2KRMA

Rdc refined solution structure of the first sh3 domain of cd2ap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
b'VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krmA00
1WXBA 1NG2A 2PZ1A 1GCQC 3TSWA 3ZL7C 4JZ3A 1M3AA 2A28A 2AKKA 1T0JA 5EC7A 2K6DA 4Z8AA 4Y92A 4J9GA 1MV3A 2LQWA 2EPDA 3EG1A 3M0RA 3VRYA 2KEAA 2K2MA 2CREA 3M0SA 1MUZA 3VS1A 3CQTA 3O5ZA 4J9IA 1BBZA 3A98A 2KR3A 1WDXA 1U3OA 2J06A 1N5ZA 1NYGA 2BTTA 2DLPA 4AFQC 2K3BA 2JM8A 5IHNA 4ESRA 4J9HA 2KROA 2HDAA 1BB9A 2AK5A 2KBTA 2RQTA 2J6FA 1W6XA 2KT8A 4JJDA 3M0PA 1GRIA 4HVUA 4D8KA 1CSKA 4AFUC 4DEXA 1NLPC 1UUEA 1X2KA 1E7OA 4GBQA 2ROLA 1X27A 2YSQA 3KFVA 2RNAA 4KRTA 2EBPA 4FSSA 2AZVA 1WX6A 1CKBA 1KSWA 2D0NA 4D8DA 1SRMA 2ED1A 4E6RA 3NHNA 1PHTA 3EG2A 2KYMA 1T3SA 1SHGA 2C0OA 2EYXA 1AD5A 2AKLA 4OMMA 2FEIA 1WYXA 4RTVA 1KIKA 1SSHA 1A0NB 2A36A 2DA9A 2YUQA 3EG0A 1SHFA 2GTOA 4CC2A 4AG1C 1WLPB 4HVVA 2DILA 1NEBA 1GBRA 2BZ8A 2DM1A 5FW9A 3H0FA 4ZNXA 1AWXA 3I9QA 1J3TA 2JM9A 2GGRA 1NLOC 1G83A 2L0AA 4F17A 4Z88A 1OPLA 2BZYA 1TUDA 1UDLA 1I1JA 1XOVA 3IQLA 4LUEA 3RNJA 5GJWB 1S1NA 3PE0A 1K0SA 2D1XA 1NEGA 3TVTA 2EYZA 3ULRB 4J9FA 3M0QA 1HD3A 4LNPA 2OAWA 4OMOA 3PVLA 2NWMA 4J9BA 1K4US 1PRMC 2K79A 3QWXX 4OMNA 2GNCA 4HCKA 3VRZA 1W70A 2LCSA 3VS4A 5IXBA 2JXBA 2DRKA 1B3QA 2K9GA 2ROTA 4J9DA 2KRNA 1AWOA 4CC7A 2JTEA 2DJQA 5IH2A 2CSIA 1OV3A 1NYFA 1U06A 2YT6A 2ABLA 2EGAA 2EYWA 4RTYA 2DBMA 3QWYA 1RI9A 2JMCA 2VKNA 1T0HA 2FPDA 2YUNA 3I5SA 1SRLA 2YUOA 1WFWA 1RUWA 2DVJA 2YUPA 2VVKA 1KFZA 5IHKA 1I0CA 4RTWA 1NM7A 1HJDA 4Z89A 2LJ1A 1QWEA 2FPFA 2LJ0A 2AZSA 5HCKA 2C0IA 4IIOA 3VS6A 2OI3A 2LX7A 3U23A 1PKTA 3SHWA 1ABQA 1KJWA 2EGCA 2XMFA 3UA6A 1OEBA 1WA7A 1JO8A 1ARKA 3NPFA 1BK2A 2DL5A 2M51A 1Y0MA 1X43A 5IXFA 2EKHA 2B86A 3PVQA 2JT4A 1PNJA 2ECZA 2DF6A 1PWTA 2LP5A 2KNBB 1EFNA 3M0TA 2HBWA 3NGPA 2CH4A 2DL8A 2L3PA 2F2XA 4LN2A 2G6FX 1JXMA 1Z9QA 3GBQA 4A63B 2HCKA 2K7AA 4CC3A 3TSZA 2KRSA 1K9AA 1ZUUA 3UF4A 1QLYA 1GCQA 2L2PA 2L3SA 1GFCA 4F14A 1QKXA 1CKAA 2ED0A 2O9VA 2RQRA 3REBB 2KE9A 1BU1A 5FWCA 3VS3A 2RF0A 4HXJA 1V1CA 3SEMA 5ECAA 1AWWA 1YWOA 2SRCA 2DMOA 2F2VA 4J9CA 2O31A 4EIKA 2I0NA 2V1QA 4AFZC 2FRWA 2FO0A 1X6GA 1H3HA 2DRMA 2RN8A 1JXOA 4GLMA 3I5RA 4OMQA 2EQIA 2BZXA 2GTJA 2LJ3A 4JJBA 2HSPA 1YP5A 2A08A 1AVZC 3NMZC 2CT3A 4OMPA 4HVWA 1ZX6A 1M27C 1UGVA 3H41A 1Y57A 3C0CA 1K0XA 4JZ4A 3FJ5A 1K1ZA 5I22A 1WXTA 2LZ6B 3UA7A 2KT1A 3UATA 1JEGA 1VYUA 4JPBW 1VYVA 2KRMA 2D8HA 1GBQA 2H8HA 1UTIA 2KGTA 2J6OA 2PNIA 2KYBA 2J05A 1LCKA 2DNUA 1AEYA 1WIEA 3EHRA 2CSQA 2LMJA 2RPNA 5FWBA 1FMKA 3RBBB 1AWJA 2FG0A 1UE9A 1UG1A 2W10A 1G2BA 2GQIA 2FRYA 1AZEA 2GBQA 1K76A 1M3BA 1PRLC 2EGEA 1SEMA 1QWFA 5IHIA 4AFSC 1UHCA 1UFFA 2JS2A 4J9EA 4M4ZA 2DBKA 2DL3A 1ABOA 3R6NA 2JW4A 1JU5C 1Z9ZA 1H8KA 1YWPA 1UECA 2PTKA 2QDLA 2LNHB 1WI7A 4QT7A 2JMAA 1QCFA 2DE0X 1AZGB 1IO6A 3JV3A 2KXCA 4WCIA 4R0KA 4RUGA 4F16A 2MIOA 2M0YA 4IIMA 1SPKA 2J6KA 2E5KA 2D8JA 4DEYA 3VS0A 1QKWA 4CC4B 2EVRA 2JS0A 1VYTA 1M8MA 4ORZA 1YNZA 1TG0A 2EYYA 3I35A 1UJ0A 2O9SA 3REAB 2RMOA 3LH5A 2CUDA 1OPKA 1ZSGA 2DL4A 4RTXA 1X2QA 3EG3A 3EGUA 1YCSB 4OMLA 1T3LA 1I07A 2DX1A 1WXUA 2RQUA 1E6GA 1RLQC 1TUCA 1B07A 3VS5A 1E6HA 2P4RA 2EW3A 3H0HA 1H92A 1GCPA 1ZLMA 2W0ZA 4JJCA 4X1VA 1PKSA 1ZBJA 2F2WA 2HEQA 2O88A 2O2OA 2CH4W 2RQVA 4AG2C 2J7IA 1HSQA 1ZUYA 2YDLA 1JQQA 1M3CA 2A37A 2OJ2A 4K11A 1M30A 2ENMA 4LUDA 2X3WD 2MCNA 2LQNA 2NUZA 1AOJA 1X69A 1FYNA 2MOXA 3EHQA 1ZUKA 2X3XD 2C0TA 3H0IA 3VS7A 1VA7A 2ESWA 4LE9A 4RTTA 5L23A 2KXDA 1GFDA 1GL5A 2V1RA 1YN8A 2RQWA 1X6BA 3VS2A 3THKA 3M0UA 2IIMA 4RTUA 1MV0B 2SEMA 2CUBA 2VWFA 2CT4A 1W1FA 1RLPC 2FPEA 2DYBA 1UJYA 4RTZA 1UHFA 2CDTA 2DL7A 5GJVB 1U5SA 2L3QA 1OOTA 5I11A
chains in the Genus database with same CATH superfamily
4A4HA 2PZ1A 4QVDA 5D7UA 2K5LA 4JLIA 2AKKA 1T0JA 5EC7A 4Z8AA 2D9TA 1VQ9A 4EMGA 5CKFA 1W2BA 4J9GA 5L8RE 4IUPA 4AT1B 1QP3A 2EWNA 4MZPA 3QSUA 3FIFA 5KYXB 4X34A 5GANj 3M0SA 4JLGA 3CPWA 2CZ1B 5LJ3h 3V7CA 3OQ5A 1N5ZA 2DVEA 4ZGEB 2G3RA 4AFQC 2JM8A 2F1LA 2YHTA 2KROA 1FWZA 1V76A 2HQHA 1VQPT 4HCCA 4KGZB 4OB0B 4IUTA 2J6FA 3C94A 3JAME 1GRIA 1QVFS 1RL2A 4DEXA 1UUEA 1X2KA 3E19A 1YHQT 4N0AC 4FSSA 4BE0A 5DLOA 3L2RA 1VQ5A 5CQXA 1VIFA 2AZVA 1MMNA 1KSWA 2D0NA 5C6SA 2VGNA 1SRMA 2RD1A 5J26A 1YITT 2E12A 5I2MA 2DJZA 3G71A 1QVGA 1W2BS 2JOYA 1SHGA 2EYXA 1AD5A 5GAN8 2K5IA 4OMMA 1WYXA 3M59A 3FEOA 3EG0A 1SHFA 3CPWS 4M7AB 2ZCFB 1B34B 2MF2A 1NEBA 1GBRA 4JRQA 3I56T 3QPHA 3LLRA 1AWXA 1VQ6T 2NYSA 3DLMA 2GGRA 1G83A 4F17A 4J8OA 3QZ5B 1OX9A 5KYYB 4JDSA 4LUEA 2LT1A 5HK3A 3PNWC 4QQ6A 3WXMB 2DO3A 3ULRB 4KH0B 4PFZA 3H8ZA 4J9FA 2CZ0B 2EJ9A 2OAWA 1RAHB 4OMOA 2RK2A 3CCJQ 1RADB 2GF7A 1WHHA 2K79A 8ATCB 1PSFA 2CP5A 3VRZA 1AT1B 1VQ7A 3HSBA 1W70A 2JXBA 4OVAA 2DIQA 1B3QA 1AHJB 3EG9B 2KRNA 1AWOA 1QVGS 1Y07A 4CC7A 5IH2A 2CSIA 2CGHA 2E3HA 5KYWA 3R6OA 2YT6A 1QMCA 4RTYA 1ZBXA 2DBMA 4IUQA 1O75A 4XK8E 1ZA1B 3A8GB 2FPDA 4HT9A 4LXCA 1SRLA 4XQ3A 1RUWA 3QYGB 2NUPB 3GLXA 3RDVA 2YUPA 4A4EA 4XTVA 5HKCA 1KFZA 1PG5B 2YLBA 2GFAA 3CCRA 4BDYA 1HJDA 3MPUB 4Z89A 2L3RA 3TCJA 4C5EA 2RI5A 4ME7A 2DK3A 1YJ9Q 2M0OA 1O9SA 4EMHA 2X51A 4IIOA 3VS6A 2P0PA 2LX7A 2CP7A 3BFMA 2OTLQ 2K57A 3SHWA 4UC4A 3X20B 5A2QE 1JO8A 2XG8D 1YJNT 5DLQE 1ARKA 1LPLA 1X43A 2NUTB 4VUBA 4IUVA 1WJQA 3MO8A 2B86A 3G71T 2JT4A 3QHSA 3P8HA 5DY9A 3AHUA 2FZGB 1NJIR 3CCET 2QG9B 1FX7A 3PT9A 4M75F 4C5IA 4C8QG 4XTWA 3CC2A 3X24B 2CP3A 5CR2A 3EFOB 5CKEA 2YRCA 3PIOA 1UGRB 4CC3A 3UF4A 1QLYA 4GY5A 1GFCA 1KHCA 1QKXA 2O9VA 1PCXA 2P84A 1BU1A 3VS3A 2RF0A 4FYVB 1M1KR 3NTIA 4OGEA 1AWWA 2SRCA 2DMOA 3ZFJA 3CCUA 4LDWA 3M9QA 1SG5A 1X6GA 2QYZA 2E41A 2DRMA 2COYA 2K4YA 4GLMA 3I5RA 1Q86U 3JCMg 4F7UB 2QTVA 4X9CA 1YP5A 1AVZC 3NMZC 5GMKl 1ZX6A 1ZSZB 2WACA 2OTJT 3CCSQ 1BI1A 4QQDA 5I22A 4QQGA 2P0QA 2KT1A 1VYUA 2EIFA 1D1BA 1X01A 1GBQA 4PFOA 2J6OA 2KYBA 2J05A 5HK0A 2DNUA 1KD1C 2RPNA 3RBBB 2A7YA 5GAOq 1G3SA 1UG1A 2W10A 2H3EB 2FRYA 5LJ5d 3EGDB 4M7DA 4FIBA 1PRLC 4FW2A 3DKMA 1SEMA 4RKUE 5D6WA 5AYFA 1M1GA 5GANe 3L2VA 5FROA 1M90U 1VQLA 2JW4A 1JU5C 3RIRA 2PTKA 2LNHB 1BCMA 3PTAA 2JNGA 1IZ6A 5GMKm 3JV3A 2KXCA 4WCIA 4R0KA 2LQKA 1Q82U 3CCLA 1M4ZA 3MEWA 3PMTA 4LDYA 2J6KA 3QXEB 1N8RU 1QKWA 2EVRA 2JS0A 1I5LA 1M8MA 1YNZA 2EYYA 1UJ0A 4ELYC 1YITQ 4KBMB 3REAB 2LDMA 2A3LA 1P92A 2RM4A 1G3YA 5CVIA 4DOWA 2DYIA 1TOVA 1OPKA 1R0CB 1R77A 3AT1B 1IHVA 1X2QA 4M7DG 1RAEB 3EGUA 3RKXA 1I07A 2DX1A 1C6VX 2AHJB 4FYWB 3OSVA 1B07A 3VS5A 2MAMA 1VUBA 4BI8B 3WVDB 1H92A 3E1SA 4BY6C 4JJCA 2DTOA 1YFNA 4V2SA 2KSSA 3OS0A 1D1AA 2F2WA 2HEQA 3CCUT 4AG2C 2X4WA 5CKDA 3JB9I 1VQ4T 2X4YA 1VQ6Q 3VUBA 4QVCA 4A54A 1M3CA 2OJ2A 4K11A 2NUZA 4L6V5 2V26A 3SFMA 4E7IA 2EAYA 3JB9F 3BE3A 2XDDA 4BY6B 3OYJA 4ZGDB 5L23A 3NTHA 1IGQA 2DFUA 4P5NA 2MPXC 1GL5A 4PJOC 1SF9A 3OYLA 1X6BA 3VS2A 2YWWA 4KH1B 1WHKA 1IGUA 4RTUA 1FXXA 3JCMJ 1VQ9Q 1KC8R 1M1FA 1WHLA 4M75B 1K8AR 2VWFA 2CT4A 2FPEA 3OYAA 1OI1A 3VYHB 2DD5A 5GAMd 2M9UA 2E70A 4M78A 2DKGA 3LW5E 2EKOA 5GMKi 4PJOB 4LDUA 5GAOr 1WXBA 1OZ3A 1GCQC 4MMKA 1VQLT 3ZL7C 2A28A 4MZMA 4PL6A 3RESA 2K6DA 1XJWB 1R0BG 2DIGA 2RHZA 1KG1A 4XU3A 4GLKA 3M0RA 1I5OB 4J5YA 3VRYA 5FRMA 4ZN1A 3JCMe 1M90C 3CCLT 2K2MA 2RHYA 3SWNC 5LJ5j 1BI2A 1PC0A 5EG2A 3O5ZA 4J9IA 1VQ5Q 2ZPFB 4HCBA 1FMWA 2E10A 4WTOB 2GFUA 2BTTA 3PGGA 1YJNQ 5GANh 2JJ9A 2O01E 5IHNA 1SKUB 3X28B 3G71Q 1YJ9T 1BB9A 1N8RC 4M78G 3J7AF 2OTLT 1NLPC 3JCMb 3H9NA 1VOMA 1E7OA 4GBQA 2I2LA 3JCMP 2ROLA 1X27A 3A8OB 2XHCA 3CMEA 4E47A 4Z02A 4D8DA 3OYBA 4C92C 2ED1A 5A0GA 2KY9A 3CEYA 1R8OB 4M75D 1XNIA 1VQNA 3NHNA 1PHTA 3EG2A 4N4IA 4J7FA 1NPPA 2MWOA 4M77A 2ZPHB 2FEIA 1KIKA 2ZPEB 1Q7YR 4PJOD 2PUKB 4FT4A 2YUQA 2GTOA 3QUIA 1PD0A 4C92B 4M7AE 4HVVA 3A5ZB 5FU6C 3QDFA 5GMKj 2DM1A 2OTJQ 4ZNXA 2LRQA 4OB2B 3I9QA 4ATOA 5LJ5g 3L42A 4Z88A 2HKQB 1TUDA 1UDLA 4TVRA 2QEXA 3E9FA 3KXTA 3OS1A 1U1TA 2DEQA 4BE2A 1S1NA 1VQMT 1K0SA 2D1XA 2FVUA 3QIIA 5FU6B 3RMSA 2DXBA 1HD3A 4EMKB 2BE9B 5GAMf 4J9BA 1EIFA 3QWXX 4OMNA 3HP9A 1H3ZA 3META 2RH2A 1OQKA 2LCSA 3CCRQ 5IXBA 5HY6A 1BIAA 1LOJA 2Y4XA 2K9GA 4J6XA 4M77G 2ZPBB 1YI2A 1U1SA 4BE1A 2HL5C 1Q81U 2EYWA 3L2UA 5GAMj 3QWYA 1RI9A 2JMCA 2HL3A 1M1KC 4M7AA 2QDYB 4KUIA 2DVJA 2QXFA 1I4K1 2VVKA 5IHKA 1PM3A 2ZGWA 4RTWA 1NM7A 3N5BB 1TS9A 2DZ9A 2LJ0A 1M9SA 1Q86R 2M1HA 5HCKA 1TH7A 5KYYA 5KYNA 3CC2Q 1VQKT 3JCMh 1KC8U 3U23A 4C92D 1K8AU 1BI0A 1KJWA 2EGCA 3UA6A 3QYHB 3UT1A 1G3TA 1WA7A 3A8HB 4F7UF 2KK4A 2A0FB 2ZZDA 2DL5A 1Y0MA 2Y90A 1UEBA 1VQNT 3HFNA 4DBFA 3PVQA 1MHNA 1PNJA 2EYQA 3V8LA 1M5Q1 2ECZA 3LYIA 2LP5A 2KNBB 1UGQB 4XU2A 2HBWA 3CCUQ 3EG9A 3OYCA 2CH4A 4E7JA 4J7IA 2BIVA 1VQ4Q 2KDSA 2G6FX 3CMAA 2HCKA 4M7AG 1WHMA 3GPLA 1K9AA 2QQ9A 3TU4K 2L2PA 4O6JA 2PVGB 2CKKA 2F69A 4DBRA 2ED0A 4PK4A 5GAMg 1M90R 1IB8A 4BD3A 4HXJA 5ECAA 3X26B 2DERA 4J9CA 4X9DA 1S72A 2V1QA 2FRWA 3JB9D 1H3HA 2VB6A 1LNXA 2RN8A 2EFIA 4F7UE 2LJ3A 2KI7A 1Q82R 3CC4A 4HVWA 1M27C 1UGPB 1BCOA 1C1AA 1N8RR 5I2SA 3FJ5A 1K1ZA 3E2UA 4NS5A 3MEUA 3UATA 1VYVA 1VQ9T 1UTIA 3QG1A 3JCMX 2PNIA 1VQLQ 2E4HA 1WIEA 3EHRA 1QP2A 5LJ3f 2CSQA 1FMKA 1WNLA 4DA4A 2FG0A 1Y71A 3CBOA 3CD6A 1UE9A 5KE2A 2QQRA 3VJPA 2F5KA 2ZAEA 3CCLQ 1Q7YU 1VQ8A 1QWFA 2F5TX 4J83A 4NL2A 4FYXB 4AFSC 2FB7A 3OYKA 1UFFA 1KQSP 4J9EA 5CIUA 1TTHB 5LL6S 5LJ5e 1Z9ZA 3TEEA 2LNVA 1UECA 5GAN6 1QCNA 2VASA 1OU8A 1WI7A 1TU0B 4QKUA 3VYGA 2DE0X 1XQHA 2DXUA 5FRNA 3CCVA 1IO6A 4RUGA 4YTLA 2MIOA 3EFSA 1VQ5T 4IIMA 1SPKA 1ZSZA 3M57A 1KC8C 2D8JA 3G6EA 2WSFE 1K8AC 4CC4B 5GAN2 4L59A 3L1AA 1FMVA 2O9SA 2PVOB 4D6WA 1YBYA 3ER0A 4RTXA 1BKBA 4NOYA 3EG3A 1YCSB 3EGXB 4C8QC 1WXUA 3LWHA 2DZCA 4RG8A 1RAIB 3EGDA 3UPUA 3OBYA 1KHIA 4PJOF 3MCAB 8AT1B 1ZLMA 2LCCA 3O8VA 4A4FA 1ZBJA 2RQVA 4XU0A 1HSQA 4XTYA 4IUUA 4KGXB 3RKYA 4C8QB 4LUDA 5GMKe 3CC4T 2MCNA 1X69A 2MOXA 1QVPA 3EHQA 1ZUKA 1TWBA 1VQMQ 3TQ7P 3JB9J 2X3XD 3H0IA 4LE9A 4BDZA 1IREB 2CP0A 3V8JA 1GFDA 4FL6A 1VQ7T 1YN8A 2QQAA 2D0QB 2RQWA 2V8KA 5C0MA 2Y4YA 2GCXA 1K9MU 4IURA 3CPFA 1D3BB 3I55A 2SEMA 4M75E 3FLGA 4OGCA 3JCMV 3OYGA 2RJFA 2XD0A 2DYBA 3S6WA 1UJYA 4RTZA 1Y96B 3P8DA 2L3QA 3QZ9B 4PJOE 3BDLA 2Z0WA 4JUVA 3QO3A 4BI3A 1G5VA 1NG2A 5IT9E 4Q5WA 2HD0A 3CCRT 4JZ3A 1M3AA 1C0MA 1N9SA 2X35A 5J39A 1Q7YC 3MKDA 2HMAA 1WJSA 4OF1A 4Y92A 3C12A 2EJFA 4B9WA 3CC7A 3PIPA 1NZ9A 2LQWA 4PNOA 3CCVT 3EG1A 4C0GA 2CZ6B 4OMFB 1F1BB 2KEAA 1YIJA 2CREA 2XIDA 4KGVB 1VQKQ 5A0DA 4OB3B 2LVMA 3ZEHA 3VS1A 2COZA 3G6ET 1BBZA 4LDXA 4F04B 2KR3A 2J06A 2DD4A 4C92F 1NYGA 3QJYA 2DLPA 4C5HA 4PJNA 2K3BA 5LJ5h 2KVQG 1LJOA 2MMPA 1VQNQ 3MEAA 4C8QD 2HDAA 2AK5A 2ZPGB 2KBTA 5CKBA 2E65A 3LH0A 2RQTA 3GIBA 3A8LB 1W6XA 2KT8A 4M75A 4JJDA 3CC2T 4LD9K 4HVUA 3OBWA 1KQSA 1JBMA 4FYYB 2YSQA 1QCOA 2L5QA 4M7DC 2LT4A 3BY7A 3SB2A 1IXDA 2FYKA 2XKOC 5D6YA 3OS2A 1OULA 1HYOA 5M9OA 5GAOp 4E6RA 1YJWA 3FRNA 3MHXA 2E3IA 3VKIA 3SD4A 1BI3A 1Q81R 3DLLA 1KK7A 5IN1A 1WHJA 4E7ZA 4RTVA 3LGLA 2A36A 2ZPIB 1RAGB 4MZTA 4C92E 2HQXA 4HCZA 5CK9A 3CCMA 1QVFP 5FW9A 2NLUA 2RK1A 5KH6A 1Q86C 3FJPA 1J3TA 2JM9A 1NLOC 3I55T 1Q95G 2VV5A 5GMKh 3V8KA 3IQLA 3RNJA 2QA4A 4JRKA 1ZQ1A 1YI2Q 2WSEE 3PE0A 3OYEA 3TVTA 1K9MC 2EYZA 4KT0E 1ZHIA 1KQSS 1I8FA 1JRIA 3FB9A 3OMGA 1W2BP 4LNPA 1MMGA 2GQVA 1H641 2NWMA 3FDRA 2KMTA 4OP0A 4HT8A 2GNCA 1N6AA 2O4XB 2R5MA 5KYUA 1VIEA 3VS4A 3CC7T 2DRKA 2ROTA 1RAFB 2YRVA 2JTEA 1N9RA 1GXIE 4HKEA 1NYFA 3DB4A 5GANd 2HSEB 1YIJT 2EGAA 2K3XA 3V7RA 4CRIA 3MJXA 2VKNA 2EQJA 1OX8A 3LGFA 1OU9A 5GAMh 3M58A 3ASKA 3ZBDA 2XU8A 3H6ZA 1Q82C 2YRDA 4XTXA 1QWEA 2FPFA 3OYIA 3JSCA 1JJ2P 1MMDA 4M7DD 2AZSA 3SWNB 1EX4A 1PKTA 3OYDA 2PQWA 3OA6A 1QVGP 4M78C 1OEBA 3M4GA 1K73U 3URGA 3FC3A 1BK2A 2M51A 4EMKA 5IXFA 5CKHA 1OZ2A 2JTMA 1I81A 2EKHA 1M2VB 2DF6A 1PWTA 2BE7D 4E7KA 1EFNA 2E6NA 3M0TA 3QKJA 3JCMQ 1VQPA 2VC8A 3LWIA 5GAN5 3G4SA 1S72Q 3NTKA 1NBEB 4M78B 2L3PA 2F2XA 4LN2A 3GBQA 3KBGA 3CC4Q 4BB7A 2E1HA 2K7AA 1QQJA 2OX7A 1YHQA 3RR6A 2R58A 5KYXA 1JB0E 3TSZA 2KRSA 1ZUUA 2RQRA 2JUFA 2KE9A 2XDPA 5FWCA 3REBB 3BDUA 1YITA 1VQ7Q 1YWOA 2F2VA 5KCHA 4EIKA 3PFSA 2DPPB 2EQKA 4BACA 1JXOA 6AT1B 1WGSA 2EQIA 2BZXA 2GTJA 2DEUA 3HTRA 2R57A 2COWA 4O5VA 2A08A 4R56A 1KQ1A 4OMPA 1WJRA 1UGVA 1VQ8Q 2V8IA 1K0XA 4JZ4A 2HQEA 1TXQA 2YLCA 2KQWA 3I56A 1WXTA 4E7LA 1JEGA 5CQYA 3A8MB 5GAN4 2KRMA 2D8HA 1VQ6A 2QTXA 5GAOn 5LJ3d 1LCKA 1AEYA 1Y7XA 2PUOB 2JVVA 5GAOl 2LC4A 2LMJA 5FWBA 4M77C 3SDZA 3CCVQ 2GQIA 4N0AA 2GBQA 3P8BB 5GANf 3HRTA 4JS5A 3JCMd 1B34A 3G6EQ 1UHCA 2QAZA 2JS2A 2DBKA 2DL3A 1WZOA 4M77B 3L2ZA 4M78D 4ANJA 2DETA 3M53A 1X75C 4B9XA 3CXCP 1MGQA 1EZZB 2JMAA 2M16A 1QCFA 4JJNK 4C8QF 2V8JA 1G3WA 3CMET 2AT1B 1VQOA 3JRZA 3X25B 4DEYA 1K9MR 1SSFA 1VYTA 3MEVA 1K73C 4ORZA 3QDRB 1TG0A 7AT1B 1V29B 1XTDA 2RHXA 3G4ST 3NFCA 5GAOm 3J81E 4PJJA 2RMOA 2H3JA 3LH5A 2CUDA 4A4GA 1D0YA 3INZA 4NL3A 2RI2A 4OMLA 1E6GA 1RLQC 1JJ2A 1TUCA 1E6HA 2K5FA 2EW3A 1YJNA 3H0HA 4M7AC 3S3MA 1GCPA 2W0ZA 1PKSA 3G7ZA 2O2OA 2CH4W 4PJLA 2DXTA 2NUPA 3OYNA 1ZUYA 3VV0A 3CCQA 2QEXT 2A37A 3CCEA 3I55Q 1M30A 2ENMA 4PKCC 2X3WD 4C8QE 2RA2A 1FYNA 4XU1A 2MYSA 2JZ2A 2K3YA 2QQBA 4RTTA 3OY9A 2LX9A 4II1A 3DB3A 3UWNA 2HKNA 9ATCB 2KXDA 4Y91A 5GANg 2DTIA 3JCMW 3F70A 2IVWA 4M77D 2NUTA 1UB4A 4B6MA 1MV0B 4C5GA 2HBPA 3CC7Q 2CUBA 1YI2T 2QK0A 2RJDA 1W1FA 2CYZB 1RLPC 1WQ7A 3M55A 2EQMA 1UHFA 2DL7A 5GJVB 5CO7A 1YIJQ 1U5SA 3UDCA 4C0DC 2K2VA 1OOTA 5I11A 1JJ2S 3EGXA 4C0FA 2IG0A 2OTJA 1KD1U 5KCOA 3EFOA 4DQ2A 2DAQA 4JRPA 3HKSA 1Q81C 2DXCA 1WQWA 3TSWA 4R55A 5FU7C 2LQ8A 4WF2A 2VXEA 3BW1A 3JCMf 3GNFB 5LJ3j 1MV3A 2EPDA 3CBPA 4C0DB 1IHWA 2PVDB 4C8QA 2EQUA 1IRXA 1VQOT 4M7DF 1MUZA 2E5QA 5FU7B 4F7UA 3L2QA 3CQTA 3A98A 1WDXA 1U3OA 1BYMA 1RAAB 4BUGA 3EH1A 4A4KA 2PU9B 4ESRA 1X6OA 4J9HA 3M5AA 1NE8A 1YJWQ 3C4SA 3OW2P 3OB9A 1TSFA 2P0KA 2CS7A 1D3BA 3V7SA 2RHIA 4M7AD 3CMAT 3M0PA 4D8KA 1CSKA 2MK5A 4AFUC 1D1CA 3KFVA 4KRTA 1Y96A 2RNAA 2EBPA 5I21A 1WX6A 1CKBA 3CCMQ 3CXCA 3D7SB 1DJ7B 3QJ6A 3CCQT 3MP8A 4OB1B 5KYWB 1S72T 2BKDN 3RKWA 2KYMA 2M02A 4MDWA 4N4GA 4AMCA 1T3SA 4C0ZA 2C0OA 2CZ7B 1PD1A 2AKLA 2IPOB 2QA4Q 1KQ2A 3HL8A 3MP1A 4M7DE 1SSHA 3OYMA 1ZA2B 1A0NB 4F7UG 2DA9A 4E7SA 2HAXA 1UGSB 5LJ3g 4CC2A 4AG1C 1WLPB 2FHDA 1HXDA 2DILA 3HRUA 2BZ8A 5FLXE 3PMIA 3H0FA 1ZSZC 1RACB 2QI2A 4XTUA 2FZCB 2WSCE 3OMCA 2L0AA 4MMLA 3GF5A 1OPLA 2BZYA 3GOXA 1VQ4A 4BI4A 1I1JA 1QW1A 1XOVA 3ME9A 5GJWB 2R5AA 2L8DA 3TREA 3CD6T 2XI9A 1NEGA 1K73R 3M0QA 3OYYA 2MI6A 2X4JA 1MNEA 3PVLA 2CP6A 1VQ8T 1K4US 4FT2A 4IKFA 1PRMC 1LVKA 1PSEA 4HCKA 3CXCS 3CBMA 3L2WA 3M4YA 1NPRA 4L5GA 4RG2A 4DBHA 5GAMe 4PFPA 4J9DA 4JRIA 2DJQA 4Y28E 1OV3A 2DTHA 3M54A 4XTZA 1U06A 2ABLA 2RB6A 4M78F 3M56A 1T0HA 2RHUA 3CCJA 2YXYA 3G1JA 2XICA 2YUNA 3I5SA 2YUOA 2B8AA 1WFWA 2QASA 3CMEQ 2D6FA 1I0CA 3RERA 2L89A 3EAEA 5KE3A 2LJ1A 1VQPQ 3G4SQ 2C0IA 4ZTJA 2OI3A 2RJEA 1MNDA 4FW1A 1ABQA 2XMFA 1YHQQ 4XAXB 3RMQA 3LX7A 3NPFA 4PJOA 3C95A 4PLIA 3EFRA 3A1PA 2O4XA 1YCYA 1WPYA 4FCYA 4J6YA 2VXFA 1YJ9A 3NGPA 2DL8A 4M78E 4DOVA 2QEXQ 1JXMA 1Z9QA 2OTLA 4MDXA 4A63B 4M7DB 4HA8A 3OW2A 1D0ZA 2X9HA 4LDVA 4FU6A 1GCQA 2L3SA 1TUGB 4F14A 1M2OA 1CKAA 3I56Q 1N27A 2CP2A 3HRSA 4E2FB 1W4SA 1ACMB 1V1CA 3SEMA 3QBYA 3MP6A 2RJCA 2O31A 1WHGA 2I0NA 4AFZC 4M77F 4M75G 1OYXA 2FO0A 2MWPA 4OMQA 4M75C 4QVZA 3HFOA 3HHTB 4JJBA 3SWNA 2HSPA 2XDBA 3JB9H 2CT3A 4PJOG 4DBQA 3HPWA 4RCCA 3H41A 1Y57A 3C0CA 2KAFA 2ATCB 2LZ6B 2LCLA 4N4HA 4EPCA 3UA7A 4RMOA 4JPBW 3OS5A 2QGGA 2QGFB 2E64A 3CPWP 2H8HA 3RUXA 1BIBA 2KGTA 1M2VA 4PJMA 2VGMA 5CAIA 2BUDA 2P4TA 1NJIU 1AWJA 2EJGA 4E7HA 1VQMA 1U8RA 5CCAA 3CCJT 3GNGA 1G2BA 1AZEA 1K76A 3OW2S 2FL7A 4RCBA 3JCMc 3Q1JA 2X4XA 5LJ3e 3CCSA 1M3BA 5LJ5f 5GAN7 2EGEA 1VQOQ 5IHIA 2XK0A 5J3BA 4FSXA 4C92A 1D09B 4M4ZA 1ABOA 4M77E 3R6NA 1H8KA 1YWPA 1M1KU 2QDLA 3OYFA 2QQSA 4QT7A 3VU3C 1AZGB 3CMAQ 2LTOA 4F16A 2JN0A 4M7AF 2M0YA 3GP8A 2E5KA 5D6XA 2C06A 1HK9A 2VYTA 3VS0A 2RO0A 3KUFA 1YJWT 2OAUA 4QW2A 3I35A 2JTFA 4FM4B 3CCQQ 4KULA 3CCEQ 3VUZA 1G8XA 1ZSGA 2DL4A 3OYHA 1VQKA 3WVEB 1T3LA 2RQUA 5GAN3 1KD1R 3OSSC 4C92G 2P4RA 5KYUB 2FZKB 3S3NA 3CCMT 4KUDK 1D0XA 4X1VA 2O88A 3T9NA 4LD6A 2J7IA 5DM7R 2YDLA 1JQQA 2QA4T 2LQNA 3J80E 5IAYA 1AOJA 4ZN3A 5A0LA 3EH2A 4ZTFA 3CD6Q 2C0TA 3VS7A 1RI0A 1VA7A 4EDUA 2ESWA 1B7TA 4EMKC 2V1RA 2HZYA 3THKA 3M0UA 2IIMA 3S3OA 1RABB 4ELZC 2E6ZA 2AIRB 5AT1B 3E9GA 1MMAA 4PLLA 1QVFA 1M8VA 2CDTA 3JB9G 4J6WA 2VUBA 3CCST 4A53A 4ZGJB 2RI3A 4JS4A 1NJIC 4CI0C 2HNIA
chains in the Genus database with same CATH topology
1WXBA 1NG2A 2PZ1A 1GCQC 3TSWA 3ZL7C 4JZ3A 1M3AA 2A28A 2AKKA 1T0JA 5EC7A 2K6DA 4Z8AA 4Y92A 4J9GA 1MV3A 2LQWA 2EPDA 3EG1A 3M0RA 3VRYA 2KEAA 2K2MA 2CREA 3M0SA 1MUZA 3VS1A 3CQTA 3O5ZA 4J9IA 1BBZA 3A98A 2KR3A 1WDXA 1U3OA 2J06A 1N5ZA 1NYGA 2BTTA 2DLPA 4AFQC 2K3BA 2JM8A 5IHNA 4ESRA 4J9HA 2KROA 2HDAA 1BB9A 2AK5A 2KBTA 2RQTA 2J6FA 1W6XA 2KT8A 4JJDA 3M0PA 1GRIA 4HVUA 4D8KA 1CSKA 4AFUC 4DEXA 1NLPC 1UUEA 1X2KA 1E7OA 4GBQA 2ROLA 1X27A 2YSQA 3KFVA 2RNAA 4KRTA 2EBPA 4FSSA 2AZVA 1WX6A 1CKBA 1KSWA 2D0NA 4D8DA 1SRMA 2ED1A 4E6RA 3NHNA 1PHTA 3EG2A 2KYMA 1T3SA 1SHGA 2C0OA 2EYXA 1AD5A 2AKLA 4OMMA 2FEIA 1WYXA 4RTVA 1KIKA 1SSHA 1A0NB 2A36A 2DA9A 2YUQA 3EG0A 1SHFA 2GTOA 4CC2A 4AG1C 1WLPB 4HVVA 2DILA 1NEBA 1GBRA 2BZ8A 2DM1A 5FW9A 3H0FA 4ZNXA 1AWXA 3I9QA 1J3TA 2JM9A 2GGRA 1NLOC 1G83A 2L0AA 4F17A 4Z88A 1OPLA 2BZYA 1TUDA 1UDLA 1I1JA 1XOVA 3IQLA 4LUEA 3RNJA 5GJWB 1S1NA 3PE0A 1K0SA 2D1XA 1NEGA 3TVTA 2EYZA 3ULRB 4J9FA 3M0QA 1HD3A 4LNPA 2OAWA 4OMOA 3PVLA 2NWMA 4J9BA 1K4US 1PRMC 2K79A 3QWXX 4OMNA 2GNCA 4HCKA 3VRZA 1W70A 2LCSA 3VS4A 5IXBA 2JXBA 2DRKA 1B3QA 2K9GA 2ROTA 4J9DA 2KRNA 1AWOA 4CC7A 2JTEA 2DJQA 5IH2A 2CSIA 1OV3A 1NYFA 1U06A 2YT6A 2ABLA 2EGAA 2EYWA 4RTYA 2DBMA 3QWYA 1RI9A 2JMCA 2VKNA 1T0HA 2FPDA 2YUNA 3I5SA 1SRLA 2YUOA 1WFWA 1RUWA 2DVJA 2YUPA 2VVKA 1KFZA 5IHKA 1I0CA 4RTWA 1NM7A 1HJDA 4Z89A 2LJ1A 1QWEA 2FPFA 2LJ0A 2AZSA 5HCKA 2C0IA 4IIOA 3VS6A 2OI3A 2LX7A 3U23A 1PKTA 3SHWA 1ABQA 1KJWA 2EGCA 2XMFA 3UA6A 1OEBA 1WA7A 1JO8A 1ARKA 3NPFA 1BK2A 2DL5A 2M51A 1Y0MA 1X43A 5IXFA 2EKHA 2B86A 3PVQA 2JT4A 1PNJA 2ECZA 2DF6A 1PWTA 2LP5A 2KNBB 1EFNA 3M0TA 2HBWA 3NGPA 2CH4A 2DL8A 2L3PA 2F2XA 4LN2A 2G6FX 1JXMA 1Z9QA 3GBQA 4A63B 2HCKA 2K7AA 4CC3A 3TSZA 2KRSA 1K9AA 1ZUUA 3UF4A 1QLYA 1GCQA 2L2PA 2L3SA 1GFCA 4F14A 1QKXA 1CKAA 2ED0A 2O9VA 2RQRA 3REBB 2KE9A 1BU1A 5FWCA 3VS3A 2RF0A 4HXJA 1V1CA 3SEMA 5ECAA 1AWWA 1YWOA 2SRCA 2DMOA 2F2VA 4J9CA 2O31A 4EIKA 2I0NA 2V1QA 4AFZC 2FRWA 2FO0A 1X6GA 1H3HA 2DRMA 2RN8A 1JXOA 4GLMA 3I5RA 4OMQA 2EQIA 2BZXA 2GTJA 2LJ3A 4JJBA 2HSPA 1YP5A 2A08A 1AVZC 3NMZC 2CT3A 4OMPA 4HVWA 1ZX6A 1M27C 1UGVA 3H41A 1Y57A 3C0CA 1K0XA 4JZ4A 3FJ5A 1K1ZA 5I22A 1WXTA 2LZ6B 3UA7A 2KT1A 3UATA 1JEGA 1VYUA 4JPBW 1VYVA 2KRMA 2D8HA 1GBQA 2H8HA 1UTIA 2KGTA 2J6OA 2PNIA 2KYBA 2J05A 1LCKA 2DNUA 1AEYA 1WIEA 3EHRA 2CSQA 2LMJA 2RPNA 5FWBA 1FMKA 3RBBB 1AWJA 2FG0A 1UE9A 1UG1A 2W10A 1G2BA 2GQIA 2FRYA 1AZEA 2GBQA 1K76A 1M3BA 1PRLC 2EGEA 1SEMA 1QWFA 5IHIA 4AFSC 1UHCA 1UFFA 2JS2A 4J9EA 4M4ZA 2DBKA 2DL3A 1ABOA 3R6NA 2JW4A 1JU5C 1Z9ZA 1H8KA 1YWPA 1UECA 2PTKA 2QDLA 2LNHB 1WI7A 4QT7A 2JMAA 1QCFA 2DE0X 1AZGB 1IO6A 3JV3A 2KXCA 4WCIA 4R0KA 4RUGA 4F16A 2MIOA 2M0YA 4IIMA 1SPKA 2J6KA 2E5KA 2D8JA 4DEYA 3VS0A 1QKWA 4CC4B 2EVRA 2JS0A 1VYTA 1M8MA 4ORZA 1YNZA 1TG0A 2EYYA 3I35A 1UJ0A 2O9SA 3REAB 2RMOA 3LH5A 2CUDA 1OPKA 1ZSGA 2DL4A 4RTXA 1X2QA 3EG3A 3EGUA 1YCSB 4OMLA 1T3LA 1I07A 2DX1A 1WXUA 2RQUA 1E6GA 1RLQC 1TUCA 1B07A 3VS5A 1E6HA 2P4RA 2EW3A 3H0HA 1H92A 1GCPA 1ZLMA 2W0ZA 4JJCA 4X1VA 1PKSA 1ZBJA 2F2WA 2HEQA 2O88A 2O2OA 2CH4W 2RQVA 4AG2C 2J7IA 1HSQA 1ZUYA 2YDLA 1JQQA 1M3CA 2A37A 2OJ2A 4K11A 1M30A 2ENMA 4LUDA 2X3WD 2MCNA 2LQNA 2NUZA 1AOJA 1X69A 1FYNA 2MOXA 3EHQA 1ZUKA 2X3XD 2C0TA 3H0IA 3VS7A 1VA7A 2ESWA 4LE9A 4RTTA 5L23A 2KXDA 1GFDA 1GL5A 2V1RA 1YN8A 2RQWA 1X6BA 3VS2A 3THKA 3M0UA 2IIMA 4RTUA 1MV0B 2SEMA 2CUBA 2VWFA 2CT4A 1W1FA 1RLPC 2FPEA 2DYBA 1UJYA 4RTZA 1UHFA 2CDTA 2DL7A 5GJVB 1U5SA 2L3QA 1OOTA 5I11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WXB A;  1NG2 A;  2PZ1 A;  1GCQ C;  3TSW A;  3ZL7 C;  4JZ3 A;  1M3A A;  2A28 A;  2AKK A;  1T0J A;  5EC7 A;  2K6D A;  4Z8A A;  4Y92 A;  4J9G A;  1MV3 A;  2LQW A;  2EPD A;  3EG1 A;  3M0R A;  3VRY A;  2KEA A;  2K2M A;  2CRE A;  3M0S A;  1MUZ A;  3VS1 A;  3CQT A;  3O5Z A;  4J9I A;  1BBZ A;  3A98 A;  2KR3 A;  1WDX A;  1U3O A;  2J06 A;  1N5Z A;  1NYG A;  2BTT A;  2DLP A;  4AFQ C;  2K3B A;  2JM8 A;  5IHN A;  4ESR A;  4J9H A;  2KRO A;  2HDA A;  1BB9 A;  2AK5 A;  2KBT A;  2RQT A;  2J6F A;  1W6X A;  2KT8 A;  4JJD A;  3M0P A;  1GRI A;  4HVU A;  4D8K A;  1CSK A;  4AFU C;  4DEX A;  1NLP C;  1UUE A;  1X2K A;  1E7O A;  4GBQ A;  2ROL A;  1X27 A;  2YSQ A;  3KFV A;  2RNA A;  4KRT A;  2EBP A;  4FSS A;  2AZV A;  1WX6 A;  1CKB A;  1KSW A;  2D0N A;  4D8D A;  1SRM A;  2ED1 A;  4E6R A;  3NHN A;  1PHT A;  3EG2 A;  2KYM A;  1T3S A;  1SHG A;  2C0O A;  2EYX A;  1AD5 A;  2AKL A;  4OMM A;  2FEI A;  1WYX A;  4RTV A;  1KIK A;  1SSH A;  1A0N B;  2A36 A;  2DA9 A;  2YUQ A;  3EG0 A;  1SHF A;  2GTO A;  4CC2 A;  4AG1 C;  1WLP B;  4HVV A;  2DIL A;  1NEB A;  1GBR A;  2BZ8 A;  2DM1 A;  5FW9 A;  3H0F A;  4ZNX A;  1AWX A;  3I9Q A;  1J3T A;  2JM9 A;  2GGR A;  1NLO C;  1G83 A;  2L0A A;  4F17 A;  4Z88 A;  1OPL A;  2BZY A;  1TUD A;  1UDL A;  1I1J A;  1XOV A;  3IQL A;  4LUE A;  3RNJ A;  5GJW B;  1S1N A;  3PE0 A;  1K0S A;  2D1X A;  1NEG A;  3TVT A;  2EYZ A;  3ULR B;  4J9F A;  3M0Q A;  1HD3 A;  4LNP A;  2OAW A;  4OMO A;  3PVL A;  2NWM A;  4J9B A;  1K4U S;  1PRM C;  2K79 A;  3QWX X;  4OMN A;  2GNC A;  4HCK A;  3VRZ A;  1W70 A;  2LCS A;  3VS4 A;  5IXB A;  2JXB A;  2DRK A;  1B3Q A;  2K9G A;  2ROT A;  4J9D A;  2KRN A;  1AWO A;  4CC7 A;  2JTE A;  2DJQ A;  5IH2 A;  2CSI A;  1OV3 A;  1NYF A;  1U06 A;  2YT6 A;  2ABL A;  2EGA A;  2EYW A;  4RTY A;  2DBM A;  3QWY A;  1RI9 A;  2JMC A;  2VKN A;  1T0H A;  2FPD A;  2YUN A;  3I5S A;  1SRL A;  2YUO A;  1WFW A;  1RUW A;  2DVJ A;  2YUP A;  2VVK A;  1KFZ A;  5IHK A;  1I0C A;  4RTW A;  1NM7 A;  1HJD A;  4Z89 A;  2LJ1 A;  1QWE A;  2FPF A;  2LJ0 A;  2AZS A;  5HCK A;  2C0I A;  4IIO A;  3VS6 A;  2OI3 A;  2LX7 A;  3U23 A;  1PKT A;  3SHW A;  1ABQ A;  1KJW A;  2EGC A;  2XMF A;  3UA6 A;  1OEB A;  1WA7 A;  1JO8 A;  1ARK A;  3NPF A;  1BK2 A;  2DL5 A;  2M51 A;  1Y0M A;  1X43 A;  5IXF A;  2EKH A;  2B86 A;  3PVQ A;  2JT4 A;  1PNJ A;  2ECZ A;  2DF6 A;  1PWT A;  2LP5 A;  2KNB B;  1EFN A;  3M0T A;  2HBW A;  3NGP A;  2CH4 A;  2DL8 A;  2L3P A;  2F2X A;  4LN2 A;  2G6F X;  1JXM A;  1Z9Q A;  3GBQ A;  4A63 B;  2HCK A;  2K7A A;  4CC3 A;  3TSZ A;  2KRS A;  1K9A A;  1ZUU A;  3UF4 A;  1QLY A;  1GCQ A;  2L2P A;  2L3S A;  1GFC A;  4F14 A;  1QKX A;  1CKA A;  2ED0 A;  2O9V A;  2RQR A;  3REB B;  2KE9 A;  1BU1 A;  5FWC A;  3VS3 A;  2RF0 A;  4HXJ A;  1V1C A;  3SEM A;  5ECA A;  1AWW A;  1YWO A;  2SRC A;  2DMO A;  2F2V A;  4J9C A;  2O31 A;  4EIK A;  2I0N A;  2V1Q A;  4AFZ C;  2FRW A;  2FO0 A;  1X6G A;  1H3H A;  2DRM A;  2RN8 A;  1JXO A;  4GLM A;  3I5R A;  4OMQ A;  2EQI A;  2BZX A;  2GTJ A;  2LJ3 A;  4JJB A;  2HSP A;  1YP5 A;  2A08 A;  1AVZ C;  3NMZ C;  2CT3 A;  4OMP A;  4HVW A;  1ZX6 A;  1M27 C;  1UGV A;  3H41 A;  1Y57 A;  3C0C A;  1K0X A;  4JZ4 A;  3FJ5 A;  1K1Z A;  5I22 A;  1WXT A;  2LZ6 B;  3UA7 A;  2KT1 A;  3UAT A;  1JEG A;  1VYU A;  4JPB W;  1VYV A;  2KRM A;  2D8H A;  1GBQ A;  2H8H A;  1UTI A;  2KGT A;  2J6O A;  2PNI A;  2KYB A;  2J05 A;  1LCK A;  2DNU A;  1AEY A;  1WIE A;  3EHR A;  2CSQ A;  2LMJ A;  2RPN A;  5FWB A;  1FMK A;  3RBB B;  1AWJ A;  2FG0 A;  1UE9 A;  1UG1 A;  2W10 A;  1G2B A;  2GQI A;  2FRY A;  1AZE A;  2GBQ A;  1K76 A;  1M3B A;  1PRL C;  2EGE A;  1SEM A;  1QWF A;  5IHI A;  4AFS C;  1UHC A;  1UFF A;  2JS2 A;  4J9E A;  4M4Z A;  2DBK A;  2DL3 A;  1ABO A;  3R6N A;  2JW4 A;  1JU5 C;  1Z9Z A;  1H8K A;  1YWP A;  1UEC A;  2PTK A;  2QDL A;  2LNH B;  1WI7 A;  4QT7 A;  2JMA A;  1QCF A;  2DE0 X;  1AZG B;  1IO6 A;  3JV3 A;  2KXC A;  4WCI A;  4R0K A;  4RUG A;  4F16 A;  2MIO A;  2M0Y A;  4IIM A;  1SPK A;  2J6K A;  2E5K A;  2D8J A;  4DEY A;  3VS0 A;  1QKW A;  4CC4 B;  2EVR A;  2JS0 A;  1VYT A;  1M8M A;  4ORZ A;  1YNZ A;  1TG0 A;  2EYY A;  3I35 A;  1UJ0 A;  2O9S A;  3REA B;  2RMO A;  3LH5 A;  2CUD A;  1OPK A;  1ZSG A;  2DL4 A;  4RTX A;  1X2Q A;  3EG3 A;  3EGU A;  1YCS B;  4OML A;  1T3L A;  1I07 A;  2DX1 A;  1WXU A;  2RQU A;  1E6G A;  1RLQ C;  1TUC A;  1B07 A;  3VS5 A;  1E6H A;  2P4R A;  2EW3 A;  3H0H A;  1H92 A;  1GCP A;  1ZLM A;  2W0Z A;  4JJC A;  4X1V A;  1PKS A;  1ZBJ A;  2F2W A;  2HEQ A;  2O88 A;  2O2O A;  2CH4 W;  2RQV A;  4AG2 C;  2J7I A;  1HSQ A;  1ZUY A;  2YDL A;  1JQQ A;  1M3C A;  2A37 A;  2OJ2 A;  4K11 A;  1M30 A;  2ENM A;  4LUD A;  2X3W D;  2MCN A;  2LQN A;  2NUZ A;  1AOJ A;  1X69 A;  1FYN A;  2MOX A;  3EHQ A;  1ZUK A;  2X3X D;  2C0T A;  3H0I A;  3VS7 A;  1VA7 A;  2ESW A;  4LE9 A;  4RTT A;  5L23 A;  2KXD A;  1GFD A;  1GL5 A;  2V1R A;  1YN8 A;  2RQW A;  1X6B A;  3VS2 A;  3THK A;  3M0U A;  2IIM A;  4RTU A;  1MV0 B;  2SEM A;  2CUB A;  2VWF A;  2CT4 A;  1W1F A;  1RLP C;  2FPE A;  2DYB A;  1UJY A;  4RTZ A;  1UHF A;  2CDT A;  2DL7 A;  5GJV B;  1U5S A;  2L3Q A;  1OOT A;  5I11 A; 
#chains in the Genus database with same CATH topology
 4A4H A;  2PZ1 A;  4QVD A;  5D7U A;  2K5L A;  4JLI A;  2AKK A;  1T0J A;  5EC7 A;  4Z8A A;  2D9T A;  1VQ9 A;  4EMG A;  5CKF A;  1W2B A;  4J9G A;  5L8R E;  4IUP A;  4AT1 B;  1QP3 A;  2EWN A;  4MZP A;  3QSU A;  3FIF A;  5KYX B;  4X34 A;  5GAN j;  3M0S A;  4JLG A;  3CPW A;  2CZ1 B;  5LJ3 h;  3V7C A;  3OQ5 A;  1N5Z A;  2DVE A;  4ZGE B;  2G3R A;  4AFQ C;  2JM8 A;  2F1L A;  2YHT A;  2KRO A;  1FWZ A;  1V76 A;  2HQH A;  1VQP T;  4HCC A;  4KGZ B;  4OB0 B;  4IUT A;  2J6F A;  3C94 A;  3JAM E;  1GRI A;  1QVF S;  1RL2 A;  4DEX A;  1UUE A;  1X2K A;  3E19 A;  1YHQ T;  4N0A C;  4FSS A;  4BE0 A;  5DLO A;  3L2R A;  1VQ5 A;  5CQX A;  1VIF A;  2AZV A;  1MMN A;  1KSW A;  2D0N A;  5C6S A;  2VGN A;  1SRM A;  2RD1 A;  5J26 A;  1YIT T;  2E12 A;  5I2M A;  2DJZ A;  3G71 A;  1QVG A;  1W2B S;  2JOY A;  1SHG A;  2EYX A;  1AD5 A;  5GAN 8;  2K5I A;  4OMM A;  1WYX A;  3M59 A;  3FEO A;  3EG0 A;  1SHF A;  3CPW S;  4M7A B;  2ZCF B;  1B34 B;  2MF2 A;  1NEB A;  1GBR A;  4JRQ A;  3I56 T;  3QPH A;  3LLR A;  1AWX A;  1VQ6 T;  2NYS A;  3DLM A;  2GGR A;  1G83 A;  4F17 A;  4J8O A;  3QZ5 B;  1OX9 A;  5KYY B;  4JDS A;  4LUE A;  2LT1 A;  5HK3 A;  3PNW C;  4QQ6 A;  3WXM B;  2DO3 A;  3ULR B;  4KH0 B;  4PFZ A;  3H8Z A;  4J9F A;  2CZ0 B;  2EJ9 A;  2OAW A;  1RAH B;  4OMO A;  2RK2 A;  3CCJ Q;  1RAD B;  2GF7 A;  1WHH A;  2K79 A;  8ATC B;  1PSF A;  2CP5 A;  3VRZ A;  1AT1 B;  1VQ7 A;  3HSB A;  1W70 A;  2JXB A;  4OVA A;  2DIQ A;  1B3Q A;  1AHJ B;  3EG9 B;  2KRN A;  1AWO A;  1QVG S;  1Y07 A;  4CC7 A;  5IH2 A;  2CSI A;  2CGH A;  2E3H A;  5KYW A;  3R6O A;  2YT6 A;  1QMC A;  4RTY A;  1ZBX A;  2DBM A;  4IUQ A;  1O75 A;  4XK8 E;  1ZA1 B;  3A8G B;  2FPD A;  4HT9 A;  4LXC A;  1SRL A;  4XQ3 A;  1RUW A;  3QYG B;  2NUP B;  3GLX A;  3RDV A;  2YUP A;  4A4E A;  4XTV A;  5HKC A;  1KFZ A;  1PG5 B;  2YLB A;  2GFA A;  3CCR A;  4BDY A;  1HJD A;  3MPU B;  4Z89 A;  2L3R A;  3TCJ A;  4C5E A;  2RI5 A;  4ME7 A;  2DK3 A;  1YJ9 Q;  2M0O A;  1O9S A;  4EMH A;  2X51 A;  4IIO A;  3VS6 A;  2P0P A;  2LX7 A;  2CP7 A;  3BFM A;  2OTL Q;  2K57 A;  3SHW A;  4UC4 A;  3X20 B;  5A2Q E;  1JO8 A;  2XG8 D;  1YJN T;  5DLQ E;  1ARK A;  1LPL A;  1X43 A;  2NUT B;  4VUB A;  4IUV A;  1WJQ A;  3MO8 A;  2B86 A;  3G71 T;  2JT4 A;  3QHS A;  3P8H A;  5DY9 A;  3AHU A;  2FZG B;  1NJI R;  3CCE T;  2QG9 B;  1FX7 A;  3PT9 A;  4M75 F;  4C5I A;  4C8Q G;  4XTW A;  3CC2 A;  3X24 B;  2CP3 A;  5CR2 A;  3EFO B;  5CKE A;  2YRC A;  3PIO A;  1UGR B;  4CC3 A;  3UF4 A;  1QLY A;  4GY5 A;  1GFC A;  1KHC A;  1QKX A;  2O9V A;  1PCX A;  2P84 A;  1BU1 A;  3VS3 A;  2RF0 A;  4FYV B;  1M1K R;  3NTI A;  4OGE A;  1AWW A;  2SRC A;  2DMO A;  3ZFJ A;  3CCU A;  4LDW A;  3M9Q A;  1SG5 A;  1X6G A;  2QYZ A;  2E41 A;  2DRM A;  2COY A;  2K4Y A;  4GLM A;  3I5R A;  1Q86 U;  3JCM g;  4F7U B;  2QTV A;  4X9C A;  1YP5 A;  1AVZ C;  3NMZ C;  5GMK l;  1ZX6 A;  1ZSZ B;  2WAC A;  2OTJ T;  3CCS Q;  1BI1 A;  4QQD A;  5I22 A;  4QQG A;  2P0Q A;  2KT1 A;  1VYU A;  2EIF A;  1D1B A;  1X01 A;  1GBQ A;  4PFO A;  2J6O A;  2KYB A;  2J05 A;  5HK0 A;  2DNU A;  1KD1 C;  2RPN A;  3RBB B;  2A7Y A;  5GAO q;  1G3S A;  1UG1 A;  2W10 A;  2H3E B;  2FRY A;  5LJ5 d;  3EGD B;  4M7D A;  4FIB A;  1PRL C;  4FW2 A;  3DKM A;  1SEM A;  4RKU E;  5D6W A;  5AYF A;  1M1G A;  5GAN e;  3L2V A;  5FRO A;  1M90 U;  1VQL A;  2JW4 A;  1JU5 C;  3RIR A;  2PTK A;  2LNH B;  1BCM A;  3PTA A;  2JNG A;  1IZ6 A;  5GMK m;  3JV3 A;  2KXC A;  4WCI A;  4R0K A;  2LQK A;  1Q82 U;  3CCL A;  1M4Z A;  3MEW A;  3PMT A;  4LDY A;  2J6K A;  3QXE B;  1N8R U;  1QKW A;  2EVR A;  2JS0 A;  1I5L A;  1M8M A;  1YNZ A;  2EYY A;  1UJ0 A;  4ELY C;  1YIT Q;  4KBM B;  3REA B;  2LDM A;  2A3L A;  1P92 A;  2RM4 A;  1G3Y A;  5CVI A;  4DOW A;  2DYI A;  1TOV A;  1OPK A;  1R0C B;  1R77 A;  3AT1 B;  1IHV A;  1X2Q A;  4M7D G;  1RAE B;  3EGU A;  3RKX A;  1I07 A;  2DX1 A;  1C6V X;  2AHJ B;  4FYW B;  3OSV A;  1B07 A;  3VS5 A;  2MAM A;  1VUB A;  4BI8 B;  3WVD B;  1H92 A;  3E1S A;  4BY6 C;  4JJC A;  2DTO A;  1YFN A;  4V2S A;  2KSS A;  3OS0 A;  1D1A A;  2F2W A;  2HEQ A;  3CCU T;  4AG2 C;  2X4W A;  5CKD A;  3JB9 I;  1VQ4 T;  2X4Y A;  1VQ6 Q;  3VUB A;  4QVC A;  4A54 A;  1M3C A;  2OJ2 A;  4K11 A;  2NUZ A;  4L6V 5;  2V26 A;  3SFM A;  4E7I A;  2EAY A;  3JB9 F;  3BE3 A;  2XDD A;  4BY6 B;  3OYJ A;  4ZGD B;  5L23 A;  3NTH A;  1IGQ A;  2DFU A;  4P5N A;  2MPX C;  1GL5 A;  4PJO C;  1SF9 A;  3OYL A;  1X6B A;  3VS2 A;  2YWW A;  4KH1 B;  1WHK A;  1IGU A;  4RTU A;  1FXX A;  3JCM J;  1VQ9 Q;  1KC8 R;  1M1F A;  1WHL A;  4M75 B;  1K8A R;  2VWF A;  2CT4 A;  2FPE A;  3OYA A;  1OI1 A;  3VYH B;  2DD5 A;  5GAM d;  2M9U A;  2E70 A;  4M78 A;  2DKG A;  3LW5 E;  2EKO A;  5GMK i;  4PJO B;  4LDU A;  5GAO r;  1WXB A;  1OZ3 A;  1GCQ C;  4MMK A;  1VQL T;  3ZL7 C;  2A28 A;  4MZM A;  4PL6 A;  3RES A;  2K6D A;  1XJW B;  1R0B G;  2DIG A;  2RHZ A;  1KG1 A;  4XU3 A;  4GLK A;  3M0R A;  1I5O B;  4J5Y A;  3VRY A;  5FRM A;  4ZN1 A;  3JCM e;  1M90 C;  3CCL T;  2K2M A;  2RHY A;  3SWN C;  5LJ5 j;  1BI2 A;  1PC0 A;  5EG2 A;  3O5Z A;  4J9I A;  1VQ5 Q;  2ZPF B;  4HCB A;  1FMW A;  2E10 A;  4WTO B;  2GFU A;  2BTT A;  3PGG A;  1YJN Q;  5GAN h;  2JJ9 A;  2O01 E;  5IHN A;  1SKU B;  3X28 B;  3G71 Q;  1YJ9 T;  1BB9 A;  1N8R C;  4M78 G;  3J7A F;  2OTL T;  1NLP C;  3JCM b;  3H9N A;  1VOM A;  1E7O A;  4GBQ A;  2I2L A;  3JCM P;  2ROL A;  1X27 A;  3A8O B;  2XHC A;  3CME A;  4E47 A;  4Z02 A;  4D8D A;  3OYB A;  4C92 C;  2ED1 A;  5A0G A;  2KY9 A;  3CEY A;  1R8O B;  4M75 D;  1XNI A;  1VQN A;  3NHN A;  1PHT A;  3EG2 A;  4N4I A;  4J7F A;  1NPP A;  2MWO A;  4M77 A;  2ZPH B;  2FEI A;  1KIK A;  2ZPE B;  1Q7Y R;  4PJO D;  2PUK B;  4FT4 A;  2YUQ A;  2GTO A;  3QUI A;  1PD0 A;  4C92 B;  4M7A E;  4HVV A;  3A5Z B;  5FU6 C;  3QDF A;  5GMK j;  2DM1 A;  2OTJ Q;  4ZNX A;  2LRQ A;  4OB2 B;  3I9Q A;  4ATO A;  5LJ5 g;  3L42 A;  4Z88 A;  2HKQ B;  1TUD A;  1UDL A;  4TVR A;  2QEX A;  3E9F A;  3KXT A;  3OS1 A;  1U1T A;  2DEQ A;  4BE2 A;  1S1N A;  1VQM T;  1K0S A;  2D1X A;  2FVU A;  3QII A;  5FU6 B;  3RMS A;  2DXB A;  1HD3 A;  4EMK B;  2BE9 B;  5GAM f;  4J9B A;  1EIF A;  3QWX X;  4OMN A;  3HP9 A;  1H3Z A;  3MET A;  2RH2 A;  1OQK A;  2LCS A;  3CCR Q;  5IXB A;  5HY6 A;  1BIA A;  1LOJ A;  2Y4X A;  2K9G A;  4J6X A;  4M77 G;  2ZPB B;  1YI2 A;  1U1S A;  4BE1 A;  2HL5 C;  1Q81 U;  2EYW A;  3L2U A;  5GAM j;  3QWY A;  1RI9 A;  2JMC A;  2HL3 A;  1M1K C;  4M7A A;  2QDY B;  4KUI A;  2DVJ A;  2QXF A;  1I4K 1;  2VVK A;  5IHK A;  1PM3 A;  2ZGW A;  4RTW A;  1NM7 A;  3N5B B;  1TS9 A;  2DZ9 A;  2LJ0 A;  1M9S A;  1Q86 R;  2M1H A;  5HCK A;  1TH7 A;  5KYY A;  5KYN A;  3CC2 Q;  1VQK T;  3JCM h;  1KC8 U;  3U23 A;  4C92 D;  1K8A U;  1BI0 A;  1KJW A;  2EGC A;  3UA6 A;  3QYH B;  3UT1 A;  1G3T A;  1WA7 A;  3A8H B;  4F7U F;  2KK4 A;  2A0F B;  2ZZD A;  2DL5 A;  1Y0M A;  2Y90 A;  1UEB A;  1VQN T;  3HFN A;  4DBF A;  3PVQ A;  1MHN A;  1PNJ A;  2EYQ A;  3V8L A;  1M5Q 1;  2ECZ A;  3LYI A;  2LP5 A;  2KNB B;  1UGQ B;  4XU2 A;  2HBW A;  3CCU Q;  3EG9 A;  3OYC A;  2CH4 A;  4E7J A;  4J7I A;  2BIV A;  1VQ4 Q;  2KDS A;  2G6F X;  3CMA A;  2HCK A;  4M7A G;  1WHM A;  3GPL A;  1K9A A;  2QQ9 A;  3TU4 K;  2L2P A;  4O6J A;  2PVG B;  2CKK A;  2F69 A;  4DBR A;  2ED0 A;  4PK4 A;  5GAM g;  1M90 R;  1IB8 A;  4BD3 A;  4HXJ A;  5ECA A;  3X26 B;  2DER A;  4J9C A;  4X9D A;  1S72 A;  2V1Q A;  2FRW A;  3JB9 D;  1H3H A;  2VB6 A;  1LNX A;  2RN8 A;  2EFI A;  4F7U E;  2LJ3 A;  2KI7 A;  1Q82 R;  3CC4 A;  4HVW A;  1M27 C;  1UGP B;  1BCO A;  1C1A A;  1N8R R;  5I2S A;  3FJ5 A;  1K1Z A;  3E2U A;  4NS5 A;  3MEU A;  3UAT A;  1VYV A;  1VQ9 T;  1UTI A;  3QG1 A;  3JCM X;  2PNI A;  1VQL Q;  2E4H A;  1WIE A;  3EHR A;  1QP2 A;  5LJ3 f;  2CSQ A;  1FMK A;  1WNL A;  4DA4 A;  2FG0 A;  1Y71 A;  3CBO A;  3CD6 A;  1UE9 A;  5KE2 A;  2QQR A;  3VJP A;  2F5K A;  2ZAE A;  3CCL Q;  1Q7Y U;  1VQ8 A;  1QWF A;  2F5T X;  4J83 A;  4NL2 A;  4FYX B;  4AFS C;  2FB7 A;  3OYK A;  1UFF A;  1KQS P;  4J9E A;  5CIU A;  1TTH B;  5LL6 S;  5LJ5 e;  1Z9Z A;  3TEE A;  2LNV A;  1UEC A;  5GAN 6;  1QCN A;  2VAS A;  1OU8 A;  1WI7 A;  1TU0 B;  4QKU A;  3VYG A;  2DE0 X;  1XQH A;  2DXU A;  5FRN A;  3CCV A;  1IO6 A;  4RUG A;  4YTL A;  2MIO A;  3EFS A;  1VQ5 T;  4IIM A;  1SPK A;  1ZSZ A;  3M57 A;  1KC8 C;  2D8J A;  3G6E A;  2WSF E;  1K8A C;  4CC4 B;  5GAN 2;  4L59 A;  3L1A A;  1FMV A;  2O9S A;  2PVO B;  4D6W A;  1YBY A;  3ER0 A;  4RTX A;  1BKB A;  4NOY A;  3EG3 A;  1YCS B;  3EGX B;  4C8Q C;  1WXU A;  3LWH A;  2DZC A;  4RG8 A;  1RAI B;  3EGD A;  3UPU A;  3OBY A;  1KHI A;  4PJO F;  3MCA B;  8AT1 B;  1ZLM A;  2LCC A;  3O8V A;  4A4F A;  1ZBJ A;  2RQV A;  4XU0 A;  1HSQ A;  4XTY A;  4IUU A;  4KGX B;  3RKY A;  4C8Q B;  4LUD A;  5GMK e;  3CC4 T;  2MCN A;  1X69 A;  2MOX A;  1QVP A;  3EHQ A;  1ZUK A;  1TWB A;  1VQM Q;  3TQ7 P;  3JB9 J;  2X3X D;  3H0I A;  4LE9 A;  4BDZ A;  1IRE B;  2CP0 A;  3V8J A;  1GFD A;  4FL6 A;  1VQ7 T;  1YN8 A;  2QQA A;  2D0Q B;  2RQW A;  2V8K A;  5C0M A;  2Y4Y A;  2GCX A;  1K9M U;  4IUR A;  3CPF A;  1D3B B;  3I55 A;  2SEM A;  4M75 E;  3FLG A;  4OGC A;  3JCM V;  3OYG A;  2RJF A;  2XD0 A;  2DYB A;  3S6W A;  1UJY A;  4RTZ A;  1Y96 B;  3P8D A;  2L3Q A;  3QZ9 B;  4PJO E;  3BDL A;  2Z0W A;  4JUV A;  3QO3 A;  4BI3 A;  1G5V A;  1NG2 A;  5IT9 E;  4Q5W A;  2HD0 A;  3CCR T;  4JZ3 A;  1M3A A;  1C0M A;  1N9S A;  2X35 A;  5J39 A;  1Q7Y C;  3MKD A;  2HMA A;  1WJS A;  4OF1 A;  4Y92 A;  3C12 A;  2EJF A;  4B9W A;  3CC7 A;  3PIP A;  1NZ9 A;  2LQW A;  4PNO A;  3CCV T;  3EG1 A;  4C0G A;  2CZ6 B;  4OMF B;  1F1B B;  2KEA A;  1YIJ A;  2CRE A;  2XID A;  4KGV B;  1VQK Q;  5A0D A;  4OB3 B;  2LVM A;  3ZEH A;  3VS1 A;  2COZ A;  3G6E T;  1BBZ A;  4LDX A;  4F04 B;  2KR3 A;  2J06 A;  2DD4 A;  4C92 F;  1NYG A;  3QJY A;  2DLP A;  4C5H A;  4PJN A;  2K3B A;  5LJ5 h;  2KVQ G;  1LJO A;  2MMP A;  1VQN Q;  3MEA A;  4C8Q D;  2HDA A;  2AK5 A;  2ZPG B;  2KBT A;  5CKB A;  2E65 A;  3LH0 A;  2RQT A;  3GIB A;  3A8L B;  1W6X A;  2KT8 A;  4M75 A;  4JJD A;  3CC2 T;  4LD9 K;  4HVU A;  3OBW A;  1KQS A;  1JBM A;  4FYY B;  2YSQ A;  1QCO A;  2L5Q A;  4M7D C;  2LT4 A;  3BY7 A;  3SB2 A;  1IXD A;  2FYK A;  2XKO C;  5D6Y A;  3OS2 A;  1OUL A;  1HYO A;  5M9O A;  5GAO p;  4E6R A;  1YJW A;  3FRN A;  3MHX A;  2E3I A;  3VKI A;  3SD4 A;  1BI3 A;  1Q81 R;  3DLL A;  1KK7 A;  5IN1 A;  1WHJ A;  4E7Z A;  4RTV A;  3LGL A;  2A36 A;  2ZPI B;  1RAG B;  4MZT A;  4C92 E;  2HQX A;  4HCZ A;  5CK9 A;  3CCM A;  1QVF P;  5FW9 A;  2NLU A;  2RK1 A;  5KH6 A;  1Q86 C;  3FJP A;  1J3T A;  2JM9 A;  1NLO C;  3I55 T;  1Q95 G;  2VV5 A;  5GMK h;  3V8K A;  3IQL A;  3RNJ A;  2QA4 A;  4JRK A;  1ZQ1 A;  1YI2 Q;  2WSE E;  3PE0 A;  3OYE A;  3TVT A;  1K9M C;  2EYZ A;  4KT0 E;  1ZHI A;  1KQS S;  1I8F A;  1JRI A;  3FB9 A;  3OMG A;  1W2B P;  4LNP A;  1MMG A;  2GQV A;  1H64 1;  2NWM A;  3FDR A;  2KMT A;  4OP0 A;  4HT8 A;  2GNC A;  1N6A A;  2O4X B;  2R5M A;  5KYU A;  1VIE A;  3VS4 A;  3CC7 T;  2DRK A;  2ROT A;  1RAF B;  2YRV A;  2JTE A;  1N9R A;  1GXI E;  4HKE A;  1NYF A;  3DB4 A;  5GAN d;  2HSE B;  1YIJ T;  2EGA A;  2K3X A;  3V7R A;  4CRI A;  3MJX A;  2VKN A;  2EQJ A;  1OX8 A;  3LGF A;  1OU9 A;  5GAM h;  3M58 A;  3ASK A;  3ZBD A;  2XU8 A;  3H6Z A;  1Q82 C;  2YRD A;  4XTX A;  1QWE A;  2FPF A;  3OYI A;  3JSC A;  1JJ2 P;  1MMD A;  4M7D D;  2AZS A;  3SWN B;  1EX4 A;  1PKT A;  3OYD A;  2PQW A;  3OA6 A;  1QVG P;  4M78 C;  1OEB A;  3M4G A;  1K73 U;  3URG A;  3FC3 A;  1BK2 A;  2M51 A;  4EMK A;  5IXF A;  5CKH A;  1OZ2 A;  2JTM A;  1I81 A;  2EKH A;  1M2V B;  2DF6 A;  1PWT A;  2BE7 D;  4E7K A;  1EFN A;  2E6N A;  3M0T A;  3QKJ A;  3JCM Q;  1VQP A;  2VC8 A;  3LWI A;  5GAN 5;  3G4S A;  1S72 Q;  3NTK A;  1NBE B;  4M78 B;  2L3P A;  2F2X A;  4LN2 A;  3GBQ A;  3KBG A;  3CC4 Q;  4BB7 A;  2E1H A;  2K7A A;  1QQJ A;  2OX7 A;  1YHQ A;  3RR6 A;  2R58 A;  5KYX A;  1JB0 E;  3TSZ A;  2KRS A;  1ZUU A;  2RQR A;  2JUF A;  2KE9 A;  2XDP A;  5FWC A;  3REB B;  3BDU A;  1YIT A;  1VQ7 Q;  1YWO A;  2F2V A;  5KCH A;  4EIK A;  3PFS A;  2DPP B;  2EQK A;  4BAC A;  1JXO A;  6AT1 B;  1WGS A;  2EQI A;  2BZX A;  2GTJ A;  2DEU A;  3HTR A;  2R57 A;  2COW A;  4O5V A;  2A08 A;  4R56 A;  1KQ1 A;  4OMP A;  1WJR A;  1UGV A;  1VQ8 Q;  2V8I A;  1K0X A;  4JZ4 A;  2HQE A;  1TXQ A;  2YLC A;  2KQW A;  3I56 A;  1WXT A;  4E7L A;  1JEG A;  5CQY A;  3A8M B;  5GAN 4;  2KRM A;  2D8H A;  1VQ6 A;  2QTX A;  5GAO n;  5LJ3 d;  1LCK A;  1AEY A;  1Y7X A;  2PUO B;  2JVV A;  5GAO l;  2LC4 A;  2LMJ A;  5FWB A;  4M77 C;  3SDZ A;  3CCV Q;  2GQI A;  4N0A A;  2GBQ A;  3P8B B;  5GAN f;  3HRT A;  4JS5 A;  3JCM d;  1B34 A;  3G6E Q;  1UHC A;  2QAZ A;  2JS2 A;  2DBK A;  2DL3 A;  1WZO A;  4M77 B;  3L2Z A;  4M78 D;  4ANJ A;  2DET A;  3M53 A;  1X75 C;  4B9X A;  3CXC P;  1MGQ A;  1EZZ B;  2JMA A;  2M16 A;  1QCF A;  4JJN K;  4C8Q F;  2V8J A;  1G3W A;  3CME T;  2AT1 B;  1VQO A;  3JRZ A;  3X25 B;  4DEY A;  1K9M R;  1SSF A;  1VYT A;  3MEV A;  1K73 C;  4ORZ A;  3QDR B;  1TG0 A;  7AT1 B;  1V29 B;  1XTD A;  2RHX A;  3G4S T;  3NFC A;  5GAO m;  3J81 E;  4PJJ A;  2RMO A;  2H3J A;  3LH5 A;  2CUD A;  4A4G A;  1D0Y A;  3INZ A;  4NL3 A;  2RI2 A;  4OML A;  1E6G A;  1RLQ C;  1JJ2 A;  1TUC A;  1E6H A;  2K5F A;  2EW3 A;  1YJN A;  3H0H A;  4M7A C;  3S3M A;  1GCP A;  2W0Z A;  1PKS A;  3G7Z A;  2O2O A;  2CH4 W;  4PJL A;  2DXT A;  2NUP A;  3OYN A;  1ZUY A;  3VV0 A;  3CCQ A;  2QEX T;  2A37 A;  3CCE A;  3I55 Q;  1M30 A;  2ENM A;  4PKC C;  2X3W D;  4C8Q E;  2RA2 A;  1FYN A;  4XU1 A;  2MYS A;  2JZ2 A;  2K3Y A;  2QQB A;  4RTT A;  3OY9 A;  2LX9 A;  4II1 A;  3DB3 A;  3UWN A;  2HKN A;  9ATC B;  2KXD A;  4Y91 A;  5GAN g;  2DTI A;  3JCM W;  3F70 A;  2IVW A;  4M77 D;  2NUT A;  1UB4 A;  4B6M A;  1MV0 B;  4C5G A;  2HBP A;  3CC7 Q;  2CUB A;  1YI2 T;  2QK0 A;  2RJD A;  1W1F A;  2CYZ B;  1RLP C;  1WQ7 A;  3M55 A;  2EQM A;  1UHF A;  2DL7 A;  5GJV B;  5CO7 A;  1YIJ Q;  1U5S A;  3UDC A;  4C0D C;  2K2V A;  1OOT A;  5I11 A;  1JJ2 S;  3EGX A;  4C0F A;  2IG0 A;  2OTJ A;  1KD1 U;  5KCO A;  3EFO A;  4DQ2 A;  2DAQ A;  4JRP A;  3HKS A;  1Q81 C;  2DXC A;  1WQW A;  3TSW A;  4R55 A;  5FU7 C;  2LQ8 A;  4WF2 A;  2VXE A;  3BW1 A;  3JCM f;  3GNF B;  5LJ3 j;  1MV3 A;  2EPD A;  3CBP A;  4C0D B;  1IHW A;  2PVD B;  4C8Q A;  2EQU A;  1IRX A;  1VQO T;  4M7D F;  1MUZ A;  2E5Q A;  5FU7 B;  4F7U A;  3L2Q A;  3CQT A;  3A98 A;  1WDX A;  1U3O A;  1BYM A;  1RAA B;  4BUG A;  3EH1 A;  4A4K A;  2PU9 B;  4ESR A;  1X6O A;  4J9H A;  3M5A A;  1NE8 A;  1YJW Q;  3C4S A;  3OW2 P;  3OB9 A;  1TSF A;  2P0K A;  2CS7 A;  1D3B A;  3V7S A;  2RHI A;  4M7A D;  3CMA T;  3M0P A;  4D8K A;  1CSK A;  2MK5 A;  4AFU C;  1D1C A;  3KFV A;  4KRT A;  1Y96 A;  2RNA A;  2EBP A;  5I21 A;  1WX6 A;  1CKB A;  3CCM Q;  3CXC A;  3D7S B;  1DJ7 B;  3QJ6 A;  3CCQ T;  3MP8 A;  4OB1 B;  5KYW B;  1S72 T;  2BKD N;  3RKW A;  2KYM A;  2M02 A;  4MDW A;  4N4G A;  4AMC A;  1T3S A;  4C0Z A;  2C0O A;  2CZ7 B;  1PD1 A;  2AKL A;  2IPO B;  2QA4 Q;  1KQ2 A;  3HL8 A;  3MP1 A;  4M7D E;  1SSH A;  3OYM A;  1ZA2 B;  1A0N B;  4F7U G;  2DA9 A;  4E7S A;  2HAX A;  1UGS B;  5LJ3 g;  4CC2 A;  4AG1 C;  1WLP B;  2FHD A;  1HXD A;  2DIL A;  3HRU A;  2BZ8 A;  5FLX E;  3PMI A;  3H0F A;  1ZSZ C;  1RAC B;  2QI2 A;  4XTU A;  2FZC B;  2WSC E;  3OMC A;  2L0A A;  4MML A;  3GF5 A;  1OPL A;  2BZY A;  3GOX A;  1VQ4 A;  4BI4 A;  1I1J A;  1QW1 A;  1XOV A;  3ME9 A;  5GJW B;  2R5A A;  2L8D A;  3TRE A;  3CD6 T;  2XI9 A;  1NEG A;  1K73 R;  3M0Q A;  3OYY A;  2MI6 A;  2X4J A;  1MNE A;  3PVL A;  2CP6 A;  1VQ8 T;  1K4U S;  4FT2 A;  4IKF A;  1PRM C;  1LVK A;  1PSE A;  4HCK A;  3CXC S;  3CBM A;  3L2W A;  3M4Y A;  1NPR A;  4L5G A;  4RG2 A;  4DBH A;  5GAM e;  4PFP A;  4J9D A;  4JRI A;  2DJQ A;  4Y28 E;  1OV3 A;  2DTH A;  3M54 A;  4XTZ A;  1U06 A;  2ABL A;  2RB6 A;  4M78 F;  3M56 A;  1T0H A;  2RHU A;  3CCJ A;  2YXY A;  3G1J A;  2XIC A;  2YUN A;  3I5S A;  2YUO A;  2B8A A;  1WFW A;  2QAS A;  3CME Q;  2D6F A;  1I0C A;  3RER A;  2L89 A;  3EAE A;  5KE3 A;  2LJ1 A;  1VQP Q;  3G4S Q;  2C0I A;  4ZTJ A;  2OI3 A;  2RJE A;  1MND A;  4FW1 A;  1ABQ A;  2XMF A;  1YHQ Q;  4XAX B;  3RMQ A;  3LX7 A;  3NPF A;  4PJO A;  3C95 A;  4PLI A;  3EFR A;  3A1P A;  2O4X A;  1YCY A;  1WPY A;  4FCY A;  4J6Y A;  2VXF A;  1YJ9 A;  3NGP A;  2DL8 A;  4M78 E;  4DOV A;  2QEX Q;  1JXM A;  1Z9Q A;  2OTL A;  4MDX A;  4A63 B;  4M7D B;  4HA8 A;  3OW2 A;  1D0Z A;  2X9H A;  4LDV A;  4FU6 A;  1GCQ A;  2L3S A;  1TUG B;  4F14 A;  1M2O A;  1CKA A;  3I56 Q;  1N27 A;  2CP2 A;  3HRS A;  4E2F B;  1W4S A;  1ACM B;  1V1C A;  3SEM A;  3QBY A;  3MP6 A;  2RJC A;  2O31 A;  1WHG A;  2I0N A;  4AFZ C;  4M77 F;  4M75 G;  1OYX A;  2FO0 A;  2MWP A;  4OMQ A;  4M75 C;  4QVZ A;  3HFO A;  3HHT B;  4JJB A;  3SWN A;  2HSP A;  2XDB A;  3JB9 H;  2CT3 A;  4PJO G;  4DBQ A;  3HPW A;  4RCC A;  3H41 A;  1Y57 A;  3C0C A;  2KAF A;  2ATC B;  2LZ6 B;  2LCL A;  4N4H A;  4EPC A;  3UA7 A;  4RMO A;  4JPB W;  3OS5 A;  2QGG A;  2QGF B;  2E64 A;  3CPW P;  2H8H A;  3RUX A;  1BIB A;  2KGT A;  1M2V A;  4PJM A;  2VGM A;  5CAI A;  2BUD A;  2P4T A;  1NJI U;  1AWJ A;  2EJG A;  4E7H A;  1VQM A;  1U8R A;  5CCA A;  3CCJ T;  3GNG A;  1G2B A;  1AZE A;  1K76 A;  3OW2 S;  2FL7 A;  4RCB A;  3JCM c;  3Q1J A;  2X4X A;  5LJ3 e;  3CCS A;  1M3B A;  5LJ5 f;  5GAN 7;  2EGE A;  1VQO Q;  5IHI A;  2XK0 A;  5J3B A;  4FSX A;  4C92 A;  1D09 B;  4M4Z A;  1ABO A;  4M77 E;  3R6N A;  1H8K A;  1YWP A;  1M1K U;  2QDL A;  3OYF A;  2QQS A;  4QT7 A;  3VU3 C;  1AZG B;  3CMA Q;  2LTO A;  4F16 A;  2JN0 A;  4M7A F;  2M0Y A;  3GP8 A;  2E5K A;  5D6X A;  2C06 A;  1HK9 A;  2VYT A;  3VS0 A;  2RO0 A;  3KUF A;  1YJW T;  2OAU A;  4QW2 A;  3I35 A;  2JTF A;  4FM4 B;  3CCQ Q;  4KUL A;  3CCE Q;  3VUZ A;  1G8X A;  1ZSG A;  2DL4 A;  3OYH A;  1VQK A;  3WVE B;  1T3L A;  2RQU A;  5GAN 3;  1KD1 R;  3OSS C;  4C92 G;  2P4R A;  5KYU B;  2FZK B;  3S3N A;  3CCM T;  4KUD K;  1D0X A;  4X1V A;  2O88 A;  3T9N A;  4LD6 A;  2J7I A;  5DM7 R;  2YDL A;  1JQQ A;  2QA4 T;  2LQN A;  3J80 E;  5IAY A;  1AOJ A;  4ZN3 A;  5A0L A;  3EH2 A;  4ZTF A;  3CD6 Q;  2C0T A;  3VS7 A;  1RI0 A;  1VA7 A;  4EDU A;  2ESW A;  1B7T A;  4EMK C;  2V1R A;  2HZY A;  3THK A;  3M0U A;  2IIM A;  3S3O A;  1RAB B;  4ELZ C;  2E6Z A;  2AIR B;  5AT1 B;  3E9G A;  1MMA A;  4PLL A;  1QVF A;  1M8V A;  2CDT A;  3JB9 G;  4J6W A;  2VUB A;  3CCS T;  4A53 A;  4ZGJ B;  2RI3 A;  4JS4 A;  1NJI C;  4CI0 C;  2HNI A; 
#chains in the Genus database with same CATH homology
 1WXB A;  1NG2 A;  2PZ1 A;  1GCQ C;  3TSW A;  3ZL7 C;  4JZ3 A;  1M3A A;  2A28 A;  2AKK A;  1T0J A;  5EC7 A;  2K6D A;  4Z8A A;  4Y92 A;  4J9G A;  1MV3 A;  2LQW A;  2EPD A;  3EG1 A;  3M0R A;  3VRY A;  2KEA A;  2K2M A;  2CRE A;  3M0S A;  1MUZ A;  3VS1 A;  3CQT A;  3O5Z A;  4J9I A;  1BBZ A;  3A98 A;  2KR3 A;  1WDX A;  1U3O A;  2J06 A;  1N5Z A;  1NYG A;  2BTT A;  2DLP A;  4AFQ C;  2K3B A;  2JM8 A;  5IHN A;  4ESR A;  4J9H A;  2KRO A;  2HDA A;  1BB9 A;  2AK5 A;  2KBT A;  2RQT A;  2J6F A;  1W6X A;  2KT8 A;  4JJD A;  3M0P A;  1GRI A;  4HVU A;  4D8K A;  1CSK A;  4AFU C;  4DEX A;  1NLP C;  1UUE A;  1X2K A;  1E7O A;  4GBQ A;  2ROL A;  1X27 A;  2YSQ A;  3KFV A;  2RNA A;  4KRT A;  2EBP A;  4FSS A;  2AZV A;  1WX6 A;  1CKB A;  1KSW A;  2D0N A;  4D8D A;  1SRM A;  2ED1 A;  4E6R A;  3NHN A;  1PHT A;  3EG2 A;  2KYM A;  1T3S A;  1SHG A;  2C0O A;  2EYX A;  1AD5 A;  2AKL A;  4OMM A;  2FEI A;  1WYX A;  4RTV A;  1KIK A;  1SSH A;  1A0N B;  2A36 A;  2DA9 A;  2YUQ A;  3EG0 A;  1SHF A;  2GTO A;  4CC2 A;  4AG1 C;  1WLP B;  4HVV A;  2DIL A;  1NEB A;  1GBR A;  2BZ8 A;  2DM1 A;  5FW9 A;  3H0F A;  4ZNX A;  1AWX A;  3I9Q A;  1J3T A;  2JM9 A;  2GGR A;  1NLO C;  1G83 A;  2L0A A;  4F17 A;  4Z88 A;  1OPL A;  2BZY A;  1TUD A;  1UDL A;  1I1J A;  1XOV A;  3IQL A;  4LUE A;  3RNJ A;  5GJW B;  1S1N A;  3PE0 A;  1K0S A;  2D1X A;  1NEG A;  3TVT A;  2EYZ A;  3ULR B;  4J9F A;  3M0Q A;  1HD3 A;  4LNP A;  2OAW A;  4OMO A;  3PVL A;  2NWM A;  4J9B A;  1K4U S;  1PRM C;  2K79 A;  3QWX X;  4OMN A;  2GNC A;  4HCK A;  3VRZ A;  1W70 A;  2LCS A;  3VS4 A;  5IXB A;  2JXB A;  2DRK A;  1B3Q A;  2K9G A;  2ROT A;  4J9D A;  2KRN A;  1AWO A;  4CC7 A;  2JTE A;  2DJQ A;  5IH2 A;  2CSI A;  1OV3 A;  1NYF A;  1U06 A;  2YT6 A;  2ABL A;  2EGA A;  2EYW A;  4RTY A;  2DBM A;  3QWY A;  1RI9 A;  2JMC A;  2VKN A;  1T0H A;  2FPD A;  2YUN A;  3I5S A;  1SRL A;  2YUO A;  1WFW A;  1RUW A;  2DVJ A;  2YUP A;  2VVK A;  1KFZ A;  5IHK A;  1I0C A;  4RTW A;  1NM7 A;  1HJD A;  4Z89 A;  2LJ1 A;  1QWE A;  2FPF A;  2LJ0 A;  2AZS A;  5HCK A;  2C0I A;  4IIO A;  3VS6 A;  2OI3 A;  2LX7 A;  3U23 A;  1PKT A;  3SHW A;  1ABQ A;  1KJW A;  2EGC A;  2XMF A;  3UA6 A;  1OEB A;  1WA7 A;  1JO8 A;  1ARK A;  3NPF A;  1BK2 A;  2DL5 A;  2M51 A;  1Y0M A;  1X43 A;  5IXF A;  2EKH A;  2B86 A;  3PVQ A;  2JT4 A;  1PNJ A;  2ECZ A;  2DF6 A;  1PWT A;  2LP5 A;  2KNB B;  1EFN A;  3M0T A;  2HBW A;  3NGP A;  2CH4 A;  2DL8 A;  2L3P A;  2F2X A;  4LN2 A;  2G6F X;  1JXM A;  1Z9Q A;  3GBQ A;  4A63 B;  2HCK A;  2K7A A;  4CC3 A;  3TSZ A;  2KRS A;  1K9A A;  1ZUU A;  3UF4 A;  1QLY A;  1GCQ A;  2L2P A;  2L3S A;  1GFC A;  4F14 A;  1QKX A;  1CKA A;  2ED0 A;  2O9V A;  2RQR A;  3REB B;  2KE9 A;  1BU1 A;  5FWC A;  3VS3 A;  2RF0 A;  4HXJ A;  1V1C A;  3SEM A;  5ECA A;  1AWW A;  1YWO A;  2SRC A;  2DMO A;  2F2V A;  4J9C A;  2O31 A;  4EIK A;  2I0N A;  2V1Q A;  4AFZ C;  2FRW A;  2FO0 A;  1X6G A;  1H3H A;  2DRM A;  2RN8 A;  1JXO A;  4GLM A;  3I5R A;  4OMQ A;  2EQI A;  2BZX A;  2GTJ A;  2LJ3 A;  4JJB A;  2HSP A;  1YP5 A;  2A08 A;  1AVZ C;  3NMZ C;  2CT3 A;  4OMP A;  4HVW A;  1ZX6 A;  1M27 C;  1UGV A;  3H41 A;  1Y57 A;  3C0C A;  1K0X A;  4JZ4 A;  3FJ5 A;  1K1Z A;  5I22 A;  1WXT A;  2LZ6 B;  3UA7 A;  2KT1 A;  3UAT A;  1JEG A;  1VYU A;  4JPB W;  1VYV A;  2KRM A;  2D8H A;  1GBQ A;  2H8H A;  1UTI A;  2KGT A;  2J6O A;  2PNI A;  2KYB A;  2J05 A;  1LCK A;  2DNU A;  1AEY A;  1WIE A;  3EHR A;  2CSQ A;  2LMJ A;  2RPN A;  5FWB A;  1FMK A;  3RBB B;  1AWJ A;  2FG0 A;  1UE9 A;  1UG1 A;  2W10 A;  1G2B A;  2GQI A;  2FRY A;  1AZE A;  2GBQ A;  1K76 A;  1M3B A;  1PRL C;  2EGE A;  1SEM A;  1QWF A;  5IHI A;  4AFS C;  1UHC A;  1UFF A;  2JS2 A;  4J9E A;  4M4Z A;  2DBK A;  2DL3 A;  1ABO A;  3R6N A;  2JW4 A;  1JU5 C;  1Z9Z A;  1H8K A;  1YWP A;  1UEC A;  2PTK A;  2QDL A;  2LNH B;  1WI7 A;  4QT7 A;  2JMA A;  1QCF A;  2DE0 X;  1AZG B;  1IO6 A;  3JV3 A;  2KXC A;  4WCI A;  4R0K A;  4RUG A;  4F16 A;  2MIO A;  2M0Y A;  4IIM A;  1SPK A;  2J6K A;  2E5K A;  2D8J A;  4DEY A;  3VS0 A;  1QKW A;  4CC4 B;  2EVR A;  2JS0 A;  1VYT A;  1M8M A;  4ORZ A;  1YNZ A;  1TG0 A;  2EYY A;  3I35 A;  1UJ0 A;  2O9S A;  3REA B;  2RMO A;  3LH5 A;  2CUD A;  1OPK A;  1ZSG A;  2DL4 A;  4RTX A;  1X2Q A;  3EG3 A;  3EGU A;  1YCS B;  4OML A;  1T3L A;  1I07 A;  2DX1 A;  1WXU A;  2RQU A;  1E6G A;  1RLQ C;  1TUC A;  1B07 A;  3VS5 A;  1E6H A;  2P4R A;  2EW3 A;  3H0H A;  1H92 A;  1GCP A;  1ZLM A;  2W0Z A;  4JJC A;  4X1V A;  1PKS A;  1ZBJ A;  2F2W A;  2HEQ A;  2O88 A;  2O2O A;  2CH4 W;  2RQV A;  4AG2 C;  2J7I A;  1HSQ A;  1ZUY A;  2YDL A;  1JQQ A;  1M3C A;  2A37 A;  2OJ2 A;  4K11 A;  1M30 A;  2ENM A;  4LUD A;  2X3W D;  2MCN A;  2LQN A;  2NUZ A;  1AOJ A;  1X69 A;  1FYN A;  2MOX A;  3EHQ A;  1ZUK A;  2X3X D;  2C0T A;  3H0I A;  3VS7 A;  1VA7 A;  2ESW A;  4LE9 A;  4RTT A;  5L23 A;  2KXD A;  1GFD A;  1GL5 A;  2V1R A;  1YN8 A;  2RQW A;  1X6B A;  3VS2 A;  3THK A;  3M0U A;  2IIM A;  4RTU A;  1MV0 B;  2SEM A;  2CUB A;  2VWF A;  2CT4 A;  1W1F A;  1RLP C;  2FPE A;  2DYB A;  1UJY A;  4RTZ A;  1UHF A;  2CDT A;  2DL7 A;  5GJV B;  1U5S A;  2L3Q A;  1OOT A;  5I11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...