2KRMA

Rdc refined solution structure of the first sh3 domain of cd2ap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krmA00
3EGUA 1ZX6A 4HVVA 4F17A 2DNUA 2KRMA 1M30A 1PRMC 2H8HA 1UG1A 1A0NB 1WLPB 3UF4A 2W0ZA 4EIKA 3QWYA 5GJWB 1RLPC 1T0HA 5GJVB 2K6DA 2F2XA 3NHNA 2RQWA 2RMOA 1JXMA 1LCKA 2DBMA 2MCNA 1MV0B 4RTWA 4DEYA 2J6KA 1Z9ZA 4KRTA 3SEMA 1X2KA 1CKAA 3VS1A 1I1JA 4JZ3A 5IXBA 1UUEA 4FSSA 4JPBW 2OI3A 1QKWA 2OAWA 1AWJA 2A08A 2EYZA 5ECAA 1M3CA 1OPLA 2F2VA 2I0NA 2J06A 3TSWA 3PE0A 4D8DA 4WCIA 3U23A 2KROA 1BU1A 1YCSB 4GBQA 2RQVA 1YP5A 1FYNA 2CUDA 2DLPA 1GFDA 1OEBA 1AVZC 3UA6A 2JS2A 2FPEA 2HEQA 2PZ1A 2ROLA 2RQRA 2YUOA 2A37A 3REAB 2D1XA 2HDAA 1NYGA 1OPKA 2FO0A 1TG0A 3O5ZA 1X69A 1JQQA 2J05A 4AG2C 1QCFA 4D8KA 3FJ5A 1NLPC 4LN2A 3EG1A 2ABLA 4R0KA 2GTOA 5I22A 1SHFA 4CC7A 2VVKA 5FWBA 2EYWA 2A36A 1ZUYA 2O2OA 2EBPA 2RNAA 1PKSA 2KRSA 1RUWA 3IQLA 2AK5A 2JM9A 3TVTA 1K76A 1T3LA 2DRKA 2KR3A 4LUDA 2XMFA 2KNBB 2CT4A 1TUCA 4F14A 1M3AA 2RQTA 5FW9A 3TSZA 3ZL7C 2YUQA 2FPFA 2JMAA 1GCPA 1K9AA 2AZSA 4J9CA 2BTTA 3VS3A 4OMOA 1SRLA 4AFZC 2PTKA 2FRWA 2KYMA 4RTVA 1SSHA 5IHIA 2L2PA 4OMPA 2D8HA 2DRMA 1QLYA 1WIEA 1GBQA 2K2MA 4AFSC 1AEYA 1W70A 3NMZC 2L3QA 2SRCA 1NM7A 2YSQA 2F2WA 2LMJA 2EQIA 4RTZA 1FMKA 1RLQC 4HCKA 2CSIA 1K4US 3RBBB 1Y0MA 2LQWA 3NGPA 2JTEA 2C0IA 1B07A 2CUBA 2DM1A 4IIMA 1UDLA 2EKHA 2EVRA 1K1ZA 3PVLA 3VRZA 2KT8A 4JJDA 2DL8A 2ROTA 1AZGB 2DL5A 4IIOA 1UFFA 2FG0A 2M0YA 4GLMA 1ABOA 1HSQA 2ENMA 2OJ2A 4J9BA 1ZUKA 1KJWA 1Z9QA 2JXBA 1VYUA 2J6OA 3I5RA 3ULRB 2O31A 1YWPA 2D0NA 4RTTA 2EW3A 1ZLMA 1E7OA 2B86A 4OMNA 1UHCA 1WXBA 3EHRA 2O88A 2JW4A 1SPKA 1I0CA 2LJ3A 4Z89A 2HBWA 3I35A 2J7IA 2O9SA 1W1FA 1H92A 2LNHB 2LX7A 2JM8A 2X3XD 2ED0A 4RTUA 2CT3A 5IHKA 5FWCA 1N5ZA 4ZNXA 1E6GA 2GQIA 2DL4A 3LH5A 4AFUC 4J9IA 3VS7A 1AD5A 2KBTA 1VA7A 3RNJA 3H41A 4M4ZA 2K79A 1SEMA 2RPNA 3GBQA 1YNZA 1V1CA 1ZBJA 2EYYA 1WA7A 1T3SA 2V1RA 1S1NA 1BK2A 2BZXA 1U5SA 1KSWA 2RF0A 2GBQA 1CKBA 1VYVA 1G2BA 2RQUA 3M0RA 2PNIA 4J9FA 3QWXX 2YUPA 4AFQC 2KT1A 1W6XA 3VS4A 2MOXA 4HXJA 1WDXA 1H3HA 2V1QA 2NWMA 1PRLC 1OV3A 1U06A 5I11A 4CC2A 2CREA 5IXFA 2J6FA 1M27C 1E6HA 4HVUA 2KEAA 1H8KA 2JS0A 2DVJA 2DYBA 1SHGA 1RI9A 2ECZA 2A28A 2DL7A 2CH4W 2E5KA 4J9DA 2LJ1A 2AZVA 1X43A 2BZYA 1NEGA 4DEXA 4AG1C 2CDTA 2DA9A 1WXTA 2LZ6B 2CSQA 2AKKA 2G6FX 2K9GA 1B3QA 1MV3A 1OOTA 3C0CA 2DE0X 4J9HA 4JJCA 2GNCA 1ZUUA 4LE9A 3M0UA 2RN8A 3H0IA 2X3WD 2LQNA 1NEBA 2DILA 3UA7A 4K11A 2K3BA 1GBRA 4A63B 4OMMA 2EGAA 1GCQC 4CC3A 2K7AA 2MIOA 1NG2A 2DF6A 3EG2A 2HCKA 3SHWA 4HVWA 1KIKA 2QDLA 3UATA 1K0SA 1IO6A 1JO8A 1GCQA 4OMLA 1NYFA 1J3TA 1JXOA 4ORZA 3I9QA 1ABQA 3M0SA 2AKLA 2HSPA 1XOVA 1MUZA 4F16A 2D8JA 5EC7A 2YT6A 3VS0A 1ZSGA 5HCKA 2L3PA 1AOJA 4RTXA 4J9GA 2C0TA 2C0OA 1AZEA 1UE9A 3VRYA 2LJ0A 3VS6A 2GTJA 4LNPA 3R6NA 4J9EA 1M3BA 3EHQA 2KXDA 1QWFA 2EYXA 2GGRA 1PWTA 2SEMA 2KRNA 1X6GA 1HJDA 3M0TA 3JV3A 1M8MA 2DMOA 1Y57A 2DL3A 1UJ0A 1NLOC 4JJBA 1PNJA 4LUEA 4Z88A 3I5SA 1CSKA 5IH2A 1JEGA 2EPDA 1PHTA 2BZ8A 1GRIA 1UECA 1X2QA 1X6BA 4OMQA 1UJYA 4RTYA 2VKNA 2DX1A 2LP5A 1T0JA 3M0QA 4X1VA 4ESRA 2NUZA 4Z8AA 1PKTA 2ED1A 1I07A 3THKA 4E6RA 2ESWA 1BB9A 3H0FA 1YWOA 1UGVA 2EGCA 1AWOA 1GFCA 2L0AA 1QKXA 1UTIA 3NPFA 1U3OA 1VYTA 5L23A 1AWWA 2KE9A 1K0XA 2DJQA 2JMCA 2M51A 1AWXA 2CH4A 3KFVA 2DBKA 1WI7A 2LCSA 3REBB 3A98A 1JU5C 2KXCA 2O9VA 4QT7A 1GL5A 2FEIA 3VS5A 3EG0A 1KFZA 1WX6A 1X27A 1BBZA 1WYXA 2YUNA 2JT4A 1ARKA 1SRMA 3VS2A 2IIMA 1WXUA 3CQTA 2KYBA 1HD3A 2KGTA 2W10A 3EG3A 3PVQA 4CC4B 5IHNA 2L3SA 1UHFA 1WFWA 3H0HA 2EGEA 1TUDA 1QWEA 4JZ4A 2FPDA 1G83A 2YDLA 3M0PA 1EFNA 2P4RA 2FRYA 1YN8A 4Y92A 4RUGA 2VWFA
chains in the Genus database with same CATH superfamily
2DVEA 3QPHA 1VQMA 2DNUA 1FX7A 4C5GA 2KRMA 4OGEA 1WLPB 1NPRA 1N8RC 4LD6A 1G8XA 2FZKB 5I2MA 1LCKA 3PNWC 2MCNA 4F7UB 1MV0B 2EJGA 4E7JA 1X2KA 1V76A 3BW1A 3VS1A 1ZHIA 5J26A 4Y91A 2OI3A 1QKWA 1N8RU 3CCET 2A08A 3PFSA 3H6ZA 2EYZA 5DLOA 1QQJA 2F2VA 3CMAQ 4E7IA 1QP2A 2YHTA 3LGLA 5KYUA 3OYKA 2GQVA 1VQ8T 3JB9I 1BIAA 2RQVA 4GY5A 1YIJT 2L8DA 1YP5A 1OYXA 1FYNA 2CUDA 2M02A 3CCMQ 1NZ9A 2QGFB 2GFAA 1Q7YR 2JS2A 2FPEA 2RQRA 4M77C 1TG0A 1Y71A 4MZMA 3SD4A 2WSCE 3G71T 2WSFE 4D8KA 1PC0A 3C12A 5KE2A 4LN2A 5I22A 2VVKA 2ZPFB 1YITQ 4M75F 4KH1B 3MCAB 3CCRT 2RNAA 3JSCA 3IQLA 3UT1A 3TVTA 2KR3A 1XJWB 4LUDA 2XMFA 3TQ7P 1VQKA 1MNEA 2CT4A 4ZN1A 1VQLT 1I8FA 3KBGA 4F14A 1M3AA 3RERA 3TSZA 3ZL7C 4F04B 1KD1C 1K9AA 2AZSA 2X51A 4RMOA 2IVWA 4J7IA 4M7AD 2IPOB 2PTKA 1M1KC 3SDZA 4RTVA 1YJWT 1WHMA 1MMGA 3LWIA 4HA8A 1G5VA 2QQBA 5A0DA 4XQ3A 2LT4A 1W70A 4TVRA 1NJIU 4F7UF 1PSFA 4KGVB 4C92B 3OBWA 1NM7A 2EQIA 1RLQC 3ZFJA 2HQHA 4BE2A 5GMKj 3RBBB 1Y0MA 3NGPA 3CC7Q 1B07A 4IUPA 5J39A 2OTJT 2VV5A 2EKHA 2FZCB 3LW5E 1YJ9T 2KT8A 4JJDA 4RKUE 1ZBXA 3G1JA 3CCJT 4NOYA 5GAMg 2E70A 2PU9B 1N6AA 1UGQB 1TWBA 3JB9D 1ABOA 2ENMA 3QYGB 3GF5A 1KJWA 2JXBA 1KC8U 1G3WA 2XHCA 1VYUA 1S72A 1NJIC 1K9MC 2CP2A 2O31A 3ZBDA 2D0NA 4M75C 5I21A 4RTTA 3JCMg 2B86A 1E7OA 4RCBA 3DB4A 1YHQT 1YI2A 4E7SA 3EHRA 4EPCA 4N4HA 3GLXA 5CIUA 1KHCA 1IZ6A 4M77D 4Z89A 1K73U 1VQ5T 4FW2A 4M78A 3CMAT 1WQWA 3OS2A 1Y96A 1JJ2S 2DZ9A 5FWCA 4ZNXA 2COZA 1E6GA 3E1SA 4BB7A 1K9MU 1RADB 3CCUQ 4J9IA 4RG2A 2LNVA 3HPWA 1M9SA 1WJRA 3CPWS 2DYIA 3H41A 2K79A 1SEMA 3GBQA 4C92E 3HP9A 1V1CA 1WA7A 1T3SA 2V1RA 1S1NA 2RF0A 3OBYA 1CKBA 3VJPA 3G4SA 1VYVA 3M0RA 1OI1A 4KGXB 3WVDB 1FMVA 2ZPBB 2EQKA 3VS4A 4QQGA 2BE7D 2E5QA 1WHGA 1M1FA 3EFSA 5D6XA 1XTDA 1WDXA 4Y28E 2DJZA 5GANe 3HFOA 3OYFA 2RK2A 1QVGA 2EFIA 3CC7A 4C0DB 5GAOn 1TH7A 4KT0E 3C94A 4HVUA 1JRIA 2KEAA 5D6WA 3MO8A 4C8QE 1F1BB 1RI9A 2ECZA 4JJNK 2E5KA 4C5EA 2EQUA 4J9DA 1Q86R 1X43A 2D6FA 1M90C 4RCCA 1RAHB 3OYYA 1WXTA 3H8ZA 3P8BB 5CAIA 2DE0X 2LRQA 1C0MA 1D1AA 4C5HA 3EFRA 2RI3A 1DJ7B 3SB2A 5GAN3 5FRNA 2DILA 3UA7A 3SWNC 1GBRA 4A63B 1Q7YC 1VQKQ 4CRIA 4MMLA 4M77B 3OYLA 4CC3A 1QVPA 2YRVA 3EG2A 2HCKA 3RR6A 3SHWA 4HVWA 1YIJQ 3UPUA 1KIKA 2EJFA 3UATA 4DBHA 1IHWA 1JO8A 1GCQA 1NYFA 4M7DD 1ZA1B 2LTOA 3I9QA 1WJSA 3M0SA 3DLLA 1VQMQ 3VS0A 2Y4YA 1ZSGA 5HCKA 4IUUA 4X9CA 5GAOr 2P0PA 4XTYA 4E2FB 4BI8B 1JB0E 2C0OA 4J6WA 1I5LA 2LDMA 1R0CB 3M4GA 3L42A 1QVGS 4BUGA 2F69A 3CCRQ 5LJ5h 3EHQA 1W2BP 1KHIA 1VQLQ 3G7ZA 1N9SA 4XTWA 3E9FA 4JS5A 4JDSA 4BD3A 2NLUA 1M8MA 2KQWA 1MMNA 2K3XA 1Y57A 2FZGB 4ZN3A 2HZYA 2DL3A 1NLOC 3CCUT 1WHLA 4Z88A 4N0AA 1H3ZA 5LJ3h 1D0XA 1S72Q 3DKMA 1PHTA 3FC3A 3V8JA 2D0QB 3T9NA 4OMQA 4RTYA 1T0JA 3M0QA 1YJNT 4ESRA 3OS1A 2EKOA 4PJOF 2ESWA 3H0FA 1UGVA 3MEWA 3CCEQ 1AWOA 2L0AA 1U3OA 3QKJA 2QEXA 2DTOA 5L23A 2KE9A 1AWWA 5KE3A 3LH0A 4R56A 2BUDA 2QQRA 1AWXA 2WACA 5FU6C 3MEVA 1YITT 2LC4A 2K5FA 3GNFB 3A98A 2O9VA 5LJ5j 2RHYA 3JCMd 4IKFA 3G6EQ 1VQ7T 3ASKA 3OB9A 1OZ3A 2V8JA 3VS5A 3EG0A 4BY6C 1KK7A 1ZSZA 1ARKA 1M2VB 2QEXT 2E65A 3CQTA 3ER0A 2KGTA 3EG3A 3PTAA 5DY9A 2NUTB 3QYHB 1XQHA 4FSXA 4C0DC 4JLIA 3TU4K 3LYIA 4UC4A 1VQMT 4E7LA 3JB9G 4BE0A 2YDLA 1I5OB 1EFNA 1D1BA 4KUIA 4Y92A 2VWFA 1LOJA 1VUBA 1Q86U 1TOVA 2COYA 1UG1A 1A0NB 4FT2A 3UF4A 1M1GA 1MNDA 1ZQ1A 4OB2B 3P8HA 5GJWB 5GJVB 1T0HA 3CD6A 3X28B 3NHNA 1G3SA 3OMGA 3A8LB 4M75B 2RMOA 2YLCA 1JXMA 3CC4T 2HMAA 2O4XA 1I81A 1Z9ZA 2QASA 4QW2A 1TXQA 1I1JA 3VYGA 1B7TA 5IXBA 1UUEA 4FSSA 4JPBW 4C8QB 2OAWA 1GXIE 1AWJA 5D7UA 3C4SA 3KUFA 1WQ7A 4ELZC 2QA4A 5KCOA 3X25B 2M0OA 1OPLA 2J06A 3TSWA 2XG8D 4BY6B 1JBMA 3PE0A 1PM3A 3X26B 3S3OA 3S3MA 3U23A 5EG2A 1BU1A 4PJOG 1Q7YU 2HSEB 5DLQE 4R55A 2P0KA 1OEBA 3SWNB 3UA6A 2PZ1A 2ROLA 2D1XA 4JRIA 4QVCA 4PJLA 5GAN5 3M53A 3OA6A 4WF2A 3EGDB 1VQNQ 3LGFA 1NLPC 3CCJA 2ABLA 4LDVA 2MK5A 3S3NA 4M7DF 5FWBA 1NE8A 1OULA 3JCMX 2OTJQ 2EYWA 1ZUYA 2O2OA 3QDFA 1Y07A 1NPPA 1RUWA 2JM9A 1K76A 3EGXB 5A0LA 3HRSA 2RQTA 5CKDA 4L5GA 2YUQA 3HL8A 2FPFA 3JCMJ 4B9WA 3CCVA 4J9CA 4JRKA 3CXCA 3MEAA 2CGHA 2L89A 4AFZC 2FRWA 2QG9B 2I2LA 5CKHA 5IT9E 3OSSC 2HQEA 4JRPA 5IHIA 4PJOA 2L2PA 4OMPA 3CCSA 2DRMA 3FLGA 1YJWA 1SSFA 2XI9A 3LX7A 2XIDA 3PGGA 4J5YA 3VV0A 3FDRA 3CCVT 1NJIR 2ATCB 2L3QA 3JCMW 3G71Q 3G6ET 4M77G 2ZPHB 2YSQA 4C92C 2F2WA 4RTZA 1D0YA 1RI0A 2E6ZA 4A4GA 1M2OA 2LQWA 2JTEA 1VQPQ 2CUBA 2DM1A 3UWNA 4IIMA 3QUIA 3CEYA 3VRZA 4M75D 2YWWA 2OTLQ 3GPLA 1TS9A 3G71A 2CZ6B 1B34B 4PJOD 4GLMA 3PMTA 4OF1A 1ZUKA 1Z9QA 1D0ZA 2E3IA 3HFNA 3I5RA 2VASA 2BKDN 5FLXE 3M59A 3M54A 3VU3C 2FHDA 4M7DB 2O88A 1LPLA 1K73R 1I0CA 1VQ9A 2LJ3A 2HBWA 3TCJA 2J7IA 3OW2A 3CCLA 1H92A 4MZTA 1Q81U 5HY6A 1VQOQ 2RHXA 5AYFA 5KYXB 5GANf 2QAZA 1RAAB 3EG9A 8AT1B 4FYXB 2CT3A 3OY9A 3PIPA 3CCJQ 1RL2A 2JN0A 5IN1A 4LDYA 2YRCA 3OYHA 2AHJB 3JCMf 2DL4A 2KI7A 3DLMA 1X6OA 1AD5A 2EIFA 5CKFA 2CP0A 2KBTA 4C0FA 3OYJA 4J6XA 3RNJA 2HQXA 1YNZA 1X75C 3SWNA 2DXBA 1U5SA 4BACA 1IRXA 1FXXA 2R58A 1G3TA 2P4TA 2RQUA 1U1TA 2E41A 2PNIA 1QVGP 4JLGA 3CPWA 4F7UE 3C95A 3ME9A 2KT1A 1U8RA 3QG1A 1HYOA 4HXJA 4N0AC 3AHUA 5LJ5e 1PG5B 8ATCB 2V1QA 1PRLC 1K8AU 4BI4A 1U06A 1M90R 3J80E 3VKIA 4F7UA 2DIGA 4CC2A 2CREA 1M90U 2R57A 3RDVA 1XNIA 3CD6Q 3RMQA 2X9HA 2PVOB 2CP5A 2JS0A 4L6V5 4ME7A 5KH6A 3GP8A 1BIBA 2QQ9A 4EMKC 2DXCA 1VQ9Q 4A4EA 2ZPIB 4XU2A 2AZVA 2RHIA 3TEEA 2CDTA 2DA9A 4V2SA 2AKKA 1B3QA 5LJ3f 4M77E 2GNCA 1ZUUA 2RH2A 2H3JA 2V8IA 3M0UA 4LE9A 5KYWB 3LLRA 5GAOm 3INZA 1K8AC 3OYCA 1LJOA 2LQ8A 1MMDA 1D1CA 4LDWA 4C8QG 4FYYB 4JS4A 1GCQC 2MIOA 1NG2A 2DF6A 2VUBA 2FYKA 5CK9A 2XDDA 3CCVQ 2RI2A 1UGSB 5CQXA 5C0MA 4M7AF 4C8QC 1YHQA 1D09B 4PJOB 2AKLA 4ANJA 4KUDK 4KGZB 5KYUB 2DERA 2YT6A 5FU7C 2L3PA 4DBQA 1AOJA 4J9GA 2ZGWA 3VRYA 5GAN7 3OYMA 4LNPA 4J9EA 2HL3A 1FMWA 5C6SA 3JAME 3M9QA 3EGDA 2GGRA 4C92G 4KULA 3FEOA 3CPWP 3X20B 2QDYB 3I55A 2LCCA 1WJQA 2DMOA 2HNIA 4ZGDB 4C0GA 4FU6A 2RHUA 1UJ0A 3JB9F 1KQSA 2E3HA 3G6EA 3I5SA 2EPDA 5LJ3j 5GAN8 1OX8A 2BZ8A 4HCZA 1GRIA 5GMKe 1X2QA 3CD6T 1X6BA 2MAMA 4A4HA 2B8AA 2RJDA 4X1VA 1OQKA 4Z8AA 3JCMb 2VYTA 1KQSS 3THKA 4XTXA 1YWOA 1UTIA 1LVKA 1VYTA 4OVAA 3WXMB 3OYNA 3GOXA 1U1SA 2M51A 4DQ2A 2CH4A 3M57A 1BYMA 1TU0B 3L2ZA 3FB9A 1JU5C 1KC8C 5GANg 3I56Q 4Q5WA 4M75G 4QT7A 2VXFA 3QO3A 1SG5A 1KQSP 2QYZA 2X4XA 1WX6A 1BBZA 1VIFA 1K8AR 2YUNA 2DD5A 2JT4A 1SRMA 2X4JA 2E4HA 2IIMA 3V7CA 2DTIA 1IREB 4PJOC 2W10A 3PVQA 4CC4B 1IGUA 2L3SA 3FJPA 3G4ST 2QI2A 3L2QA 3H0HA 2QTXA 2Y4XA 3FIFA 2DKGA 4JZ4A 4N4GA 1Q81C 1G83A 1YN8A 4RUGA 4X9DA 2QGGA 3EGUA 1VIEA 1ZX6A 4HVVA 4F17A 4ZTJA 1M30A 2H8HA 3L2UA 3N5BB 4EIKA 2K6DA 2HL5C 3CCEA 2RQWA 2DBMA 5GAMf 4RTWA 2RM4A 4LXCA 3SEMA 3CMAA 1VQNA 1UB4A 1Y96B 2JZ2A 2HBPA 4KBMB 5LJ5g 3JCMe 4PJNA 1M3CA 4QVDA 5LL6S 5GAOq 4D8DA 1Q95G 1I4K1 1YCSB 2RB6A 1S72T 5GAMd 2DLPA 4PJOE 1AVZC 5CKEA 4C5IA 3REAB 2HDAA 1NYGA 4P5NA 4HCCA 3CCRA 2LQKA 2DIQA 4A54A 2PVGB 1JQQA 2J05A 4AG2C 2CYZB 3VUBA 3E2UA 2M9UA 4R0KA 1SHFA 2DXUA 2JVVA 3I55T 2A36A 2EBPA 2KRSA 3L2WA 1IB8A 2AK5A 1TUCA 3MKDA 5FW9A 1IGQA 3OMCA 4C92D 3BY7A 2VGNA 1GCPA 2R5AA 2BTTA 1QCNA 1WGSA 2KYMA 2DEUA 2AIRB 3G4SQ 4QQDA 4XU1A 5CQYA 1IHVA 5GANh 1UGPB 1VQLA 1QLYA 1WIEA 3A1PA 3OS0A 3OQ5A 3A8GB 4PFOA 3JCMQ 1AEYA 3NMZC 2SRCA 3QIIA 4E7ZA 1W2BS 2BIVA 2CS7A 2D9TA 1FMKA 4PJJA 3CCUA 2K57A 2CSIA 2V26A 2C0IA 2YLBA 1TSFA 3CCMA 1MGQA 1YI2Q 3CBPA 2MMPA 2RO0A 3PVLA 3RESA 2RJCA 1NBEB 4C8QD 3CC2T 3WVEB 2DL8A 1R0BG 2GF7A 4FW1A 2XDBA 1AZGB 4FL6A 1YIJA 2MF2A 4PK4A 4C92F 1RAGB 2OJ2A 1EIFA 1YJNA 2A7YA 3CCLQ 4LD9K 3E9GA 3HSBA 4IUVA 2QA4T 2CP3A 4EDUA 1YWPA 3O8VA 5LJ3g 1BKBA 5LJ3e 4OMNA 3EFOA 1WXBA 4XK8E 5GAN2 3CXCS 2JW4A 1SPKA 1ZSZC 5HK3A 2IG0A 2XDPA 3I35A 1Q81R 1W1FA 3ZEHA 2LNHB 2LX7A 4J7FA 3MP8A 4EMKA 2CP7A 2OTLT 5GANd 3EAEA 4OB1B 2DD4A 5IHKA 3I55Q 3VUZA 2DFUA 2CZ0B 3L2RA 4J6YA 3EH2A 4FM4B 3Q1JA 2CZ7B 1ZSZB 2X4WA 3I56A 2M16A 3JB9J 1VQ7Q 1YFNA 1KSWA 4FYWB 2GBQA 2A0FB 1G2BA 2JTFA 4J9FA 4M78D 3QWXX 1K73C 4WTOB 4ZGJB 2YUPA 4AFQC 1TUGB 4M75E 4C8QA 1VQ4A 3A8HB 3V8KA 2MOXA 2E10A 1H3HA 5LJ5f 2NWMA 3RIRA 2ZPEB 5I11A 4BDZA 3CCLT 1M2VA 5IXFA 2J6FA 1M27C 4L59A 3NFCA 1H8KA 3P8DA 2DVJA 1JJ2P 2A28A 3OS5A 2DL7A 2CH4W 1WHKA 4N4IA 1KD1U 4B9XA 1NEGA 4DEXA 2PVDB 4ATOA 5D6YA 4AG1C 5GMKh 3M5AA 4M7AA 2G6FX 4MDXA 1OOTA 4IUQA 3NTIA 1EX4A 4JJCA 3MJXA 3JRZA 2X35A 3H9NA 2MWPA 4OP0A 3NTHA 2RN8A 4KH0B 2X3WD 2LQNA 4OGCA 3E19A 2K3BA 2LX9A 4E47A 5GAN6 1TTHB 1VQ4Q 2QQAA 4OMMA 2K3YA 4JUVA 3AT1B 1K0SA 1BI1A 1IO6A 4IURA 4M7AE 2ZZDA 4OMLA 1JXOA 3HKSA 1ABQA 4QQ6A 2HSPA 1XOVA 1MUZA 4F16A 1OU9A 3DB3A 5EC7A 1PD1A 1V29B 2KVQG 3PIOA 3CCST 2KSSA 1VQ6T 2C0TA 1YHQQ 4GLKA 3URGA 3MP1A 4M77F 1UE9A 1QW1A 4JRQA 2COWA 2XKOC 5KYYB 3VS6A 2GTJA 2G3RA 3OYIA 1O9SA 3R6NA 1M3BA 2KXDA 3PT9A 1QWFA 2DEQA 4BI3A 1G3YA 2RJEA 3A8MB 4A53A 4M7DA 2KRNA 2LVMA 3CMEQ 3CC7T 4HT9A 3M0TA 2RJFA 4M78G 2OTJA 2HAXA 1Q82R 1WHHA 4M78B 1MMAA 3EH1A 3M58A 5KYXA 2MPXC 1SF9A 4JJBA 1QCOA 4XAXB 1PNJA 5CCAA 3OYAA 5A0GA 1CSKA 4A4FA 2F1LA 4E7KA 2C06A 1UJYA 2VKNA 3RMSA 2LP5A 2X4YA 5GAOp 2NUZA 3R6OA 1PKTA 2ED1A 4OMFB 4E6RA 3QZ9B 5J3BA 3QJYA 1BB9A 2EGCA 1GFCA 1HXDA 4II1A 1QKXA 4AMCA 3NPFA 3CMEA 1VQNT 2DJQA 2E6NA 3OYDA 4PFPA 2ZCFB 3CBMA 1Q82C 2DBKA 1WI7A 4EMKB 3GIBA 4FYVB 2KMTA 2KXCA 4M7DG 5GMKi 1KG1A 1KFZA 3J81E 4QKUA 1WYXA 2GCXA 1Q86C 3QZ5B 3VS2A 1WXUA 3BDLA 2KYBA 1HD3A 3CC4A 5IHNA 3S6WA 4EMGA 2EGEA 3CC2Q 1OZ2A 2XD0A 1YJNQ 3M4YA 1QWEA 2FPDA 1VQ8Q 1KQ2A 2P4RA 5CR2A 4DBFA 4PL6A 1VQ6Q 2PQWA 5FU6B 3UDCA 1IXDA 4J83A 1PRMC 2HKNA 2VGMA 2W0ZA 2KK4A 2RD1A 3QWYA 1RLPC 1BCOA 3EFOB 2F2XA 4B6MA 2NUPB 5GMKm 1QMCA 4FT4A 2MWOA 2ZAEA 4DEYA 2J6KA 1FWZA 3BDUA 4M78F 4KRTA 4DBRA 2L5QA 1CKAA 9ATCB 3QSUA 4PJMA 4JZ3A 3CCQA 3MPUB 2HD0A 4NS5A 2E12A 2LCLA 3META 1Y7XA 1N8RR 3A5ZB 5ECAA 3OYGA 2I0NA 1BI2A 3CPFA 4RG8A 1PSEA 4WCIA 1HK9A 2CP6A 2KROA 3RKYA 4DOVA 4GBQA 2CKKA 1VQ8A 3MP6A 3CXCP 6AT1B 1GFDA 4QVZA 2DZCA 2HEQA 5GAOl 2YUOA 2A37A 1OPKA 4ELYC 2FO0A 3QJ6A 5IAYA 1YJ9A 3D7SB 3CC4Q 3O5ZA 1X69A 3F70A 1R77A 3CCSQ 1AHJB 1QCFA 4PLLA 3FJ5A 3EG1A 4M7AB 2GTOA 1VQKT 3M56A 4M7DE 4CC7A 1WZOA 2QA4Q 3TREA 1JJ2A 5KYWA 1VQ9T 3GNGA 2R5MA 1UEBA 1PKSA 3QBYA 1T3LA 2DRKA 2KNBB 2P0QA 2MI6A 3BE3A 4C0ZA 1ACMB 2JMAA 1WPYA 2K5IA 3VS3A 4MDWA 4OMOA 3RUXA 1SRLA 5KYYA 1KD1R 5FROA 4ZTFA 1BCMA 1SSHA 5M9OA 2D8HA 2KAFA 2QXFA 1GBQA 1QP3A 1M8VA 2K2MA 1RABB 4AFSC 2L3RA 2OTLA 2RK1A 3SFMA 4E7HA 2LMJA 4HCKA 1C1AA 1K4US 3J7AF 1P92A 4M77A 5GAMe 1RAEB 2DAQA 1QVFS 1VQ5Q 1UDLA 1EZZB 2RI5A 2EYQA 2EVRA 1K1ZA 1UGRB 5CO7A 2JJ9A 2ROTA 2DL5A 4IIOA 1UFFA 2FG0A 2M0YA 3JCMP 3L1AA 1HSQA 4FIBA 1YJWQ 1QVFA 4XTUA 4NL2A 2HKQB 4J9BA 3CBOA 4Z02A 1D3BB 2J6OA 3ULRB 1PD0A 4D6WA 3LWHA 1M4ZA 2QK0A 5A2QE 1WHJA 4ZGEB 1SKUB 2EW3A 1ZLMA 3NTKA 1VQ5A 1UHCA 4M75A 2P84A 2DTHA 2O4XB 1M5Q1 4EMHA 4O6JA 2O9SA 4HCBA 5AT1B 2JM8A 4F7UG 2X3XD 2XK0A 2ED0A 4RTUA 3A8OB 1LNXA 1M1KR 5I2SA 1N5ZA 2H3EB 4M78C 2LT1A 1ZA2B 2CZ1B 5FRMA 1YITA 4NL3A 2GQIA 1MHNA 3LH5A 3OYEA 4AFUC 3VS7A 2V8KA 1K9MR 2KY9A 1VA7A 2VXEA 1WNLA 3JCMc 2FVUA 4M4ZA 5CKBA 2RPNA 5GANj 1ZBJA 2DK3A 3QDRB 2EYYA 4LDUA 2NUTA 3CCQQ 2NUPA 5GMKl 2XU8A 1BK2A 2BZXA 2AT1B 2EWNA 3HRTA 4X34A 4XU3A 2MYSA 2K2VA 1W6XA 1W2BA 4FCYA 3OSVA 3L2VA 1BI3A 4M78E 3RKWA 4O5VA 2Z0WA 3PMIA 1VQ4T 1OV3A 1OX9A 2K5LA 3HHTB 1YJ9Q 1VQPA 1YI2T 2FL7A 1E6HA 4J8OA 2JOYA 2QTVA 4IUTA 3CMET 4HT8A 2DYBA 2DO3A 1SHGA 3JB9H 2EQJA 4C8QF 4M7AC 2WSEE 2LJ1A 2BZYA 2RHZA 2LZ6B 2CSQA 2K9GA 1MV3A 2YRDA 3C0CA 1VQPT 5DM7R 1BI0A 4J9HA 2E64A 3QXEB 1RAIB 3H0IA 1NEBA 4OB3B 4K11A 2K4YA 2KDSA 3EGXA 4XU0A 2EGAA 1R8OB 5L8RE 2OAUA 2K7AA 4AT1B 1H641 2E1HA 2QDLA 3MHXA 3X24B 2EAYA 1J3TA 1VQOT 4ORZA 4PFZA 2DETA 1VQ6A 4YTLA 2D8JA 1OU8A 2A3LA 1VOMA 3V7RA 4VUBA 2PUOB 2NYSA 3HTRA 4RTXA 4DOWA 5GAMh 1QVFP 4HKEA 3VYHB 1KC8R 1AZEA 3KXTA 2ZPGB 2DXTA 2LJ0A 4LDXA 5GAN4 2M1HA 2F5TX 4M7DC 2JTMA 5CVIA 4M7AG 3JCMh 2JUFA 3CCQT 1VQOA 2EYXA 4PKCC 3RKXA 2F5KA 2RA2A 3CC2A 1PWTA 2SEMA 1VQ7A 2BE9B 1X6GA 1HJDA 3MEUA 3JV3A 3OYBA 2FB7A 4C92A 1Q82U 4CI0C 3EG9B 1X01A 5HK0A 5FU7B 4LUEA 1M1KU 5HKCA 5IH2A 1JEGA 2YXYA 2OX7A 2JNGA 1UECA 3M55A 2DPPB 2DX1A 1YCYA 5LJ5d 5LJ3d 1KQ1A 4A4KA 1N9RA 3V7SA 1I07A 4MMKA 3QHSA 1YBYA 2Y90A 1N27A 3OW2P 4OB0B 1PCXA 1K0XA 3BFMA 2PUKB 5GAMj 4BDYA 2JMCA 1AT1B 1C6VX 2QQSA 2XICA 4MZPA 1O75A 3JCMV 2GFUA 3KFVA 2EQMA 2LCSA 3REBB 3CCMT 4XTVA 3OW2S 1RAFB 2VC8A 1GL5A 2FEIA 1RACB 1X27A 2VB6A 5KYNA 3FRNA 4XTZA 3HRUA 4PNOA 2O01E 1UHFA 7AT1B 1WFWA 1B34A 5KCHA 3I56T 1TUDA 1W4SA 4PLIA 3V8LA 2EJ9A 2QEXQ 3M0PA 4DA4A 1D3BA 2FRYA 4BE1A
chains in the Genus database with same CATH topology
3EGUA 1ZX6A 4HVVA 4F17A 2DNUA 2KRMA 1M30A 1PRMC 2H8HA 1UG1A 1A0NB 1WLPB 3UF4A 2W0ZA 4EIKA 3QWYA 5GJWB 1RLPC 1T0HA 5GJVB 2K6DA 2F2XA 3NHNA 2RQWA 2RMOA 1JXMA 1LCKA 2DBMA 2MCNA 1MV0B 4RTWA 4DEYA 2J6KA 1Z9ZA 4KRTA 3SEMA 1X2KA 1CKAA 3VS1A 1I1JA 4JZ3A 5IXBA 1UUEA 4FSSA 4JPBW 2OI3A 1QKWA 2OAWA 1AWJA 2A08A 2EYZA 5ECAA 1M3CA 1OPLA 2F2VA 2I0NA 2J06A 3TSWA 3PE0A 4D8DA 4WCIA 3U23A 2KROA 1BU1A 1YCSB 4GBQA 2RQVA 1YP5A 1FYNA 2CUDA 2DLPA 1GFDA 1OEBA 1AVZC 3UA6A 2JS2A 2FPEA 2HEQA 2PZ1A 2ROLA 2RQRA 2YUOA 2A37A 3REAB 2D1XA 2HDAA 1NYGA 1OPKA 2FO0A 1TG0A 3O5ZA 1X69A 1JQQA 2J05A 4AG2C 1QCFA 4D8KA 3FJ5A 1NLPC 4LN2A 3EG1A 2ABLA 4R0KA 2GTOA 5I22A 1SHFA 4CC7A 2VVKA 5FWBA 2EYWA 2A36A 1ZUYA 2O2OA 2EBPA 2RNAA 1PKSA 2KRSA 1RUWA 3IQLA 2AK5A 2JM9A 3TVTA 1K76A 1T3LA 2DRKA 2KR3A 4LUDA 2XMFA 2KNBB 2CT4A 1TUCA 4F14A 1M3AA 2RQTA 5FW9A 3TSZA 3ZL7C 2YUQA 2FPFA 2JMAA 1GCPA 1K9AA 2AZSA 4J9CA 2BTTA 3VS3A 4OMOA 1SRLA 4AFZC 2PTKA 2FRWA 2KYMA 4RTVA 1SSHA 5IHIA 2L2PA 4OMPA 2D8HA 2DRMA 1QLYA 1WIEA 1GBQA 2K2MA 4AFSC 1AEYA 1W70A 3NMZC 2L3QA 2SRCA 1NM7A 2YSQA 2F2WA 2LMJA 2EQIA 4RTZA 1FMKA 1RLQC 4HCKA 2CSIA 1K4US 3RBBB 1Y0MA 2LQWA 3NGPA 2JTEA 2C0IA 1B07A 2CUBA 2DM1A 4IIMA 1UDLA 2EKHA 2EVRA 1K1ZA 3PVLA 3VRZA 2KT8A 4JJDA 2DL8A 2ROTA 1AZGB 2DL5A 4IIOA 1UFFA 2FG0A 2M0YA 4GLMA 1ABOA 1HSQA 2ENMA 2OJ2A 4J9BA 1ZUKA 1KJWA 1Z9QA 2JXBA 1VYUA 2J6OA 3I5RA 3ULRB 2O31A 1YWPA 2D0NA 4RTTA 2EW3A 1ZLMA 1E7OA 2B86A 4OMNA 1UHCA 1WXBA 3EHRA 2O88A 2JW4A 1SPKA 1I0CA 2LJ3A 4Z89A 2HBWA 3I35A 2J7IA 2O9SA 1W1FA 1H92A 2LNHB 2LX7A 2JM8A 2X3XD 2ED0A 4RTUA 2CT3A 5IHKA 5FWCA 1N5ZA 4ZNXA 1E6GA 2GQIA 2DL4A 3LH5A 4AFUC 4J9IA 3VS7A 1AD5A 2KBTA 1VA7A 3RNJA 3H41A 4M4ZA 2K79A 1SEMA 2RPNA 3GBQA 1YNZA 1V1CA 1ZBJA 2EYYA 1WA7A 1T3SA 2V1RA 1S1NA 1BK2A 2BZXA 1U5SA 1KSWA 2RF0A 2GBQA 1CKBA 1VYVA 1G2BA 2RQUA 3M0RA 2PNIA 4J9FA 3QWXX 2YUPA 4AFQC 2KT1A 1W6XA 3VS4A 2MOXA 4HXJA 1WDXA 1H3HA 2V1QA 2NWMA 1PRLC 1OV3A 1U06A 5I11A 4CC2A 2CREA 5IXFA 2J6FA 1M27C 1E6HA 4HVUA 2KEAA 1H8KA 2JS0A 2DVJA 2DYBA 1SHGA 1RI9A 2ECZA 2A28A 2DL7A 2CH4W 2E5KA 4J9DA 2LJ1A 2AZVA 1X43A 2BZYA 1NEGA 4DEXA 4AG1C 2CDTA 2DA9A 1WXTA 2LZ6B 2CSQA 2AKKA 2G6FX 2K9GA 1B3QA 1MV3A 1OOTA 3C0CA 2DE0X 4J9HA 4JJCA 2GNCA 1ZUUA 4LE9A 3M0UA 2RN8A 3H0IA 2X3WD 2LQNA 1NEBA 2DILA 3UA7A 4K11A 2K3BA 1GBRA 4A63B 4OMMA 2EGAA 1GCQC 4CC3A 2K7AA 2MIOA 1NG2A 2DF6A 3EG2A 2HCKA 3SHWA 4HVWA 1KIKA 2QDLA 3UATA 1K0SA 1IO6A 1JO8A 1GCQA 4OMLA 1NYFA 1J3TA 1JXOA 4ORZA 3I9QA 1ABQA 3M0SA 2AKLA 2HSPA 1XOVA 1MUZA 4F16A 2D8JA 5EC7A 2YT6A 3VS0A 1ZSGA 5HCKA 2L3PA 1AOJA 4RTXA 4J9GA 2C0TA 2C0OA 1AZEA 1UE9A 3VRYA 2LJ0A 3VS6A 2GTJA 4LNPA 3R6NA 4J9EA 1M3BA 3EHQA 2KXDA 1QWFA 2EYXA 2GGRA 1PWTA 2SEMA 2KRNA 1X6GA 1HJDA 3M0TA 3JV3A 1M8MA 2DMOA 1Y57A 2DL3A 1UJ0A 1NLOC 4JJBA 1PNJA 4LUEA 4Z88A 3I5SA 1CSKA 5IH2A 1JEGA 2EPDA 1PHTA 2BZ8A 1GRIA 1UECA 1X2QA 1X6BA 4OMQA 1UJYA 4RTYA 2VKNA 2DX1A 2LP5A 1T0JA 3M0QA 4X1VA 4ESRA 2NUZA 4Z8AA 1PKTA 2ED1A 1I07A 3THKA 4E6RA 2ESWA 1BB9A 3H0FA 1YWOA 1UGVA 2EGCA 1AWOA 1GFCA 2L0AA 1QKXA 1UTIA 3NPFA 1U3OA 1VYTA 5L23A 1AWWA 2KE9A 1K0XA 2DJQA 2JMCA 2M51A 1AWXA 2CH4A 3KFVA 2DBKA 1WI7A 2LCSA 3REBB 3A98A 1JU5C 2KXCA 2O9VA 4QT7A 1GL5A 2FEIA 3VS5A 3EG0A 1KFZA 1WX6A 1X27A 1BBZA 1WYXA 2YUNA 2JT4A 1ARKA 1SRMA 3VS2A 2IIMA 1WXUA 3CQTA 2KYBA 1HD3A 2KGTA 2W10A 3EG3A 3PVQA 4CC4B 5IHNA 2L3SA 1UHFA 1WFWA 3H0HA 2EGEA 1TUDA 1QWEA 4JZ4A 2FPDA 1G83A 2YDLA 3M0PA 1EFNA 2P4RA 2FRYA 1YN8A 4Y92A 4RUGA 2VWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EGU A;  1ZX6 A;  4HVV A;  4F17 A;  2DNU A;  2KRM A;  1M30 A;  1PRM C;  2H8H A;  1UG1 A;  1A0N B;  1WLP B;  3UF4 A;  2W0Z A;  4EIK A;  3QWY A;  5GJW B;  1RLP C;  1T0H A;  5GJV B;  2K6D A;  2F2X A;  3NHN A;  2RQW A;  2RMO A;  1JXM A;  1LCK A;  2DBM A;  2MCN A;  1MV0 B;  4RTW A;  4DEY A;  2J6K A;  1Z9Z A;  4KRT A;  3SEM A;  1X2K A;  1CKA A;  3VS1 A;  1I1J A;  4JZ3 A;  5IXB A;  1UUE A;  4FSS A;  4JPB W;  2OI3 A;  1QKW A;  2OAW A;  1AWJ A;  2A08 A;  2EYZ A;  5ECA A;  1M3C A;  1OPL A;  2F2V A;  2I0N A;  2J06 A;  3TSW A;  3PE0 A;  4D8D A;  4WCI A;  3U23 A;  2KRO A;  1BU1 A;  1YCS B;  4GBQ A;  2RQV A;  1YP5 A;  1FYN A;  2CUD A;  2DLP A;  1GFD A;  1OEB A;  1AVZ C;  3UA6 A;  2JS2 A;  2FPE A;  2HEQ A;  2PZ1 A;  2ROL A;  2RQR A;  2YUO A;  2A37 A;  3REA B;  2D1X A;  2HDA A;  1NYG A;  1OPK A;  2FO0 A;  1TG0 A;  3O5Z A;  1X69 A;  1JQQ A;  2J05 A;  4AG2 C;  1QCF A;  4D8K A;  3FJ5 A;  1NLP C;  4LN2 A;  3EG1 A;  2ABL A;  4R0K A;  2GTO A;  5I22 A;  1SHF A;  4CC7 A;  2VVK A;  5FWB A;  2EYW A;  2A36 A;  1ZUY A;  2O2O A;  2EBP A;  2RNA A;  1PKS A;  2KRS A;  1RUW A;  3IQL A;  2AK5 A;  2JM9 A;  3TVT A;  1K76 A;  1T3L A;  2DRK A;  2KR3 A;  4LUD A;  2XMF A;  2KNB B;  2CT4 A;  1TUC A;  4F14 A;  1M3A A;  2RQT A;  5FW9 A;  3TSZ A;  3ZL7 C;  2YUQ A;  2FPF A;  2JMA A;  1GCP A;  1K9A A;  2AZS A;  4J9C A;  2BTT A;  3VS3 A;  4OMO A;  1SRL A;  4AFZ C;  2PTK A;  2FRW A;  2KYM A;  4RTV A;  1SSH A;  5IHI A;  2L2P A;  4OMP A;  2D8H A;  2DRM A;  1QLY A;  1WIE A;  1GBQ A;  2K2M A;  4AFS C;  1AEY A;  1W70 A;  3NMZ C;  2L3Q A;  2SRC A;  1NM7 A;  2YSQ A;  2F2W A;  2LMJ A;  2EQI A;  4RTZ A;  1FMK A;  1RLQ C;  4HCK A;  2CSI A;  1K4U S;  3RBB B;  1Y0M A;  2LQW A;  3NGP A;  2JTE A;  2C0I A;  1B07 A;  2CUB A;  2DM1 A;  4IIM A;  1UDL A;  2EKH A;  2EVR A;  1K1Z A;  3PVL A;  3VRZ A;  2KT8 A;  4JJD A;  2DL8 A;  2ROT A;  1AZG B;  2DL5 A;  4IIO A;  1UFF A;  2FG0 A;  2M0Y A;  4GLM A;  1ABO A;  1HSQ A;  2ENM A;  2OJ2 A;  4J9B A;  1ZUK A;  1KJW A;  1Z9Q A;  2JXB A;  1VYU A;  2J6O A;  3I5R A;  3ULR B;  2O31 A;  1YWP A;  2D0N A;  4RTT A;  2EW3 A;  1ZLM A;  1E7O A;  2B86 A;  4OMN A;  1UHC A;  1WXB A;  3EHR A;  2O88 A;  2JW4 A;  1SPK A;  1I0C A;  2LJ3 A;  4Z89 A;  2HBW A;  3I35 A;  2J7I A;  2O9S A;  1W1F A;  1H92 A;  2LNH B;  2LX7 A;  2JM8 A;  2X3X D;  2ED0 A;  4RTU A;  2CT3 A;  5IHK A;  5FWC A;  1N5Z A;  4ZNX A;  1E6G A;  2GQI A;  2DL4 A;  3LH5 A;  4AFU C;  4J9I A;  3VS7 A;  1AD5 A;  2KBT A;  1VA7 A;  3RNJ A;  3H41 A;  4M4Z A;  2K79 A;  1SEM A;  2RPN A;  3GBQ A;  1YNZ A;  1V1C A;  1ZBJ A;  2EYY A;  1WA7 A;  1T3S A;  2V1R A;  1S1N A;  1BK2 A;  2BZX A;  1U5S A;  1KSW A;  2RF0 A;  2GBQ A;  1CKB A;  1VYV A;  1G2B A;  2RQU A;  3M0R A;  2PNI A;  4J9F A;  3QWX X;  2YUP A;  4AFQ C;  2KT1 A;  1W6X A;  3VS4 A;  2MOX A;  4HXJ A;  1WDX A;  1H3H A;  2V1Q A;  2NWM A;  1PRL C;  1OV3 A;  1U06 A;  5I11 A;  4CC2 A;  2CRE A;  5IXF A;  2J6F A;  1M27 C;  1E6H A;  4HVU A;  2KEA A;  1H8K A;  2JS0 A;  2DVJ A;  2DYB A;  1SHG A;  1RI9 A;  2ECZ A;  2A28 A;  2DL7 A;  2CH4 W;  2E5K A;  4J9D A;  2LJ1 A;  2AZV A;  1X43 A;  2BZY A;  1NEG A;  4DEX A;  4AG1 C;  2CDT A;  2DA9 A;  1WXT A;  2LZ6 B;  2CSQ A;  2AKK A;  2G6F X;  2K9G A;  1B3Q A;  1MV3 A;  1OOT A;  3C0C A;  2DE0 X;  4J9H A;  4JJC A;  2GNC A;  1ZUU A;  4LE9 A;  3M0U A;  2RN8 A;  3H0I A;  2X3W D;  2LQN A;  1NEB A;  2DIL A;  3UA7 A;  4K11 A;  2K3B A;  1GBR A;  4A63 B;  4OMM A;  2EGA A;  1GCQ C;  4CC3 A;  2K7A A;  2MIO A;  1NG2 A;  2DF6 A;  3EG2 A;  2HCK A;  3SHW A;  4HVW A;  1KIK A;  2QDL A;  3UAT A;  1K0S A;  1IO6 A;  1JO8 A;  1GCQ A;  4OML A;  1NYF A;  1J3T A;  1JXO A;  4ORZ A;  3I9Q A;  1ABQ A;  3M0S A;  2AKL A;  2HSP A;  1XOV A;  1MUZ A;  4F16 A;  2D8J A;  5EC7 A;  2YT6 A;  3VS0 A;  1ZSG A;  5HCK A;  2L3P A;  1AOJ A;  4RTX A;  4J9G A;  2C0T A;  2C0O A;  1AZE A;  1UE9 A;  3VRY A;  2LJ0 A;  3VS6 A;  2GTJ A;  4LNP A;  3R6N A;  4J9E A;  1M3B A;  3EHQ A;  2KXD A;  1QWF A;  2EYX A;  2GGR A;  1PWT A;  2SEM A;  2KRN A;  1X6G A;  1HJD A;  3M0T A;  3JV3 A;  1M8M A;  2DMO A;  1Y57 A;  2DL3 A;  1UJ0 A;  1NLO C;  4JJB A;  1PNJ A;  4LUE A;  4Z88 A;  3I5S A;  1CSK A;  5IH2 A;  1JEG A;  2EPD A;  1PHT A;  2BZ8 A;  1GRI A;  1UEC A;  1X2Q A;  1X6B A;  4OMQ A;  1UJY A;  4RTY A;  2VKN A;  2DX1 A;  2LP5 A;  1T0J A;  3M0Q A;  4X1V A;  4ESR A;  2NUZ A;  4Z8A A;  1PKT A;  2ED1 A;  1I07 A;  3THK A;  4E6R A;  2ESW A;  1BB9 A;  3H0F A;  1YWO A;  1UGV A;  2EGC A;  1AWO A;  1GFC A;  2L0A A;  1QKX A;  1UTI A;  3NPF A;  1U3O A;  1VYT A;  5L23 A;  1AWW A;  2KE9 A;  1K0X A;  2DJQ A;  2JMC A;  2M51 A;  1AWX A;  2CH4 A;  3KFV A;  2DBK A;  1WI7 A;  2LCS A;  3REB B;  3A98 A;  1JU5 C;  2KXC A;  2O9V A;  4QT7 A;  1GL5 A;  2FEI A;  3VS5 A;  3EG0 A;  1KFZ A;  1WX6 A;  1X27 A;  1BBZ A;  1WYX A;  2YUN A;  2JT4 A;  1ARK A;  1SRM A;  3VS2 A;  2IIM A;  1WXU A;  3CQT A;  2KYB A;  1HD3 A;  2KGT A;  2W10 A;  3EG3 A;  3PVQ A;  4CC4 B;  5IHN A;  2L3S A;  1UHF A;  1WFW A;  3H0H A;  2EGE A;  1TUD A;  1QWE A;  4JZ4 A;  2FPD A;  1G83 A;  2YDL A;  3M0P A;  1EFN A;  2P4R A;  2FRY A;  1YN8 A;  4Y92 A;  4RUG A;  2VWF A; 
#chains in the Genus database with same CATH topology
 2DVE A;  3QPH A;  1VQM A;  2DNU A;  1FX7 A;  4C5G A;  2KRM A;  4OGE A;  1WLP B;  1NPR A;  1N8R C;  4LD6 A;  1G8X A;  2FZK B;  5I2M A;  1LCK A;  3PNW C;  2MCN A;  4F7U B;  1MV0 B;  2EJG A;  4E7J A;  1X2K A;  1V76 A;  3BW1 A;  3VS1 A;  1ZHI A;  5J26 A;  4Y91 A;  2OI3 A;  1QKW A;  1N8R U;  3CCE T;  2A08 A;  3PFS A;  3H6Z A;  2EYZ A;  5DLO A;  1QQJ A;  2F2V A;  3CMA Q;  4E7I A;  1QP2 A;  2YHT A;  3LGL A;  5KYU A;  3OYK A;  2GQV A;  1VQ8 T;  3JB9 I;  1BIA A;  2RQV A;  4GY5 A;  1YIJ T;  2L8D A;  1YP5 A;  1OYX A;  1FYN A;  2CUD A;  2M02 A;  3CCM Q;  1NZ9 A;  2QGF B;  2GFA A;  1Q7Y R;  2JS2 A;  2FPE A;  2RQR A;  4M77 C;  1TG0 A;  1Y71 A;  4MZM A;  3SD4 A;  2WSC E;  3G71 T;  2WSF E;  4D8K A;  1PC0 A;  3C12 A;  5KE2 A;  4LN2 A;  5I22 A;  2VVK A;  2ZPF B;  1YIT Q;  4M75 F;  4KH1 B;  3MCA B;  3CCR T;  2RNA A;  3JSC A;  3IQL A;  3UT1 A;  3TVT A;  2KR3 A;  1XJW B;  4LUD A;  2XMF A;  3TQ7 P;  1VQK A;  1MNE A;  2CT4 A;  4ZN1 A;  1VQL T;  1I8F A;  3KBG A;  4F14 A;  1M3A A;  3RER A;  3TSZ A;  3ZL7 C;  4F04 B;  1KD1 C;  1K9A A;  2AZS A;  2X51 A;  4RMO A;  2IVW A;  4J7I A;  4M7A D;  2IPO B;  2PTK A;  1M1K C;  3SDZ A;  4RTV A;  1YJW T;  1WHM A;  1MMG A;  3LWI A;  4HA8 A;  1G5V A;  2QQB A;  5A0D A;  4XQ3 A;  2LT4 A;  1W70 A;  4TVR A;  1NJI U;  4F7U F;  1PSF A;  4KGV B;  4C92 B;  3OBW A;  1NM7 A;  2EQI A;  1RLQ C;  3ZFJ A;  2HQH A;  4BE2 A;  5GMK j;  3RBB B;  1Y0M A;  3NGP A;  3CC7 Q;  1B07 A;  4IUP A;  5J39 A;  2OTJ T;  2VV5 A;  2EKH A;  2FZC B;  3LW5 E;  1YJ9 T;  2KT8 A;  4JJD A;  4RKU E;  1ZBX A;  3G1J A;  3CCJ T;  4NOY A;  5GAM g;  2E70 A;  2PU9 B;  1N6A A;  1UGQ B;  1TWB A;  3JB9 D;  1ABO A;  2ENM A;  3QYG B;  3GF5 A;  1KJW A;  2JXB A;  1KC8 U;  1G3W A;  2XHC A;  1VYU A;  1S72 A;  1NJI C;  1K9M C;  2CP2 A;  2O31 A;  3ZBD A;  2D0N A;  4M75 C;  5I21 A;  4RTT A;  3JCM g;  2B86 A;  1E7O A;  4RCB A;  3DB4 A;  1YHQ T;  1YI2 A;  4E7S A;  3EHR A;  4EPC A;  4N4H A;  3GLX A;  5CIU A;  1KHC A;  1IZ6 A;  4M77 D;  4Z89 A;  1K73 U;  1VQ5 T;  4FW2 A;  4M78 A;  3CMA T;  1WQW A;  3OS2 A;  1Y96 A;  1JJ2 S;  2DZ9 A;  5FWC A;  4ZNX A;  2COZ A;  1E6G A;  3E1S A;  4BB7 A;  1K9M U;  1RAD B;  3CCU Q;  4J9I A;  4RG2 A;  2LNV A;  3HPW A;  1M9S A;  1WJR A;  3CPW S;  2DYI A;  3H41 A;  2K79 A;  1SEM A;  3GBQ A;  4C92 E;  3HP9 A;  1V1C A;  1WA7 A;  1T3S A;  2V1R A;  1S1N A;  2RF0 A;  3OBY A;  1CKB A;  3VJP A;  3G4S A;  1VYV A;  3M0R A;  1OI1 A;  4KGX B;  3WVD B;  1FMV A;  2ZPB B;  2EQK A;  3VS4 A;  4QQG A;  2BE7 D;  2E5Q A;  1WHG A;  1M1F A;  3EFS A;  5D6X A;  1XTD A;  1WDX A;  4Y28 E;  2DJZ A;  5GAN e;  3HFO A;  3OYF A;  2RK2 A;  1QVG A;  2EFI A;  3CC7 A;  4C0D B;  5GAO n;  1TH7 A;  4KT0 E;  3C94 A;  4HVU A;  1JRI A;  2KEA A;  5D6W A;  3MO8 A;  4C8Q E;  1F1B B;  1RI9 A;  2ECZ A;  4JJN K;  2E5K A;  4C5E A;  2EQU A;  4J9D A;  1Q86 R;  1X43 A;  2D6F A;  1M90 C;  4RCC A;  1RAH B;  3OYY A;  1WXT A;  3H8Z A;  3P8B B;  5CAI A;  2DE0 X;  2LRQ A;  1C0M A;  1D1A A;  4C5H A;  3EFR A;  2RI3 A;  1DJ7 B;  3SB2 A;  5GAN 3;  5FRN A;  2DIL A;  3UA7 A;  3SWN C;  1GBR A;  4A63 B;  1Q7Y C;  1VQK Q;  4CRI A;  4MML A;  4M77 B;  3OYL A;  4CC3 A;  1QVP A;  2YRV A;  3EG2 A;  2HCK A;  3RR6 A;  3SHW A;  4HVW A;  1YIJ Q;  3UPU A;  1KIK A;  2EJF A;  3UAT A;  4DBH A;  1IHW A;  1JO8 A;  1GCQ A;  1NYF A;  4M7D D;  1ZA1 B;  2LTO A;  3I9Q A;  1WJS A;  3M0S A;  3DLL A;  1VQM Q;  3VS0 A;  2Y4Y A;  1ZSG A;  5HCK A;  4IUU A;  4X9C A;  5GAO r;  2P0P A;  4XTY A;  4E2F B;  4BI8 B;  1JB0 E;  2C0O A;  4J6W A;  1I5L A;  2LDM A;  1R0C B;  3M4G A;  3L42 A;  1QVG S;  4BUG A;  2F69 A;  3CCR Q;  5LJ5 h;  3EHQ A;  1W2B P;  1KHI A;  1VQL Q;  3G7Z A;  1N9S A;  4XTW A;  3E9F A;  4JS5 A;  4JDS A;  4BD3 A;  2NLU A;  1M8M A;  2KQW A;  1MMN A;  2K3X A;  1Y57 A;  2FZG B;  4ZN3 A;  2HZY A;  2DL3 A;  1NLO C;  3CCU T;  1WHL A;  4Z88 A;  4N0A A;  1H3Z A;  5LJ3 h;  1D0X A;  1S72 Q;  3DKM A;  1PHT A;  3FC3 A;  3V8J A;  2D0Q B;  3T9N A;  4OMQ A;  4RTY A;  1T0J A;  3M0Q A;  1YJN T;  4ESR A;  3OS1 A;  2EKO A;  4PJO F;  2ESW A;  3H0F A;  1UGV A;  3MEW A;  3CCE Q;  1AWO A;  2L0A A;  1U3O A;  3QKJ A;  2QEX A;  2DTO A;  5L23 A;  2KE9 A;  1AWW A;  5KE3 A;  3LH0 A;  4R56 A;  2BUD A;  2QQR A;  1AWX A;  2WAC A;  5FU6 C;  3MEV A;  1YIT T;  2LC4 A;  2K5F A;  3GNF B;  3A98 A;  2O9V A;  5LJ5 j;  2RHY A;  3JCM d;  4IKF A;  3G6E Q;  1VQ7 T;  3ASK A;  3OB9 A;  1OZ3 A;  2V8J A;  3VS5 A;  3EG0 A;  4BY6 C;  1KK7 A;  1ZSZ A;  1ARK A;  1M2V B;  2QEX T;  2E65 A;  3CQT A;  3ER0 A;  2KGT A;  3EG3 A;  3PTA A;  5DY9 A;  2NUT B;  3QYH B;  1XQH A;  4FSX A;  4C0D C;  4JLI A;  3TU4 K;  3LYI A;  4UC4 A;  1VQM T;  4E7L A;  3JB9 G;  4BE0 A;  2YDL A;  1I5O B;  1EFN A;  1D1B A;  4KUI A;  4Y92 A;  2VWF A;  1LOJ A;  1VUB A;  1Q86 U;  1TOV A;  2COY A;  1UG1 A;  1A0N B;  4FT2 A;  3UF4 A;  1M1G A;  1MND A;  1ZQ1 A;  4OB2 B;  3P8H A;  5GJW B;  5GJV B;  1T0H A;  3CD6 A;  3X28 B;  3NHN A;  1G3S A;  3OMG A;  3A8L B;  4M75 B;  2RMO A;  2YLC A;  1JXM A;  3CC4 T;  2HMA A;  2O4X A;  1I81 A;  1Z9Z A;  2QAS A;  4QW2 A;  1TXQ A;  1I1J A;  3VYG A;  1B7T A;  5IXB A;  1UUE A;  4FSS A;  4JPB W;  4C8Q B;  2OAW A;  1GXI E;  1AWJ A;  5D7U A;  3C4S A;  3KUF A;  1WQ7 A;  4ELZ C;  2QA4 A;  5KCO A;  3X25 B;  2M0O A;  1OPL A;  2J06 A;  3TSW A;  2XG8 D;  4BY6 B;  1JBM A;  3PE0 A;  1PM3 A;  3X26 B;  3S3O A;  3S3M A;  3U23 A;  5EG2 A;  1BU1 A;  4PJO G;  1Q7Y U;  2HSE B;  5DLQ E;  4R55 A;  2P0K A;  1OEB A;  3SWN B;  3UA6 A;  2PZ1 A;  2ROL A;  2D1X A;  4JRI A;  4QVC A;  4PJL A;  5GAN 5;  3M53 A;  3OA6 A;  4WF2 A;  3EGD B;  1VQN Q;  3LGF A;  1NLP C;  3CCJ A;  2ABL A;  4LDV A;  2MK5 A;  3S3N A;  4M7D F;  5FWB A;  1NE8 A;  1OUL A;  3JCM X;  2OTJ Q;  2EYW A;  1ZUY A;  2O2O A;  3QDF A;  1Y07 A;  1NPP A;  1RUW A;  2JM9 A;  1K76 A;  3EGX B;  5A0L A;  3HRS A;  2RQT A;  5CKD A;  4L5G A;  2YUQ A;  3HL8 A;  2FPF A;  3JCM J;  4B9W A;  3CCV A;  4J9C A;  4JRK A;  3CXC A;  3MEA A;  2CGH A;  2L89 A;  4AFZ C;  2FRW A;  2QG9 B;  2I2L A;  5CKH A;  5IT9 E;  3OSS C;  2HQE A;  4JRP A;  5IHI A;  4PJO A;  2L2P A;  4OMP A;  3CCS A;  2DRM A;  3FLG A;  1YJW A;  1SSF A;  2XI9 A;  3LX7 A;  2XID A;  3PGG A;  4J5Y A;  3VV0 A;  3FDR A;  3CCV T;  1NJI R;  2ATC B;  2L3Q A;  3JCM W;  3G71 Q;  3G6E T;  4M77 G;  2ZPH B;  2YSQ A;  4C92 C;  2F2W A;  4RTZ A;  1D0Y A;  1RI0 A;  2E6Z A;  4A4G A;  1M2O A;  2LQW A;  2JTE A;  1VQP Q;  2CUB A;  2DM1 A;  3UWN A;  4IIM A;  3QUI A;  3CEY A;  3VRZ A;  4M75 D;  2YWW A;  2OTL Q;  3GPL A;  1TS9 A;  3G71 A;  2CZ6 B;  1B34 B;  4PJO D;  4GLM A;  3PMT A;  4OF1 A;  1ZUK A;  1Z9Q A;  1D0Z A;  2E3I A;  3HFN A;  3I5R A;  2VAS A;  2BKD N;  5FLX E;  3M59 A;  3M54 A;  3VU3 C;  2FHD A;  4M7D B;  2O88 A;  1LPL A;  1K73 R;  1I0C A;  1VQ9 A;  2LJ3 A;  2HBW A;  3TCJ A;  2J7I A;  3OW2 A;  3CCL A;  1H92 A;  4MZT A;  1Q81 U;  5HY6 A;  1VQO Q;  2RHX A;  5AYF A;  5KYX B;  5GAN f;  2QAZ A;  1RAA B;  3EG9 A;  8AT1 B;  4FYX B;  2CT3 A;  3OY9 A;  3PIP A;  3CCJ Q;  1RL2 A;  2JN0 A;  5IN1 A;  4LDY A;  2YRC A;  3OYH A;  2AHJ B;  3JCM f;  2DL4 A;  2KI7 A;  3DLM A;  1X6O A;  1AD5 A;  2EIF A;  5CKF A;  2CP0 A;  2KBT A;  4C0F A;  3OYJ A;  4J6X A;  3RNJ A;  2HQX A;  1YNZ A;  1X75 C;  3SWN A;  2DXB A;  1U5S A;  4BAC A;  1IRX A;  1FXX A;  2R58 A;  1G3T A;  2P4T A;  2RQU A;  1U1T A;  2E41 A;  2PNI A;  1QVG P;  4JLG A;  3CPW A;  4F7U E;  3C95 A;  3ME9 A;  2KT1 A;  1U8R A;  3QG1 A;  1HYO A;  4HXJ A;  4N0A C;  3AHU A;  5LJ5 e;  1PG5 B;  8ATC B;  2V1Q A;  1PRL C;  1K8A U;  4BI4 A;  1U06 A;  1M90 R;  3J80 E;  3VKI A;  4F7U A;  2DIG A;  4CC2 A;  2CRE A;  1M90 U;  2R57 A;  3RDV A;  1XNI A;  3CD6 Q;  3RMQ A;  2X9H A;  2PVO B;  2CP5 A;  2JS0 A;  4L6V 5;  4ME7 A;  5KH6 A;  3GP8 A;  1BIB A;  2QQ9 A;  4EMK C;  2DXC A;  1VQ9 Q;  4A4E A;  2ZPI B;  4XU2 A;  2AZV A;  2RHI A;  3TEE A;  2CDT A;  2DA9 A;  4V2S A;  2AKK A;  1B3Q A;  5LJ3 f;  4M77 E;  2GNC A;  1ZUU A;  2RH2 A;  2H3J A;  2V8I A;  3M0U A;  4LE9 A;  5KYW B;  3LLR A;  5GAO m;  3INZ A;  1K8A C;  3OYC A;  1LJO A;  2LQ8 A;  1MMD A;  1D1C A;  4LDW A;  4C8Q G;  4FYY B;  4JS4 A;  1GCQ C;  2MIO A;  1NG2 A;  2DF6 A;  2VUB A;  2FYK A;  5CK9 A;  2XDD A;  3CCV Q;  2RI2 A;  1UGS B;  5CQX A;  5C0M A;  4M7A F;  4C8Q C;  1YHQ A;  1D09 B;  4PJO B;  2AKL A;  4ANJ A;  4KUD K;  4KGZ B;  5KYU B;  2DER A;  2YT6 A;  5FU7 C;  2L3P A;  4DBQ A;  1AOJ A;  4J9G A;  2ZGW A;  3VRY A;  5GAN 7;  3OYM A;  4LNP A;  4J9E A;  2HL3 A;  1FMW A;  5C6S A;  3JAM E;  3M9Q A;  3EGD A;  2GGR A;  4C92 G;  4KUL A;  3FEO A;  3CPW P;  3X20 B;  2QDY B;  3I55 A;  2LCC A;  1WJQ A;  2DMO A;  2HNI A;  4ZGD B;  4C0G A;  4FU6 A;  2RHU A;  1UJ0 A;  3JB9 F;  1KQS A;  2E3H A;  3G6E A;  3I5S A;  2EPD A;  5LJ3 j;  5GAN 8;  1OX8 A;  2BZ8 A;  4HCZ A;  1GRI A;  5GMK e;  1X2Q A;  3CD6 T;  1X6B A;  2MAM A;  4A4H A;  2B8A A;  2RJD A;  4X1V A;  1OQK A;  4Z8A A;  3JCM b;  2VYT A;  1KQS S;  3THK A;  4XTX A;  1YWO A;  1UTI A;  1LVK A;  1VYT A;  4OVA A;  3WXM B;  3OYN A;  3GOX A;  1U1S A;  2M51 A;  4DQ2 A;  2CH4 A;  3M57 A;  1BYM A;  1TU0 B;  3L2Z A;  3FB9 A;  1JU5 C;  1KC8 C;  5GAN g;  3I56 Q;  4Q5W A;  4M75 G;  4QT7 A;  2VXF A;  3QO3 A;  1SG5 A;  1KQS P;  2QYZ A;  2X4X A;  1WX6 A;  1BBZ A;  1VIF A;  1K8A R;  2YUN A;  2DD5 A;  2JT4 A;  1SRM A;  2X4J A;  2E4H A;  2IIM A;  3V7C A;  2DTI A;  1IRE B;  4PJO C;  2W10 A;  3PVQ A;  4CC4 B;  1IGU A;  2L3S A;  3FJP A;  3G4S T;  2QI2 A;  3L2Q A;  3H0H A;  2QTX A;  2Y4X A;  3FIF A;  2DKG A;  4JZ4 A;  4N4G A;  1Q81 C;  1G83 A;  1YN8 A;  4RUG A;  4X9D A;  2QGG A;  3EGU A;  1VIE A;  1ZX6 A;  4HVV A;  4F17 A;  4ZTJ A;  1M30 A;  2H8H A;  3L2U A;  3N5B B;  4EIK A;  2K6D A;  2HL5 C;  3CCE A;  2RQW A;  2DBM A;  5GAM f;  4RTW A;  2RM4 A;  4LXC A;  3SEM A;  3CMA A;  1VQN A;  1UB4 A;  1Y96 B;  2JZ2 A;  2HBP A;  4KBM B;  5LJ5 g;  3JCM e;  4PJN A;  1M3C A;  4QVD A;  5LL6 S;  5GAO q;  4D8D A;  1Q95 G;  1I4K 1;  1YCS B;  2RB6 A;  1S72 T;  5GAM d;  2DLP A;  4PJO E;  1AVZ C;  5CKE A;  4C5I A;  3REA B;  2HDA A;  1NYG A;  4P5N A;  4HCC A;  3CCR A;  2LQK A;  2DIQ A;  4A54 A;  2PVG B;  1JQQ A;  2J05 A;  4AG2 C;  2CYZ B;  3VUB A;  3E2U A;  2M9U A;  4R0K A;  1SHF A;  2DXU A;  2JVV A;  3I55 T;  2A36 A;  2EBP A;  2KRS A;  3L2W A;  1IB8 A;  2AK5 A;  1TUC A;  3MKD A;  5FW9 A;  1IGQ A;  3OMC A;  4C92 D;  3BY7 A;  2VGN A;  1GCP A;  2R5A A;  2BTT A;  1QCN A;  1WGS A;  2KYM A;  2DEU A;  2AIR B;  3G4S Q;  4QQD A;  4XU1 A;  5CQY A;  1IHV A;  5GAN h;  1UGP B;  1VQL A;  1QLY A;  1WIE A;  3A1P A;  3OS0 A;  3OQ5 A;  3A8G B;  4PFO A;  3JCM Q;  1AEY A;  3NMZ C;  2SRC A;  3QII A;  4E7Z A;  1W2B S;  2BIV A;  2CS7 A;  2D9T A;  1FMK A;  4PJJ A;  3CCU A;  2K57 A;  2CSI A;  2V26 A;  2C0I A;  2YLB A;  1TSF A;  3CCM A;  1MGQ A;  1YI2 Q;  3CBP A;  2MMP A;  2RO0 A;  3PVL A;  3RES A;  2RJC A;  1NBE B;  4C8Q D;  3CC2 T;  3WVE B;  2DL8 A;  1R0B G;  2GF7 A;  4FW1 A;  2XDB A;  1AZG B;  4FL6 A;  1YIJ A;  2MF2 A;  4PK4 A;  4C92 F;  1RAG B;  2OJ2 A;  1EIF A;  1YJN A;  2A7Y A;  3CCL Q;  4LD9 K;  3E9G A;  3HSB A;  4IUV A;  2QA4 T;  2CP3 A;  4EDU A;  1YWP A;  3O8V A;  5LJ3 g;  1BKB A;  5LJ3 e;  4OMN A;  3EFO A;  1WXB A;  4XK8 E;  5GAN 2;  3CXC S;  2JW4 A;  1SPK A;  1ZSZ C;  5HK3 A;  2IG0 A;  2XDP A;  3I35 A;  1Q81 R;  1W1F A;  3ZEH A;  2LNH B;  2LX7 A;  4J7F A;  3MP8 A;  4EMK A;  2CP7 A;  2OTL T;  5GAN d;  3EAE A;  4OB1 B;  2DD4 A;  5IHK A;  3I55 Q;  3VUZ A;  2DFU A;  2CZ0 B;  3L2R A;  4J6Y A;  3EH2 A;  4FM4 B;  3Q1J A;  2CZ7 B;  1ZSZ B;  2X4W A;  3I56 A;  2M16 A;  3JB9 J;  1VQ7 Q;  1YFN A;  1KSW A;  4FYW B;  2GBQ A;  2A0F B;  1G2B A;  2JTF A;  4J9F A;  4M78 D;  3QWX X;  1K73 C;  4WTO B;  4ZGJ B;  2YUP A;  4AFQ C;  1TUG B;  4M75 E;  4C8Q A;  1VQ4 A;  3A8H B;  3V8K A;  2MOX A;  2E10 A;  1H3H A;  5LJ5 f;  2NWM A;  3RIR A;  2ZPE B;  5I11 A;  4BDZ A;  3CCL T;  1M2V A;  5IXF A;  2J6F A;  1M27 C;  4L59 A;  3NFC A;  1H8K A;  3P8D A;  2DVJ A;  1JJ2 P;  2A28 A;  3OS5 A;  2DL7 A;  2CH4 W;  1WHK A;  4N4I A;  1KD1 U;  4B9X A;  1NEG A;  4DEX A;  2PVD B;  4ATO A;  5D6Y A;  4AG1 C;  5GMK h;  3M5A A;  4M7A A;  2G6F X;  4MDX A;  1OOT A;  4IUQ A;  3NTI A;  1EX4 A;  4JJC A;  3MJX A;  3JRZ A;  2X35 A;  3H9N A;  2MWP A;  4OP0 A;  3NTH A;  2RN8 A;  4KH0 B;  2X3W D;  2LQN A;  4OGC A;  3E19 A;  2K3B A;  2LX9 A;  4E47 A;  5GAN 6;  1TTH B;  1VQ4 Q;  2QQA A;  4OMM A;  2K3Y A;  4JUV A;  3AT1 B;  1K0S A;  1BI1 A;  1IO6 A;  4IUR A;  4M7A E;  2ZZD A;  4OML A;  1JXO A;  3HKS A;  1ABQ A;  4QQ6 A;  2HSP A;  1XOV A;  1MUZ A;  4F16 A;  1OU9 A;  3DB3 A;  5EC7 A;  1PD1 A;  1V29 B;  2KVQ G;  3PIO A;  3CCS T;  2KSS A;  1VQ6 T;  2C0T A;  1YHQ Q;  4GLK A;  3URG A;  3MP1 A;  4M77 F;  1UE9 A;  1QW1 A;  4JRQ A;  2COW A;  2XKO C;  5KYY B;  3VS6 A;  2GTJ A;  2G3R A;  3OYI A;  1O9S A;  3R6N A;  1M3B A;  2KXD A;  3PT9 A;  1QWF A;  2DEQ A;  4BI3 A;  1G3Y A;  2RJE A;  3A8M B;  4A53 A;  4M7D A;  2KRN A;  2LVM A;  3CME Q;  3CC7 T;  4HT9 A;  3M0T A;  2RJF A;  4M78 G;  2OTJ A;  2HAX A;  1Q82 R;  1WHH A;  4M78 B;  1MMA A;  3EH1 A;  3M58 A;  5KYX A;  2MPX C;  1SF9 A;  4JJB A;  1QCO A;  4XAX B;  1PNJ A;  5CCA A;  3OYA A;  5A0G A;  1CSK A;  4A4F A;  2F1L A;  4E7K A;  2C06 A;  1UJY A;  2VKN A;  3RMS A;  2LP5 A;  2X4Y A;  5GAO p;  2NUZ A;  3R6O A;  1PKT A;  2ED1 A;  4OMF B;  4E6R A;  3QZ9 B;  5J3B A;  3QJY A;  1BB9 A;  2EGC A;  1GFC A;  1HXD A;  4II1 A;  1QKX A;  4AMC A;  3NPF A;  3CME A;  1VQN T;  2DJQ A;  2E6N A;  3OYD A;  4PFP A;  2ZCF B;  3CBM A;  1Q82 C;  2DBK A;  1WI7 A;  4EMK B;  3GIB A;  4FYV B;  2KMT A;  2KXC A;  4M7D G;  5GMK i;  1KG1 A;  1KFZ A;  3J81 E;  4QKU A;  1WYX A;  2GCX A;  1Q86 C;  3QZ5 B;  3VS2 A;  1WXU A;  3BDL A;  2KYB A;  1HD3 A;  3CC4 A;  5IHN A;  3S6W A;  4EMG A;  2EGE A;  3CC2 Q;  1OZ2 A;  2XD0 A;  1YJN Q;  3M4Y A;  1QWE A;  2FPD A;  1VQ8 Q;  1KQ2 A;  2P4R A;  5CR2 A;  4DBF A;  4PL6 A;  1VQ6 Q;  2PQW A;  5FU6 B;  3UDC A;  1IXD A;  4J83 A;  1PRM C;  2HKN A;  2VGM A;  2W0Z A;  2KK4 A;  2RD1 A;  3QWY A;  1RLP C;  1BCO A;  3EFO B;  2F2X A;  4B6M A;  2NUP B;  5GMK m;  1QMC A;  4FT4 A;  2MWO A;  2ZAE A;  4DEY A;  2J6K A;  1FWZ A;  3BDU A;  4M78 F;  4KRT A;  4DBR A;  2L5Q A;  1CKA A;  9ATC B;  3QSU A;  4PJM A;  4JZ3 A;  3CCQ A;  3MPU B;  2HD0 A;  4NS5 A;  2E12 A;  2LCL A;  3MET A;  1Y7X A;  1N8R R;  3A5Z B;  5ECA A;  3OYG A;  2I0N A;  1BI2 A;  3CPF A;  4RG8 A;  1PSE A;  4WCI A;  1HK9 A;  2CP6 A;  2KRO A;  3RKY A;  4DOV A;  4GBQ A;  2CKK A;  1VQ8 A;  3MP6 A;  3CXC P;  6AT1 B;  1GFD A;  4QVZ A;  2DZC A;  2HEQ A;  5GAO l;  2YUO A;  2A37 A;  1OPK A;  4ELY C;  2FO0 A;  3QJ6 A;  5IAY A;  1YJ9 A;  3D7S B;  3CC4 Q;  3O5Z A;  1X69 A;  3F70 A;  1R77 A;  3CCS Q;  1AHJ B;  1QCF A;  4PLL A;  3FJ5 A;  3EG1 A;  4M7A B;  2GTO A;  1VQK T;  3M56 A;  4M7D E;  4CC7 A;  1WZO A;  2QA4 Q;  3TRE A;  1JJ2 A;  5KYW A;  1VQ9 T;  3GNG A;  2R5M A;  1UEB A;  1PKS A;  3QBY A;  1T3L A;  2DRK A;  2KNB B;  2P0Q A;  2MI6 A;  3BE3 A;  4C0Z A;  1ACM B;  2JMA A;  1WPY A;  2K5I A;  3VS3 A;  4MDW A;  4OMO A;  3RUX A;  1SRL A;  5KYY A;  1KD1 R;  5FRO A;  4ZTF A;  1BCM A;  1SSH A;  5M9O A;  2D8H A;  2KAF A;  2QXF A;  1GBQ A;  1QP3 A;  1M8V A;  2K2M A;  1RAB B;  4AFS C;  2L3R A;  2OTL A;  2RK1 A;  3SFM A;  4E7H A;  2LMJ A;  4HCK A;  1C1A A;  1K4U S;  3J7A F;  1P92 A;  4M77 A;  5GAM e;  1RAE B;  2DAQ A;  1QVF S;  1VQ5 Q;  1UDL A;  1EZZ B;  2RI5 A;  2EYQ A;  2EVR A;  1K1Z A;  1UGR B;  5CO7 A;  2JJ9 A;  2ROT A;  2DL5 A;  4IIO A;  1UFF A;  2FG0 A;  2M0Y A;  3JCM P;  3L1A A;  1HSQ A;  4FIB A;  1YJW Q;  1QVF A;  4XTU A;  4NL2 A;  2HKQ B;  4J9B A;  3CBO A;  4Z02 A;  1D3B B;  2J6O A;  3ULR B;  1PD0 A;  4D6W A;  3LWH A;  1M4Z A;  2QK0 A;  5A2Q E;  1WHJ A;  4ZGE B;  1SKU B;  2EW3 A;  1ZLM A;  3NTK A;  1VQ5 A;  1UHC A;  4M75 A;  2P84 A;  2DTH A;  2O4X B;  1M5Q 1;  4EMH A;  4O6J A;  2O9S A;  4HCB A;  5AT1 B;  2JM8 A;  4F7U G;  2X3X D;  2XK0 A;  2ED0 A;  4RTU A;  3A8O B;  1LNX A;  1M1K R;  5I2S A;  1N5Z A;  2H3E B;  4M78 C;  2LT1 A;  1ZA2 B;  2CZ1 B;  5FRM A;  1YIT A;  4NL3 A;  2GQI A;  1MHN A;  3LH5 A;  3OYE A;  4AFU C;  3VS7 A;  2V8K A;  1K9M R;  2KY9 A;  1VA7 A;  2VXE A;  1WNL A;  3JCM c;  2FVU A;  4M4Z A;  5CKB A;  2RPN A;  5GAN j;  1ZBJ A;  2DK3 A;  3QDR B;  2EYY A;  4LDU A;  2NUT A;  3CCQ Q;  2NUP A;  5GMK l;  2XU8 A;  1BK2 A;  2BZX A;  2AT1 B;  2EWN A;  3HRT A;  4X34 A;  4XU3 A;  2MYS A;  2K2V A;  1W6X A;  1W2B A;  4FCY A;  3OSV A;  3L2V A;  1BI3 A;  4M78 E;  3RKW A;  4O5V A;  2Z0W A;  3PMI A;  1VQ4 T;  1OV3 A;  1OX9 A;  2K5L A;  3HHT B;  1YJ9 Q;  1VQP A;  1YI2 T;  2FL7 A;  1E6H A;  4J8O A;  2JOY A;  2QTV A;  4IUT A;  3CME T;  4HT8 A;  2DYB A;  2DO3 A;  1SHG A;  3JB9 H;  2EQJ A;  4C8Q F;  4M7A C;  2WSE E;  2LJ1 A;  2BZY A;  2RHZ A;  2LZ6 B;  2CSQ A;  2K9G A;  1MV3 A;  2YRD A;  3C0C A;  1VQP T;  5DM7 R;  1BI0 A;  4J9H A;  2E64 A;  3QXE B;  1RAI B;  3H0I A;  1NEB A;  4OB3 B;  4K11 A;  2K4Y A;  2KDS A;  3EGX A;  4XU0 A;  2EGA A;  1R8O B;  5L8R E;  2OAU A;  2K7A A;  4AT1 B;  1H64 1;  2E1H A;  2QDL A;  3MHX A;  3X24 B;  2EAY A;  1J3T A;  1VQO T;  4ORZ A;  4PFZ A;  2DET A;  1VQ6 A;  4YTL A;  2D8J A;  1OU8 A;  2A3L A;  1VOM A;  3V7R A;  4VUB A;  2PUO B;  2NYS A;  3HTR A;  4RTX A;  4DOW A;  5GAM h;  1QVF P;  4HKE A;  3VYH B;  1KC8 R;  1AZE A;  3KXT A;  2ZPG B;  2DXT A;  2LJ0 A;  4LDX A;  5GAN 4;  2M1H A;  2F5T X;  4M7D C;  2JTM A;  5CVI A;  4M7A G;  3JCM h;  2JUF A;  3CCQ T;  1VQO A;  2EYX A;  4PKC C;  3RKX A;  2F5K A;  2RA2 A;  3CC2 A;  1PWT A;  2SEM A;  1VQ7 A;  2BE9 B;  1X6G A;  1HJD A;  3MEU A;  3JV3 A;  3OYB A;  2FB7 A;  4C92 A;  1Q82 U;  4CI0 C;  3EG9 B;  1X01 A;  5HK0 A;  5FU7 B;  4LUE A;  1M1K U;  5HKC A;  5IH2 A;  1JEG A;  2YXY A;  2OX7 A;  2JNG A;  1UEC A;  3M55 A;  2DPP B;  2DX1 A;  1YCY A;  5LJ5 d;  5LJ3 d;  1KQ1 A;  4A4K A;  1N9R A;  3V7S A;  1I07 A;  4MMK A;  3QHS A;  1YBY A;  2Y90 A;  1N27 A;  3OW2 P;  4OB0 B;  1PCX A;  1K0X A;  3BFM A;  2PUK B;  5GAM j;  4BDY A;  2JMC A;  1AT1 B;  1C6V X;  2QQS A;  2XIC A;  4MZP A;  1O75 A;  3JCM V;  2GFU A;  3KFV A;  2EQM A;  2LCS A;  3REB B;  3CCM T;  4XTV A;  3OW2 S;  1RAF B;  2VC8 A;  1GL5 A;  2FEI A;  1RAC B;  1X27 A;  2VB6 A;  5KYN A;  3FRN A;  4XTZ A;  3HRU A;  4PNO A;  2O01 E;  1UHF A;  7AT1 B;  1WFW A;  1B34 A;  5KCH A;  3I56 T;  1TUD A;  1W4S A;  4PLI A;  3V8L A;  2EJ9 A;  2QEX Q;  3M0P A;  4DA4 A;  1D3B A;  2FRY A;  4BE1 A; 
#chains in the Genus database with same CATH homology
 3EGU A;  1ZX6 A;  4HVV A;  4F17 A;  2DNU A;  2KRM A;  1M30 A;  1PRM C;  2H8H A;  1UG1 A;  1A0N B;  1WLP B;  3UF4 A;  2W0Z A;  4EIK A;  3QWY A;  5GJW B;  1RLP C;  1T0H A;  5GJV B;  2K6D A;  2F2X A;  3NHN A;  2RQW A;  2RMO A;  1JXM A;  1LCK A;  2DBM A;  2MCN A;  1MV0 B;  4RTW A;  4DEY A;  2J6K A;  1Z9Z A;  4KRT A;  3SEM A;  1X2K A;  1CKA A;  3VS1 A;  1I1J A;  4JZ3 A;  5IXB A;  1UUE A;  4FSS A;  4JPB W;  2OI3 A;  1QKW A;  2OAW A;  1AWJ A;  2A08 A;  2EYZ A;  5ECA A;  1M3C A;  1OPL A;  2F2V A;  2I0N A;  2J06 A;  3TSW A;  3PE0 A;  4D8D A;  4WCI A;  3U23 A;  2KRO A;  1BU1 A;  1YCS B;  4GBQ A;  2RQV A;  1YP5 A;  1FYN A;  2CUD A;  2DLP A;  1GFD A;  1OEB A;  1AVZ C;  3UA6 A;  2JS2 A;  2FPE A;  2HEQ A;  2PZ1 A;  2ROL A;  2RQR A;  2YUO A;  2A37 A;  3REA B;  2D1X A;  2HDA A;  1NYG A;  1OPK A;  2FO0 A;  1TG0 A;  3O5Z A;  1X69 A;  1JQQ A;  2J05 A;  4AG2 C;  1QCF A;  4D8K A;  3FJ5 A;  1NLP C;  4LN2 A;  3EG1 A;  2ABL A;  4R0K A;  2GTO A;  5I22 A;  1SHF A;  4CC7 A;  2VVK A;  5FWB A;  2EYW A;  2A36 A;  1ZUY A;  2O2O A;  2EBP A;  2RNA A;  1PKS A;  2KRS A;  1RUW A;  3IQL A;  2AK5 A;  2JM9 A;  3TVT A;  1K76 A;  1T3L A;  2DRK A;  2KR3 A;  4LUD A;  2XMF A;  2KNB B;  2CT4 A;  1TUC A;  4F14 A;  1M3A A;  2RQT A;  5FW9 A;  3TSZ A;  3ZL7 C;  2YUQ A;  2FPF A;  2JMA A;  1GCP A;  1K9A A;  2AZS A;  4J9C A;  2BTT A;  3VS3 A;  4OMO A;  1SRL A;  4AFZ C;  2PTK A;  2FRW A;  2KYM A;  4RTV A;  1SSH A;  5IHI A;  2L2P A;  4OMP A;  2D8H A;  2DRM A;  1QLY A;  1WIE A;  1GBQ A;  2K2M A;  4AFS C;  1AEY A;  1W70 A;  3NMZ C;  2L3Q A;  2SRC A;  1NM7 A;  2YSQ A;  2F2W A;  2LMJ A;  2EQI A;  4RTZ A;  1FMK A;  1RLQ C;  4HCK A;  2CSI A;  1K4U S;  3RBB B;  1Y0M A;  2LQW A;  3NGP A;  2JTE A;  2C0I A;  1B07 A;  2CUB A;  2DM1 A;  4IIM A;  1UDL A;  2EKH A;  2EVR A;  1K1Z A;  3PVL A;  3VRZ A;  2KT8 A;  4JJD A;  2DL8 A;  2ROT A;  1AZG B;  2DL5 A;  4IIO A;  1UFF A;  2FG0 A;  2M0Y A;  4GLM A;  1ABO A;  1HSQ A;  2ENM A;  2OJ2 A;  4J9B A;  1ZUK A;  1KJW A;  1Z9Q A;  2JXB A;  1VYU A;  2J6O A;  3I5R A;  3ULR B;  2O31 A;  1YWP A;  2D0N A;  4RTT A;  2EW3 A;  1ZLM A;  1E7O A;  2B86 A;  4OMN A;  1UHC A;  1WXB A;  3EHR A;  2O88 A;  2JW4 A;  1SPK A;  1I0C A;  2LJ3 A;  4Z89 A;  2HBW A;  3I35 A;  2J7I A;  2O9S A;  1W1F A;  1H92 A;  2LNH B;  2LX7 A;  2JM8 A;  2X3X D;  2ED0 A;  4RTU A;  2CT3 A;  5IHK A;  5FWC A;  1N5Z A;  4ZNX A;  1E6G A;  2GQI A;  2DL4 A;  3LH5 A;  4AFU C;  4J9I A;  3VS7 A;  1AD5 A;  2KBT A;  1VA7 A;  3RNJ A;  3H41 A;  4M4Z A;  2K79 A;  1SEM A;  2RPN A;  3GBQ A;  1YNZ A;  1V1C A;  1ZBJ A;  2EYY A;  1WA7 A;  1T3S A;  2V1R A;  1S1N A;  1BK2 A;  2BZX A;  1U5S A;  1KSW A;  2RF0 A;  2GBQ A;  1CKB A;  1VYV A;  1G2B A;  2RQU A;  3M0R A;  2PNI A;  4J9F A;  3QWX X;  2YUP A;  4AFQ C;  2KT1 A;  1W6X A;  3VS4 A;  2MOX A;  4HXJ A;  1WDX A;  1H3H A;  2V1Q A;  2NWM A;  1PRL C;  1OV3 A;  1U06 A;  5I11 A;  4CC2 A;  2CRE A;  5IXF A;  2J6F A;  1M27 C;  1E6H A;  4HVU A;  2KEA A;  1H8K A;  2JS0 A;  2DVJ A;  2DYB A;  1SHG A;  1RI9 A;  2ECZ A;  2A28 A;  2DL7 A;  2CH4 W;  2E5K A;  4J9D A;  2LJ1 A;  2AZV A;  1X43 A;  2BZY A;  1NEG A;  4DEX A;  4AG1 C;  2CDT A;  2DA9 A;  1WXT A;  2LZ6 B;  2CSQ A;  2AKK A;  2G6F X;  2K9G A;  1B3Q A;  1MV3 A;  1OOT A;  3C0C A;  2DE0 X;  4J9H A;  4JJC A;  2GNC A;  1ZUU A;  4LE9 A;  3M0U A;  2RN8 A;  3H0I A;  2X3W D;  2LQN A;  1NEB A;  2DIL A;  3UA7 A;  4K11 A;  2K3B A;  1GBR A;  4A63 B;  4OMM A;  2EGA A;  1GCQ C;  4CC3 A;  2K7A A;  2MIO A;  1NG2 A;  2DF6 A;  3EG2 A;  2HCK A;  3SHW A;  4HVW A;  1KIK A;  2QDL A;  3UAT A;  1K0S A;  1IO6 A;  1JO8 A;  1GCQ A;  4OML A;  1NYF A;  1J3T A;  1JXO A;  4ORZ A;  3I9Q A;  1ABQ A;  3M0S A;  2AKL A;  2HSP A;  1XOV A;  1MUZ A;  4F16 A;  2D8J A;  5EC7 A;  2YT6 A;  3VS0 A;  1ZSG A;  5HCK A;  2L3P A;  1AOJ A;  4RTX A;  4J9G A;  2C0T A;  2C0O A;  1AZE A;  1UE9 A;  3VRY A;  2LJ0 A;  3VS6 A;  2GTJ A;  4LNP A;  3R6N A;  4J9E A;  1M3B A;  3EHQ A;  2KXD A;  1QWF A;  2EYX A;  2GGR A;  1PWT A;  2SEM A;  2KRN A;  1X6G A;  1HJD A;  3M0T A;  3JV3 A;  1M8M A;  2DMO A;  1Y57 A;  2DL3 A;  1UJ0 A;  1NLO C;  4JJB A;  1PNJ A;  4LUE A;  4Z88 A;  3I5S A;  1CSK A;  5IH2 A;  1JEG A;  2EPD A;  1PHT A;  2BZ8 A;  1GRI A;  1UEC A;  1X2Q A;  1X6B A;  4OMQ A;  1UJY A;  4RTY A;  2VKN A;  2DX1 A;  2LP5 A;  1T0J A;  3M0Q A;  4X1V A;  4ESR A;  2NUZ A;  4Z8A A;  1PKT A;  2ED1 A;  1I07 A;  3THK A;  4E6R A;  2ESW A;  1BB9 A;  3H0F A;  1YWO A;  1UGV A;  2EGC A;  1AWO A;  1GFC A;  2L0A A;  1QKX A;  1UTI A;  3NPF A;  1U3O A;  1VYT A;  5L23 A;  1AWW A;  2KE9 A;  1K0X A;  2DJQ A;  2JMC A;  2M51 A;  1AWX A;  2CH4 A;  3KFV A;  2DBK A;  1WI7 A;  2LCS A;  3REB B;  3A98 A;  1JU5 C;  2KXC A;  2O9V A;  4QT7 A;  1GL5 A;  2FEI A;  3VS5 A;  3EG0 A;  1KFZ A;  1WX6 A;  1X27 A;  1BBZ A;  1WYX A;  2YUN A;  2JT4 A;  1ARK A;  1SRM A;  3VS2 A;  2IIM A;  1WXU A;  3CQT A;  2KYB A;  1HD3 A;  2KGT A;  2W10 A;  3EG3 A;  3PVQ A;  4CC4 B;  5IHN A;  2L3S A;  1UHF A;  1WFW A;  3H0H A;  2EGE A;  1TUD A;  1QWE A;  4JZ4 A;  2FPD A;  1G83 A;  2YDL A;  3M0P A;  1EFN A;  2P4R A;  2FRY A;  1YN8 A;  4Y92 A;  4RUG A;  2VWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...