3SA 3VS1A 2J6KA 4HCKA 4PKCC 3OYCA 5GAN8 3RKYA 2DL8A 3TEEA 3GOXA 1T3LA 5GAMd 4E7IA 5KE3A 3QDRB 3SHWA 4IKFA 3QBYA 3HKSA 1TUCA 4OMPA 1GCQC 1BU1A 1VQ5T 1MUZA 2F5KA 1YJ9Q 5HKCA 3V8JA 2H3EB 2LJ3A 4IUQA 3A8MB 4OB2B 1RI0A 1NPPA 4MZPA 4M78G 2KR3A 3SDZA 2KT8A 2JTFA 4JDSA 4GBQA 1M3CA 1YIJQ 3VS5A 2HMAA 5D6WA 1NE8A 2VKNA 4R56A 5KCOA 4N4IA 4L5GA 1YHQQ 4C8QB 3LYIA 3OS0A 3OBYA 4XU1A 1AWOA 1LNXA 5KE2A 1VQKQ 1K9MU 2CKKA 2BE7D 1VQ7Q 1PWTA 4RTTA 3LLRA 5FROA 2GFUA 3QO3A 4GLKA 4M7DC 3EG1A 1H92A 4A4KA 2E70A 4HVWA 4F17A 4N0AC 3G4SA 2MYSA 1NLPC 3RNJA 4RTXA 1ACMB 2JNGA 3PTAA 3JV3A 2EQKA 1OX9A 4EMGA 2LZ6B 2K3BA 3LH5A 1AHJB 4E7ZA 1PRMC 5DY9A 4PJLA 2JM8A 1YHQA 3M4GA 2QQ9A 5EG2A 4ZN1A 4IUUA 3URGA 4ELYC 4PJOE 1E6HA 1QWFA 4X1VA 5GANe 1NEBA 4M7AC 2YLCA 3A8GB 2EFIA 3JCMf 3CC2T 5I22A 4BE2A 4C92B 5D6XA 2CP0A 4Q5WA 2CH4A 3CCEQ 3DLMA 1PNJA 2E10A 1AOJA 1WYXA 1Q82R 2EGEA 4HVUA 2VXEA 2F1LA 1AZEA 1M90C 2FVUA 1IRXA 1R0BG 1TXQA 2L0AA 4N0AA 3OMGA 1TU0B 4F16A 1WFWA 1VUBA 4AMCA 1WHJA 2AKLA 3OYGA 2RJDA 2QG9B 1N5ZA 2DF6A 3SWNC 2KDSA 2O4XA 2NUZA 3I56T 3ASKA 3VRZA 2EGCA 2JMCA 1FXXA 2XICA 4A53A 2JUFA 3J80E 1YJNA 1FMVA 2MCNA 3G7ZA 2KAFA 1D0YA 4R55A 3RKXA 3M54A 1QCNA 5KYXA 1WHKA 1LCKA 3QZ5B 1VIFA 3D7SB 4LUEA 1ARKA 5LJ3h 2BZXA 3JCMb 1PD1A 3OBWA 2JMAA 2MI6A 1AZGB 4RTZA 2M1HA 3CCVA 2QQBA 3M55A 4NS5A 5GAN7 5J39A 3QYGB 1M2VB 3JAME 1WXUA 1Z9QA 1ZX6A 4O6JA 4AFZC 2OJ2A 1BCMA 2VYTA 2HSEB 1R8OB 4OVAA 4BE1A 3L2RA 2GQVA 3ZL7C 2QTVA 4KGXB 5CKBA 3REBB 4M77D 1YJWT 3FEOA 1Q86R 3PE0A 3I55A 1UFFA 3VS3A 1K76A 3RKWA 1UDLA 4M75D 3ZFJA 1SKUB 2HSPA 3SEMA 3C0CA 2DMOA 1N9SA 1PSEA 4C5HA 4PJOA 1I5LA 3QPHA 1HK9A 1TG0A 4M77B 1I1JA 3BW1A 2K4YA 2A28A 2DXTA 1Q7YR 3TCJA 2MWPA 4JZ4A 4RCBA 4RUGA 2CP3A 5DLOA 5IT9E 1QW1A 4K11A 4N4HA 2ZPEB 2GTOA 3CBMA 4J7FA 3CPWS 2DL7A 4M78E 5KYWB 3OA6A 1VQKA 1VQLA 5LJ3f 4UC4A 3I56Q 5I2SA 4ME7A 5EC7A 5GMKm 1S72T 2CP6A 3NPFA 3LH0A 4DOVA 4OF1A 2CREA 1ZUUA 3M0PA 5J3BA 4AFSC 4FM4B 5DLQE 2QGFB 1C1AA 2EAYA 2RD1A 4M78C 3RERA 3P8BB 4L6V5 3E2UA 1K4US 1QMCA 1KC8C 3MEWA 2D9TA 2V8KA 4KUDK 2RNAA 4ZNXA 1QVPA 3CCET 4OMLA 1QP2A 3M5AA 4BI3A 3OS2A 2DA9A 3EG9B 4A63B 3CBOA 2KRNA 1YI2T 3EH2A 4C5EA 2D8JA 3NTHA 1KK7A 3HTRA 2LDMA 2QDLA 1PKSA 2MOXA 4QVZA 5GAN6 2R58A 1WJRA 4MDWA 3A98A 1UGSB 3DLLA 1ZBXA 1NG2A 2L3PA 3T9NA 1U3OA 1G3WA 3J7AF 2FPDA 1XNIA 4Y91A 4ANJA 2A0FB 2PQWA 1YCYA 1U8RA 2KT1A 3JB9F 2ZCFB 3OW2A 1S72A 3C4SA 1JBMA 5HY6A 1WXTA 2SEMA 3AHUA 2RJFA 3KFVA 4HA8A 3FDRA 1OV3A 2RHIA 4B9WA 1MMNA 2Y90A 3QWYA 4MZTA 2DYBA 1V76A 3P8HA 1K9MR 2CZ1B 3PVLA 1VQ7T 1QKWA 1VQKT 2FL7A 2KE9A 5CAIA 5GAMj 2K5FA 1YITA 3LGFA 1UB4A 3S3MA 2RK1A 1KHIA 3VKIA 1Z9ZA 1K0XA 1FWZA 1B3QA 1I8FA 1RAHB 1PM3A 1D0ZA 2LNHB 1VOMA 2A08A 3M0RA 4LDWA 4PJOB 1BI3A 3QYHB 4E2FB 2X3XD 4BI8B 4KUIA 4J9BA 3M56A 3ME9A 1VQ8Q 2EJ9A 4KGVB 1QVFS 3VYHB 3MHXA 1FX7A 1IGQA 2K57A 4VUBA 1M1FA 2K6DA 1VQ5Q 3UA7A 4D6WA 4CRIA 9ATCB 3OYMA 2X4XA 1K73C 3VUZA 2DL4A 1WHMA 1IO6A 3TSZA 2O9VA 3SWNB 1A0NB 3CCUA 4M78D 3M58A 4LDXA 3EAEA 3EG3A 3QDFA 4PJMA 2F2XA 1AEYA 1TUDA 1I0CA 3JRZA 4KRTA 2K7AA 4M77G 3CCRA 4HT8A 3NFCA 1K1ZA 4F7UA 3RIRA 2EYYA 2HBWA 1BI0A 3C95A 5KYUA 1RUWA 1B07A 1QCOA 1JB0E 2KGTA 1PSFA 1TSFA 4XU3A 3M59A 2ESWA 4PJOC 2KVQG 3JB9H 1Y0MA 4QVDA 3J81E 2E5QA 2O2OA 1W70A 1RACB 2PU9B 3CCQA 1G83A 5GMKe 4JUVA 2JXBA 5CO7A 1V1CA 3QHSA 1OOTA 1KD1C 3HRUA 5GANg 4C8QE 3QJYA 1FMKA 2DKGA 2RO0A 2LX7A 2LC4A 4D8KA 1XJWB 4QT7A 1NLOC 4PLLA 5GAOn 3CMAA 4A4HA 2DVJA 1QKXA 2BZ8A 4DQ2A 2JTMA 4PJNA 4ORZA 2DD4A 2KYBA 3VS6A 2ROLA 3CPFA 1KQ2A 3E1SA 1OEBA 5HK3A 1WZOA 1K73R 3DB3A 3MCAB 1M3AA 2RQRA 2HKNA 1D1AA 2RJCA 3CCST 4BY6C 2X3WD 2K3YA 2RM4A 3C12A 1IREB 1WI7A 2DAQA 2KEAA 2OI3A 3QSUA 1YNZA 2QASA 2XHCA 3MEAA 4M7DA 2DRKA 4HCZA 3ZEHA 3MJXA 2QXFA 2M0OA 1CSKA 4FSSA 4JS4A 3CCUT 1VQMA 4BB7A 3UPUA 4LXCA 4EPCA 3CD6T 4M7AF 3H0HA 3GPLA 3JCMV 3SWNA
chains in the Genus database with same CATH topology
4OMOA 1EFNA 1QWFA 3VRYA 4X1VA 4CC7A 4AFQC 1NEBA 5GJWB 1VYTA 2I0NA 1AD5A 2MIOA 2NWMA 1YWPA 3U23A 2BZYA 1SEMA 3EGUA 5I22A 2KRMA 4LE9A 2IIMA 2CH4A 1PNJA 1X27A 2BTTA 2OAWA 1AOJA 1W6XA 1WYXA 3EG2A 4RTYA 2AZVA 2EGEA 4HVUA 2H8HA 1KSWA 2JS2A 1AZEA 2DE0X 2L0AA 3TSWA 2K79A 1SHFA 4F16A 1WFWA 1ZSGA 2RMOA 2AKLA 2DILA 1JXMA 4RTVA 1E7OA 2KYMA 1I07A 4J9CA 4D8DA 2PZ1A 1N5ZA 1UHCA 2DF6A 1ZBJA 2NUZA 2JW4A 4J9GA 1H8KA 2A37A 4JJCA 3VRZA 1AWJA 2EGCA 2JMCA 1X69A 2EKHA 1QWEA 2KRSA 2P4RA 1NYGA 1E6GA 2CUDA 2FG0A 2AK5A 2V1QA 2MCNA 3NHNA 1AVZC 4IIOA 3M0UA 1KJWA 1LCKA 2ECZA 4CC4B 2LQWA 4LUEA 1ARKA 1M3BA 2BZXA 1X2QA 3GBQA 3RBBB 4ESRA 2JMAA 4JJDA 1AZGB 1SSHA 2RQWA 2B86A 4RTZA 2CDTA 2V1RA 1OPLA 2RN8A 2C0OA 3NMZC 1GRIA 2JTEA 3VS0A 2O88A 1WXUA 1Z9QA 1ZX6A 4AFZC 4RTWA 1OPKA 2OJ2A 1YN8A 2YUPA 1AWXA 1JO8A 2D1XA 3ZL7C 1ZUKA 2EPDA 2F2VA 1J3TA 1H3HA 2D0NA 3QWXX 3REBB 2L3SA 4Z89A 2KBTA 2DL3A 2KXDA 2L3QA 3EHQA 1YWOA 3PE0A 2KROA 1HD3A 1Y57A 3M0SA 2DNUA 1UFFA 3VS3A 1JEGA 1K76A 2DRMA 1UDLA 2KNBB 2HSPA 3SEMA 2LQNA 1GCQA 3C0CA 1GBRA 1ABOA 2DMOA 1X2KA 2G6FX 5IHIA 2GBQA 2CUBA 4IIMA 1KFZA 1TG0A 1I1JA 2K9GA 1X6BA 2DBMA 2A28A 1SPKA 4OMNA 1PHTA 4JZ4A 2DX1A 3VS2A 3UATA 3VS4A 4RUGA 4K11A 1PRLC 2J7IA 3H0FA 2GTOA 2DL7A 2FPFA 1PKTA 1VA7A 1UG1A 1WA7A 4J9DA 1X43A 1CKBA 2C0TA 2RF0A 3I9QA 1WX6A 1NYFA 4EIKA 1UTIA 5EC7A 2CSIA 2J05A 3NPFA 1M8MA 2CREA 4J9EA 1ZUUA 4AG2C 1GFCA 3M0PA 4Y92A 4AFSC 1MV0B 1M27C 1K0SA 1JU5C 1NM7A 2O9SA 2W0ZA 2KXCA 1K4US 1G2BA 1VYUA 2FO0A 1SRLA 2RNAA 4ZNXA 1MV3A 5FWCA 4OMLA 3UA6A 2AKKA 3UF4A 2DA9A 2ROTA 4A63B 2EW3A 2YUNA 2KRNA 1BK2A 2J06A 4LNPA 2CT3A 2E5KA 1GFDA 1T0JA 3REAB 2D8JA 1FYNA 1RI9A 2YSQA 2EVRA 2QDLA 1PKSA 2MOXA 4JZ3A 3O5ZA 4RTUA 4DEYA 1GCPA 1JXOA 3A98A 3THKA 1NG2A 2L3PA 1S1NA 1U3OA 2FPEA 2K2MA 2FPDA 1JQQA 1M30A 3EG0A 4HXJA 1QLYA 2M51A 2KT1A 2YT6A 5IH2A 2J6OA 2A36A 2W10A 1WXBA 1ZLMA 4Z8AA 1AWWA 4LN2A 2HEQA 1WXTA 2SEMA 5HCKA 3PVQA 3KFVA 1SRMA 2PTKA 4OMQA 3I5SA 4CC2A 2EBPA 1OV3A 5IXBA 1U5SA 2AZSA 1UUEA 2ED0A 3ULRB 2DM1A 2LJ0A 2LJ1A 2DYBA 3QWYA 3PVLA 2YDLA 2L2PA 1QKWA 2JT4A 4M4ZA 4J9IA 5GJVB 2RQTA 2KE9A 2DBKA 2O31A 1ABQA 1Z9ZA 2YUQA 1K0XA 1B3QA 1WLPB 2EYWA 2JM9A 2CSQA 2C0IA 2CT4A 2LNHB 2A08A 3M0RA 2EQIA 3TVTA 2ABLA 1WIEA 2D8HA 2X3XD 1GBQA 4J9BA 2PNIA 4WCIA 5L23A 1T0HA 1KIKA 1BB9A 1U06A 2RQUA 1VYVA 2K6DA 2SRCA 3FJ5A 2FEIA 3UA7A 4F14A 2VWFA 4J9HA 5FW9A 2GNCA 4R0KA 5IHNA 3H41A 4LUDA 1W1FA 2DL4A 2GTJA 5FWBA 2JS0A 1ZUYA 1IO6A 1WDXA 3TSZA 2HCKA 1X6GA 2O9VA 4JPBW 1UE9A 2EGAA 1QCFA 1A0NB 1UHFA 1UJ0A 4JJBA 3R6NA 4DEXA 1T3SA 3EG3A 2J6KA 3I5RA 3EHRA 4HCKA 3VS1A 2F2XA 1AEYA 1RLQC 5IXFA 4AFUC 1TUDA 1I0CA 1SHGA 2DL8A 4KRTA 2K7AA 4J9FA 1T3LA 1UGVA 1K1ZA 4HVVA 4CC3A 2EYYA 3SHWA 2VVKA 2HBWA 3NGPA 2CH4W 2J6FA 2F2WA 1RUWA 1TUCA 2GGRA 1B07A 2KGTA 4OMPA 1GCQC 1BU1A 4OMMA 4Z88A 1MUZA 4AG1C 2ED1A 2ESWA 1UJYA 3CQTA 1CKAA 2YUOA 2LJ3A 1HSQA 1UECA 3IQLA 1Y0MA 1HJDA 2EYXA 2O2OA 1W70A 2KR3A 2KT8A 1G83A 1XOVA 4GBQA 1M3CA 2JXBA 1V1CA 3M0TA 2LCSA 4GLMA 3VS5A 1OOTA 2VKNA 3H0IA 2RPNA 1FMKA 1BBZA 2DLPA 2RQVA 2FRWA 2LX7A 4E6RA 4D8KA 1AWOA 2XMFA 4QT7A 1NLOC 2DVJA 1QKXA 1PWTA 2BZ8A 4RTTA 4ORZA 2KYBA 3VS6A 2ROLA 1YCSB 3EG1A 1H92A 3VS7A 1OEBA 1RLPC 2LMJA 4HVWA 4F17A 5ECAA 1M3AA 2RQRA 1NLPC 1GL5A 2X3WD 2ENMA 1NEGA 2M0YA 2EYZA 3RNJA 4RTXA 1WI7A 2KEAA 2GQIA 3JV3A 2OI3A 2HDAA 3M0QA 1YNZA 2DJQA 2LZ6B 2DRKA 2K3BA 3LH5A 1PRMC 1CSKA 4FSSA 2JM8A 2FRYA 1YP5A 2DL5A 5IHKA 2LP5A 5I11A 3I35A 1E6HA 3H0HA 1K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OMO A;  1EFN A;  1QWF A;  3VRY A;  4X1V A;  4CC7 A;  4AFQ C;  1NEB A;  5GJW B;  1VYT A;  2I0N A;  1AD5 A;  2MIO A;  2NWM A;  1YWP A;  3U23 A;  2BZY A;  1SEM A;  3EGU A;  5I22 A;  2KRM A;  4LE9 A;  2IIM A;  2CH4 A;  1PNJ A;  1X27 A;  2BTT A;  2OAW A;  1AOJ A;  1W6X A;  1WYX A;  3EG2 A;  4RTY A;  2AZV A;  2EGE A;  4HVU A;  2H8H A;  1KSW A;  2JS2 A;  1AZE A;  2DE0 X;  2L0A A;  3TSW A;  2K79 A;  1SHF A;  4F16 A;  1WFW A;  1ZSG A;  2RMO A;  2AKL A;  2DIL A;  1JXM A;  4RTV A;  1E7O A;  2KYM A;  1I07 A;  4J9C A;  4D8D A;  2PZ1 A;  1N5Z A;  1UHC A;  2DF6 A;  1ZBJ A;  2NUZ A;  2JW4 A;  4J9G A;  1H8K A;  2A37 A;  4JJC A;  3VRZ A;  1AWJ A;  2EGC A;  2JMC A;  1X69 A;  2EKH A;  1QWE A;  2KRS A;  2P4R A;  1NYG A;  1E6G A;  2CUD A;  2FG0 A;  2AK5 A;  2V1Q A;  2MCN A;  3NHN A;  1AVZ C;  4IIO A;  3M0U A;  1KJW A;  1LCK A;  2ECZ A;  4CC4 B;  2LQW A;  4LUE A;  1ARK A;  1M3B A;  2BZX A;  1X2Q A;  3GBQ A;  3RBB B;  4ESR A;  2JMA A;  4JJD A;  1AZG B;  1SSH A;  2RQW A;  2B86 A;  4RTZ A;  2CDT A;  2V1R A;  1OPL A;  2RN8 A;  2C0O A;  3NMZ C;  1GRI A;  2JTE A;  3VS0 A;  2O88 A;  1WXU A;  1Z9Q A;  1ZX6 A;  4AFZ C;  4RTW A;  1OPK A;  2OJ2 A;  1YN8 A;  2YUP A;  1AWX A;  1JO8 A;  2D1X A;  3ZL7 C;  1ZUK A;  2EPD A;  2F2V A;  1J3T A;  1H3H A;  2D0N A;  3QWX X;  3REB B;  2L3S A;  4Z89 A;  2KBT A;  2DL3 A;  2KXD A;  2L3Q A;  3EHQ A;  1YWO A;  3PE0 A;  2KRO A;  1HD3 A;  1Y57 A;  3M0S A;  2DNU A;  1UFF A;  3VS3 A;  1JEG A;  1K76 A;  2DRM A;  1UDL A;  2KNB B;  2HSP A;  3SEM A;  2LQN A;  1GCQ A;  3C0C A;  1GBR A;  1ABO A;  2DMO A;  1X2K A;  2G6F X;  5IHI A;  2GBQ A;  2CUB A;  4IIM A;  1KFZ A;  1TG0 A;  1I1J A;  2K9G A;  1X6B A;  2DBM A;  2A28 A;  1SPK A;  4OMN A;  1PHT A;  4JZ4 A;  2DX1 A;  3VS2 A;  3UAT A;  3VS4 A;  4RUG A;  4K11 A;  1PRL C;  2J7I A;  3H0F A;  2GTO A;  2DL7 A;  2FPF A;  1PKT A;  1VA7 A;  1UG1 A;  1WA7 A;  4J9D A;  1X43 A;  1CKB A;  2C0T A;  2RF0 A;  3I9Q A;  1WX6 A;  1NYF A;  4EIK A;  1UTI A;  5EC7 A;  2CSI A;  2J05 A;  3NPF A;  1M8M A;  2CRE A;  4J9E A;  1ZUU A;  4AG2 C;  1GFC A;  3M0P A;  4Y92 A;  4AFS C;  1MV0 B;  1M27 C;  1K0S A;  1JU5 C;  1NM7 A;  2O9S A;  2W0Z A;  2KXC A;  1K4U S;  1G2B A;  1VYU A;  2FO0 A;  1SRL A;  2RNA A;  4ZNX A;  1MV3 A;  5FWC A;  4OML A;  3UA6 A;  2AKK A;  3UF4 A;  2DA9 A;  2ROT A;  4A63 B;  2EW3 A;  2YUN A;  2KRN A;  1BK2 A;  2J06 A;  4LNP A;  2CT3 A;  2E5K A;  1GFD A;  1T0J A;  3REA B;  2D8J A;  1FYN A;  1RI9 A;  2YSQ A;  2EVR A;  2QDL A;  1PKS A;  2MOX A;  4JZ3 A;  3O5Z A;  4RTU A;  4DEY A;  1GCP A;  1JXO A;  3A98 A;  3THK A;  1NG2 A;  2L3P A;  1S1N A;  1U3O A;  2FPE A;  2K2M A;  2FPD A;  1JQQ A;  1M30 A;  3EG0 A;  4HXJ A;  1QLY A;  2M51 A;  2KT1 A;  2YT6 A;  5IH2 A;  2J6O A;  2A36 A;  2W10 A;  1WXB A;  1ZLM A;  4Z8A A;  1AWW A;  4LN2 A;  2HEQ A;  1WXT A;  2SEM A;  5HCK A;  3PVQ A;  3KFV A;  1SRM A;  2PTK A;  4OMQ A;  3I5S A;  4CC2 A;  2EBP A;  1OV3 A;  5IXB A;  1U5S A;  2AZS A;  1UUE A;  2ED0 A;  3ULR B;  2DM1 A;  2LJ0 A;  2LJ1 A;  2DYB A;  3QWY A;  3PVL A;  2YDL A;  2L2P A;  1QKW A;  2JT4 A;  4M4Z A;  4J9I A;  5GJV B;  2RQT A;  2KE9 A;  2DBK A;  2O31 A;  1ABQ A;  1Z9Z A;  2YUQ A;  1K0X A;  1B3Q A;  1WLP B;  2EYW A;  2JM9 A;  2CSQ A;  2C0I A;  2CT4 A;  2LNH B;  2A08 A;  3M0R A;  2EQI A;  3TVT A;  2ABL A;  1WIE A;  2D8H A;  2X3X D;  1GBQ A;  4J9B A;  2PNI A;  4WCI A;  5L23 A;  1T0H A;  1KIK A;  1BB9 A;  1U06 A;  2RQU A;  1VYV A;  2K6D A;  2SRC A;  3FJ5 A;  2FEI A;  3UA7 A;  4F14 A;  2VWF A;  4J9H A;  5FW9 A;  2GNC A;  4R0K A;  5IHN A;  3H41 A;  4LUD A;  1W1F A;  2DL4 A;  2GTJ A;  5FWB A;  2JS0 A;  1ZUY A;  1IO6 A;  1WDX A;  3TSZ A;  2HCK A;  1X6G A;  2O9V A;  4JPB W;  1UE9 A;  2EGA A;  1QCF A;  1A0N B;  1UHF A;  1UJ0 A;  4JJB A;  3R6N A;  4DEX A;  1T3S A;  3EG3 A;  2J6K A;  3I5R A;  3EHR A;  4HCK A;  3VS1 A;  2F2X A;  1AEY A;  1RLQ C;  5IXF A;  4AFU C;  1TUD A;  1I0C A;  1SHG A;  2DL8 A;  4KRT A;  2K7A A;  4J9F A;  1T3L A;  1UGV A;  1K1Z A;  4HVV A;  4CC3 A;  2EYY A;  3SHW A;  2VVK A;  2HBW A;  3NGP A;  2CH4 W;  2J6F A;  2F2W A;  1RUW A;  1TUC A;  2GGR A;  1B07 A;  2KGT A;  4OMP A;  1GCQ C;  1BU1 A;  4OMM A;  4Z88 A;  1MUZ A;  4AG1 C;  2ED1 A;  2ESW A;  1UJY A;  3CQT A;  1CKA A;  2YUO A;  2LJ3 A;  1HSQ A;  1UEC A;  3IQL A;  1Y0M A;  1HJD A;  2EYX A;  2O2O A;  1W70 A;  2KR3 A;  2KT8 A;  1G83 A;  1XOV A;  4GBQ A;  1M3C A;  2JXB A;  1V1C A;  3M0T A;  2LCS A;  4GLM A;  3VS5 A;  1OOT A;  2VKN A;  3H0I A;  2RPN A;  1FMK A;  1BBZ A;  2DLP A;  2RQV A;  2FRW A;  2LX7 A;  4E6R A;  4D8K A;  1AWO A;  2XMF A;  4QT7 A;  1NLO C;  2DVJ A;  1QKX A;  1PWT A;  2BZ8 A;  4RTT A;  4ORZ A;  2KYB A;  3VS6 A;  2ROL A;  1YCS B;  3EG1 A;  1H92 A;  3VS7 A;  1OEB A;  1RLP C;  2LMJ A;  4HVW A;  4F17 A;  5ECA A;  1M3A A;  2RQR A;  1NLP C;  1GL5 A;  2X3W D;  2ENM A;  1NEG A;  2M0Y A;  2EYZ A;  3RNJ A;  4RTX A;  1WI7 A;  2KEA A;  2GQI A;  3JV3 A;  2OI3 A;  2HDA A;  3M0Q A;  1YNZ A;  2DJQ A;  2LZ6 B;  2DRK A;  2K3B A;  3LH5 A;  1PRM C;  1CSK A;  4FSS A;  2JM8 A;  2FRY A;  1YP5 A;  2DL5 A;  5IHK A;  2LP5 A;  5I11 A;  3I35 A;  1E6H A;  3H0H A;  1K9A A; 
#chains in the Genus database with same CATH topology
 4OMO A;  4AFQ C;  5GJW B;  3X24 B;  1MNE A;  1VYT A;  4J8O A;  1YI2 A;  2YLB A;  1BI1 A;  1YWP A;  3U23 A;  3CPW A;  1N8R R;  4MDX A;  4M7A G;  2ZPB B;  2KRM A;  2DPP B;  2L5Q A;  4LE9 A;  1VQP A;  2IIM A;  2QEX Q;  4F7U E;  2DYI A;  2AZV A;  3HFN A;  2FB7 A;  1SSF A;  3GF5 A;  4BI4 A;  2PVG B;  1UGP B;  1RAI B;  2K79 A;  4C92 E;  3CCM T;  2QQA A;  1SHF A;  1ZSG A;  4ZGE B;  2MF2 A;  1N27 A;  1E7O A;  1NBE B;  1YIT T;  3A8H B;  2ZPH B;  3CME Q;  2RI5 A;  3M9Q A;  4KGZ B;  4JJC A;  3OMC A;  4PJO D;  4M7D G;  4GY5 A;  1X69 A;  1QWE A;  3HRT A;  3H6Z A;  1NYG A;  2YRD A;  1X6O A;  2E64 A;  2KMT A;  4RCC A;  4KH1 B;  3MKD A;  4KUL A;  3NHN A;  1VQ7 A;  5CIU A;  5GMK l;  2VXF A;  1KJW A;  4E47 A;  2Y4X A;  3OW2 S;  1VQ4 Q;  2ECZ A;  3G6E T;  4CC4 B;  1VQL T;  1M3B A;  4HKE A;  3PGG A;  4KH0 B;  2DEU A;  2MWO A;  3EFS A;  2ATC B;  3GBQ A;  4JJD A;  1G8X A;  2XID A;  1OQK A;  7AT1 B;  3OSV A;  3RMS A;  1N8R U;  2RQW A;  2B86 A;  1JRI A;  4PL6 A;  2V1R A;  2RN8 A;  1Q95 G;  1RAE B;  2C0O A;  2DTH A;  2CP5 A;  3L2V A;  2DO3 A;  3CME T;  3CBP A;  2YUP A;  3LWH A;  3GLX A;  1AWX A;  3CC4 T;  1OUL A;  1PC0 A;  1B34 A;  1BKB A;  3CCL T;  3CCM Q;  1H3H A;  1N6A A;  1KQS S;  2D0N A;  4X9C A;  3QWX X;  5IAY A;  4FT4 A;  4Z89 A;  2BUD A;  2L3Q A;  4M75 E;  1IXD A;  2MAM A;  5LJ5 f;  1OZ3 A;  2COY A;  2MPX C;  4EMK A;  3JCM Q;  1FMW A;  2KNB B;  3KBG A;  1Y7X A;  3BDL A;  5FU6 C;  2D0Q B;  5LJ3 g;  4J6X A;  2M16 A;  1ZA2 B;  2CUB A;  4IIM A;  2NUP B;  3E19 A;  1KFZ A;  4C0Z A;  3JCM X;  2IVW A;  1Q82 C;  1OZ2 A;  3BY7 A;  4J83 A;  2DBM A;  8AT1 B;  4LDU A;  4PLI A;  3UAT A;  3EGX B;  2VB6 A;  1NPR A;  1VQ6 Q;  2F5T X;  3M53 A;  3JCM W;  1OI1 A;  2D6F A;  2VGM A;  4LDY A;  2FPF A;  1NJI U;  1VQM Q;  2DET A;  3CCS Q;  4F7U F;  1CKB A;  3I9Q A;  4JRQ A;  4J5Y A;  2OAU A;  4C8Q D;  1UGR B;  1NYF A;  1UTI A;  2DEQ A;  3CCS A;  3I55 Q;  2CSI A;  2J05 A;  3EH1 A;  5KYY B;  3A1P A;  3RES A;  1NJI C;  2AT1 B;  5KYY A;  4M78 F;  1BCO A;  3EGD B;  1MV0 B;  5LJ3 d;  5GMK j;  3L2Q A;  1M90 R;  1NZ9 A;  4O5V A;  3CME A;  4KBM B;  2KXC A;  4C0D C;  4F04 B;  3ER0 A;  1GXI E;  1G2B A;  2HL3 A;  1SRL A;  2F69 A;  2E12 A;  5FWC A;  4PJJ A;  3OS5 A;  2AKK A;  4XU2 A;  4BE0 A;  1QP3 A;  1K9M C;  4FYV B;  8ATC B;  2EW3 A;  2YUN A;  2J06 A;  1Q86 C;  1F1B B;  4II1 A;  3R6O A;  3LX7 A;  1RI9 A;  3RMQ A;  3CCR Q;  1RAD B;  3O5Z A;  4DEY A;  3HSB A;  4V2S A;  1JXO A;  3EFO B;  4C8Q F;  3CD6 A;  3JSC A;  4M77 F;  5A0L A;  1VQO A;  4HXJ A;  4NOY A;  2HQH A;  3S3O A;  1QLY A;  2YHT A;  1NJI R;  2M51 A;  4FW1 A;  4JRP A;  1WNL A;  4WTO B;  4ZGJ B;  4DBH A;  2A36 A;  2EJG A;  2W10 A;  4MZM A;  5HCK A;  2PTK A;  4OMQ A;  1VQ5 A;  4A54 A;  1BYM A;  2AZS A;  3ULR B;  3MO8 A;  4JLI A;  1LJO A;  2GCX A;  2E3I A;  2LJ0 A;  3UDC A;  5FRM A;  5J26 A;  1KD1 U;  2L2P A;  5CKH A;  4J9I A;  3V7R A;  3S3N A;  3HHT B;  1QVF A;  2FYK A;  1ABQ A;  2YUQ A;  1PCX A;  1VIE A;  1VQ6 T;  1VQ8 T;  4FT2 A;  1Q86 U;  1U1S A;  1WIE A;  2D8H A;  1GBQ A;  4PJO F;  3GNG A;  1C0M A;  2JN0 A;  4OP0 A;  2A3L A;  1KIK A;  1U06 A;  4M75 B;  4HCB A;  5CQY A;  3EGX A;  1LOJ A;  3X26 B;  1VYV A;  3V8L A;  1KC8 U;  1VQP Q;  4F14 A;  4J9H A;  5FW9 A;  4C92 D;  4NL3 A;  1Y71 A;  3MP1 A;  3OYK A;  4LUD A;  2JVV A;  4M7A A;  1EIF A;  2JS0 A;  1ZUY A;  3JB9 G;  1BIB A;  3MET A;  2EGA A;  1QCF A;  1UHF A;  4E7H A;  4JJB A;  3R6N A;  2FHD A;  2DTI A;  3I5R A;  3EHR A;  5GAN d;  2LX9 A;  1VQO T;  3CCV Q;  5HK0 A;  2ZPI B;  2FZK B;  3G71 Q;  3JCM J;  4CC3 A;  2OX7 A;  3NGP A;  2CH4 W;  4JLG A;  2F2W A;  5C0M A;  1JJ2 A;  2YWW A;  4M75 C;  2X4J A;  1VQ8 A;  4OMM A;  4Z88 A;  2L89 A;  1VQ4 A;  3CEY A;  4E7K A;  1UJY A;  4C92 F;  1IHV A;  2WSC E;  2RHU A;  1CKA A;  1YI2 Q;  2YUO A;  1UEC A;  3E9G A;  3G1J A;  3IQL A;  5CK9 A;  2XD0 A;  2LRQ A;  2PVD B;  2EYX A;  1WHG A;  4DBQ A;  5M9O A;  2Z0W A;  3CCJ T;  2RA2 A;  3FIF A;  2E4H A;  1XOV A;  3HP9 A;  2LCS A;  4GLM A;  3H0I A;  2RPN A;  2E6N A;  1TS9 A;  4XTZ A;  2DLP A;  2FRW A;  4E6R A;  3BE3 A;  4FCY A;  2NUP A;  5CQX A;  2KY9 A;  1WHL A;  3VS7 A;  2XDP A;  1I4K 1;  4QQD A;  2LMJ A;  2P0P A;  1YBY A;  2HD0 A;  1GL5 A;  1N9R A;  4ATO A;  3QUI A;  2M0Y A;  4JS5 A;  3Q1J A;  4HT9 A;  1IZ6 A;  2GQI A;  1MMA A;  2DFU A;  4IUV A;  2L8D A;  2XI9 A;  2DXC A;  4FSX A;  1YP5 A;  2QAZ A;  2DL5 A;  2LP5 A;  3GIB A;  2QQS A;  1QVG A;  1K9A A;  2YXY A;  2O01 E;  4C92 C;  1EFN A;  1KD1 R;  2V8J A;  3VRY A;  4ZTF A;  4A4E A;  4DOW A;  3CCQ T;  3HPW A;  3CCL A;  3KXT A;  1AD5 A;  1UGQ B;  2EWN A;  2CZ0 B;  2MIO A;  2RHY A;  3CD6 Q;  2NWM A;  4X9D A;  4J6Y A;  3EGU A;  1SF9 A;  5GAO m;  1PG5 B;  4LDV A;  4PK4 A;  4FYX B;  2OAW A;  1W6X A;  1G5V A;  3EG2 A;  2ZPF B;  1BIA A;  2H8H A;  2JS2 A;  2DE0 X;  4ZGD B;  3INZ A;  3HFO A;  3RDV A;  3CCJ A;  4J6W A;  5LJ5 j;  3N5B B;  1JXM A;  2KYM A;  1I07 A;  3G4S T;  1UHC A;  1EZZ B;  1ZBJ A;  3GNF B;  2H3J A;  2JW4 A;  1H8K A;  1Q7Y C;  1MHN A;  5GAN 3;  4N4G A;  4Y28 E;  3JB9 J;  2RHX A;  2P4R A;  3A5Z B;  1D09 B;  2G3R A;  1YFN A;  1H64 1;  2CUD A;  3EFR A;  1M2V A;  5LJ3 e;  5LJ5 e;  5GAO r;  1P92 A;  1AVZ C;  5FU7 B;  3M0U A;  2LQW A;  4M7A D;  1TWB A;  3RBB B;  1SG5 A;  1VQ6 A;  1QQJ A;  1KQS P;  1SSH A;  1HXD A;  2BE9 B;  2DVE A;  2LCL A;  3NMZ C;  1VQN T;  2JTE A;  2X35 A;  3VS0 A;  2PUO B;  1M5Q 1;  3MP8 A;  2KQW A;  3JB9 D;  5LJ5 d;  1KHC A;  4M78 A;  2OTJ Q;  2ZGW A;  2QA4 T;  2V8I A;  2D1X A;  4DBF A;  2EPD A;  2R5A A;  3C94 A;  3JB9 I;  4EMH A;  2CYZ B;  3MEU A;  2KBT A;  2OTJ T;  2KRO A;  4XTU A;  4JRI A;  2CGH A;  1HD3 A;  3P8D A;  1Y57 A;  3O8V A;  1O9S A;  1D0X A;  4BDZ A;  1IHW A;  5GAM e;  1GBR A;  1VQN Q;  1YIJ A;  1ZQ1 A;  2G6F X;  2XKO C;  2GBQ A;  2E1H A;  3H8Z A;  1M2O A;  1D3B B;  4EMK C;  5CCA A;  1G3S A;  1Y96 A;  5L8R E;  2NUT A;  3OYJ A;  4P5N A;  4B6M A;  2NUT B;  5KCH A;  4OMN A;  1M90 U;  3CC7 Q;  2DX1 A;  3VS2 A;  3VS4 A;  1WGS A;  2RH2 A;  5LJ5 g;  1W2B P;  2QI2 A;  4BAC A;  4NL2 A;  5GAN f;  3V7C A;  1PKT A;  1WA7 A;  1UG1 A;  3VV0 A;  4ZTJ A;  5D6Y A;  2GFA A;  2RF0 A;  3CC4 A;  1TH7 A;  5CR2 A;  3ZBD A;  4LD9 K;  1Q81 C;  4RKU E;  1VQ9 A;  3VUB A;  1M8M A;  3TRE A;  1M9S A;  1RAB B;  4J9E A;  4AG2 C;  1GFC A;  5GAM f;  4ZN3 A;  1MND A;  2X4W A;  3NTI A;  4Y92 A;  3SFM A;  3WXM B;  1KQ1 A;  1M27 C;  1YHQ T;  2KI7 A;  1K0S A;  1OYX A;  2O9S A;  3UWN A;  4YTL A;  2RB6 A;  2W0Z A;  5GMK h;  2E65 A;  2DXB A;  1VYU A;  1WJQ A;  4QQ6 A;  2FO0 A;  3S6W A;  6AT1 B;  4QW2 A;  1MV3 A;  3DB4 A;  3UA6 A;  2I2L A;  3CC7 T;  1PD0 A;  2ZAE A;  3X28 B;  3UF4 A;  2ROT A;  4QQG A;  1BK2 A;  4LNP A;  1GFD A;  1T0J A;  4PNO A;  3BFM A;  4M78 B;  1FYN A;  4QKU A;  5GAN 4;  2DIG A;  2PVO B;  2YSQ A;  2EVR A;  4C8Q C;  2ZPG B;  5GAM h;  4OB1 B;  1EX4 A;  4RTU A;  1GCP A;  5GAO l;  1G3T A;  4LD6 A;  3QZ9 B;  3THK A;  2Y4Y A;  4EMK B;  3SD4 A;  2OTL A;  1JJ2 P;  2BIV A;  1S1N A;  5KYW A;  2FPE A;  2K2M A;  2RHZ A;  4C8Q G;  2DZ9 A;  2M02 A;  1C6V X;  2BKD N;  2J6O A;  5A0D A;  1WXB A;  1B7T A;  1ZLM A;  3CC2 A;  4M7D B;  2DXU A;  1AWW A;  4X34 A;  2HEQ A;  4WF2 A;  1M1K R;  3PVQ A;  3L2W A;  1G3Y A;  2LNV A;  4HCC A;  5FRN A;  1SRM A;  2QA4 Q;  3BDU A;  2DZC A;  2B8A A;  3I5S A;  3G71 A;  4CC2 A;  2EJF A;  1Q82 U;  1U5S A;  2KK4 A;  2E3H A;  1UUE A;  2ED0 A;  1S72 Q;  1K8A R;  2QQR A;  1UEB A;  2YDL A;  1D1C A;  2CZ7 B;  2RQT A;  4OGC A;  2O31 A;  3OQ5 A;  2CP2 A;  2EQM A;  3PMT A;  4M75 F;  5FU6 B;  2EYW A;  2JM9 A;  2CSQ A;  1IB8 A;  4C8Q A;  2E41 A;  2K5L A;  2EQI A;  2HQX A;  3TVT A;  1M1G A;  1M1K U;  4IUR A;  3CMA T;  5L23 A;  4XTV A;  3CXC A;  4FYY B;  2E6Z A;  3OYI A;  4M7A E;  2SRC A;  3H9N A;  2DTO A;  2EKO A;  3FJ5 A;  4PFO A;  4Z02 A;  4E7S A;  2VWF A;  2LVM A;  3AT1 B;  1OU8 A;  3VJP A;  1W1F A;  2GTJ A;  1WDX A;  2AIR B;  2DK3 A;  3G4S Q;  4FIB A;  1YJW A;  4JPB W;  4E7J A;  2OTJ A;  3G71 T;  3L2Z A;  3V7S A;  2CS7 A;  4M77 E;  3QKJ A;  1UJ0 A;  1VQO Q;  1YJW Q;  3QII A;  4DEX A;  2HL5 C;  1RLQ C;  5IXF A;  3L2U A;  4AFU C;  1SHG A;  1TOV A;  4OB0 B;  1V29 B;  4J9F A;  4OMF B;  4A4F A;  5I21 A;  2L3R A;  1UGV A;  4HVV A;  5GAN h;  3KUF A;  2VVK A;  1WJS A;  3JCM d;  3TQ7 P;  2J6F A;  3X25 B;  4BUG A;  2GGR A;  4IUP A;  4MML A;  3CCQ Q;  2P84 A;  1VQP T;  4AG1 C;  2ED1 A;  2NLU A;  3WVE B;  3CQT A;  4DA4 A;  2FZC B;  3TU4 K;  1ZSZ C;  2CP7 A;  1HSQ A;  1HJD A;  2LQK A;  3OYB A;  4M75 A;  3JCM P;  2LQ8 A;  3L42 A;  3FB9 A;  3M0T A;  5KYU B;  4FYW B;  2O4X B;  1W2B A;  2R5M A;  3F70 A;  1Q7Y U;  4OB3 B;  1BBZ A;  2RQV A;  1K8A C;  1U1T A;  2XMF A;  2QK0 A;  5AT1 B;  2PUK B;  4MMK A;  5KH6 A;  5KYN A;  1O75 A;  4PFP A;  1YCS B;  1KQS A;  2EYQ A;  1RLP C;  3CPW P;  3UT1 A;  5ECA A;  1AT1 B;  2IG0 A;  2LCC A;  3G6E A;  2LTO A;  3E9F A;  3PT9 A;  2ENM A;  1NEG A;  2EYZ A;  2EQU A;  1M1K C;  2VGN A;  2RI3 A;  2HDA A;  3OYE A;  3M0Q A;  2DJQ A;  1HYO A;  3QXE B;  5LJ3 j;  3CCJ Q;  2RI2 A;  4C5G A;  2FRY A;  3CC2 Q;  1KG1 A;  1X75 C;  5IHK A;  4DBR A;  5I11 A;  2DIQ A;  2QGG A;  2MK5 A;  3I35 A;  1LPL A;  2P0K A;  4J7I A;  2QEX A;  4BD3 A;  3CCR T;  4CC7 A;  3CC7 A;  3EFO A;  1MMD A;  1ZSZ B;  2I0N A;  3RR6 A;  1YJ9 A;  2EQJ A;  2MMP A;  1D3B A;  4EDU A;  3OYA A;  2BZY A;  1Y96 B;  4FU6 A;  1SEM A;  2DD5 A;  2XDD A;  3NTK A;  3QG1 A;  2YRV A;  4C92 G;  1R0C B;  2K2V A;  1X27 A;  2BTT A;  4RTY A;  5IN1 A;  2EIF A;  3OYD A;  1KSW A;  3CCV T;  1BI2 A;  1R77 A;  2DER A;  2XK0 A;  1VQ9 Q;  1XQH A;  3TSW A;  4F7U G;  2RMO A;  2DIL A;  4RTV A;  4JRK A;  4M77 A;  4J9C A;  4D8D A;  2PZ1 A;  5AYF A;  5LL6 S;  4BY6 B;  3FC3 A;  3FRN A;  4XTY A;  4J9G A;  4C5I A;  1LVK A;  2A37 A;  1X01 A;  1AWJ A;  1Q81 R;  3LWI A;  2HAX A;  4E7L A;  2EKH A;  2KRS A;  4C0D B;  5GAN 5;  1E6G A;  1MMG A;  2FG0 A;  2AK5 A;  2V1Q A;  1YIJ T;  2DJZ A;  1RAG B;  3PMI A;  4IIO A;  2VV5 A;  1WPY A;  1N8R C;  4M7D E;  3L1A A;  1X2Q A;  4M7D D;  4ESR A;  1YJ9 T;  4F7U B;  4XTX A;  2NYS A;  2QDY B;  2VUB A;  2X51 A;  3PFS A;  2CDT A;  2JZ2 A;  1OPL A;  4IUT A;  1GRI A;  1Q81 U;  3JCM h;  2O88 A;  3OYF A;  3FJP A;  4RTW A;  1OPK A;  2X4Y A;  3JCM g;  3M4Y A;  1YN8 A;  5A0G A;  2HZY A;  3EGD A;  1ZHI A;  4M75 G;  1KC8 R;  3PIO A;  2FZG B;  1JO8 A;  1ZUK A;  2WSE E;  2F2V A;  1J3T A;  2CZ6 B;  3HRS A;  4XQ3 A;  3GP8 A;  4RMO A;  1QVG S;  3MP6 A;  1VQ9 T;  2L3S A;  3I56 A;  4C0F A;  2DL3 A;  2KXD A;  3V8K A;  5CVI A;  3EHQ A;  1YWO A;  2IPO B;  1TTH B;  3M0S A;  2DNU A;  3CC4 Q;  1JEG A;  2JJ9 A;  2DRM A;  1YJN T;  1W2B S;  3VYG A;  2LQN A;  1GCQ A;  1ABO A;  2COZ A;  1X2K A;  5IHI A;  5DM7 R;  3OYL A;  3FLG A;  3CCE A;  1RAA B;  1WQ7 A;  2R57 A;  5D7U A;  3CXC P;  2K9G A;  1X6B A;  4BDY A;  2VC8 A;  4C92 A;  2OTL Q;  1I81 A;  1ZSZ A;  1SPK A;  2RJE A;  1PHT A;  2YRC A;  3G6E Q;  3DKM A;  4TVR A;  4XU0 A;  1H3Z A;  2RK2 A;  1PRL C;  5LJ5 h;  3A8O B;  1WHH A;  3OY9 A;  1WQW A;  1ZA1 B;  2J7I A;  3H0F A;  4XAX B;  3PIP A;  1VA7 A;  4J9D A;  1X43 A;  2C0T A;  3OW2 P;  4CI0 C;  4B9X A;  4QVC A;  1WX6 A;  4EIK A;  5GAN j;  3MEV A;  1I5O B;  3I55 T;  1YIT Q;  3LW5 E;  1Y07 A;  1TUG B;  2K3X A;  3QJ6 A;  1W4S A;  3JCM e;  1VQN A;  5A2Q E;  1B34 B;  1VQM T;  3OYY A;  4AT1 B;  2COW A;  3VU3 C;  1JU5 C;  1NM7 A;  5CKE A;  4C0G A;  4PJO G;  4KT0 E;  1OX8 A;  3A8L B;  3JCM c;  2WSF E;  2QEX T;  4FW2 A;  1D1B A;  3SB2 A;  2QA4 A;  1K73 U;  2KSS A;  2JOY A;  1QVG P;  1DJ7 B;  3HL8 A;  2CT3 A;  5FLX E;  5GAN 2;  2E5K A;  5CKF A;  3REA B;  2P4T A;  3OS1 A;  2XDB A;  2XU8 A;  2XG8 D;  2ZZD A;  4JZ3 A;  4M77 C;  3WVD B;  4FL6 A;  2X9H A;  1RL2 A;  2GF7 A;  1MGQ A;  1JQQ A;  1M30 A;  2M9U A;  3PNW C;  3EG0 A;  3CCU Q;  3MPU B;  3OYN A;  2YT6 A;  5IH2 A;  5CKD A;  2HBP A;  4PFZ A;  3EG9 A;  4Z8A A;  4LN2 A;  4M7A B;  4XTW A;  5KYX B;  1M4Z A;  3CCL Q;  2QTX A;  2LT1 A;  2C06 A;  2EBP A;  2HNI A;  5IXB A;  4ELZ C;  4OGE A;  2QYZ A;  1OU9 A;  2K5I A;  1JJ2 S;  1QVF P;  2DM1 A;  2LJ1 A;  3CCM A;  2JT4 A;  4M4Z A;  5GJV B;  4XK8 E;  2DBK A;  2VAS A;  3CXC S;  2LT4 A;  4A4G A;  1M8V A;  1WLP B;  2HQE A;  2C0I A;  2CT4 A;  1IGU A;  2AHJ B;  5GAO p;  4RG2 A;  3CMA Q;  5GAM g;  1VQL Q;  2ABL A;  1VQ4 T;  3M57 A;  5GAO q;  2PNI A;  2OTL T;  4WCI A;  1T0H A;  4L59 A;  1K8A U;  1BB9 A;  2RQU A;  5GMK i;  5FU7 C;  2FEI A;  2P0Q A;  3OSS C;  2GNC A;  4R0K A;  3OYH A;  4JJN K;  5I2M A;  5IHN A;  3H41 A;  3LGL A;  2A7Y A;  2WAC A;  2HKQ B;  5FWB A;  4RG8 A;  1YJN Q;  2HCK A;  1X6G A;  1RAF B;  1UE9 A;  5C6S A;  3RUX A;  3OB9 A;  1XTD A;  2V26 A;  4M7D F;  3X20 B;  1T3S A;  3VS1 A;  2J6K A;  4HCK A;  4PKC C;  3OYC A;  5GAN 8;  3RKY A;  2DL8 A;  3TEE A;  3GOX A;  1T3L A;  5GAM d;  4E7I A;  5KE3 A;  3QDR B;  3SHW A;  4IKF A;  3QBY A;  3HKS A;  1TUC A;  4OMP A;  1GCQ C;  1BU1 A;  1VQ5 T;  1MUZ A;  2F5K A;  1YJ9 Q;  5HKC A;  3V8J A;  2H3E B;  2LJ3 A;  4IUQ A;  3A8M B;  4OB2 B;  1RI0 A;  1NPP A;  4MZP A;  4M78 G;  2KR3 A;  3SDZ A;  2KT8 A;  2JTF A;  4JDS A;  4GBQ A;  1M3C A;  1YIJ Q;  3VS5 A;  2HMA A;  5D6W A;  1NE8 A;  2VKN A;  4R56 A;  5KCO A;  4N4I A;  4L5G A;  1YHQ Q;  4C8Q B;  3LYI A;  3OS0 A;  3OBY A;  4XU1 A;  1AWO A;  1LNX A;  5KE2 A;  1VQK Q;  1K9M U;  2CKK A;  2BE7 D;  1VQ7 Q;  1PWT A;  4RTT A;  3LLR A;  5FRO A;  2GFU A;  3QO3 A;  4GLK A;  4M7D C;  3EG1 A;  1H92 A;  4A4K A;  2E70 A;  4HVW A;  4F17 A;  4N0A C;  3G4S A;  2MYS A;  1NLP C;  3RNJ A;  4RTX A;  1ACM B;  2JNG A;  3PTA A;  3JV3 A;  2EQK A;  1OX9 A;  4EMG A;  2LZ6 B;  2K3B A;  3LH5 A;  1AHJ B;  4E7Z A;  1PRM C;  5DY9 A;  4PJL A;  2JM8 A;  1YHQ A;  3M4G A;  2QQ9 A;  5EG2 A;  4ZN1 A;  4IUU A;  3URG A;  4ELY C;  4PJO E;  1E6H A;  1QWF A;  4X1V A;  5GAN e;  1NEB A;  4M7A C;  2YLC A;  3A8G B;  2EFI A;  3JCM f;  3CC2 T;  5I22 A;  4BE2 A;  4C92 B;  5D6X A;  2CP0 A;  4Q5W A;  2CH4 A;  3CCE Q;  3DLM A;  1PNJ A;  2E10 A;  1AOJ A;  1WYX A;  1Q82 R;  2EGE A;  4HVU A;  2VXE A;  2F1L A;  1AZE A;  1M90 C;  2FVU A;  1IRX A;  1R0B G;  1TXQ A;  2L0A A;  4N0A A;  3OMG A;  1TU0 B;  4F16 A;  1WFW A;  1VUB A;  4AMC A;  1WHJ A;  2AKL A;  3OYG A;  2RJD A;  2QG9 B;  1N5Z A;  2DF6 A;  3SWN C;  2KDS A;  2O4X A;  2NUZ A;  3I56 T;  3ASK A;  3VRZ A;  2EGC A;  2JMC A;  1FXX A;  2XIC A;  4A53 A;  2JUF A;  3J80 E;  1YJN A;  1FMV A;  2MCN A;  3G7Z A;  2KAF A;  1D0Y A;  4R55 A;  3RKX A;  3M54 A;  1QCN A;  5KYX A;  1WHK A;  1LCK A;  3QZ5 B;  1VIF A;  3D7S B;  4LUE A;  1ARK A;  5LJ3 h;  2BZX A;  3JCM b;  1PD1 A;  3OBW A;  2JMA A;  2MI6 A;  1AZG B;  4RTZ A;  2M1H A;  3CCV A;  2QQB A;  3M55 A;  4NS5 A;  5GAN 7;  5J39 A;  3QYG B;  1M2V B;  3JAM E;  1WXU A;  1Z9Q A;  1ZX6 A;  4O6J A;  4AFZ C;  2OJ2 A;  1BCM A;  2VYT A;  2HSE B;  1R8O B;  4OVA A;  4BE1 A;  3L2R A;  2GQV A;  3ZL7 C;  2QTV A;  4KGX B;  5CKB A;  3REB B;  4M77 D;  1YJW T;  3FEO A;  1Q86 R;  3PE0 A;  3I55 A;  1UFF A;  3VS3 A;  1K76 A;  3RKW A;  1UDL A;  4M75 D;  3ZFJ A;  1SKU B;  2HSP A;  3SEM A;  3C0C A;  2DMO A;  1N9S A;  1PSE A;  4C5H A;  4PJO A;  1I5L A;  3QPH A;  1HK9 A;  1TG0 A;  4M77 B;  1I1J A;  3BW1 A;  2K4Y A;  2A28 A;  2DXT A;  1Q7Y R;  3TCJ A;  2MWP A;  4JZ4 A;  4RCB A;  4RUG A;  2CP3 A;  5DLO A;  5IT9 E;  1QW1 A;  4K11 A;  4N4H A;  2ZPE B;  2GTO A;  3CBM A;  4J7F A;  3CPW S;  2DL7 A;  4M78 E;  5KYW B;  3OA6 A;  1VQK A;  1VQL A;  5LJ3 f;  4UC4 A;  3I56 Q;  5I2S A;  4ME7 A;  5EC7 A;  5GMK m;  1S72 T;  2CP6 A;  3NPF A;  3LH0 A;  4DOV A;  4OF1 A;  2CRE A;  1ZUU A;  3M0P A;  5J3B A;  4AFS C;  4FM4 B;  5DLQ E;  2QGF B;  1C1A A;  2EAY A;  2RD1 A;  4M78 C;  3RER A;  3P8B B;  4L6V 5;  3E2U A;  1K4U S;  1QMC A;  1KC8 C;  3MEW A;  2D9T A;  2V8K A;  4KUD K;  2RNA A;  4ZNX A;  1QVP A;  3CCE T;  4OML A;  1QP2 A;  3M5A A;  4BI3 A;  3OS2 A;  2DA9 A;  3EG9 B;  4A63 B;  3CBO A;  2KRN A;  1YI2 T;  3EH2 A;  4C5E A;  2D8J A;  3NTH A;  1KK7 A;  3HTR A;  2LDM A;  2QDL A;  1PKS A;  2MOX A;  4QVZ A;  5GAN 6;  2R58 A;  1WJR A;  4MDW A;  3A98 A;  1UGS B;  3DLL A;  1ZBX A;  1NG2 A;  2L3P A;  3T9N A;  1U3O A;  1G3W A;  3J7A F;  2FPD A;  1XNI A;  4Y91 A;  4ANJ A;  2A0F B;  2PQW A;  1YCY A;  1U8R A;  2KT1 A;  3JB9 F;  2ZCF B;  3OW2 A;  1S72 A;  3C4S A;  1JBM A;  5HY6 A;  1WXT A;  2SEM A;  3AHU A;  2RJF A;  3KFV A;  4HA8 A;  3FDR A;  1OV3 A;  2RHI A;  4B9W A;  1MMN A;  2Y90 A;  3QWY A;  4MZT A;  2DYB A;  1V76 A;  3P8H A;  1K9M R;  2CZ1 B;  3PVL A;  1VQ7 T;  1QKW A;  1VQK T;  2FL7 A;  2KE9 A;  5CAI A;  5GAM j;  2K5F A;  1YIT A;  3LGF A;  1UB4 A;  3S3M A;  2RK1 A;  1KHI A;  3VKI A;  1Z9Z A;  1K0X A;  1FWZ A;  1B3Q A;  1I8F A;  1RAH B;  1PM3 A;  1D0Z A;  2LNH B;  1VOM A;  2A08 A;  3M0R A;  4LDW A;  4PJO B;  1BI3 A;  3QYH B;  4E2F B;  2X3X D;  4BI8 B;  4KUI A;  4J9B A;  3M56 A;  3ME9 A;  1VQ8 Q;  2EJ9 A;  4KGV B;  1QVF S;  3VYH B;  3MHX A;  1FX7 A;  1IGQ A;  2K57 A;  4VUB A;  1M1F A;  2K6D A;  1VQ5 Q;  3UA7 A;  4D6W A;  4CRI A;  9ATC B;  3OYM A;  2X4X A;  1K73 C;  3VUZ A;  2DL4 A;  1WHM A;  1IO6 A;  3TSZ A;  2O9V A;  3SWN B;  1A0N B;  3CCU A;  4M78 D;  3M58 A;  4LDX A;  3EAE A;  3EG3 A;  3QDF A;  4PJM A;  2F2X A;  1AEY A;  1TUD A;  1I0C A;  3JRZ A;  4KRT A;  2K7A A;  4M77 G;  3CCR A;  4HT8 A;  3NFC A;  1K1Z A;  4F7U A;  3RIR A;  2EYY A;  2HBW A;  1BI0 A;  3C95 A;  5KYU A;  1RUW A;  1B07 A;  1QCO A;  1JB0 E;  2KGT A;  1PSF A;  1TSF A;  4XU3 A;  3M59 A;  2ESW A;  4PJO C;  2KVQ G;  3JB9 H;  1Y0M A;  4QVD A;  3J81 E;  2E5Q A;  2O2O A;  1W70 A;  1RAC B;  2PU9 B;  3CCQ A;  1G83 A;  5GMK e;  4JUV A;  2JXB A;  5CO7 A;  1V1C A;  3QHS A;  1OOT A;  1KD1 C;  3HRU A;  5GAN g;  4C8Q E;  3QJY A;  1FMK A;  2DKG A;  2RO0 A;  2LX7 A;  2LC4 A;  4D8K A;  1XJW B;  4QT7 A;  1NLO C;  4PLL A;  5GAO n;  3CMA A;  4A4H A;  2DVJ A;  1QKX A;  2BZ8 A;  4DQ2 A;  2JTM A;  4PJN A;  4ORZ A;  2DD4 A;  2KYB A;  3VS6 A;  2ROL A;  3CPF A;  1KQ2 A;  3E1S A;  1OEB A;  5HK3 A;  1WZO A;  1K73 R;  3DB3 A;  3MCA B;  1M3A A;  2RQR A;  2HKN A;  1D1A A;  2RJC A;  3CCS T;  4BY6 C;  2X3W D;  2K3Y A;  2RM4 A;  3C12 A;  1IRE B;  1WI7 A;  2DAQ A;  2KEA A;  2OI3 A;  3QSU A;  1YNZ A;  2QAS A;  2XHC A;  3MEA A;  4M7D A;  2DRK A;  4HCZ A;  3ZEH A;  3MJX A;  2QXF A;  2M0O A;  1CSK A;  4FSS A;  4JS4 A;  3CCU T;  1VQM A;  4BB7 A;  3UPU A;  4LXC A;  4EPC A;  3CD6 T;  4M7A F;  3H0H A;  3GPL A;  3JCM V;  3SWN A; 
#chains in the Genus database with same CATH homology
 4OMO A;  1EFN A;  1QWF A;  3VRY A;  4X1V A;  4CC7 A;  4AFQ C;  1NEB A;  5GJW B;  1VYT A;  2I0N A;  1AD5 A;  2MIO A;  2NWM A;  1YWP A;  3U23 A;  2BZY A;  1SEM A;  3EGU A;  5I22 A;  2KRM A;  4LE9 A;  2IIM A;  2CH4 A;  1PNJ A;  1X27 A;  2BTT A;  2OAW A;  1AOJ A;  1W6X A;  1WYX A;  3EG2 A;  4RTY A;  2AZV A;  2EGE A;  4HVU A;  2H8H A;  1KSW A;  2JS2 A;  1AZE A;  2DE0 X;  2L0A A;  3TSW A;  2K79 A;  1SHF A;  4F16 A;  1WFW A;  1ZSG A;  2RMO A;  2AKL A;  2DIL A;  1JXM A;  4RTV A;  1E7O A;  2KYM A;  1I07 A;  4J9C A;  4D8D A;  2PZ1 A;  1N5Z A;  1UHC A;  2DF6 A;  1ZBJ A;  2NUZ A;  2JW4 A;  4J9G A;  1H8K A;  2A37 A;  4JJC A;  3VRZ A;  1AWJ A;  2EGC A;  2JMC A;  1X69 A;  2EKH A;  1QWE A;  2KRS A;  2P4R A;  1NYG A;  1E6G A;  2CUD A;  2FG0 A;  2AK5 A;  2V1Q A;  2MCN A;  3NHN A;  1AVZ C;  4IIO A;  3M0U A;  1KJW A;  1LCK A;  2ECZ A;  4CC4 B;  2LQW A;  4LUE A;  1ARK A;  1M3B A;  2BZX A;  1X2Q A;  3GBQ A;  3RBB B;  4ESR A;  2JMA A;  4JJD A;  1AZG B;  1SSH A;  2RQW A;  2B86 A;  4RTZ A;  2CDT A;  2V1R A;  1OPL A;  2RN8 A;  2C0O A;  3NMZ C;  1GRI A;  2JTE A;  3VS0 A;  2O88 A;  1WXU A;  1Z9Q A;  1ZX6 A;  4AFZ C;  4RTW A;  1OPK A;  2OJ2 A;  1YN8 A;  2YUP A;  1AWX A;  1JO8 A;  2D1X A;  3ZL7 C;  1ZUK A;  2EPD A;  2F2V A;  1J3T A;  1H3H A;  2D0N A;  3QWX X;  3REB B;  2L3S A;  4Z89 A;  2KBT A;  2DL3 A;  2KXD A;  2L3Q A;  3EHQ A;  1YWO A;  3PE0 A;  2KRO A;  1HD3 A;  1Y57 A;  3M0S A;  2DNU A;  1UFF A;  3VS3 A;  1JEG A;  1K76 A;  2DRM A;  1UDL A;  2KNB B;  2HSP A;  3SEM A;  2LQN A;  1GCQ A;  3C0C A;  1GBR A;  1ABO A;  2DMO A;  1X2K A;  2G6F X;  5IHI A;  2GBQ A;  2CUB A;  4IIM A;  1KFZ A;  1TG0 A;  1I1J A;  2K9G A;  1X6B A;  2DBM A;  2A28 A;  1SPK A;  4OMN A;  1PHT A;  4JZ4 A;  2DX1 A;  3VS2 A;  3UAT A;  3VS4 A;  4RUG A;  4K11 A;  1PRL C;  2J7I A;  3H0F A;  2GTO A;  2DL7 A;  2FPF A;  1PKT A;  1VA7 A;  1UG1 A;  1WA7 A;  4J9D A;  1X43 A;  1CKB A;  2C0T A;  2RF0 A;  3I9Q A;  1WX6 A;  1NYF A;  4EIK A;  1UTI A;  5EC7 A;  2CSI A;  2J05 A;  3NPF A;  1M8M A;  2CRE A;  4J9E A;  1ZUU A;  4AG2 C;  1GFC A;  3M0P A;  4Y92 A;  4AFS C;  1MV0 B;  1M27 C;  1K0S A;  1JU5 C;  1NM7 A;  2O9S A;  2W0Z A;  2KXC A;  1K4U S;  1G2B A;  1VYU A;  2FO0 A;  1SRL A;  2RNA A;  4ZNX A;  1MV3 A;  5FWC A;  4OML A;  3UA6 A;  2AKK A;  3UF4 A;  2DA9 A;  2ROT A;  4A63 B;  2EW3 A;  2YUN A;  2KRN A;  1BK2 A;  2J06 A;  4LNP A;  2CT3 A;  2E5K A;  1GFD A;  1T0J A;  3REA B;  2D8J A;  1FYN A;  1RI9 A;  2YSQ A;  2EVR A;  2QDL A;  1PKS A;  2MOX A;  4JZ3 A;  3O5Z A;  4RTU A;  4DEY A;  1GCP A;  1JXO A;  3A98 A;  3THK A;  1NG2 A;  2L3P A;  1S1N A;  1U3O A;  2FPE A;  2K2M A;  2FPD A;  1JQQ A;  1M30 A;  3EG0 A;  4HXJ A;  1QLY A;  2M51 A;  2KT1 A;  2YT6 A;  5IH2 A;  2J6O A;  2A36 A;  2W10 A;  1WXB A;  1ZLM A;  4Z8A A;  1AWW A;  4LN2 A;  2HEQ A;  1WXT A;  2SEM A;  5HCK A;  3PVQ A;  3KFV A;  1SRM A;  2PTK A;  4OMQ A;  3I5S A;  4CC2 A;  2EBP A;  1OV3 A;  5IXB A;  1U5S A;  2AZS A;  1UUE A;  2ED0 A;  3ULR B;  2DM1 A;  2LJ0 A;  2LJ1 A;  2DYB A;  3QWY A;  3PVL A;  2YDL A;  2L2P A;  1QKW A;  2JT4 A;  4M4Z A;  4J9I A;  5GJV B;  2RQT A;  2KE9 A;  2DBK A;  2O31 A;  1ABQ A;  1Z9Z A;  2YUQ A;  1K0X A;  1B3Q A;  1WLP B;  2EYW A;  2JM9 A;  2CSQ A;  2C0I A;  2CT4 A;  2LNH B;  2A08 A;  3M0R A;  2EQI A;  3TVT A;  2ABL A;  1WIE A;  2D8H A;  2X3X D;  1GBQ A;  4J9B A;  2PNI A;  4WCI A;  5L23 A;  1T0H A;  1KIK A;  1BB9 A;  1U06 A;  2RQU A;  1VYV A;  2K6D A;  2SRC A;  3FJ5 A;  2FEI A;  3UA7 A;  4F14 A;  2VWF A;  4J9H A;  5FW9 A;  2GNC A;  4R0K A;  5IHN A;  3H41 A;  4LUD A;  1W1F A;  2DL4 A;  2GTJ A;  5FWB A;  2JS0 A;  1ZUY A;  1IO6 A;  1WDX A;  3TSZ A;  2HCK A;  1X6G A;  2O9V A;  4JPB W;  1UE9 A;  2EGA A;  1QCF A;  1A0N B;  1UHF A;  1UJ0 A;  4JJB A;  3R6N A;  4DEX A;  1T3S A;  3EG3 A;  2J6K A;  3I5R A;  3EHR A;  4HCK A;  3VS1 A;  2F2X A;  1AEY A;  1RLQ C;  5IXF A;  4AFU C;  1TUD A;  1I0C A;  1SHG A;  2DL8 A;  4KRT A;  2K7A A;  4J9F A;  1T3L A;  1UGV A;  1K1Z A;  4HVV A;  4CC3 A;  2EYY A;  3SHW A;  2VVK A;  2HBW A;  3NGP A;  2CH4 W;  2J6F A;  2F2W A;  1RUW A;  1TUC A;  2GGR A;  1B07 A;  2KGT A;  4OMP A;  1GCQ C;  1BU1 A;  4OMM A;  4Z88 A;  1MUZ A;  4AG1 C;  2ED1 A;  2ESW A;  1UJY A;  3CQT A;  1CKA A;  2YUO A;  2LJ3 A;  1HSQ A;  1UEC A;  3IQL A;  1Y0M A;  1HJD A;  2EYX A;  2O2O A;  1W70 A;  2KR3 A;  2KT8 A;  1G83 A;  1XOV A;  4GBQ A;  1M3C A;  2JXB A;  1V1C A;  3M0T A;  2LCS A;  4GLM A;  3VS5 A;  1OOT A;  2VKN A;  3H0I A;  2RPN A;  1FMK A;  1BBZ A;  2DLP A;  2RQV A;  2FRW A;  2LX7 A;  4E6R A;  4D8K A;  1AWO A;  2XMF A;  4QT7 A;  1NLO C;  2DVJ A;  1QKX A;  1PWT A;  2BZ8 A;  4RTT A;  4ORZ A;  2KYB A;  3VS6 A;  2ROL A;  1YCS B;  3EG1 A;  1H92 A;  3VS7 A;  1OEB A;  1RLP C;  2LMJ A;  4HVW A;  4F17 A;  5ECA A;  1M3A A;  2RQR A;  1NLP C;  1GL5 A;  2X3W D;  2ENM A;  1NEG A;  2M0Y A;  2EYZ A;  3RNJ A;  4RTX A;  1WI7 A;  2KEA A;  2GQI A;  3JV3 A;  2OI3 A;  2HDA A;  3M0Q A;  1YNZ A;  2DJQ A;  2LZ6 B;  2DRK A;  2K3B A;  3LH5 A;  1PRM C;  1CSK A;  4FSS A;  2JM8 A;  2FRY A;  1YP5 A;  2DL5 A;  5IHK A;  2LP5 A;  5I11 A;  3I35 A;  1E6H A;  3H0H A;  1K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...