2KRMA

Rdc refined solution structure of the first sh3 domain of cd2ap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krmA00
4HCKA 1K4US 3NMZC 1VYVA 2HBWA 2H8HA 1QKXA 3I35A 3JV3A 2F2WA 1HJDA 5IXBA 1ZX6A 2F2VA 2PNIA 2DX1A 4J9FA 2GNCA 1GRIA 1JXOA 2RF0A 1CKAA 4J9CA 2PTKA 1K1ZA 2D8HA 2O88A 3EHRA 4RTTA 2RQVA 1ZBJA 4LE9A 2LCSA 3EHQA 2RQWA 4Z8AA 2EBPA 2EYXA 4KRTA 1WYXA 2P4RA 2JXBA 4RUGA 3THKA 1ZUYA 4EIKA 1HSQA 3VS2A 1X2QA 2OAWA 1JXMA 1ARKA 5FWBA 2GQIA 3SHWA 4FSSA 1HD3A 2ESWA 2L2PA 2DA9A 2RPNA 4JJDA 2KYMA 1B3QA 2D0NA 2V1RA 1OPLA 2CT4A 2EW3A 1AZGB 1BK2A 1UJ0A 4LUDA 4K11A 5FW9A 2M51A 2D8JA 4AFUC 2A08A 2LMJA 3H0HA 2KGTA 4J9BA 4D8DA 1PKSA 4CC2A 1E6GA 1H3HA 2NWMA 1WX6A 2DBKA 2DL5A 4JZ4A 2YUOA 2KT1A 3PVLA 2YT6A 2FEIA 2LZ6B 5I11A 3EG2A 2RN8A 2I0NA 2SRCA 1QWFA 1K9AA 2KNBB 2O9SA 1AZEA 4DEXA 1YNZA 3UA6A 3C0CA 3I5RA 3IQLA 4JJCA 3M0SA 2K6DA 1U3OA 5GJWB 2ED0A 2ROTA 4E6RA 3UF4A 2EGEA 3M0RA 1WLPB 2RQRA 2J6FA 1NEGA 1KFZA 4RTZA 2J7IA 1U5SA 2C0OA 2EGCA 2O9VA 1H92A 2SEMA 4IIOA 1WXBA 2CREA 1GCQA 1X69A 1M27C 4F17A 1MUZA 1RUWA 2KXCA 1AOJA 5FWCA 1YWPA 2BZXA 1T0JA 1LCKA 1G2BA 2AKLA 1UUEA 2AZVA 2ED1A 5HCKA 1ABQA 2YUPA 2DL3A 2LJ1A 4OMMA 2JM9A 2LQWA 1K0SA 4D8KA 2HDAA 1KSWA 2BZ8A 2M0YA 4HXJA 2A37A 2DL7A 2K9GA 4RTXA 1ZUUA 2FPEA 3I9QA 1X43A 2OJ2A 5EC7A 1BU1A 2IIMA 2PZ1A 3SEMA 4JPBW 2FO0A 1AVZC 1T0HA 1WDXA 2L0AA 2LX7A 2J05A 1WFWA 2J6KA 1JQQA 4RTYA 1SRLA 3LH5A 2YDLA 2MCNA 3VS5A 1WI7A 1NYGA 2KE9A 4J9EA 4F14A 1W1FA 4HVUA 2RQUA 2GTJA 2YUQA 1AEYA 3NPFA 3ZL7C 1ZSGA 1IO6A 2W0ZA 1SHGA 3EG1A 1QKWA 2GBQA 2JTEA 4AFSC 1QWEA 1BBZA 3KFVA 4J9IA 1VA7A 3TVTA 2CUBA 1UHFA 2C0TA 4IIMA 1QCFA 3VS3A 2D1XA 4R0KA 3EG0A 3RBBB 2CT3A 1PKTA 1M3AA 2DBMA 3U23A 1PHTA 1J3TA 1UE9A 1YCSB 4CC7A 2C0IA 1FMKA 1RLQC 2DILA 3REAB 1KJWA 2J06A 1G83A 2CSIA 2VKNA 1GBQA 2FG0A 2V1QA 2DM1A 2A28A 1GFDA 4CC4B 2EKHA 2JW4A 2KBTA 1U06A 1AWOA 1T3LA 1M8MA 3VS6A 2EVRA 2L3QA 4LNPA 3VS1A 1PRMC 2JT4A 1I1JA 5IHKA 1M30A 1NEBA 1CSKA 1EFNA 2HCKA 1ABOA 3REBB 1Z9QA 2DMOA 1PRLC 5I22A 1OPKA 4GLMA 1JU5C 3VS4A 1NG2A 4CC3A 2ABLA 2YSQA 1XOVA 5IH2A 1Z9ZA 2JMAA 2DE0X 1I0CA 4GBQA 2K79A 1NYFA 1TG0A 1Y57A 5L23A 1VYUA 3VS7A 2G6FX 1KIKA 4RTUA 1T3SA 1NLPC 1SHFA 1Y0MA 2LP5A 2EYYA 1TUDA 1V1CA 2O31A 1UFFA 2EYZA 2CH4W 3QWYA 1X6BA 3I5SA 4QT7A 2X3WD 1JEGA 2L3SA 1M3CA 2KXDA 1M3BA 4ORZA 2LJ0A 3M0PA 2DJQA 1UECA 2DVJA 1B07A 2VWFA 2CDTA 2EQIA 4RTWA 4J9HA 2K3BA 2EYWA 2BTTA 1AWWA 2KYBA 3H41A 2KROA 4JJBA 1GFCA 2JS0A 2DL8A 1N5ZA 3TSWA 2W10A 2CUDA 3PVQA 4AG1C 2QDLA 2ENMA 1A0NB 5IHIA 4Z88A 1BB9A 2DNUA 4OMLA 4OMQA 1H8KA 2LJ3A 2O2OA 4J9DA 2K2MA 2JMCA 3M0TA 2VVKA 4ESRA 5IHNA 4LN2A 2A36A 1OOTA 2YUNA 5ECAA 3ULRB 1TUCA 1NM7A 2DL4A 2JM8A 4AFZC 1WXUA 4Z89A 2E5KA 1MV0B 4RTVA 3TSZA 4Y92A 1UGVA 3EGUA 2EPDA 2MIOA 1QLYA 1YN8A 3CQTA 3QWXX 1GBRA 2DF6A 2KR3A 4JZ3A 3EG3A 1W70A 1YWOA 2RQTA 2FRYA 2NUZA 1CKBA 1OV3A 1GCQC 4HVVA 1OEBA 2EGAA 2RMOA 4F16A 2AK5A 2F2XA 1E7OA 2KT8A 1SEMA 1GL5A 1JO8A 1I07A 1X6GA 2LQNA 3VRYA 3M0UA 1MV3A 1NLOC 2AKKA 3UATA 3VS0A 5IXFA 3M0QA 4OMPA 3O5ZA 1YP5A 1K0XA 1ZUKA 1UDLA 4ZNXA 2GGRA 2MOXA 2FRWA 2CH4A 4A63B 3R6NA 3RNJA 1WA7A 3NHNA 3H0FA 1WXTA 2KRMA 2X3XD 2ECZA 1SRMA 2KRNA 2B86A 3GBQA 1S1NA 1AWJA 2FPDA 2JS2A 2OI3A 2ROLA 1UG1A 1AD5A 1SPKA 1ZLMA 1X2KA 2HSPA 1AWXA 4LUEA 2XMFA 2DRMA 3FJ5A 1UHCA 1GCPA 1PNJA 1E6HA 1K76A 2AZSA 1RLPC 1RI9A 4AFQC 2HEQA 4M4ZA 4OMNA 2BZYA 3NGPA 2DLPA 2LNHB 3H0IA 4AG2C 2K7AA 2FPFA 2J6OA 2DRKA 2KRSA 3VRZA 2RNAA 3PE0A 4J9GA 3UA7A 2CSQA 3A98A 1UJYA 2DYBA 1WIEA 4DEYA 1X27A 1SSHA 4X1VA 2L3PA 2GTOA 1FYNA 1VYTA 1UTIA 1W6XA 2KEAA 4WCIA 5GJVB 4OMOA 4HVWA 1PWTA
chains in the Genus database with same CATH superfamily
4BB7A 3CPWP 3RMQA 1JJ2S 4C92B 4BI3A 2VGNA 1VYVA 4M7AG 1C1AA 3I35A 1D1CA 3OB9A 1FXXA 1YHQT 2E1HA 5IXBA 1ZX6A 2F2VA 5LJ3h 4J9FA 4C8QG 1GRIA 3CCSA 2RF0A 1CKAA 4J9CA 1K73U 1M1FA 2EWNA 2LCSA 3EHQA 4KRTA 2LRQA 2YWWA 3QO3A 3CCVA 2P4RA 4EIKA 2XHCA 1YJNA 1K73C 1ARKA 2PUKB 3RDVA 2YRVA 5KCHA 2L2PA 7AT1B 4PKCC 2V1RA 3LX7A 5M9OA 3QIIA 4C92F 3ER0A 3PMTA 5KYYA 2CT4A 3E9GA 1MMGA 1UJ0A 1BK2A 4LUDA 3GPLA 4K11A 1Q7YU 4II1A 3FDRA 4M7DB 2LMJA 3H0HA 1K73R 3A8HB 1M8VA 2X4JA 4M75G 3LYIA 4JZ4A 3BFMA 2YUOA 3PVLA 1WHKA 4UC4A 1Q7YC 2RN8A 1VQ9A 2RK1A 1IRXA 1QWFA 2KNBB 2YRCA 4FT2A 4C92G 5GANg 4XTUA 2E6ZA 4JLGA 1M1GA 3PTAA 3M0SA 1G8XA 1U3OA 5GJWB 2ED0A 2RJEA 2ROTA 4E6RA 4D6WA 1MHNA 3WVEB 1WLPB 4FYYB 3CCJA 2MAMA 4HA8A 1VQ4Q 1O75A 2M16A 1WJSA 4XU0A 2SEMA 3CMAQ 5CAIA 1WGSA 3JCMd 4M7DF 1MUZA 4OGEA 4DA4A 2XDBA 1N8RU 2BZXA 1T0JA 5D6YA 3QHSA 4EMKC 5LL6S 5AT1B 4OB3B 1JBMA 3I55T 2YUPA 2DL3A 2LJ1A 1FMVA 1K0SA 2RB6A 4RKUE 3HRSA 1NPRA 2HDAA 3JB9D 1N8RC 2A37A 4RTXA 3M57A 1ZUUA 2FPEA 1M2VB 2AT1B 4M7DG 1BU1A 2PZ1A 1AVZC 2QTVA 1ZA2B 5GMKm 4M77B 2LX7A 2J05A 2COZA 3MKDA 1VQLA 4C0FA 1SRLA 3VS5A 4N0AA 4A4FA 1WI7A 1NYGA 2KE9A 4F14A 1W1FA 4A4KA 4XTXA 1N8RR 4LDXA 2QYZA 3C12A 2CZ7B 2EFIA 3Q1JA 3EG1A 1QKWA 2GBQA 3I56A 3JCMX 4ZN3A 3G71A 3TVTA 4LD9K 2CYZB 1NJIR 3VS3A 2Y4XA 4LXCA 1QQJA 1IHVA 1C0MA 4DBHA 3EG0A 1BCMA 4QVCA 1BYMA 3P8BB 3QJYA 1YJ9Q 2GQVA 3MPUB 2NLUA 4CC7A 1FMKA 1JRIA 2DILA 3MCAB 1RAAB 2J06A 3C4SA 1G83A 2CSIA 2COYA 2QA4A 3QKJA 2DM1A 2QXFA 4M77F 2M9UA 1GFDA 2KBTA 2LCCA 1D0YA 5GMKh 1YJWQ 1N27A 4B6MA 4M7AE 2EVRA 3QZ9B 5D6XA 5KYUA 2PVDB 4JS4A 3DLMA 3CD6T 3DB4A 5IHKA 4XU3A 3CC7T 5KYWA 1WHMA 3GNFB 4JJNK 3S3NA 3CMEQ 4QQ6A 2DMOA 4GLMA 3FEOA 4M77G 3L2QA 3VS4A 1NG2A 4FW2A 3OBYA 2ABLA 2YSQA 2ZPFB 5IH2A 4GBQA 3CCRT 1I0CA 1VQNT 2K5LA 1NYFA 1TG0A 4E7ZA 1VYUA 1KIKA 1ZSZB 2MMPA 4AMCA 1NLPC 1SHFA 4MMKA 2LP5A 1Q81R 3RESA 1YITA 2YHTA 2E41A 2ZCFB 5GAOn 2L3SA 1M3BA 1KK7A 1BIAA 4QW2A 1S72T 1OZ2A 4XTYA 2VWFA 4EMGA 5I2SA 2EQIA 1EIFA 4RTWA 4M75E 4XQ3A 4OP0A 5CCAA 2M0OA 1VQKA 2QQBA 3OYCA 4AG1C 2QDLA 2BIVA 1RAIB 4ATOA 4C0DB 2DNUA 2DERA 2XK0A 3M53A 2LNVA 2YLCA 2RH2A 1H8KA 2LJ3A 4RMOA 4J9DA 4M75A 5GANf 2K2VA 2QAZA 2XD0A 3UDCA 2K2MA 2R58A 1VQ8A 2X4XA 2VVKA 1JJ2A 4RG2A 2M02A 3FRNA 1TUCA 2OTJT 4M78C 1WXUA 5HK3A 1HYOA 2EPDA 4J5YA 3A8GB 1QLYA 3QWXX 1LPLA 3JCMc 4JZ3A 3L2VA 3PT9A 3CCVQ 4HKEA 2FRYA 5KYYB 2NUZA 3OS1A 1OV3A 3JB9I 2EAYA 3CXCA 1YJNQ 3PNWC 2EIFA 3V7SA 1QP2A 2QDYB 2DEUA 1XJWB 3M4YA 3CCET 1QCOA 2HKQB 1E7OA 1SEMA 1W2BP 4XTWA 4QKUA 4F7UG 1IB8A 1MMNA 1I4K1 1G3WA 1I5OB 4Y28E 4PLLA 4OMPA 1K0XA 2VGMA 2QASA 2CZ6B 3R6NA 3DKMA 3NHNA 2VYTA 3OYAA 2DIQA 1YBYA 1VQ4A 1Y96A 2X3XD 1SSFA 4BUGA 1SRMA 2LDMA 1VQ9Q 3AT1B 4C92C 3CMAA 2JS2A 1YFNA 1ZLMA 4BY6C 3QG1A 2MPXC 1QVFP 1F1BB 2O4XA 8AT1B 1GCPA 3SFMA 2CS7A 2AZSA 1RLPC 1I8FA 3S6WA 4AFQC 1R77A 3VYGA 4OB1B 2HEQA 2E3HA 5GANe 1TWBA 2E12A 2HBPA 1PG5B 3EGXA 1D09B 1QP3A 2HNIA 3UA7A 4OVAA 5CKHA 1UJYA 2K3YA 1HK9A 4LDVA 4V2SA 1SSHA 3HKSA 3MEUA 1PCXA 4WCIA 1KQSP 1UTIA 3JCMf 3M54A 4OMOA 1D1AA 2XDDA 4A53A 5HKCA 3G4ST 4HCKA 4NS5A 3G6EQ 2YRDA 3NMZC 1N9RA 2HBWA 2H8HA 2EQUA 4PJNA 2LC4A 2BE9B 2LT4A 3MO8A 2RHZA 2DD5A 4L5GA 2WSEE 2DX1A 3LLRA 3CPFA 1VQLQ 4KT0E 1K1ZA 3CCMA 1BI0A 2D8HA 2CZ1B 2G3RA 2XIDA 3MP8A 3L2ZA 2RQVA 4Y91A 4IURA 2RQWA 4Z8AA 1EZZB 1WYXA 3I56Q 2KI7A 2JXBA 4RUGA 1ZUYA 1X2QA 2ZPGB 2OAWA 4BDYA 1JXMA 2VC8A 3HHTB 2L89A 2DK3A 3QBYA 4E7HA 5CQYA 5D6WA 1I5LA 3MHXA 2RPNA 4PK4A 3V7CA 2D0NA 4NOYA 1PSEA 4N4IA 3A5ZB 4OB0B 1VQOA 2E64A 2A08A 5KYUB 3OW2A 3CMEA 1PSFA 2QA4Q 4J9BA 4D8DA 1PKSA 4CC2A 5LJ5g 3KBGA 2DL5A 2KT1A 2LZ6B 3D7SB 1VQ4T 3OYKA 1OU9A 2JZ2A 3CC2A 3HFNA 1K9AA 2O9SA 3EAEA 1AZEA 3CCQA 3QPHA 4ZTFA 1M90U 2HAXA 3UA6A 3OYLA 3JCMP 5LJ5j 3BDUA 3JSCA 3SB2A 1P92A 3CBMA 3M0RA 1MNDA 3JCMe 1M90C 1D0XA 2ZZDA 2PUOB 1U5SA 2C0OA 1EX4A 2LCLA 3KXTA 4R56A 4FT4A 1WHGA 5C6SA 2CREA 1GCQA 1X69A 3HTRA 1RUWA 2KXCA 1AOJA 5FWCA 1YWPA 4RCBA 2F1LA 1KQ1A 3VUBA 5GANd 1YITQ 1G2BA 2AKLA 1AT1B 1UUEA 2ED1A 1M90R 1ABQA 2QEXA 2F5TX 2JM9A 4D8KA 3LGLA 1KSWA 4VUBA 5A0LA 4HXJA 2K9GA 5CK9A 1G3SA 3I9QA 3JRZA 1SG5A 1RAFB 4BY6B 2IIMA 2M1HA 5GANh 4JPBW 2EQJA 4MMLA 1VQKQ 2R57A 1QMCA 1T0HA 1WDXA 2X4WA 4M78G 2FZGB 2CP5A 4HVUA 2BUDA 4PJLA 1YJ9T 3RERA 2GTJA 4LDWA 4WTOB 4HT8A 1ZSGA 5FU7C 1QVGA 2W0ZA 2RHIA 1BIBA 3A8LB 3CXCS 1VQ8Q 4E7KA 1BBZA 4J9IA 2CUBA 1PC0A 2C0TA 5GMKe 3OYBA 2D1XA 3QDRB 1YJWT 1PKTA 3JB9F 1RAHB 3OMCA 4C5EA 4AT1B 1J3TA 4JS5A 1ZSZC 4EMKA 3PIPA 4E7SA 3H6ZA 3HFOA 2NUTB 2PVOB 3NTIA 4MZPA 5GAMg 2A28A 4DBRA 4EDUA 4CC4B 3UPUA 1U06A 2RD1A 2MF2A 1WNLA 1T3LA 2P84A 4A4GA 1FMWA 5DLOA 3JB9G 1TOVA 2ATCB 4JRPA 3NTKA 1I1JA 1G3YA 2QG9B 1YIJT 5GAOr 5KCOA 2RK2A 1NPPA 1RI0A 4FYWB 1NEBA 2WSCE 1EFNA 4M7AD 2HMAA 3EH1A 2QGGA 5GAMj 1ABOA 2DFUA 3REBB 3RUXA 1JU5C 1D3BA 2LQ8A 4C0DC 1Q7YR 5IT9E 2JMAA 4XU1A 2FYKA 1OI1A 1PM3A 1Y57A 5L23A 2E65A 2G6FX 3NTHA 3OYYA 3LH0A 2PQWA 2LT1A 4PJOE 1Y0MA 3RR6A 5LJ3g 1TUDA 1IHWA 1V1CA 1MMDA 1NBEB 1XTDA 3CC4A 2QQ9A 3O8VA 3CPWA 1YI2T 4PFOA 3VUZA 3QWYA 1X6BA 3HP9A 3I5SA 4FCYA 1QCNA 5GAN7 3QSUA 2FB7A 2EKOA 2JOYA 2LJ0A 1UECA 1H641 4PJMA 5A0DA 3G6EA 3TEEA 3S3MA 4PJOA 3JCMh 2K3BA 2EYWA 2R5AA 5LJ3j 1AHJB 1AWWA 4JRKA 4MZTA 4X9DA 3H41A 2KROA 3G1JA 1GFCA 3EFOB 3OSSC 2DL8A 3C95A 4M75D 3EGDB 2EQKA 1VQ7A 1VQ5A 3CCST 4ZGDB 2PVGB 3GLXA 1VQPQ 1M9SA 5CKFA 1TU0B 2Y4YA 1B7TA 1RADB 1D1BA 3CCVT 4ESRA 5IHNA 2A36A 5ECAA 2YUNA 5D7UA 4C5IA 1YJNT 1NM7A 2JM8A 3CCLA 5CO7A 4Z89A 2E5KA 2RHXA 2KVQG 1O9SA 3TSZA 3EGUA 3ZFJA 3CCMQ 2MIOA 1GBRA 2DF6A 4P5NA 2KR3A 3OW2S 2FL7A 3CCUA 5AYFA 4BI8B 1KHCA 1W70A 1YWOA 4KGXB 1R0CB 2CP7A 1CKBA 1YHQQ 2LVMA 4HVVA 1OEBA 1BKBA 2EGAA 2AK5A 4XTZA 1JJ2P 2DKGA 3META 3OYNA 2JTFA 1VQ9T 2D9TA 2HQXA 1I07A 2WSFE 1X6GA 2DZ9A 5FU7B 3VRYA 2QK0A 1NLOC 1VQOQ 3UT1A 4C8QE 3GP8A 3O5ZA 1YP5A 1ZUKA 4ZNXA 2DXBA 2CH4A 2KK4A 2DZCA 3T9NA 3OS2A 4M7AA 3SWNA 2O01E 4OF1A 3CCJT 4KGZB 2ECZA 1LVKA 3QUIA 3CC2Q 2E5QA 1S1NA 2FPDA 2WACA 3MP1A 3CCQQ 4J6WA 4C8QA 1AD5A 1SPKA 2MYSA 4JDSA 1AWXA 3OSVA 4LUEA 3URGA 2XMFA 4J7IA 1TXQA 1K76A 2NUPA 2XI9A 1ZQ1A 1B34B 4E7JA 2LNHB 1RACB 2DTIA 4OGCA 1BI3A 4E7LA 3N5BB 2BE7D 2RI5A 2KAFA 1Q86C 2DYBA 3CBPA 3E1SA 4X1VA 2B8AA 1W6XA 4C92E 3PFSA 1VQLT 5DM7R 2QEXQ 1QVGS 3ASKA 3RIRA 1K4US 1KG1A 2DTHA 3I56T 1Q95G 1QKXA 3G71T 1FX7A 4HCZA 3A8OB 3M4GA 3JV3A 1R8OB 4IUUA 2XKOC 4C92A 2PNIA 2DYIA 3I55Q 5L8RE 1JXOA 1UEBA 2PTKA 3OYMA 3L42A 3J81E 3EG9A 3E9FA 2O88A 1ACMB 2GFUA 2H3EB 3EHRA 3LGFA 1ZBJA 1X01A 4LE9A 5CIUA 1V29B 1RAGB 5GMKj 3JB9H 3THKA 1HSQA 2QA4T 4RCCA 2C06A 5FWBA 4ZGJB 2GQIA 3SHWA 1HD3A 2DA9A 2KYMA 1B3QA 1MNEA 2F69A 2DETA 4M7DE 4TVRA 4O6JA 1OPLA 4OB2B 4DOWA 2EW3A 2KQWA 1VQMA 2M51A 5FU6C 3TU4K 1KHIA 1FWZA 2DAQA 1IGUA 2KGTA 3OY9A 4CI0C 1YCYA 2NWMA 2DBKA 1WQ7A 5KE3A 2YT6A 2DIGA 4M7DA 5CR2A 5I11A 2I0NA 3SD4A 1TSFA 3VU3C 4DEXA 1D3BB 1YNZA 2OTLA 5GAN3 3CPWS 4FSXA 4MZMA 3C0CA 3I5RA 2KDSA 4X34A 3DLLA 2K6DA 1YITT 2V8KA 2VUBA 4XU2A 2EGEA 2RQRA 1BCOA 4C0ZA 2RHUA 2J7IA 2L5QA 2L8DA 2O9VA 3G7ZA 3CD6Q 5GAN8 4BD3A 2HD0A 4F17A 3CC7Q 4MDWA 5FRNA 2QQRA 4PJOB 2BKDN 1VQKT 2RO0A 3LW5E 3CC4Q 1LCKA 4BE1A 2VASA 3FB9A 1MMAA 2LQWA 3M55A 1VQPA 5KYNA 4XK8E 3L2RA 5DLQE 2BZ8A 2M0YA 2DL7A 2COWA 2XG8D 1I81A 1VQ8T 4M77E 2OJ2A 4FU6A 3TCJA 5KH6A 2MK5A 2K3XA 4C5HA 2FO0A 2L0AA 2CGHA 1NZ9A 4EPCA 1M2VA 2KMTA 3LH5A 2YDLA 1VQ7Q 3L2UA 1VQ5Q 4J9EA 2P0QA 2RQUA 2DEQA 2QGFB 2YUQA 3TQ7P 3RKXA 1OULA 3ZL7C 5FRMA 4E47A 1OYXA 3QYHB 3OYJA 3OYHA 1SHGA 1XQHA 4M77A 1QW1A 2QQAA 1LOJA 4FIBA 3KFVA 1VIFA 1VA7A 4PJOF 1W2BA 3JCMJ 2DJZA 5A0GA 1YHQA 1OX9A 1QCFA 3CBOA 4R0KA 3CCLQ 5GAOq 2FVUA 3PGGA 1M3AA 2DBMA 2IVWA 3U23A 2XDPA 3UWNA 4DOVA 2OX7A 5KYXA 4E2FB 2RJFA 2C0IA 4DBQA 1WHJA 2IPOB 3TREA 3CCUQ 2VKNA 2HQEA 1OQKA 4KH1B 3P8HA 5HK0A 3OYDA 3CEYA 2EKHA 2JW4A 4N4HA 3KUFA 5KYWB 5I21A 1AWOA 1QVFA 2L3QA 1VQ6Q 3VS1A 1ZA1B 1Q82U 3FIFA 1PRMC 3CMAT 3V8KA 4M7AB 1M30A 1K9MU 4GLKA 4BI4A 3DB3A 2CP0A 1Z9QA 1U1TA 2LX9A 2HSEB 1OPKA 2ZGWA 1Q82C 4PFPA 1XOVA 3QYGB 1W4SA 2DE0X 1K9MC 2GFAA 3V8JA 2A3LA 1KC8U 3VS7A 4XTVA 4EMHA 4KH0B 4RTUA 1KQSA 5FU6B 1K8AU 4YTLA 1TUGB 2NUPB 3QJ6A 2VXFA 3MEVA 2E10A 2V26A 2O31A 4LD6A 2CH4W 2NYSA 1Q82R 4PJOD 2X3WD 1KC8C 4F7UE 1OX8A 2KXDA 1K9MR 3M0PA 2DJQA 2I2LA 1K8AC 4C5GA 1B07A 2HZYA 2CDTA 1UGQB 4M7AF 4LDYA 4C0GA 3E19A 4JJBA 2JS0A 1N5ZA 1PD1A 1ZHIA 2CUDA 2V8IA 5J39A 4M75B 1KC8R 4F7UA 1WQWA 2KY9A 4A4EA 2HKNA 3I55A 5EG2A 5IHIA 2Z0WA 2LTOA 1A0NB 3CCMT 5FLXE 1G3TA 1WZOA 2X51A 9ATCB 2O2OA 2DD4A 3VV0A 2RHYA 4QVDA 2H3JA 2JMCA 3M0TA 1VOMA 3EG9B 4LN2A 1OOTA 4O5VA 5GAN5 2DL4A 4AFZC 5GAOl 1MV0B 4RTVA 3G4SQ 2P4TA 1X6OA 1YN8A 3CQTA 2CZ0B 2DTOA 3PIOA 2D0QB 2RM4A 2GCXA 4ZTJA 4PJJA 2VV5A 1VQOT 2CP3A 3EG3A 3OYIA 3ZBDA 4X9CA 3CMET 4FL6A 4CRIA 4M75F 4Z02A 1GCQC 2RMOA 5DY9A 2KT8A 3CC2T 3OYGA 1C6VX 4JRQA 3CCQT 2LQNA 3J80E 1BI2A 1MV3A 2AKKA 3C94A 1VQMQ 1Y71A 5IXFA 1QVPA 4J83A 4N4GA 1Y96B 2EQMA 2GGRA 5HY6A 2FRWA 3NFCA 4A63B 3RNJA 5CVIA 4A4HA 1WHLA 4M78D 4QVZA 4C8QD 3H0FA 1WXTA 4KGVB 3V7RA 2KRMA 3EH2A 2O4XB 2KRNA 3CD6A 2B86A 5A2QE 3GBQA 2OI3A 1WJQA 2ROLA 3SDZA 3CC7A 1UG1A 2A0FB 2OTLQ 2HSPA 5IN1A 2E4HA 2DRMA 1PNJA 1TTHB 3EGXB 4BACA 2QEXT 1U1SA 3CCRA 1RI9A 4QQDA 1VQNA 5GANj 4M4ZA 1U8RA 1M4ZA 3E2UA 3MEWA 3JB9J 3H0IA 2K7AA 3L2WA 4KUIA 3JCMV 3VRZA 3HSBA 4J9GA 3H9NA 2CSQA 2Y90A 3L1AA 3BE3A 5LJ5f 2HL5C 1VYTA 5GJVB 3M58A 2AHJB 1PWTA 1S72A 5J26A 1NJIU 4MDXA 2PU9B 4C92D 1W2BS 3PMIA 2YLBA 3F70A 3X20B 2CP2A 3H8ZA 5CKDA 4IUQA 4FM4B 2F2WA 1HJDA 5GAN4 1NJIC 1NE8A 1XNIA 2GNCA 2P0KA 5FROA 4E7IA 3R6OA 4RTTA 4IUTA 2EBPA 2EYXA 8ATCB 2L3RA 3MJXA 3VS2A 5KYXB 2OTJA 1QVFS 2RJCA 1RL2A 3EFRA 4FSSA 5KE2A 2ESWA 3GNGA 4BE2A 4JJDA 1VQ6A 3FLGA 2K5IA 1AZGB 3ME9A 5FW9A 2D8JA 4AFUC 4M78E 1LJOA 2LQKA 4M7DD 2EYQA 4PJOC 1E6GA 1H3HA 4BE0A 1WX6A 1Q81U 3JCMg 3OS5A 2YXYA 2FEIA 2K57A 3CCEA 3EG2A 1KQSS 2SRCA 4HCBA 1JB0E 2D6FA 3CXCP 3A1PA 3RKWA 4M78A 1D0ZA 4KUDK 3IQLA 4JJCA 4N0AC 1Q81C 5I2MA 3CC4T 2MWPA 5GMKi 2K4YA 3OA6A 5LJ5e 3UF4A 2AIRB 1OU8A 2J6FA 1NEGA 1Q86U 1KFZA 1UB4A 2DVEA 4RTZA 1H3ZA 1LNXA 2EGCA 1UGSB 3G6ET 1VUBA 3HRTA 1H92A 3BW1A 4PNOA 4IIOA 4OMFB 1WXBA 1YIJQ 2GF7A 1M27C 3INZA 3JCMb 5J3BA 2X4YA 1G5VA 5GAMf 3X26B 2OAUA 2AZVA 3V8LA 5HCKA 1VQ7T 1VQ5T 4OMMA 1RABB 2V8JA 2A7YA 4J6YA 4NL2A 1OZ3A 4F7UB 3A8MB 2RJDA 3VYHB 2IG0A 1M5Q1 1X43A 4KULA 3X24B 3M56A 4QQGA 5EC7A 3SEMA 4ME7A 1Q86R 4ELYC 4ELZC 1YI2Q 1MGQA 3CCLT 2JVVA 1WFWA 4M77D 2J6KA 1JQQA 4RTYA 2MCNA 2MWOA 1UGRB 3G4SA 4L59A 4FYVB 4NL3A 1X75C 1DJ7B 4JLIA 1AEYA 3NPFA 1IO6A 2E70A 4M7AC 3SWNC 2JTEA 4AFSC 1IREB 3CCUT 1QWEA 5LJ3f 4J8OA 2DPPB 3X25B 1UHFA 4GY5A 4IIMA 4LDUA 4C8QC 4EMKB 1HXDA 2JUFA 3RBBB 2CT3A 3OS0A 3CCSQ 4R55A 2JN0A 1PHTA 1VQ6T 4F7UF 1UE9A 1YCSB 3X28B 3S3OA 4J7FA 1RLQC 3OBWA 2E6NA 1UGPB 2DXTA 3REAB 2R5MA 1KJWA 2HQHA 1KD1U 1GBQA 2K5FA 1PD0A 2FG0A 3MP6A 2V1QA 2FZCB 2ZPEB 5GAOm 3WXMB 4IUPA 3P8DA 2RA2A 1M8MA 4KBMB 3VS6A 2NUTA 4WF2A 3JCMQ 4LNPA 2F5KA 5GAOp 2EJGA 1KD1C 5CQXA 3M9QA 2JT4A 1M2OA 2ZAEA 2FHDA 4HCCA 1IGQA 4JUVA 4A54A 4FYXB 1CSKA 2HCKA 1KQ2A 3M59A 2X35A 4M75C 1PRLC 5I22A 1M1KU 5GAMe 3J7AF 3GIBA 3RKYA 4CC3A 2X9HA 4DBFA 3JCMW 1Z9ZA 1SKUB 3OW2P 1KD1R 2K79A 2RI2A 2DXUA 5LJ5d 4DQ2A 2DO3A 1T3SA 3VJPA 1M1KC 4F04B 2EYYA 5C0MA 3QXEB 2QQSA 1RAEB 2VXEA 1IXDA 2ZPBB 4ZN1A 1UFFA 2EYZA 2RI3A 5GMKl 3EFSA 4QT7A 1JEGA 1M3CA 4JRIA 4ORZA 2JJ9A 3CCJQ 3CCRQ 5LJ5h 2DVJA 1VQNQ 3BDLA 3OQ5A 4J9HA 4IUVA 1M1KR 2BTTA 4Q5WA 2KYBA 1VIEA 5CKEA 5LJ3e 1Y7XA 3ZEHA 1WJRA 3TSWA 3OYFA 2W10A 4BDZA 3LWIA 3PVQA 1GXIE 2ENMA 1SF9A 4FW1A 4Z88A 1BB9A 4OMLA 3EFOA 4OMQA 1S72Q 3GF5A 3OYEA 6AT1B 3HPWA 1TS9A 4M7DC 3EGDA 4B9XA 2MI6A 3ULRB 3JAME 2XU8A 5CKBA 2VB6A 4L6V5 4Y92A 1YJ9A 1UGVA 4HT9A 4ZGEB 3GOXA 2QTXA 4PL6A 1VQMT 3LWHA 4IKFA 3HL8A 3G71Q 4XAXB 3QZ5B 4PFZA 2RQTA 1R0BG 4PLIA 1Y07A 4PJOG 3MEAA 2OTJQ 1QVGP 4B9WA 2E3IA 4F16A 1YJWA 2DXCA 2F2XA 1WPYA 1WHHA 1GL5A 1JO8A 3FJPA 1BI1A 3M0UA 2OTLT 3UATA 3SWNB 3VS0A 3M0QA 2HL3A 3VKIA 2ZPIB 5GAN6 1UDLA 5GAN2 2KSSA 2MOXA 4M78B 1WA7A 1ZBXA 2EJFA 2JNGA 4C8QB 3FC3A 1N9SA 3HRUA 3CCEQ 2P0PA 5GAMd 3WVDB 1AWJA 1YIJA 2CP6A 4J6XA 1X2KA 1V76A 2XICA 2JTMA 2CKKA 3FJ5A 1UHCA 4M77C 4RG8A 1ZSZA 1E6HA 3M5AA 3BY7A 4ANJA 1VQPT 1IZ6A 5GAMh 4OMNA 2BZYA 2EJ9A 3NGPA 2DLPA 2ZPHB 4AG2C 2FPFA 3QDFA 2J6OA 2QI2A 2DRKA 2KRSA 5IAYA 2RNAA 3PE0A 3A98A 1B34A 1YI2A 4M78F 1WIEA 4DEYA 2FZKB 3RMSA 1X27A 4C8QF 2GTOA 2L3PA 1FYNA 2KEAA 3AHUA 3OMGA 5LJ3d 4HVWA 1TH7A 1K8AR 1N6AA
chains in the Genus database with same CATH topology
4HCKA 1K4US 3NMZC 1VYVA 2HBWA 2H8HA 1QKXA 3I35A 3JV3A 2F2WA 1HJDA 5IXBA 1ZX6A 2F2VA 2PNIA 2DX1A 4J9FA 2GNCA 1GRIA 1JXOA 2RF0A 1CKAA 4J9CA 2PTKA 1K1ZA 2D8HA 2O88A 3EHRA 4RTTA 2RQVA 1ZBJA 4LE9A 2LCSA 3EHQA 2RQWA 4Z8AA 2EBPA 2EYXA 4KRTA 1WYXA 2P4RA 2JXBA 4RUGA 3THKA 1ZUYA 4EIKA 1HSQA 3VS2A 1X2QA 2OAWA 1JXMA 1ARKA 5FWBA 2GQIA 3SHWA 4FSSA 1HD3A 2ESWA 2L2PA 2DA9A 2RPNA 4JJDA 2KYMA 1B3QA 2D0NA 2V1RA 1OPLA 2CT4A 2EW3A 1AZGB 1BK2A 1UJ0A 4LUDA 4K11A 5FW9A 2M51A 2D8JA 4AFUC 2A08A 2LMJA 3H0HA 2KGTA 4J9BA 4D8DA 1PKSA 4CC2A 1E6GA 1H3HA 2NWMA 1WX6A 2DBKA 2DL5A 4JZ4A 2YUOA 2KT1A 3PVLA 2YT6A 2FEIA 2LZ6B 5I11A 3EG2A 2RN8A 2I0NA 2SRCA 1QWFA 1K9AA 2KNBB 2O9SA 1AZEA 4DEXA 1YNZA 3UA6A 3C0CA 3I5RA 3IQLA 4JJCA 3M0SA 2K6DA 1U3OA 5GJWB 2ED0A 2ROTA 4E6RA 3UF4A 2EGEA 3M0RA 1WLPB 2RQRA 2J6FA 1NEGA 1KFZA 4RTZA 2J7IA 1U5SA 2C0OA 2EGCA 2O9VA 1H92A 2SEMA 4IIOA 1WXBA 2CREA 1GCQA 1X69A 1M27C 4F17A 1MUZA 1RUWA 2KXCA 1AOJA 5FWCA 1YWPA 2BZXA 1T0JA 1LCKA 1G2BA 2AKLA 1UUEA 2AZVA 2ED1A 5HCKA 1ABQA 2YUPA 2DL3A 2LJ1A 4OMMA 2JM9A 2LQWA 1K0SA 4D8KA 2HDAA 1KSWA 2BZ8A 2M0YA 4HXJA 2A37A 2DL7A 2K9GA 4RTXA 1ZUUA 2FPEA 3I9QA 1X43A 2OJ2A 5EC7A 1BU1A 2IIMA 2PZ1A 3SEMA 4JPBW 2FO0A 1AVZC 1T0HA 1WDXA 2L0AA 2LX7A 2J05A 1WFWA 2J6KA 1JQQA 4RTYA 1SRLA 3LH5A 2YDLA 2MCNA 3VS5A 1WI7A 1NYGA 2KE9A 4J9EA 4F14A 1W1FA 4HVUA 2RQUA 2GTJA 2YUQA 1AEYA 3NPFA 3ZL7C 1ZSGA 1IO6A 2W0ZA 1SHGA 3EG1A 1QKWA 2GBQA 2JTEA 4AFSC 1QWEA 1BBZA 3KFVA 4J9IA 1VA7A 3TVTA 2CUBA 1UHFA 2C0TA 4IIMA 1QCFA 3VS3A 2D1XA 4R0KA 3EG0A 3RBBB 2CT3A 1PKTA 1M3AA 2DBMA 3U23A 1PHTA 1J3TA 1UE9A 1YCSB 4CC7A 2C0IA 1FMKA 1RLQC 2DILA 3REAB 1KJWA 2J06A 1G83A 2CSIA 2VKNA 1GBQA 2FG0A 2V1QA 2DM1A 2A28A 1GFDA 4CC4B 2EKHA 2JW4A 2KBTA 1U06A 1AWOA 1T3LA 1M8MA 3VS6A 2EVRA 2L3QA 4LNPA 3VS1A 1PRMC 2JT4A 1I1JA 5IHKA 1M30A 1NEBA 1CSKA 1EFNA 2HCKA 1ABOA 3REBB 1Z9QA 2DMOA 1PRLC 5I22A 1OPKA 4GLMA 1JU5C 3VS4A 1NG2A 4CC3A 2ABLA 2YSQA 1XOVA 5IH2A 1Z9ZA 2JMAA 2DE0X 1I0CA 4GBQA 2K79A 1NYFA 1TG0A 1Y57A 5L23A 1VYUA 3VS7A 2G6FX 1KIKA 4RTUA 1T3SA 1NLPC 1SHFA 1Y0MA 2LP5A 2EYYA 1TUDA 1V1CA 2O31A 1UFFA 2EYZA 2CH4W 3QWYA 1X6BA 3I5SA 4QT7A 2X3WD 1JEGA 2L3SA 1M3CA 2KXDA 1M3BA 4ORZA 2LJ0A 3M0PA 2DJQA 1UECA 2DVJA 1B07A 2VWFA 2CDTA 2EQIA 4RTWA 4J9HA 2K3BA 2EYWA 2BTTA 1AWWA 2KYBA 3H41A 2KROA 4JJBA 1GFCA 2JS0A 2DL8A 1N5ZA 3TSWA 2W10A 2CUDA 3PVQA 4AG1C 2QDLA 2ENMA 1A0NB 5IHIA 4Z88A 1BB9A 2DNUA 4OMLA 4OMQA 1H8KA 2LJ3A 2O2OA 4J9DA 2K2MA 2JMCA 3M0TA 2VVKA 4ESRA 5IHNA 4LN2A 2A36A 1OOTA 2YUNA 5ECAA 3ULRB 1TUCA 1NM7A 2DL4A 2JM8A 4AFZC 1WXUA 4Z89A 2E5KA 1MV0B 4RTVA 3TSZA 4Y92A 1UGVA 3EGUA 2EPDA 2MIOA 1QLYA 1YN8A 3CQTA 3QWXX 1GBRA 2DF6A 2KR3A 4JZ3A 3EG3A 1W70A 1YWOA 2RQTA 2FRYA 2NUZA 1CKBA 1OV3A 1GCQC 4HVVA 1OEBA 2EGAA 2RMOA 4F16A 2AK5A 2F2XA 1E7OA 2KT8A 1SEMA 1GL5A 1JO8A 1I07A 1X6GA 2LQNA 3VRYA 3M0UA 1MV3A 1NLOC 2AKKA 3UATA 3VS0A 5IXFA 3M0QA 4OMPA 3O5ZA 1YP5A 1K0XA 1ZUKA 1UDLA 4ZNXA 2GGRA 2MOXA 2FRWA 2CH4A 4A63B 3R6NA 3RNJA 1WA7A 3NHNA 3H0FA 1WXTA 2KRMA 2X3XD 2ECZA 1SRMA 2KRNA 2B86A 3GBQA 1S1NA 1AWJA 2FPDA 2JS2A 2OI3A 2ROLA 1UG1A 1AD5A 1SPKA 1ZLMA 1X2KA 2HSPA 1AWXA 4LUEA 2XMFA 2DRMA 3FJ5A 1UHCA 1GCPA 1PNJA 1E6HA 1K76A 2AZSA 1RLPC 1RI9A 4AFQC 2HEQA 4M4ZA 4OMNA 2BZYA 3NGPA 2DLPA 2LNHB 3H0IA 4AG2C 2K7AA 2FPFA 2J6OA 2DRKA 2KRSA 3VRZA 2RNAA 3PE0A 4J9GA 3UA7A 2CSQA 3A98A 1UJYA 2DYBA 1WIEA 4DEYA 1X27A 1SSHA 4X1VA 2L3PA 2GTOA 1FYNA 1VYTA 1UTIA 1W6XA 2KEAA 4WCIA 5GJVB 4OMOA 4HVWA 1PWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCK A;  1K4U S;  3NMZ C;  1VYV A;  2HBW A;  2H8H A;  1QKX A;  3I35 A;  3JV3 A;  2F2W A;  1HJD A;  5IXB A;  1ZX6 A;  2F2V A;  2PNI A;  2DX1 A;  4J9F A;  2GNC A;  1GRI A;  1JXO A;  2RF0 A;  1CKA A;  4J9C A;  2PTK A;  1K1Z A;  2D8H A;  2O88 A;  3EHR A;  4RTT A;  2RQV A;  1ZBJ A;  4LE9 A;  2LCS A;  3EHQ A;  2RQW A;  4Z8A A;  2EBP A;  2EYX A;  4KRT A;  1WYX A;  2P4R A;  2JXB A;  4RUG A;  3THK A;  1ZUY A;  4EIK A;  1HSQ A;  3VS2 A;  1X2Q A;  2OAW A;  1JXM A;  1ARK A;  5FWB A;  2GQI A;  3SHW A;  4FSS A;  1HD3 A;  2ESW A;  2L2P A;  2DA9 A;  2RPN A;  4JJD A;  2KYM A;  1B3Q A;  2D0N A;  2V1R A;  1OPL A;  2CT4 A;  2EW3 A;  1AZG B;  1BK2 A;  1UJ0 A;  4LUD A;  4K11 A;  5FW9 A;  2M51 A;  2D8J A;  4AFU C;  2A08 A;  2LMJ A;  3H0H A;  2KGT A;  4J9B A;  4D8D A;  1PKS A;  4CC2 A;  1E6G A;  1H3H A;  2NWM A;  1WX6 A;  2DBK A;  2DL5 A;  4JZ4 A;  2YUO A;  2KT1 A;  3PVL A;  2YT6 A;  2FEI A;  2LZ6 B;  5I11 A;  3EG2 A;  2RN8 A;  2I0N A;  2SRC A;  1QWF A;  1K9A A;  2KNB B;  2O9S A;  1AZE A;  4DEX A;  1YNZ A;  3UA6 A;  3C0C A;  3I5R A;  3IQL A;  4JJC A;  3M0S A;  2K6D A;  1U3O A;  5GJW B;  2ED0 A;  2ROT A;  4E6R A;  3UF4 A;  2EGE A;  3M0R A;  1WLP B;  2RQR A;  2J6F A;  1NEG A;  1KFZ A;  4RTZ A;  2J7I A;  1U5S A;  2C0O A;  2EGC A;  2O9V A;  1H92 A;  2SEM A;  4IIO A;  1WXB A;  2CRE A;  1GCQ A;  1X69 A;  1M27 C;  4F17 A;  1MUZ A;  1RUW A;  2KXC A;  1AOJ A;  5FWC A;  1YWP A;  2BZX A;  1T0J A;  1LCK A;  1G2B A;  2AKL A;  1UUE A;  2AZV A;  2ED1 A;  5HCK A;  1ABQ A;  2YUP A;  2DL3 A;  2LJ1 A;  4OMM A;  2JM9 A;  2LQW A;  1K0S A;  4D8K A;  2HDA A;  1KSW A;  2BZ8 A;  2M0Y A;  4HXJ A;  2A37 A;  2DL7 A;  2K9G A;  4RTX A;  1ZUU A;  2FPE A;  3I9Q A;  1X43 A;  2OJ2 A;  5EC7 A;  1BU1 A;  2IIM A;  2PZ1 A;  3SEM A;  4JPB W;  2FO0 A;  1AVZ C;  1T0H A;  1WDX A;  2L0A A;  2LX7 A;  2J05 A;  1WFW A;  2J6K A;  1JQQ A;  4RTY A;  1SRL A;  3LH5 A;  2YDL A;  2MCN A;  3VS5 A;  1WI7 A;  1NYG A;  2KE9 A;  4J9E A;  4F14 A;  1W1F A;  4HVU A;  2RQU A;  2GTJ A;  2YUQ A;  1AEY A;  3NPF A;  3ZL7 C;  1ZSG A;  1IO6 A;  2W0Z A;  1SHG A;  3EG1 A;  1QKW A;  2GBQ A;  2JTE A;  4AFS C;  1QWE A;  1BBZ A;  3KFV A;  4J9I A;  1VA7 A;  3TVT A;  2CUB A;  1UHF A;  2C0T A;  4IIM A;  1QCF A;  3VS3 A;  2D1X A;  4R0K A;  3EG0 A;  3RBB B;  2CT3 A;  1PKT A;  1M3A A;  2DBM A;  3U23 A;  1PHT A;  1J3T A;  1UE9 A;  1YCS B;  4CC7 A;  2C0I A;  1FMK A;  1RLQ C;  2DIL A;  3REA B;  1KJW A;  2J06 A;  1G83 A;  2CSI A;  2VKN A;  1GBQ A;  2FG0 A;  2V1Q A;  2DM1 A;  2A28 A;  1GFD A;  4CC4 B;  2EKH A;  2JW4 A;  2KBT A;  1U06 A;  1AWO A;  1T3L A;  1M8M A;  3VS6 A;  2EVR A;  2L3Q A;  4LNP A;  3VS1 A;  1PRM C;  2JT4 A;  1I1J A;  5IHK A;  1M30 A;  1NEB A;  1CSK A;  1EFN A;  2HCK A;  1ABO A;  3REB B;  1Z9Q A;  2DMO A;  1PRL C;  5I22 A;  1OPK A;  4GLM A;  1JU5 C;  3VS4 A;  1NG2 A;  4CC3 A;  2ABL A;  2YSQ A;  1XOV A;  5IH2 A;  1Z9Z A;  2JMA A;  2DE0 X;  1I0C A;  4GBQ A;  2K79 A;  1NYF A;  1TG0 A;  1Y57 A;  5L23 A;  1VYU A;  3VS7 A;  2G6F X;  1KIK A;  4RTU A;  1T3S A;  1NLP C;  1SHF A;  1Y0M A;  2LP5 A;  2EYY A;  1TUD A;  1V1C A;  2O31 A;  1UFF A;  2EYZ A;  2CH4 W;  3QWY A;  1X6B A;  3I5S A;  4QT7 A;  2X3W D;  1JEG A;  2L3S A;  1M3C A;  2KXD A;  1M3B A;  4ORZ A;  2LJ0 A;  3M0P A;  2DJQ A;  1UEC A;  2DVJ A;  1B07 A;  2VWF A;  2CDT A;  2EQI A;  4RTW A;  4J9H A;  2K3B A;  2EYW A;  2BTT A;  1AWW A;  2KYB A;  3H41 A;  2KRO A;  4JJB A;  1GFC A;  2JS0 A;  2DL8 A;  1N5Z A;  3TSW A;  2W10 A;  2CUD A;  3PVQ A;  4AG1 C;  2QDL A;  2ENM A;  1A0N B;  5IHI A;  4Z88 A;  1BB9 A;  2DNU A;  4OML A;  4OMQ A;  1H8K A;  2LJ3 A;  2O2O A;  4J9D A;  2K2M A;  2JMC A;  3M0T A;  2VVK A;  4ESR A;  5IHN A;  4LN2 A;  2A36 A;  1OOT A;  2YUN A;  5ECA A;  3ULR B;  1TUC A;  1NM7 A;  2DL4 A;  2JM8 A;  4AFZ C;  1WXU A;  4Z89 A;  2E5K A;  1MV0 B;  4RTV A;  3TSZ A;  4Y92 A;  1UGV A;  3EGU A;  2EPD A;  2MIO A;  1QLY A;  1YN8 A;  3CQT A;  3QWX X;  1GBR A;  2DF6 A;  2KR3 A;  4JZ3 A;  3EG3 A;  1W70 A;  1YWO A;  2RQT A;  2FRY A;  2NUZ A;  1CKB A;  1OV3 A;  1GCQ C;  4HVV A;  1OEB A;  2EGA A;  2RMO A;  4F16 A;  2AK5 A;  2F2X A;  1E7O A;  2KT8 A;  1SEM A;  1GL5 A;  1JO8 A;  1I07 A;  1X6G A;  2LQN A;  3VRY A;  3M0U A;  1MV3 A;  1NLO C;  2AKK A;  3UAT A;  3VS0 A;  5IXF A;  3M0Q A;  4OMP A;  3O5Z A;  1YP5 A;  1K0X A;  1ZUK A;  1UDL A;  4ZNX A;  2GGR A;  2MOX A;  2FRW A;  2CH4 A;  4A63 B;  3R6N A;  3RNJ A;  1WA7 A;  3NHN A;  3H0F A;  1WXT A;  2KRM A;  2X3X D;  2ECZ A;  1SRM A;  2KRN A;  2B86 A;  3GBQ A;  1S1N A;  1AWJ A;  2FPD A;  2JS2 A;  2OI3 A;  2ROL A;  1UG1 A;  1AD5 A;  1SPK A;  1ZLM A;  1X2K A;  2HSP A;  1AWX A;  4LUE A;  2XMF A;  2DRM A;  3FJ5 A;  1UHC A;  1GCP A;  1PNJ A;  1E6H A;  1K76 A;  2AZS A;  1RLP C;  1RI9 A;  4AFQ C;  2HEQ A;  4M4Z A;  4OMN A;  2BZY A;  3NGP A;  2DLP A;  2LNH B;  3H0I A;  4AG2 C;  2K7A A;  2FPF A;  2J6O A;  2DRK A;  2KRS A;  3VRZ A;  2RNA A;  3PE0 A;  4J9G A;  3UA7 A;  2CSQ A;  3A98 A;  1UJY A;  2DYB A;  1WIE A;  4DEY A;  1X27 A;  1SSH A;  4X1V A;  2L3P A;  2GTO A;  1FYN A;  1VYT A;  1UTI A;  1W6X A;  2KEA A;  4WCI A;  5GJV B;  4OMO A;  4HVW A;  1PWT A; 
#chains in the Genus database with same CATH topology
 4BB7 A;  3CPW P;  3RMQ A;  1JJ2 S;  4C92 B;  4BI3 A;  2VGN A;  1VYV A;  4M7A G;  1C1A A;  3I35 A;  1D1C A;  3OB9 A;  1FXX A;  1YHQ T;  2E1H A;  5IXB A;  1ZX6 A;  2F2V A;  5LJ3 h;  4J9F A;  4C8Q G;  1GRI A;  3CCS A;  2RF0 A;  1CKA A;  4J9C A;  1K73 U;  1M1F A;  2EWN A;  2LCS A;  3EHQ A;  4KRT A;  2LRQ A;  2YWW A;  3QO3 A;  3CCV A;  2P4R A;  4EIK A;  2XHC A;  1YJN A;  1K73 C;  1ARK A;  2PUK B;  3RDV A;  2YRV A;  5KCH A;  2L2P A;  7AT1 B;  4PKC C;  2V1R A;  3LX7 A;  5M9O A;  3QII A;  4C92 F;  3ER0 A;  3PMT A;  5KYY A;  2CT4 A;  3E9G A;  1MMG A;  1UJ0 A;  1BK2 A;  4LUD A;  3GPL A;  4K11 A;  1Q7Y U;  4II1 A;  3FDR A;  4M7D B;  2LMJ A;  3H0H A;  1K73 R;  3A8H B;  1M8V A;  2X4J A;  4M75 G;  3LYI A;  4JZ4 A;  3BFM A;  2YUO A;  3PVL A;  1WHK A;  4UC4 A;  1Q7Y C;  2RN8 A;  1VQ9 A;  2RK1 A;  1IRX A;  1QWF A;  2KNB B;  2YRC A;  4FT2 A;  4C92 G;  5GAN g;  4XTU A;  2E6Z A;  4JLG A;  1M1G A;  3PTA A;  3M0S A;  1G8X A;  1U3O A;  5GJW B;  2ED0 A;  2RJE A;  2ROT A;  4E6R A;  4D6W A;  1MHN A;  3WVE B;  1WLP B;  4FYY B;  3CCJ A;  2MAM A;  4HA8 A;  1VQ4 Q;  1O75 A;  2M16 A;  1WJS A;  4XU0 A;  2SEM A;  3CMA Q;  5CAI A;  1WGS A;  3JCM d;  4M7D F;  1MUZ A;  4OGE A;  4DA4 A;  2XDB A;  1N8R U;  2BZX A;  1T0J A;  5D6Y A;  3QHS A;  4EMK C;  5LL6 S;  5AT1 B;  4OB3 B;  1JBM A;  3I55 T;  2YUP A;  2DL3 A;  2LJ1 A;  1FMV A;  1K0S A;  2RB6 A;  4RKU E;  3HRS A;  1NPR A;  2HDA A;  3JB9 D;  1N8R C;  2A37 A;  4RTX A;  3M57 A;  1ZUU A;  2FPE A;  1M2V B;  2AT1 B;  4M7D G;  1BU1 A;  2PZ1 A;  1AVZ C;  2QTV A;  1ZA2 B;  5GMK m;  4M77 B;  2LX7 A;  2J05 A;  2COZ A;  3MKD A;  1VQL A;  4C0F A;  1SRL A;  3VS5 A;  4N0A A;  4A4F A;  1WI7 A;  1NYG A;  2KE9 A;  4F14 A;  1W1F A;  4A4K A;  4XTX A;  1N8R R;  4LDX A;  2QYZ A;  3C12 A;  2CZ7 B;  2EFI A;  3Q1J A;  3EG1 A;  1QKW A;  2GBQ A;  3I56 A;  3JCM X;  4ZN3 A;  3G71 A;  3TVT A;  4LD9 K;  2CYZ B;  1NJI R;  3VS3 A;  2Y4X A;  4LXC A;  1QQJ A;  1IHV A;  1C0M A;  4DBH A;  3EG0 A;  1BCM A;  4QVC A;  1BYM A;  3P8B B;  3QJY A;  1YJ9 Q;  2GQV A;  3MPU B;  2NLU A;  4CC7 A;  1FMK A;  1JRI A;  2DIL A;  3MCA B;  1RAA B;  2J06 A;  3C4S A;  1G83 A;  2CSI A;  2COY A;  2QA4 A;  3QKJ A;  2DM1 A;  2QXF A;  4M77 F;  2M9U A;  1GFD A;  2KBT A;  2LCC A;  1D0Y A;  5GMK h;  1YJW Q;  1N27 A;  4B6M A;  4M7A E;  2EVR A;  3QZ9 B;  5D6X A;  5KYU A;  2PVD B;  4JS4 A;  3DLM A;  3CD6 T;  3DB4 A;  5IHK A;  4XU3 A;  3CC7 T;  5KYW A;  1WHM A;  3GNF B;  4JJN K;  3S3N A;  3CME Q;  4QQ6 A;  2DMO A;  4GLM A;  3FEO A;  4M77 G;  3L2Q A;  3VS4 A;  1NG2 A;  4FW2 A;  3OBY A;  2ABL A;  2YSQ A;  2ZPF B;  5IH2 A;  4GBQ A;  3CCR T;  1I0C A;  1VQN T;  2K5L A;  1NYF A;  1TG0 A;  4E7Z A;  1VYU A;  1KIK A;  1ZSZ B;  2MMP A;  4AMC A;  1NLP C;  1SHF A;  4MMK A;  2LP5 A;  1Q81 R;  3RES A;  1YIT A;  2YHT A;  2E41 A;  2ZCF B;  5GAO n;  2L3S A;  1M3B A;  1KK7 A;  1BIA A;  4QW2 A;  1S72 T;  1OZ2 A;  4XTY A;  2VWF A;  4EMG A;  5I2S A;  2EQI A;  1EIF A;  4RTW A;  4M75 E;  4XQ3 A;  4OP0 A;  5CCA A;  2M0O A;  1VQK A;  2QQB A;  3OYC A;  4AG1 C;  2QDL A;  2BIV A;  1RAI B;  4ATO A;  4C0D B;  2DNU A;  2DER A;  2XK0 A;  3M53 A;  2LNV A;  2YLC A;  2RH2 A;  1H8K A;  2LJ3 A;  4RMO A;  4J9D A;  4M75 A;  5GAN f;  2K2V A;  2QAZ A;  2XD0 A;  3UDC A;  2K2M A;  2R58 A;  1VQ8 A;  2X4X A;  2VVK A;  1JJ2 A;  4RG2 A;  2M02 A;  3FRN A;  1TUC A;  2OTJ T;  4M78 C;  1WXU A;  5HK3 A;  1HYO A;  2EPD A;  4J5Y A;  3A8G B;  1QLY A;  3QWX X;  1LPL A;  3JCM c;  4JZ3 A;  3L2V A;  3PT9 A;  3CCV Q;  4HKE A;  2FRY A;  5KYY B;  2NUZ A;  3OS1 A;  1OV3 A;  3JB9 I;  2EAY A;  3CXC A;  1YJN Q;  3PNW C;  2EIF A;  3V7S A;  1QP2 A;  2QDY B;  2DEU A;  1XJW B;  3M4Y A;  3CCE T;  1QCO A;  2HKQ B;  1E7O A;  1SEM A;  1W2B P;  4XTW A;  4QKU A;  4F7U G;  1IB8 A;  1MMN A;  1I4K 1;  1G3W A;  1I5O B;  4Y28 E;  4PLL A;  4OMP A;  1K0X A;  2VGM A;  2QAS A;  2CZ6 B;  3R6N A;  3DKM A;  3NHN A;  2VYT A;  3OYA A;  2DIQ A;  1YBY A;  1VQ4 A;  1Y96 A;  2X3X D;  1SSF A;  4BUG A;  1SRM A;  2LDM A;  1VQ9 Q;  3AT1 B;  4C92 C;  3CMA A;  2JS2 A;  1YFN A;  1ZLM A;  4BY6 C;  3QG1 A;  2MPX C;  1QVF P;  1F1B B;  2O4X A;  8AT1 B;  1GCP A;  3SFM A;  2CS7 A;  2AZS A;  1RLP C;  1I8F A;  3S6W A;  4AFQ C;  1R77 A;  3VYG A;  4OB1 B;  2HEQ A;  2E3H A;  5GAN e;  1TWB A;  2E12 A;  2HBP A;  1PG5 B;  3EGX A;  1D09 B;  1QP3 A;  2HNI A;  3UA7 A;  4OVA A;  5CKH A;  1UJY A;  2K3Y A;  1HK9 A;  4LDV A;  4V2S A;  1SSH A;  3HKS A;  3MEU A;  1PCX A;  4WCI A;  1KQS P;  1UTI A;  3JCM f;  3M54 A;  4OMO A;  1D1A A;  2XDD A;  4A53 A;  5HKC A;  3G4S T;  4HCK A;  4NS5 A;  3G6E Q;  2YRD A;  3NMZ C;  1N9R A;  2HBW A;  2H8H A;  2EQU A;  4PJN A;  2LC4 A;  2BE9 B;  2LT4 A;  3MO8 A;  2RHZ A;  2DD5 A;  4L5G A;  2WSE E;  2DX1 A;  3LLR A;  3CPF A;  1VQL Q;  4KT0 E;  1K1Z A;  3CCM A;  1BI0 A;  2D8H A;  2CZ1 B;  2G3R A;  2XID A;  3MP8 A;  3L2Z A;  2RQV A;  4Y91 A;  4IUR A;  2RQW A;  4Z8A A;  1EZZ B;  1WYX A;  3I56 Q;  2KI7 A;  2JXB A;  4RUG A;  1ZUY A;  1X2Q A;  2ZPG B;  2OAW A;  4BDY A;  1JXM A;  2VC8 A;  3HHT B;  2L89 A;  2DK3 A;  3QBY A;  4E7H A;  5CQY A;  5D6W A;  1I5L A;  3MHX A;  2RPN A;  4PK4 A;  3V7C A;  2D0N A;  4NOY A;  1PSE A;  4N4I A;  3A5Z B;  4OB0 B;  1VQO A;  2E64 A;  2A08 A;  5KYU B;  3OW2 A;  3CME A;  1PSF A;  2QA4 Q;  4J9B A;  4D8D A;  1PKS A;  4CC2 A;  5LJ5 g;  3KBG A;  2DL5 A;  2KT1 A;  2LZ6 B;  3D7S B;  1VQ4 T;  3OYK A;  1OU9 A;  2JZ2 A;  3CC2 A;  3HFN A;  1K9A A;  2O9S A;  3EAE A;  1AZE A;  3CCQ A;  3QPH A;  4ZTF A;  1M90 U;  2HAX A;  3UA6 A;  3OYL A;  3JCM P;  5LJ5 j;  3BDU A;  3JSC A;  3SB2 A;  1P92 A;  3CBM A;  3M0R A;  1MND A;  3JCM e;  1M90 C;  1D0X A;  2ZZD A;  2PUO B;  1U5S A;  2C0O A;  1EX4 A;  2LCL A;  3KXT A;  4R56 A;  4FT4 A;  1WHG A;  5C6S A;  2CRE A;  1GCQ A;  1X69 A;  3HTR A;  1RUW A;  2KXC A;  1AOJ A;  5FWC A;  1YWP A;  4RCB A;  2F1L A;  1KQ1 A;  3VUB A;  5GAN d;  1YIT Q;  1G2B A;  2AKL A;  1AT1 B;  1UUE A;  2ED1 A;  1M90 R;  1ABQ A;  2QEX A;  2F5T X;  2JM9 A;  4D8K A;  3LGL A;  1KSW A;  4VUB A;  5A0L A;  4HXJ A;  2K9G A;  5CK9 A;  1G3S A;  3I9Q A;  3JRZ A;  1SG5 A;  1RAF B;  4BY6 B;  2IIM A;  2M1H A;  5GAN h;  4JPB W;  2EQJ A;  4MML A;  1VQK Q;  2R57 A;  1QMC A;  1T0H A;  1WDX A;  2X4W A;  4M78 G;  2FZG B;  2CP5 A;  4HVU A;  2BUD A;  4PJL A;  1YJ9 T;  3RER A;  2GTJ A;  4LDW A;  4WTO B;  4HT8 A;  1ZSG A;  5FU7 C;  1QVG A;  2W0Z A;  2RHI A;  1BIB A;  3A8L B;  3CXC S;  1VQ8 Q;  4E7K A;  1BBZ A;  4J9I A;  2CUB A;  1PC0 A;  2C0T A;  5GMK e;  3OYB A;  2D1X A;  3QDR B;  1YJW T;  1PKT A;  3JB9 F;  1RAH B;  3OMC A;  4C5E A;  4AT1 B;  1J3T A;  4JS5 A;  1ZSZ C;  4EMK A;  3PIP A;  4E7S A;  3H6Z A;  3HFO A;  2NUT B;  2PVO B;  3NTI A;  4MZP A;  5GAM g;  2A28 A;  4DBR A;  4EDU A;  4CC4 B;  3UPU A;  1U06 A;  2RD1 A;  2MF2 A;  1WNL A;  1T3L A;  2P84 A;  4A4G A;  1FMW A;  5DLO A;  3JB9 G;  1TOV A;  2ATC B;  4JRP A;  3NTK A;  1I1J A;  1G3Y A;  2QG9 B;  1YIJ T;  5GAO r;  5KCO A;  2RK2 A;  1NPP A;  1RI0 A;  4FYW B;  1NEB A;  2WSC E;  1EFN A;  4M7A D;  2HMA A;  3EH1 A;  2QGG A;  5GAM j;  1ABO A;  2DFU A;  3REB B;  3RUX A;  1JU5 C;  1D3B A;  2LQ8 A;  4C0D C;  1Q7Y R;  5IT9 E;  2JMA A;  4XU1 A;  2FYK A;  1OI1 A;  1PM3 A;  1Y57 A;  5L23 A;  2E65 A;  2G6F X;  3NTH A;  3OYY A;  3LH0 A;  2PQW A;  2LT1 A;  4PJO E;  1Y0M A;  3RR6 A;  5LJ3 g;  1TUD A;  1IHW A;  1V1C A;  1MMD A;  1NBE B;  1XTD A;  3CC4 A;  2QQ9 A;  3O8V A;  3CPW A;  1YI2 T;  4PFO A;  3VUZ A;  3QWY A;  1X6B A;  3HP9 A;  3I5S A;  4FCY A;  1QCN A;  5GAN 7;  3QSU A;  2FB7 A;  2EKO A;  2JOY A;  2LJ0 A;  1UEC A;  1H64 1;  4PJM A;  5A0D A;  3G6E A;  3TEE A;  3S3M A;  4PJO A;  3JCM h;  2K3B A;  2EYW A;  2R5A A;  5LJ3 j;  1AHJ B;  1AWW A;  4JRK A;  4MZT A;  4X9D A;  3H41 A;  2KRO A;  3G1J A;  1GFC A;  3EFO B;  3OSS C;  2DL8 A;  3C95 A;  4M75 D;  3EGD B;  2EQK A;  1VQ7 A;  1VQ5 A;  3CCS T;  4ZGD B;  2PVG B;  3GLX A;  1VQP Q;  1M9S A;  5CKF A;  1TU0 B;  2Y4Y A;  1B7T A;  1RAD B;  1D1B A;  3CCV T;  4ESR A;  5IHN A;  2A36 A;  5ECA A;  2YUN A;  5D7U A;  4C5I A;  1YJN T;  1NM7 A;  2JM8 A;  3CCL A;  5CO7 A;  4Z89 A;  2E5K A;  2RHX A;  2KVQ G;  1O9S A;  3TSZ A;  3EGU A;  3ZFJ A;  3CCM Q;  2MIO A;  1GBR A;  2DF6 A;  4P5N A;  2KR3 A;  3OW2 S;  2FL7 A;  3CCU A;  5AYF A;  4BI8 B;  1KHC A;  1W70 A;  1YWO A;  4KGX B;  1R0C B;  2CP7 A;  1CKB A;  1YHQ Q;  2LVM A;  4HVV A;  1OEB A;  1BKB A;  2EGA A;  2AK5 A;  4XTZ A;  1JJ2 P;  2DKG A;  3MET A;  3OYN A;  2JTF A;  1VQ9 T;  2D9T A;  2HQX A;  1I07 A;  2WSF E;  1X6G A;  2DZ9 A;  5FU7 B;  3VRY A;  2QK0 A;  1NLO C;  1VQO Q;  3UT1 A;  4C8Q E;  3GP8 A;  3O5Z A;  1YP5 A;  1ZUK A;  4ZNX A;  2DXB A;  2CH4 A;  2KK4 A;  2DZC A;  3T9N A;  3OS2 A;  4M7A A;  3SWN A;  2O01 E;  4OF1 A;  3CCJ T;  4KGZ B;  2ECZ A;  1LVK A;  3QUI A;  3CC2 Q;  2E5Q A;  1S1N A;  2FPD A;  2WAC A;  3MP1 A;  3CCQ Q;  4J6W A;  4C8Q A;  1AD5 A;  1SPK A;  2MYS A;  4JDS A;  1AWX A;  3OSV A;  4LUE A;  3URG A;  2XMF A;  4J7I A;  1TXQ A;  1K76 A;  2NUP A;  2XI9 A;  1ZQ1 A;  1B34 B;  4E7J A;  2LNH B;  1RAC B;  2DTI A;  4OGC A;  1BI3 A;  4E7L A;  3N5B B;  2BE7 D;  2RI5 A;  2KAF A;  1Q86 C;  2DYB A;  3CBP A;  3E1S A;  4X1V A;  2B8A A;  1W6X A;  4C92 E;  3PFS A;  1VQL T;  5DM7 R;  2QEX Q;  1QVG S;  3ASK A;  3RIR A;  1K4U S;  1KG1 A;  2DTH A;  3I56 T;  1Q95 G;  1QKX A;  3G71 T;  1FX7 A;  4HCZ A;  3A8O B;  3M4G A;  3JV3 A;  1R8O B;  4IUU A;  2XKO C;  4C92 A;  2PNI A;  2DYI A;  3I55 Q;  5L8R E;  1JXO A;  1UEB A;  2PTK A;  3OYM A;  3L42 A;  3J81 E;  3EG9 A;  3E9F A;  2O88 A;  1ACM B;  2GFU A;  2H3E B;  3EHR A;  3LGF A;  1ZBJ A;  1X01 A;  4LE9 A;  5CIU A;  1V29 B;  1RAG B;  5GMK j;  3JB9 H;  3THK A;  1HSQ A;  2QA4 T;  4RCC A;  2C06 A;  5FWB A;  4ZGJ B;  2GQI A;  3SHW A;  1HD3 A;  2DA9 A;  2KYM A;  1B3Q A;  1MNE A;  2F69 A;  2DET A;  4M7D E;  4TVR A;  4O6J A;  1OPL A;  4OB2 B;  4DOW A;  2EW3 A;  2KQW A;  1VQM A;  2M51 A;  5FU6 C;  3TU4 K;  1KHI A;  1FWZ A;  2DAQ A;  1IGU A;  2KGT A;  3OY9 A;  4CI0 C;  1YCY A;  2NWM A;  2DBK A;  1WQ7 A;  5KE3 A;  2YT6 A;  2DIG A;  4M7D A;  5CR2 A;  5I11 A;  2I0N A;  3SD4 A;  1TSF A;  3VU3 C;  4DEX A;  1D3B B;  1YNZ A;  2OTL A;  5GAN 3;  3CPW S;  4FSX A;  4MZM A;  3C0C A;  3I5R A;  2KDS A;  4X34 A;  3DLL A;  2K6D A;  1YIT T;  2V8K A;  2VUB A;  4XU2 A;  2EGE A;  2RQR A;  1BCO A;  4C0Z A;  2RHU A;  2J7I A;  2L5Q A;  2L8D A;  2O9V A;  3G7Z A;  3CD6 Q;  5GAN 8;  4BD3 A;  2HD0 A;  4F17 A;  3CC7 Q;  4MDW A;  5FRN A;  2QQR A;  4PJO B;  2BKD N;  1VQK T;  2RO0 A;  3LW5 E;  3CC4 Q;  1LCK A;  4BE1 A;  2VAS A;  3FB9 A;  1MMA A;  2LQW A;  3M55 A;  1VQP A;  5KYN A;  4XK8 E;  3L2R A;  5DLQ E;  2BZ8 A;  2M0Y A;  2DL7 A;  2COW A;  2XG8 D;  1I81 A;  1VQ8 T;  4M77 E;  2OJ2 A;  4FU6 A;  3TCJ A;  5KH6 A;  2MK5 A;  2K3X A;  4C5H A;  2FO0 A;  2L0A A;  2CGH A;  1NZ9 A;  4EPC A;  1M2V A;  2KMT A;  3LH5 A;  2YDL A;  1VQ7 Q;  3L2U A;  1VQ5 Q;  4J9E A;  2P0Q A;  2RQU A;  2DEQ A;  2QGF B;  2YUQ A;  3TQ7 P;  3RKX A;  1OUL A;  3ZL7 C;  5FRM A;  4E47 A;  1OYX A;  3QYH B;  3OYJ A;  3OYH A;  1SHG A;  1XQH A;  4M77 A;  1QW1 A;  2QQA A;  1LOJ A;  4FIB A;  3KFV A;  1VIF A;  1VA7 A;  4PJO F;  1W2B A;  3JCM J;  2DJZ A;  5A0G A;  1YHQ A;  1OX9 A;  1QCF A;  3CBO A;  4R0K A;  3CCL Q;  5GAO q;  2FVU A;  3PGG A;  1M3A A;  2DBM A;  2IVW A;  3U23 A;  2XDP A;  3UWN A;  4DOV A;  2OX7 A;  5KYX A;  4E2F B;  2RJF A;  2C0I A;  4DBQ A;  1WHJ A;  2IPO B;  3TRE A;  3CCU Q;  2VKN A;  2HQE A;  1OQK A;  4KH1 B;  3P8H A;  5HK0 A;  3OYD A;  3CEY A;  2EKH A;  2JW4 A;  4N4H A;  3KUF A;  5KYW B;  5I21 A;  1AWO A;  1QVF A;  2L3Q A;  1VQ6 Q;  3VS1 A;  1ZA1 B;  1Q82 U;  3FIF A;  1PRM C;  3CMA T;  3V8K A;  4M7A B;  1M30 A;  1K9M U;  4GLK A;  4BI4 A;  3DB3 A;  2CP0 A;  1Z9Q A;  1U1T A;  2LX9 A;  2HSE B;  1OPK A;  2ZGW A;  1Q82 C;  4PFP A;  1XOV A;  3QYG B;  1W4S A;  2DE0 X;  1K9M C;  2GFA A;  3V8J A;  2A3L A;  1KC8 U;  3VS7 A;  4XTV A;  4EMH A;  4KH0 B;  4RTU A;  1KQS A;  5FU6 B;  1K8A U;  4YTL A;  1TUG B;  2NUP B;  3QJ6 A;  2VXF A;  3MEV A;  2E10 A;  2V26 A;  2O31 A;  4LD6 A;  2CH4 W;  2NYS A;  1Q82 R;  4PJO D;  2X3W D;  1KC8 C;  4F7U E;  1OX8 A;  2KXD A;  1K9M R;  3M0P A;  2DJQ A;  2I2L A;  1K8A C;  4C5G A;  1B07 A;  2HZY A;  2CDT A;  1UGQ B;  4M7A F;  4LDY A;  4C0G A;  3E19 A;  4JJB A;  2JS0 A;  1N5Z A;  1PD1 A;  1ZHI A;  2CUD A;  2V8I A;  5J39 A;  4M75 B;  1KC8 R;  4F7U A;  1WQW A;  2KY9 A;  4A4E A;  2HKN A;  3I55 A;  5EG2 A;  5IHI A;  2Z0W A;  2LTO A;  1A0N B;  3CCM T;  5FLX E;  1G3T A;  1WZO A;  2X51 A;  9ATC B;  2O2O A;  2DD4 A;  3VV0 A;  2RHY A;  4QVD A;  2H3J A;  2JMC A;  3M0T A;  1VOM A;  3EG9 B;  4LN2 A;  1OOT A;  4O5V A;  5GAN 5;  2DL4 A;  4AFZ C;  5GAO l;  1MV0 B;  4RTV A;  3G4S Q;  2P4T A;  1X6O A;  1YN8 A;  3CQT A;  2CZ0 B;  2DTO A;  3PIO A;  2D0Q B;  2RM4 A;  2GCX A;  4ZTJ A;  4PJJ A;  2VV5 A;  1VQO T;  2CP3 A;  3EG3 A;  3OYI A;  3ZBD A;  4X9C A;  3CME T;  4FL6 A;  4CRI A;  4M75 F;  4Z02 A;  1GCQ C;  2RMO A;  5DY9 A;  2KT8 A;  3CC2 T;  3OYG A;  1C6V X;  4JRQ A;  3CCQ T;  2LQN A;  3J80 E;  1BI2 A;  1MV3 A;  2AKK A;  3C94 A;  1VQM Q;  1Y71 A;  5IXF A;  1QVP A;  4J83 A;  4N4G A;  1Y96 B;  2EQM A;  2GGR A;  5HY6 A;  2FRW A;  3NFC A;  4A63 B;  3RNJ A;  5CVI A;  4A4H A;  1WHL A;  4M78 D;  4QVZ A;  4C8Q D;  3H0F A;  1WXT A;  4KGV B;  3V7R A;  2KRM A;  3EH2 A;  2O4X B;  2KRN A;  3CD6 A;  2B86 A;  5A2Q E;  3GBQ A;  2OI3 A;  1WJQ A;  2ROL A;  3SDZ A;  3CC7 A;  1UG1 A;  2A0F B;  2OTL Q;  2HSP A;  5IN1 A;  2E4H A;  2DRM A;  1PNJ A;  1TTH B;  3EGX B;  4BAC A;  2QEX T;  1U1S A;  3CCR A;  1RI9 A;  4QQD A;  1VQN A;  5GAN j;  4M4Z A;  1U8R A;  1M4Z A;  3E2U A;  3MEW A;  3JB9 J;  3H0I A;  2K7A A;  3L2W A;  4KUI A;  3JCM V;  3VRZ A;  3HSB A;  4J9G A;  3H9N A;  2CSQ A;  2Y90 A;  3L1A A;  3BE3 A;  5LJ5 f;  2HL5 C;  1VYT A;  5GJV B;  3M58 A;  2AHJ B;  1PWT A;  1S72 A;  5J26 A;  1NJI U;  4MDX A;  2PU9 B;  4C92 D;  1W2B S;  3PMI A;  2YLB A;  3F70 A;  3X20 B;  2CP2 A;  3H8Z A;  5CKD A;  4IUQ A;  4FM4 B;  2F2W A;  1HJD A;  5GAN 4;  1NJI C;  1NE8 A;  1XNI A;  2GNC A;  2P0K A;  5FRO A;  4E7I A;  3R6O A;  4RTT A;  4IUT A;  2EBP A;  2EYX A;  8ATC B;  2L3R A;  3MJX A;  3VS2 A;  5KYX B;  2OTJ A;  1QVF S;  2RJC A;  1RL2 A;  3EFR A;  4FSS A;  5KE2 A;  2ESW A;  3GNG A;  4BE2 A;  4JJD A;  1VQ6 A;  3FLG A;  2K5I A;  1AZG B;  3ME9 A;  5FW9 A;  2D8J A;  4AFU C;  4M78 E;  1LJO A;  2LQK A;  4M7D D;  2EYQ A;  4PJO C;  1E6G A;  1H3H A;  4BE0 A;  1WX6 A;  1Q81 U;  3JCM g;  3OS5 A;  2YXY A;  2FEI A;  2K57 A;  3CCE A;  3EG2 A;  1KQS S;  2SRC A;  4HCB A;  1JB0 E;  2D6F A;  3CXC P;  3A1P A;  3RKW A;  4M78 A;  1D0Z A;  4KUD K;  3IQL A;  4JJC A;  4N0A C;  1Q81 C;  5I2M A;  3CC4 T;  2MWP A;  5GMK i;  2K4Y A;  3OA6 A;  5LJ5 e;  3UF4 A;  2AIR B;  1OU8 A;  2J6F A;  1NEG A;  1Q86 U;  1KFZ A;  1UB4 A;  2DVE A;  4RTZ A;  1H3Z A;  1LNX A;  2EGC A;  1UGS B;  3G6E T;  1VUB A;  3HRT A;  1H92 A;  3BW1 A;  4PNO A;  4IIO A;  4OMF B;  1WXB A;  1YIJ Q;  2GF7 A;  1M27 C;  3INZ A;  3JCM b;  5J3B A;  2X4Y A;  1G5V A;  5GAM f;  3X26 B;  2OAU A;  2AZV A;  3V8L A;  5HCK A;  1VQ7 T;  1VQ5 T;  4OMM A;  1RAB B;  2V8J A;  2A7Y A;  4J6Y A;  4NL2 A;  1OZ3 A;  4F7U B;  3A8M B;  2RJD A;  3VYH B;  2IG0 A;  1M5Q 1;  1X43 A;  4KUL A;  3X24 B;  3M56 A;  4QQG A;  5EC7 A;  3SEM A;  4ME7 A;  1Q86 R;  4ELY C;  4ELZ C;  1YI2 Q;  1MGQ A;  3CCL T;  2JVV A;  1WFW A;  4M77 D;  2J6K A;  1JQQ A;  4RTY A;  2MCN A;  2MWO A;  1UGR B;  3G4S A;  4L59 A;  4FYV B;  4NL3 A;  1X75 C;  1DJ7 B;  4JLI A;  1AEY A;  3NPF A;  1IO6 A;  2E70 A;  4M7A C;  3SWN C;  2JTE A;  4AFS C;  1IRE B;  3CCU T;  1QWE A;  5LJ3 f;  4J8O A;  2DPP B;  3X25 B;  1UHF A;  4GY5 A;  4IIM A;  4LDU A;  4C8Q C;  4EMK B;  1HXD A;  2JUF A;  3RBB B;  2CT3 A;  3OS0 A;  3CCS Q;  4R55 A;  2JN0 A;  1PHT A;  1VQ6 T;  4F7U F;  1UE9 A;  1YCS B;  3X28 B;  3S3O A;  4J7F A;  1RLQ C;  3OBW A;  2E6N A;  1UGP B;  2DXT A;  3REA B;  2R5M A;  1KJW A;  2HQH A;  1KD1 U;  1GBQ A;  2K5F A;  1PD0 A;  2FG0 A;  3MP6 A;  2V1Q A;  2FZC B;  2ZPE B;  5GAO m;  3WXM B;  4IUP A;  3P8D A;  2RA2 A;  1M8M A;  4KBM B;  3VS6 A;  2NUT A;  4WF2 A;  3JCM Q;  4LNP A;  2F5K A;  5GAO p;  2EJG A;  1KD1 C;  5CQX A;  3M9Q A;  2JT4 A;  1M2O A;  2ZAE A;  2FHD A;  4HCC A;  1IGQ A;  4JUV A;  4A54 A;  4FYX B;  1CSK A;  2HCK A;  1KQ2 A;  3M59 A;  2X35 A;  4M75 C;  1PRL C;  5I22 A;  1M1K U;  5GAM e;  3J7A F;  3GIB A;  3RKY A;  4CC3 A;  2X9H A;  4DBF A;  3JCM W;  1Z9Z A;  1SKU B;  3OW2 P;  1KD1 R;  2K79 A;  2RI2 A;  2DXU A;  5LJ5 d;  4DQ2 A;  2DO3 A;  1T3S A;  3VJP A;  1M1K C;  4F04 B;  2EYY A;  5C0M A;  3QXE B;  2QQS A;  1RAE B;  2VXE A;  1IXD A;  2ZPB B;  4ZN1 A;  1UFF A;  2EYZ A;  2RI3 A;  5GMK l;  3EFS A;  4QT7 A;  1JEG A;  1M3C A;  4JRI A;  4ORZ A;  2JJ9 A;  3CCJ Q;  3CCR Q;  5LJ5 h;  2DVJ A;  1VQN Q;  3BDL A;  3OQ5 A;  4J9H A;  4IUV A;  1M1K R;  2BTT A;  4Q5W A;  2KYB A;  1VIE A;  5CKE A;  5LJ3 e;  1Y7X A;  3ZEH A;  1WJR A;  3TSW A;  3OYF A;  2W10 A;  4BDZ A;  3LWI A;  3PVQ A;  1GXI E;  2ENM A;  1SF9 A;  4FW1 A;  4Z88 A;  1BB9 A;  4OML A;  3EFO A;  4OMQ A;  1S72 Q;  3GF5 A;  3OYE A;  6AT1 B;  3HPW A;  1TS9 A;  4M7D C;  3EGD A;  4B9X A;  2MI6 A;  3ULR B;  3JAM E;  2XU8 A;  5CKB A;  2VB6 A;  4L6V 5;  4Y92 A;  1YJ9 A;  1UGV A;  4HT9 A;  4ZGE B;  3GOX A;  2QTX A;  4PL6 A;  1VQM T;  3LWH A;  4IKF A;  3HL8 A;  3G71 Q;  4XAX B;  3QZ5 B;  4PFZ A;  2RQT A;  1R0B G;  4PLI A;  1Y07 A;  4PJO G;  3MEA A;  2OTJ Q;  1QVG P;  4B9W A;  2E3I A;  4F16 A;  1YJW A;  2DXC A;  2F2X A;  1WPY A;  1WHH A;  1GL5 A;  1JO8 A;  3FJP A;  1BI1 A;  3M0U A;  2OTL T;  3UAT A;  3SWN B;  3VS0 A;  3M0Q A;  2HL3 A;  3VKI A;  2ZPI B;  5GAN 6;  1UDL A;  5GAN 2;  2KSS A;  2MOX A;  4M78 B;  1WA7 A;  1ZBX A;  2EJF A;  2JNG A;  4C8Q B;  3FC3 A;  1N9S A;  3HRU A;  3CCE Q;  2P0P A;  5GAM d;  3WVD B;  1AWJ A;  1YIJ A;  2CP6 A;  4J6X A;  1X2K A;  1V76 A;  2XIC A;  2JTM A;  2CKK A;  3FJ5 A;  1UHC A;  4M77 C;  4RG8 A;  1ZSZ A;  1E6H A;  3M5A A;  3BY7 A;  4ANJ A;  1VQP T;  1IZ6 A;  5GAM h;  4OMN A;  2BZY A;  2EJ9 A;  3NGP A;  2DLP A;  2ZPH B;  4AG2 C;  2FPF A;  3QDF A;  2J6O A;  2QI2 A;  2DRK A;  2KRS A;  5IAY A;  2RNA A;  3PE0 A;  3A98 A;  1B34 A;  1YI2 A;  4M78 F;  1WIE A;  4DEY A;  2FZK B;  3RMS A;  1X27 A;  4C8Q F;  2GTO A;  2L3P A;  1FYN A;  2KEA A;  3AHU A;  3OMG A;  5LJ3 d;  4HVW A;  1TH7 A;  1K8A R;  1N6A A; 
#chains in the Genus database with same CATH homology
 4HCK A;  1K4U S;  3NMZ C;  1VYV A;  2HBW A;  2H8H A;  1QKX A;  3I35 A;  3JV3 A;  2F2W A;  1HJD A;  5IXB A;  1ZX6 A;  2F2V A;  2PNI A;  2DX1 A;  4J9F A;  2GNC A;  1GRI A;  1JXO A;  2RF0 A;  1CKA A;  4J9C A;  2PTK A;  1K1Z A;  2D8H A;  2O88 A;  3EHR A;  4RTT A;  2RQV A;  1ZBJ A;  4LE9 A;  2LCS A;  3EHQ A;  2RQW A;  4Z8A A;  2EBP A;  2EYX A;  4KRT A;  1WYX A;  2P4R A;  2JXB A;  4RUG A;  3THK A;  1ZUY A;  4EIK A;  1HSQ A;  3VS2 A;  1X2Q A;  2OAW A;  1JXM A;  1ARK A;  5FWB A;  2GQI A;  3SHW A;  4FSS A;  1HD3 A;  2ESW A;  2L2P A;  2DA9 A;  2RPN A;  4JJD A;  2KYM A;  1B3Q A;  2D0N A;  2V1R A;  1OPL A;  2CT4 A;  2EW3 A;  1AZG B;  1BK2 A;  1UJ0 A;  4LUD A;  4K11 A;  5FW9 A;  2M51 A;  2D8J A;  4AFU C;  2A08 A;  2LMJ A;  3H0H A;  2KGT A;  4J9B A;  4D8D A;  1PKS A;  4CC2 A;  1E6G A;  1H3H A;  2NWM A;  1WX6 A;  2DBK A;  2DL5 A;  4JZ4 A;  2YUO A;  2KT1 A;  3PVL A;  2YT6 A;  2FEI A;  2LZ6 B;  5I11 A;  3EG2 A;  2RN8 A;  2I0N A;  2SRC A;  1QWF A;  1K9A A;  2KNB B;  2O9S A;  1AZE A;  4DEX A;  1YNZ A;  3UA6 A;  3C0C A;  3I5R A;  3IQL A;  4JJC A;  3M0S A;  2K6D A;  1U3O A;  5GJW B;  2ED0 A;  2ROT A;  4E6R A;  3UF4 A;  2EGE A;  3M0R A;  1WLP B;  2RQR A;  2J6F A;  1NEG A;  1KFZ A;  4RTZ A;  2J7I A;  1U5S A;  2C0O A;  2EGC A;  2O9V A;  1H92 A;  2SEM A;  4IIO A;  1WXB A;  2CRE A;  1GCQ A;  1X69 A;  1M27 C;  4F17 A;  1MUZ A;  1RUW A;  2KXC A;  1AOJ A;  5FWC A;  1YWP A;  2BZX A;  1T0J A;  1LCK A;  1G2B A;  2AKL A;  1UUE A;  2AZV A;  2ED1 A;  5HCK A;  1ABQ A;  2YUP A;  2DL3 A;  2LJ1 A;  4OMM A;  2JM9 A;  2LQW A;  1K0S A;  4D8K A;  2HDA A;  1KSW A;  2BZ8 A;  2M0Y A;  4HXJ A;  2A37 A;  2DL7 A;  2K9G A;  4RTX A;  1ZUU A;  2FPE A;  3I9Q A;  1X43 A;  2OJ2 A;  5EC7 A;  1BU1 A;  2IIM A;  2PZ1 A;  3SEM A;  4JPB W;  2FO0 A;  1AVZ C;  1T0H A;  1WDX A;  2L0A A;  2LX7 A;  2J05 A;  1WFW A;  2J6K A;  1JQQ A;  4RTY A;  1SRL A;  3LH5 A;  2YDL A;  2MCN A;  3VS5 A;  1WI7 A;  1NYG A;  2KE9 A;  4J9E A;  4F14 A;  1W1F A;  4HVU A;  2RQU A;  2GTJ A;  2YUQ A;  1AEY A;  3NPF A;  3ZL7 C;  1ZSG A;  1IO6 A;  2W0Z A;  1SHG A;  3EG1 A;  1QKW A;  2GBQ A;  2JTE A;  4AFS C;  1QWE A;  1BBZ A;  3KFV A;  4J9I A;  1VA7 A;  3TVT A;  2CUB A;  1UHF A;  2C0T A;  4IIM A;  1QCF A;  3VS3 A;  2D1X A;  4R0K A;  3EG0 A;  3RBB B;  2CT3 A;  1PKT A;  1M3A A;  2DBM A;  3U23 A;  1PHT A;  1J3T A;  1UE9 A;  1YCS B;  4CC7 A;  2C0I A;  1FMK A;  1RLQ C;  2DIL A;  3REA B;  1KJW A;  2J06 A;  1G83 A;  2CSI A;  2VKN A;  1GBQ A;  2FG0 A;  2V1Q A;  2DM1 A;  2A28 A;  1GFD A;  4CC4 B;  2EKH A;  2JW4 A;  2KBT A;  1U06 A;  1AWO A;  1T3L A;  1M8M A;  3VS6 A;  2EVR A;  2L3Q A;  4LNP A;  3VS1 A;  1PRM C;  2JT4 A;  1I1J A;  5IHK A;  1M30 A;  1NEB A;  1CSK A;  1EFN A;  2HCK A;  1ABO A;  3REB B;  1Z9Q A;  2DMO A;  1PRL C;  5I22 A;  1OPK A;  4GLM A;  1JU5 C;  3VS4 A;  1NG2 A;  4CC3 A;  2ABL A;  2YSQ A;  1XOV A;  5IH2 A;  1Z9Z A;  2JMA A;  2DE0 X;  1I0C A;  4GBQ A;  2K79 A;  1NYF A;  1TG0 A;  1Y57 A;  5L23 A;  1VYU A;  3VS7 A;  2G6F X;  1KIK A;  4RTU A;  1T3S A;  1NLP C;  1SHF A;  1Y0M A;  2LP5 A;  2EYY A;  1TUD A;  1V1C A;  2O31 A;  1UFF A;  2EYZ A;  2CH4 W;  3QWY A;  1X6B A;  3I5S A;  4QT7 A;  2X3W D;  1JEG A;  2L3S A;  1M3C A;  2KXD A;  1M3B A;  4ORZ A;  2LJ0 A;  3M0P A;  2DJQ A;  1UEC A;  2DVJ A;  1B07 A;  2VWF A;  2CDT A;  2EQI A;  4RTW A;  4J9H A;  2K3B A;  2EYW A;  2BTT A;  1AWW A;  2KYB A;  3H41 A;  2KRO A;  4JJB A;  1GFC A;  2JS0 A;  2DL8 A;  1N5Z A;  3TSW A;  2W10 A;  2CUD A;  3PVQ A;  4AG1 C;  2QDL A;  2ENM A;  1A0N B;  5IHI A;  4Z88 A;  1BB9 A;  2DNU A;  4OML A;  4OMQ A;  1H8K A;  2LJ3 A;  2O2O A;  4J9D A;  2K2M A;  2JMC A;  3M0T A;  2VVK A;  4ESR A;  5IHN A;  4LN2 A;  2A36 A;  1OOT A;  2YUN A;  5ECA A;  3ULR B;  1TUC A;  1NM7 A;  2DL4 A;  2JM8 A;  4AFZ C;  1WXU A;  4Z89 A;  2E5K A;  1MV0 B;  4RTV A;  3TSZ A;  4Y92 A;  1UGV A;  3EGU A;  2EPD A;  2MIO A;  1QLY A;  1YN8 A;  3CQT A;  3QWX X;  1GBR A;  2DF6 A;  2KR3 A;  4JZ3 A;  3EG3 A;  1W70 A;  1YWO A;  2RQT A;  2FRY A;  2NUZ A;  1CKB A;  1OV3 A;  1GCQ C;  4HVV A;  1OEB A;  2EGA A;  2RMO A;  4F16 A;  2AK5 A;  2F2X A;  1E7O A;  2KT8 A;  1SEM A;  1GL5 A;  1JO8 A;  1I07 A;  1X6G A;  2LQN A;  3VRY A;  3M0U A;  1MV3 A;  1NLO C;  2AKK A;  3UAT A;  3VS0 A;  5IXF A;  3M0Q A;  4OMP A;  3O5Z A;  1YP5 A;  1K0X A;  1ZUK A;  1UDL A;  4ZNX A;  2GGR A;  2MOX A;  2FRW A;  2CH4 A;  4A63 B;  3R6N A;  3RNJ A;  1WA7 A;  3NHN A;  3H0F A;  1WXT A;  2KRM A;  2X3X D;  2ECZ A;  1SRM A;  2KRN A;  2B86 A;  3GBQ A;  1S1N A;  1AWJ A;  2FPD A;  2JS2 A;  2OI3 A;  2ROL A;  1UG1 A;  1AD5 A;  1SPK A;  1ZLM A;  1X2K A;  2HSP A;  1AWX A;  4LUE A;  2XMF A;  2DRM A;  3FJ5 A;  1UHC A;  1GCP A;  1PNJ A;  1E6H A;  1K76 A;  2AZS A;  1RLP C;  1RI9 A;  4AFQ C;  2HEQ A;  4M4Z A;  4OMN A;  2BZY A;  3NGP A;  2DLP A;  2LNH B;  3H0I A;  4AG2 C;  2K7A A;  2FPF A;  2J6O A;  2DRK A;  2KRS A;  3VRZ A;  2RNA A;  3PE0 A;  4J9G A;  3UA7 A;  2CSQ A;  3A98 A;  1UJY A;  2DYB A;  1WIE A;  4DEY A;  1X27 A;  1SSH A;  4X1V A;  2L3P A;  2GTO A;  1FYN A;  1VYT A;  1UTI A;  1W6X A;  2KEA A;  4WCI A;  5GJV B;  4OMO A;  4HVW A;  1PWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...