2KRMA

Rdc refined solution structure of the first sh3 domain of cd2ap
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
VDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krmA00
2RQRA 2V1QA 2JMAA 1AVZC 4CC4B 1PKSA 4DEYA 1T0HA 3UA7A 1VA7A 1WXBA 1TUDA 1NLPC 1WXUA 2DVJA 1GCQC 1WXTA 3H0IA 1WDXA 2JS2A 1BK2A 1QKXA 2F2VA 1NLOC 2K7AA 2CSIA 1RUWA 2JMCA 2LZ6B 1K0XA 2K2MA 2A37A 1UJ0A 1NEGA 2ED0A 3PE0A 3QWXX 2OJ2A 4Z89A 2DNUA 1XOVA 1KSWA 2YUOA 1UTIA 1GFCA 3VS7A 3R6NA 4F14A 2EYWA 2IIMA 2MOXA 2L3PA 2JM8A 3SEMA 1WX6A 1UE9A 5FWBA 2ROLA 2W10A 1SSHA 3RBBB 5GJWB 2GGRA 2O2OA 2PZ1A 1K0SA 2CUBA 1UUEA 2DYBA 2O9SA 2B86A 3EGUA 5EC7A 1GRIA 2DL8A 1ABQA 3VS2A 1MV3A 2EPDA 5HCKA 2HCKA 2O9VA 1UHFA 2BZYA 1OEBA 2VKNA 2DLPA 2RQWA 2F2XA 3NMZC 2K6DA 2HEQA 2LX7A 2AZSA 2J7IA 1JEGA 1ABOA 2FRWA 2KRNA 1GL5A 2JT4A 2YSQA 3VRYA 1Z9QA 1A0NB 2CT4A 4ZNXA 1K4US 2YUNA 1X69A 2DX1A 1PKTA 1JXOA 2J05A 4IIOA 1G2BA 1UG1A 3REBB 2M0YA 1JO8A 1WLPB 1ZLMA 3ZL7C 2GTOA 4CC2A 1UJYA 4AG1C 1K1ZA 1HD3A 1X6BA 2CUDA 3UF4A 1CKAA 1PRMC 2HSPA 2KRSA 2DE0X 4EIKA 1E7OA 2DMOA 2D8HA 2KYMA 2CH4W 4J9EA 2DBMA 2FEIA 3M0UA 4RTUA 1UDLA 2BZ8A 2FRYA 2FO0A 1MV0B 1K76A 2EBPA 2KNBB 1YN8A 4D8DA 1W1FA 2C0IA 2LJ1A 1H3HA 2EGEA 2GBQA 2A08A 4OMNA 1RI9A 1J3TA 2ECZA 2M51A 1B07A 1GFDA 5GJVB 2DF6A 5ECAA 2KROA 2JXBA 1AWJA 2DJQA 2RN8A 2RF0A 2CREA 3EG3A 2A28A 2CDTA 1YNZA 1T3SA 2JW4A 1WA7A 2L0AA 4WCIA 1UECA 2CT3A 2KE9A 2DILA 2GQIA 2D1XA 2YT6A 1W6XA 2X3WD 2RQTA 1M3AA 4J9IA 2LQNA 3NGPA 1VYUA 2ENMA 2H8HA 1AZEA 1B3QA 5IXFA 2EYZA 4Y92A 4FSSA 3VS4A 4D8KA 1GCPA 2RNAA 1M8MA 4RTVA 5I11A 1NYFA 1ARKA 3IQLA 2EYYA 2YDLA 1M3BA 3A98A 1NG2A 3ULRB 1KFZA 2VVKA 1FMKA 4HVUA 2FPEA 1M3CA 1AD5A 4AG2C 2KXCA 2EW3A 1QWFA 4RTZA 2O88A 1BB9A 4F16A 2LNHB 2E5KA 1YP5A 3M0QA 1QKWA 2DL5A 5I22A 2ROTA 1RLQC 1RLPC 2FPDA 1AWOA 2DRMA 4LN2A 3RNJA 1I0CA 3REAB 2LCSA 1YWOA 1WI7A 3PVQA 4HVWA 4RTWA 3EG1A 1OOTA 1GBRA 4RUGA 1M27C 1WYXA 2C0OA 2QDLA 2DRKA 2DL7A 4ESRA 2AKLA 1JXMA 3C0CA 4GBQA 2RMOA 2D8JA 4AFQC 2KEAA 1T0JA 2OAWA 1PRLC 1BBZA 4K11A 1SHGA 2PNIA 3LH5A 2F2WA 4JZ4A 2EYXA 4QT7A 5FW9A 2EQIA 2BTTA 3QWYA 4ORZA 1I07A 4Z88A 3EHRA 4JJCA 1CKBA 1X2KA 4OMPA 2ESWA 2J6OA 2NUZA 3M0TA 2CSQA 2L2PA 4LNPA 2EKHA 1UHCA 2D0NA 3FJ5A 2LJ0A 2KT8A 4OMLA 4LUEA 1EFNA 1NM7A 3VS0A 3TSWA 1ZUYA 1LCKA 1W70A 1H92A 4J9BA 5IHIA 4OMOA 1JU5C 1UFFA 1AWWA 4RTYA 4E6RA 2BZXA 2KGTA 4LE9A 2GNCA 2PTKA 3O5ZA 4JPBW 3M0SA 2SRCA 4IIMA 1YCSB 2L3SA 1ZSGA 3I5RA 1X6GA 1SEMA 2KR3A 2FPFA 1NYGA 2RQUA 3VS1A 2RQVA 4J9HA 2YUPA 4OMQA 1H8KA 1AWXA 1E6GA 1WIEA 4DEXA 2OI3A 2RPNA 1UGVA 2CH4A 1OPKA 4F17A 3I9QA 4HCKA 5IHKA 1PNJA 2O31A 3TVTA 2L3QA 3PVLA 1WFWA 4GLMA 2W0ZA 1OPLA 2K3BA 1SRLA 1ZBJA 5IHNA 2J06A 1E6HA 2EVRA 2GTJA 1X43A 2LMJA 4HVVA 2KRMA 2J6KA 2C0TA 2VWFA 2AK5A 2G6FX 1AOJA 2V1RA 3VS5A 1Y57A 4JJDA 2A36A 2P4RA 1ZX6A 2I0NA 4M4ZA 2K79A 3KFVA 3CQTA 2DL4A 4J9FA 2KXDA 3TSZA 1T3LA 3H0HA 1SPKA 5FWCA 2DM1A 1GBQA 4RTXA 1M30A 1X27A 2YUQA 4AFZC 2FG0A 3UATA 4Z8AA 1U5SA 2MIOA 4OMMA 2MCNA 4CC3A 1N5ZA 1GCQA 4J9GA 3U23A 2DA9A 2LJ3A 3NPFA 1S1NA 4AFUC 5L23A 1Z9ZA 3H41A 3I5SA 4X1VA 2ED1A 1OV3A 1CSKA 1FYNA 2HBWA 1IO6A 1TUCA 4KRTA 2AZVA 2DL3A 2KBTA 4RTTA 4J9DA 1TG0A 4J9CA 2LQWA 1KIKA 3EHQA 4HXJA 1G83A 1HSQA 1NEBA 4JJBA 3UA6A 1AZGB 2ABLA 1QWEA 3JV3A 2JS0A 3VS6A 3I35A 2JM9A 1MUZA 2SEMA 1VYTA 1I1JA 4R0KA 2EGAA 1Y0MA 4A63B 3GBQA 5IXBA 2EGCA 1YWPA 1SHFA 2K9GA 1ZUUA 2XMFA 1X2QA 1V1CA 1HJDA 1VYVA 5IH2A 1BU1A 1U06A 2AKKA 4AFSC 2X3XD 2LP5A 2HDAA 3H0FA 3M0PA 2KYBA 1SRMA 1U3OA 3SHWA 2J6FA 4LUDA 3VS3A 1QLYA 2DBKA 3NHNA 1AEYA 1ZUKA 3EG2A 4CC7A 4JZ3A 1PWTA 2KT1A 1JQQA 2JTEA 1K9AA 2NWMA 3VRZA 1QCFA 3THKA 3M0RA 1PHTA 1KJWA 3EG0A
chains in the Genus database with same CATH superfamily
2JMAA 5KH6A 1AVZC 3M57A 3JCMf 1VQ4A 4GLKA 4DEYA 3UA7A 1YJNQ 2V26A 3HFNA 1TUDA 1GCQC 1RAFB 4OB2B 1WDXA 5CKBA 4LDWA 1QKXA 1Q7YU 4KH0B 4C0DB 1VQ5Q 2LZ6B 3LWIA 3EAEA 1K0XA 1YIJQ 3N5BB 4MZMA 3QWXX 2OJ2A 2M9UA 3QZ9B 3SWNC 1N9SA 5LJ3f 4XTZA 5KYUA 1ZBXA 5CVIA 4M7DD 2RI2A 2LDMA 1UTIA 5CO7A 3L2UA 2JOYA 3CCLT 3VS7A 4F14A 2EYWA 3PNWC 3OYLA 1LNXA 5C0MA 2L3PA 3H8ZA 1UE9A 1VQOQ 1SSHA 2PVGB 4QVCA 4HT9A 4MDXA 3LYIA 3C95A 4V2SA 2O9SA 3UWNA 3WVEB 4F04B 1GRIA 3M58A 2DL8A 3CCST 2K5FA 3OW2S 4BD3A 5KCHA 5GAMj 2O9VA 1UHFA 1VIFA 4RMOA 2DLPA 3ER0A 3OS2A 3CCRT 3NMZC 2E64A 1N8RC 2AZSA 3CXCA 3HTRA 1G3YA 2KRNA 2ZPHB 3C12A 4E7HA 3CCUA 2F5KA 4E2FB 4JRKA 2EYQA 1RAAB 1A0NB 2CT4A 1M1KU 4ZNXA 2EQJA 5D6WA 2DX1A 1Q82R 1VQPQ 2XICA 5I21A 1JO8A 1WLPB 5GAMd 3ZL7C 1PD0A 1QVPA 1U8RA 2CP3A 1UGSB 4AG1C 1N9RA 3UPUA 1K1ZA 1X6BA 2F69A 3UF4A 1PRMC 2F1LA 5CK9A 4EDUA 4BE0A 1K8AC 1FXXA 2KYMA 4PJOC 2ZPFB 1IHWA 1YITT 3M0UA 2LTOA 4C8QB 2BZ8A 2FO0A 2X4XA 1MV0B 3OYDA 1EX4A 4E7IA 4E7JA 3CBPA 1W2BS 5CR2A 2L3RA 1C6VX 3WXMB 2GBQA 4FYVB 5GAOr 2AHJB 1VQ7T 2OTLT 2LNVA 4WTOB 4J8OA 3CCQA 3MEAA 1FMVA 2DF6A 2QTXA 5ECAA 4ELZC 1G3SA 1UB4A 4FW1A 5FU7C 2KROA 2MYSA 2JXBA 2O01E 5A0GA 4PJOE 4RCBA 2RHYA 1PSEA 3CMAA 2ZPIB 1YNZA 4FYWB 3HPWA 1WA7A 2L0AA 3I55A 2CT3A 5J3BA 4X9CA 3X26B 1W6XA 3SFMA 2X3WD 3MPUB 4JRPA 4ZGEB 4J9IA 5LJ5j 1NJIC 3OYGA 1B3QA 2KDSA 3G1JA 3CPWA 2EYZA 1D0XA 3HRUA 1EZZB 2EYYA 3A98A 1M3BA 1NG2A 2GFUA 1KFZA 4HVUA 3QYGB 2O88A 4RTZA 1QWFA 4RG8A 4QVDA 2B8AA 1VQMQ 4PFOA 4F16A 1YP5A 5I22A 2DTHA 2ROTA 1RLPC 4KH1B 2DRMA 2PUKB 5LJ5d 2EQMA 2EJ9A 2E6ZA 1WI7A 1C0MA 1WYXA 3V7CA 3QIIA 2QDLA 4BACA 3EGXB 1M2OA 4JRIA 2XIDA 4ZGDB 1MMDA 3V7RA 1VQKQ 3G6EQ 3SD4A 4LDUA 4J6YA 4C8QA 3EFRA 2PNIA 4C92A 1KC8U 2F2WA 2BTTA 2OX7A 1ACMB 4Z88A 2HAXA 1X2KA 2BIVA 2ESWA 3TCJA 2ZZDA 1F1BB 2I2LA 2Z0WA 2L89A 3OYFA 2QDYB 2Y4YA 1QMCA 3FJ5A 2HNIA 2KT8A 4OMLA 4LUEA 4BDZA 4M78E 1TXQA 4ANJA 1ZUYA 5GMKe 4LDYA 4C8QF 1LCKA 2COWA 1H92A 3SWNB 1K73R 4J9BA 2RI5A 4OMOA 3MEVA 4FU6A 3JCMe 2FZKB 2KGTA 4LE9A 4MDWA 1NJIU 4VUBA 2QQBA 2PTKA 1Q7YR 2EWNA 2K3XA 2HD0A 1Y96B 2KR3A 1VQ5A 3MP1A 2OTJQ 1YIJA 1MMAA 4M7DC 5DM7R 3X20B 2LC4A 8ATCB 4IUQA 2RPNA 1OPKA 4F17A 4HCKA 3E19A 3CC7Q 3OMCA 1QCNA 2E12A 1VQLA 2X4JA 3CCVA 4O5VA 2LCCA 1D0YA 1SRLA 4ELYC 2J06A 1G3TA 1NBEB 3A1PA 4PJOG 2DIGA 1VQOA 4TVRA 2EJFA 1KD1R 2KK4A 1OI1A 2AK5A 3EGXA 3LW5E 4MZTA 5HK0A 2I0NA 4PNOA 2KXDA 1BIBA 1T3LA 4XAXB 1ZSZC 1VQNT 2CP7A 4XTXA 1M30A 2YUQA 3G71A 2PU9B 4JJNK 2FG0A 2QEXQ 1M90C 9ATCB 3JCMJ 2AT1B 1M1KR 3JB9H 4OGEA 4PJOB 1N5ZA 1GCQA 5KE3A 3OYCA 3OQ5A 1VQPA 2RK2A 2IVWA 4PL6A 3JCMQ 1FYNA 1TWBA 3OYIA 2R5AA 1VQ8Q 3X24B 2DZ9A 3GIBA 4J9DA 3SWNA 2VYTA 2HKNA 5GAOp 1HSQA 2DXUA 3JRZA 2JS0A 1EIFA 3I35A 3I56T 2HZYA 2JM9A 5FU7B 3DLLA 1Y07A 2EIFA 2X4WA 3BFMA 3VKIA 2K4YA 4PJMA 2BUDA 2E3HA 3CCEQ 1YWPA 1SHFA 4HT8A 2RHIA 4HA8A 1HJDA 1TUGB 2QA4Q 1BU1A 2AKKA 2COZA 2HDAA 4IUVA 1P92A 1SRMA 2FL7A 1VQ9T 2J6FA 4M77E 1SF9A 4Z02A 4FIBA 2NUPA 1VQ6Q 2KAFA 3NHNA 2WSFE 4CC7A 2EQUA 1QVFP 4M78G 3SB2A 2KT1A 2M02A 3OS1A 1JJ2S 1LJOA 1WJSA 1MNEA 1M8VA 3M0RA 4PJOD 4BE2A 1C1AA 2RQRA 2V1QA 4FYXB 3JB9G 4CC4B 1PKSA 2X51A 4BI4A 1N8RR 1WHLA 1YFNA 3RKXA 1G5VA 1NLPC 1WXUA 4E7ZA 2MWPA 1WXTA 3H0IA 4M75G 1M90U 1BK2A 4JUVA 1TS9A 3JCMW 2E4HA 1RUWA 2JMCA 2K5LA 3CD6T 1X75C 2JTMA 1K9MU 1YJWT 2RHZA 2ED0A 3Q1JA 3PE0A 1M2VB 4BUGA 1IGUA 4D6WA 5GANg 1WJRA 1HK9A 1WZOA 4ZN3A 4KGXB 4LD9K 3R6NA 7AT1B 1BKBA 2K2VA 3MO8A 1K8AR 4FM4B 5J26A 2ROLA 2W10A 3PT9A 1B7TA 1OX8A 3EH2A 4QQ6A 1SKUB 3MP6A 3V8JA 1XQHA 5AT1B 3EGUA 5EC7A 4PJOF 4FW2A 3OB9A 2QI2A 1ABQA 5M9OA 2QQAA 1VQKA 3G6EA 1OEBA 3CXCP 2E10A 4A4GA 1YI2A 1YHQQ 2NLUA 1KG1A 3CCQT 3G4ST 4PJJA 1JEGA 4XTYA 5IN1A 2CP5A 1WHJA 2RH2A 2RJFA 1Z9QA 2YUNA 4N4GA 1X69A 1JXOA 2DO3A 2NYSA 2A7YA 4J7IA 4M7DB 1UG1A 2M0YA 3E2UA 1IB8A 2DD4A 2A0FB 5LJ5h 2YWWA 4M78D 1Q81C 1NJIR 4J7FA 3VU3C 3JCMc 1QVGP 4JDSA 2HSPA 2KRSA 2YXYA 3JB9D 2DE0X 2DMOA 2D8HA 3GF5A 2VGMA 4J9EA 1U1TA 2DBMA 2FEIA 2HQXA 3TU4K 3L42A 5GMKi 1M9SA 4RCCA 1I5OB 5GAOm 3P8DA 4D8DA 3ZBDA 1M2VA 2RB6A 3CCLQ 2C0IA 2LJ1A 3HP9A 1QVFA 4N4IA 1H3HA 1R0CB 3E9FA 1D1BA 4QKUA 2ECZA 4BDYA 4NL3A 1ZSZB 4M77G 1B07A 3QZ5B 2XDDA 3JAME 2KVQG 3L2RA 4XU0A 2DVEA 2K3YA 2KI7A 2RF0A 2V8JA 3LWHA 2GCXA 3CC4A 3CCSQ 1YJ9T 2A28A 1BI2A 3META 1T3SA 2RJDA 4DBRA 2CP6A 4PK4A 3CCRQ 2FZGB 2XKOC 3CPWP 3A8GB 2RQTA 4PJLA 1VYUA 2ENMA 2H8HA 5IXFA 4FSSA 4F7UE 1FX7A 4D8KA 1VIEA 4LXCA 1M8MA 4RTVA 5CKFA 3CCJA 1PM3A 1FMWA 3IQLA 3QJ6A 3ULRB 3BDUA 3FC3A 3OYEA 4A4FA 3M0QA 5GAMg 2DL5A 4XU2A 1PSFA 4M7DA 4C0FA 4KUIA 2YRCA 2LCSA 3GNFB 1Q81U 1YWOA 2HMAA 4MMLA 4RTWA 1KQSS 1GBRA 3ASKA 1Y71A 1YITQ 2C0OA 4M7AC 3OS0A 1WPYA 4IUUA 1QP2A 3C0CA 4A4HA 3OYKA 2RMOA 2D8JA 1N27A 2KEAA 1T0JA 1PRLC 2DERA 4M7DF 4NL2A 2COYA 3CCEA 4BY6C 1VQ7Q 2OTLQ 3GNGA 2EYXA 2PQWA 4QT7A 5FW9A 2QA4A 1VQLT 5CIUA 2EQIA 3CCVT 4HCBA 4KUDK 3QDRB 4OMPA 1M4ZA 2NUZA 2CSQA 1ZSZA 2L2PA 1BI0A 5GAOn 1V29B 2EKHA 1VQ6A 1UHCA 1QVGA 4M77D 3OYHA 2HKQB 1ZA2B 3GP8A 4M7AE 1EFNA 3VS0A 3CCMT 1JB0E 5KYNA 4B9XA 5GAN3 1W70A 2YHTA 2HQEA 1JU5C 5GMKm 1KC8C 3F70A 2FB7A 4E6RA 2MI6A 3G71T 1AHJB 3NTKA 1M90R 3O5ZA 1UGRB 2DFUA 4IIMA 4JLGA 1YCSB 2L3SA 4QQDA 3I5RA 1M1FA 2XU8A 2FPFA 5EG2A 2RJEA 3VS1A 4PLLA 2RQVA 4C0ZA 3OYJA 1H8KA 2LRQA 1E6GA 4WF2A 3I9QA 3VYGA 1OU9A 1PNJA 1SSFA 2NUTB 5LJ5g 5FROA 2W0ZA 2EKOA 3T9NA 4LDVA 2K3BA 1H3ZA 4E7SA 1LOJA 5CQXA 3VUBA 1RACB 1RAEB 1NE8A 2X4YA 1Y7XA 2LMJA 2KRMA 2MAMA 2J6KA 2V8KA 2VWFA 5LJ3j 2G6FX 1AOJA 2V1RA 3CC2T 3VS5A 2A36A 3QHSA 1ZX6A 3MCAB 3JCMd 4M4ZA 2K79A 2CZ6B 3H0HA 5FWCA 2O4XB 3X25B 4F7UG 3FJPA 2V8IA 4Z8AA 2MIOA 4OMMA 2AIRB 2E65A 3HFOA 2QAZA 2X9HA 3U23A 2DA9A 4IUPA 4M78C 5LJ3d 3H41A 3I5SA 2ED1A 3A8LB 1CSKA 2HBWA 4KGZB 4C5IA 1TUCA 2RM4A 2KBTA 4RTTA 3OBWA 2YLBA 4XTUA 4NS5A 1KIKA 3OYAA 1R0BG 3KBGA 2Y90A 1MHNA 1SG5A 1XJWB 4F7UB 1QWEA 2JTFA 2K57A 3VS6A 5GAN4 4M75C 1MUZA 1VYTA 3OBYA 1AT1B 3FRNA 5GANh 1ZUUA 2XI9A 2XMFA 3VYHB 3LGFA 1RAGB 5IH2A 1U06A 4AFSC 2HSEB 5C6SA 4NOYA 3CCLA 2JZ2A 5KYWB 1S72T 1U3OA 3NTHA 1RL2A 2D6FA 2NUTA 4LUDA 1YJNA 2RI3A 2DBKA 3CBMA 3MP8A 1AEYA 3EG2A 4M75E 2LQ8A 2Y4XA 4M7AG 1PWTA 1JQQA 4JLIA 3M4GA 2RA2A 2DZCA 4FSXA 5KCOA 3JB9J 1PHTA 2MF2A 1GXIE 3UDCA 4X34A 3INZA 1YI2T 3CCRA 3EG9B 1VQNQ 3URGA 5LJ5e 4DOWA 1T0HA 1WHGA 1VA7A 4RKUE 2P84A 3PTAA 1W4SA 1BI3A 2XD0A 2RO0A 1NLOC 2CSIA 4MMKA 2K2MA 4CI0C 2PVOB 1IGQA 4M7AB 4DQ2A 4A54A 2IG0A 4Z89A 2DNUA 3PMIA 2HBPA 3J80E 1WNLA 3EGDB 3KUFA 5GANf 5FLXE 5A2QE 3MKDA 4E7LA 2YUOA 3E1SA 1Q81R 3CMET 4BY6B 1GFCA 4R56A 2IIMA 3FB9A 3UT1A 3CPFA 2L5QA 3I56Q 3GPLA 1IZ6A 3TEEA 5FWBA 1U1SA 2CKKA 1FWZA 4HKEA 2O2OA 2PZ1A 1K9MC 4ATOA 1UUEA 2XK0A 2B86A 3VS2A 4EMKC 3NTIA 4OF1A 2HCKA 2BZYA 1QCOA 1DJ7B 1VQ9Q 4EMHA 2K6DA 5J39A 1VQ4T 1VQ7A 2LX7A 2E1HA 5D7UA 2XDPA 2J7IA 1GL5A 3OYBA 5HY6A 5KYWA 4M77C 2ZPEB 2YSQA 5CQYA 1PC0A 3VRYA 1X01A 4F7UF 3A5ZB 3CC4T 4BB7A 1PKTA 2J05A 2DETA 1MMNA 3REBB 2WSCE 1Y96A 4E7KA 2ZPGB 4M7AD 2D0QB 1D3BB 1O75A 1UJYA 1HD3A 3EG9A 4EMGA 2CUDA 1CKAA 3CD6Q 3PIPA 4EIKA 3CCJT 1YJWQ 3RR6A 1Q82U 4KBMB 4RTUA 1UDLA 1YBYA 1K76A 2RJCA 2KNBB 5GAMh 5CCAA 1W1FA 4C5HA 4KGVB 4A4EA 2EGEA 1LPLA 2A08A 4OMNA 4PFZA 1RI0A 3EFOB 1HYOA 2M51A 3EGDA 4QVZA 1RADB 1GFDA 5GJVB 4Y28E 3M53A 1I5LA 3CCUT 2DD5A 5CKEA 4JS4A 1NPPA 1KQ2A 2DJQA 2RN8A 2M0OA 3GOXA 2CREA 4J5YA 4DA4A 2CDTA 3S3NA 4KT0E 4YTLA 2M16A 1OU8A 2JW4A 4WCIA 4HCCA 2KE9A 4M78B 2DILA 4C5GA 4M7AF 4LDXA 2YT6A 4PJOA 2HL5C 3HRSA 3CCQQ 3S6WA 3G4SQ 2LQNA 1VQMA 1TH7A 3NGPA 4XTWA 5KYXB 1AZEA 1OYXA 4OB1B 3C94A 3MEWA 4HCZA 3BY7A 2RNAA 2HQHA 3PMTA 5I11A 3RERA 4DOVA 1ARKA 4DBHA 2OAUA 4M75B 1FMKA 1TU0B 4C92C 2FPEA 1AD5A 4AG2C 2KXCA 3JCMP 1WQ7A 2ZAEA 1K73C 2LNHB 1R77A 1RLQC 1KHCA 2FPDA 3PGGA 3DKMA 5GAMf 1AWOA 4ME7A 1KC8R 1HXDA 1WHKA 1I4K1 3BW1A 4L5GA 3M55A 5KE2A 1D3BA 1BI1A 2VV5A 2E41A 5CAIA 2QXFA 4HVWA 3EG1A 1OOTA 5DLOA 1BYMA 4OB3B 1M27C 2MPXC 4C8QE 2DL7A 2X35A 4OGCA 1OZ2A 4ESRA 4C92E 3OA6A 3CMAT 1JXMA 4EPCA 3HSBA 4GBQA 2VXEA 3V7SA 4XK8E 3I55T 1BBZA 2WACA 2BE7D 1SHGA 2CS7A 1JJ2A 3SDZA 2C06A 2MMPA 4JJCA 5CKDA 1CKBA 2FZCB 3A8HB 3DLMA 3EFOA 1LVKA 3A8OB 3P8HA 1YJ9Q 1UGQB 1KD1C 4B9WA 1OULA 4LNPA 5LJ3h 2D0NA 2JN0A 4L59A 2LJ0A 3TSWA 3L2VA 3ZEHA 3CXCS 2OTJA 4N4HA 4M75D 1JRIA 1V76A 1G3WA 3OYMA 1UFFA 4M78A 4II1A 4RTYA 3LGLA 2BZXA 1VQNA 1D09B 1Q86C 2H3EB 2R57A 3X28B 3CC7A 5KYXA 5CKHA 1ZSGA 3E9GA 1X6GA 1SEMA 2IPOB 2MWOA 1NYGA 2RQUA 2XG8D 2DJZA 4M75A 3QDFA 2QTVA 2YUPA 4EMKB 1R8OB 4CRIA 1ZA1B 2DPPB 5GANe 4M78F 1K73U 3OW2P 2OI3A 1UGVA 3S3OA 3O8VA 3WVDB 5IHKA 4ZGJB 1QVGS 3CBOA 2O31A 3TVTA 5LJ5f 1WFWA 4GLMA 4XQ3A 4ZTJA 2RHXA 1ZBJA 1KQSP 3JB9F 3I56A 4M77B 2EVRA 2GTJA 2QEXA 2DKGA 4OB0B 1BCMA 4M75F 2DXBA 4JJDA 2CP0A 2P4RA 2VASA 1VQLQ 4BI3A 3LH0A 3CCVQ 3CQTA 1GBQA 4OVAA 4RTXA 1VQ9A 1TSFA 4AFZC 5GAN8 1VQ8A 3UATA 3LX7A 4JRQA 1YJNT 1KD1U 3CCMQ 4J9GA 1VQ5T 2DEQA 2LJ3A 2CP2A 3NPFA 1S1NA 4AFUC 5A0DA 1Z9ZA 2DXCA 4BI8B 5L23A 2H3JA 1YIJT 3CPWS 1OV3A 3DB3A 2DEUA 2KQWA 2DL3A 3M56A 3G71Q 1W2BP 2JJ9A 2F5TX 2CZ1B 4J9CA 2GFAA 2M1HA 2E3IA 1Q86U 1AZGB 2ABLA 4B6MA 3JV3A 1TOVA 3JCMV 4Y91A 4C8QG 3CD6A 1YJWA 1I81A 4C92G 1VQOT 3JSCA 3OY9A 5FRMA 4R0KA 3ME9A 3VV0A 2EGAA 1Y0MA 4A63B 3GBQA 5IXBA 1XNIA 2EGCA 1IREB 3OSSC 4FT2A 3H0FA 4EMKA 5DLQE 2VB6A 3SHWA 3V8KA 1Q95G 4OP0A 2BKDN 1WGSA 3VS3A 5FRNA 1MMGA 1UGPB 2G3RA 1ZUKA 4A53A 1K9MR 3CC2Q 4M77A 2JTEA 4C92B 4C5EA 2KY9A 3M4YA 5GMKj 1VQPT 3RDVA 1OZ3A 3JCMg 5LL6S 2R5MA 4J6WA 3M5AA 3G4SA 1BIAA 4IURA 1WXBA 2DVJA 4MZPA 3OW2A 2JS2A 2GQVA 2F2VA 2JUFA 2K7AA 1NZ9A 3L1AA 4M77F 2A37A 1UJ0A 4RG2A 1M5Q1 1NEGA 1D1CA 1XTDA 3OS5A 1KQSA 1ZQ1A 1VUBA 2DTIA 5LJ3g 5GAN6 5D6XA 1XOVA 1KSWA 5GAMe 2PUOB 5GAOq 5D6YA 2QASA 1N8RU 2DIQA 2MOXA 2JM8A 3SEMA 1YHQA 1WX6A 1KQ1A 2DXTA 1O9SA 3RBBB 8AT1B 5GJWB 2KMTA 2GGRA 5GAOl 1K0SA 4XU3A 2CUBA 2DYBA 2MK5A 2FHDA 3JCMX 1VOMA 4KULA 1MV3A 2E6NA 2EPDA 5HKCA 5HCKA 4N0AC 3RUXA 4C8QD 3RMSA 1B34B 2VKNA 4C92D 2RQWA 1S72Q 2F2XA 3QSUA 2BE9B 3JB9I 2HEQA 5HK3A 2LCLA 3D7SB 3ZFJA 1ABOA 2FRWA 2DYIA 1K8AU 2JT4A 1W2BA 2A3LA 4FT4A 2VGNA 3VUZA 5FU6C 1K4US 1YJ9A 3DB4A 2FYKA 4IIOA 1G2BA 1YI2Q 3FLGA 2XDBA 2E70A 2YLCA 5KYYB 1IHVA 1ZLMA 3BDLA 2ZGWA 1VQMT 2GTOA 4CC2A 1MGQA 1RAIB 1G8XA 3TREA 3M9QA 3MEUA 2EFIA 1E7OA 3FIFA 3V8LA 2CH4W 3OYYA 2DAQA 4AT1B 1N6AA 3OMGA 2RD1A 1JBMA 3AT1B 2FRYA 3MHXA 2EBPA 4C92F 1YN8A 2QGFB 3CCSA 3CMEQ 1VQKT 3G6ET 3PFSA 1KHIA 1WHHA 1D1AA 1RI9A 3HHTB 1J3TA 4IKFA 1IXDA 4A4KA 3R6OA 3BE3A 4Q5WA 5GAN7 2P0KA 4GY5A 3QPHA 2O4XA 3HKSA 5GAN2 1AWJA 3HRTA 3EG3A 1Q82C 3QJYA 1MNDA 5LJ3e 2HL3A 3HL8A 1UECA 3GLXA 2GQIA 2D1XA 4L6V5 3H9NA 3P8BB 2QG9B 1VQ4Q 6AT1B 1M3AA 2NUPB 3L2ZA 1B34A 4Y92A 4E47A 3VS4A 3CC4Q 1GCPA 4J83A 4BE1A 4FYYB 1D0ZA 3RMQA 1NYFA 2YDLA 1WHMA 2WSEE 2VVKA 2VXFA 1YITA 1M3CA 1QQJA 4M7DE 4F7UA 3QG1A 3CCMA 2EW3A 2CYZB 3QYHB 2OTJT 1BB9A 2E5KA 5GMKl 1QKWA 4OMFB 4O6JA 4AMCA 4LN2A 4UC4A 2R58A 3RNJA 1I0CA 3S3MA 3REAB 5KYYA 1Q86R 2ZCFB 3CC7T 2OTLA 2DK3A 3RIRA 3CCJQ 3L2QA 3PVQA 4C0DC 4RUGA 2LT4A 2QGGA 4FL6A 2CGHA 1PCXA 5IAYA 2DRKA 2AKLA 3MJXA 1JJ2P 4AFQC 2P4TA 2OAWA 1RABB 4K11A 4XTVA 3M59A 3LH5A 4JZ4A 5A0LA 2LQKA 4QW2A 2EQKA 3QWYA 3CCUQ 4ORZA 1I07A 1TTHB 2L8DA 3EHRA 2FVUA 3A8MB 2J6OA 4FCYA 3M0TA 4PLIA 3EH1A 2CZ0B 3FDRA 2D9TA 1IRXA 2QEXT 5IT9E 1OQKA 1NM7A 3RKYA 3CC2A 2P0PA 5L8RE 2QQRA 4ZTFA 1BCOA 2QQ9A 4P5NA 3VJPA 5AYFA 5IHIA 4M7AA 1AWWA 3H6ZA 3LLRA 1VQ8T 3CEYA 2GNCA 2LX9A 4JPBW 3M0SA 2SRCA 4PKCC 1OX9A 1ZHIA 2K5IA 4QQGA 4X9DA 4DBFA 2CZ7B 3AHUA 4J9HA 3OYNA 4OMQA 1AWXA 1WIEA 2YRDA 4DEXA 2CH4A 3CCET 3RKWA 2QA4T 2P0QA 2L3QA 3PVLA 3C4SA 1OPLA 1WQWA 4JS5A 5IHNA 2LVMA 1E6HA 2GF7A 2ZPBB 3CMAQ 3L2WA 1X43A 1QVFS 3FEOA 3KXTA 5FU6B 1VQ6T 4C8QC 2PVDB 4HVVA 3I55Q 4LD6A 2C0TA 2XHCA 3M54A 1Y57A 3QBYA 5GANj 3KFVA 4J9FA 2DL4A 3TSZA 1SPKA 1S72A 2DM1A 3G7ZA 2QK0A 1X27A 4ZN1A 2RHUA 1U5SA 1Q7YC 4DBQA 3RESA 5GAN5 1X6OA 3EFSA 2MCNA 3PIOA 4CC3A 2EAYA 4M7DG 3QO3A 5GMKh 5KYUB 1H641 2JVVA 4X1VA 5I2SA 3JCMh 5GANd 2VUBA 4IUTA 1IO6A 4KRTA 2AZVA 4XU1A 2YRVA 1TG0A 2LQWA 2QQSA 3EHQA 4HXJA 1G83A 4PFPA 1NEBA 4JJBA 3UA6A 3QKJA 2RK1A 2EJGA 2SEMA 2JNGA 1M1GA 1I1JA 1PG5B 2E5QA 1NPRA 4PJNA 2LT1A 2ATCB 2KSSA 4J6XA 2K9GA 1X2QA 1V1CA 1VYVA 4R55A 1QW1A 4C0GA 3CMEA 2X3XD 1I8FA 2LP5A 1KK7A 3QUIA 3M0PA 1YCYA 1PD1A 3JCMb 5DY9A 2KYBA 4N0AA 3NFCA 1UEBA 1YHQT 3TQ7P 3OSVA 1M1KC 1QLYA 2QYZA 3J81E 5I2MA 3J7AF 4JZ3A 2DTOA 1K9AA 1QP3A 2NWMA 3VRZA 1QCFA 1RAHB 3THKA 1WJQA 1KJWA 3EG0A 3QXEB 2VC8A
chains in the Genus database with same CATH topology
2RQRA 2V1QA 2JMAA 1AVZC 4CC4B 1PKSA 4DEYA 1T0HA 3UA7A 1VA7A 1WXBA 1TUDA 1NLPC 1WXUA 2DVJA 1GCQC 1WXTA 3H0IA 1WDXA 2JS2A 1BK2A 1QKXA 2F2VA 1NLOC 2K7AA 2CSIA 1RUWA 2JMCA 2LZ6B 1K0XA 2K2MA 2A37A 1UJ0A 1NEGA 2ED0A 3PE0A 3QWXX 2OJ2A 4Z89A 2DNUA 1XOVA 1KSWA 2YUOA 1UTIA 1GFCA 3VS7A 3R6NA 4F14A 2EYWA 2IIMA 2MOXA 2L3PA 2JM8A 3SEMA 1WX6A 1UE9A 5FWBA 2ROLA 2W10A 1SSHA 3RBBB 5GJWB 2GGRA 2O2OA 2PZ1A 1K0SA 2CUBA 1UUEA 2DYBA 2O9SA 2B86A 3EGUA 5EC7A 1GRIA 2DL8A 1ABQA 3VS2A 1MV3A 2EPDA 5HCKA 2HCKA 2O9VA 1UHFA 2BZYA 1OEBA 2VKNA 2DLPA 2RQWA 2F2XA 3NMZC 2K6DA 2HEQA 2LX7A 2AZSA 2J7IA 1JEGA 1ABOA 2FRWA 2KRNA 1GL5A 2JT4A 2YSQA 3VRYA 1Z9QA 1A0NB 2CT4A 4ZNXA 1K4US 2YUNA 1X69A 2DX1A 1PKTA 1JXOA 2J05A 4IIOA 1G2BA 1UG1A 3REBB 2M0YA 1JO8A 1WLPB 1ZLMA 3ZL7C 2GTOA 4CC2A 1UJYA 4AG1C 1K1ZA 1HD3A 1X6BA 2CUDA 3UF4A 1CKAA 1PRMC 2HSPA 2KRSA 2DE0X 4EIKA 1E7OA 2DMOA 2D8HA 2KYMA 2CH4W 4J9EA 2DBMA 2FEIA 3M0UA 4RTUA 1UDLA 2BZ8A 2FRYA 2FO0A 1MV0B 1K76A 2EBPA 2KNBB 1YN8A 4D8DA 1W1FA 2C0IA 2LJ1A 1H3HA 2EGEA 2GBQA 2A08A 4OMNA 1RI9A 1J3TA 2ECZA 2M51A 1B07A 1GFDA 5GJVB 2DF6A 5ECAA 2KROA 2JXBA 1AWJA 2DJQA 2RN8A 2RF0A 2CREA 3EG3A 2A28A 2CDTA 1YNZA 1T3SA 2JW4A 1WA7A 2L0AA 4WCIA 1UECA 2CT3A 2KE9A 2DILA 2GQIA 2D1XA 2YT6A 1W6XA 2X3WD 2RQTA 1M3AA 4J9IA 2LQNA 3NGPA 1VYUA 2ENMA 2H8HA 1AZEA 1B3QA 5IXFA 2EYZA 4Y92A 4FSSA 3VS4A 4D8KA 1GCPA 2RNAA 1M8MA 4RTVA 5I11A 1NYFA 1ARKA 3IQLA 2EYYA 2YDLA 1M3BA 3A98A 1NG2A 3ULRB 1KFZA 2VVKA 1FMKA 4HVUA 2FPEA 1M3CA 1AD5A 4AG2C 2KXCA 2EW3A 1QWFA 4RTZA 2O88A 1BB9A 4F16A 2LNHB 2E5KA 1YP5A 3M0QA 1QKWA 2DL5A 5I22A 2ROTA 1RLQC 1RLPC 2FPDA 1AWOA 2DRMA 4LN2A 3RNJA 1I0CA 3REAB 2LCSA 1YWOA 1WI7A 3PVQA 4HVWA 4RTWA 3EG1A 1OOTA 1GBRA 4RUGA 1M27C 1WYXA 2C0OA 2QDLA 2DRKA 2DL7A 4ESRA 2AKLA 1JXMA 3C0CA 4GBQA 2RMOA 2D8JA 4AFQC 2KEAA 1T0JA 2OAWA 1PRLC 1BBZA 4K11A 1SHGA 2PNIA 3LH5A 2F2WA 4JZ4A 2EYXA 4QT7A 5FW9A 2EQIA 2BTTA 3QWYA 4ORZA 1I07A 4Z88A 3EHRA 4JJCA 1CKBA 1X2KA 4OMPA 2ESWA 2J6OA 2NUZA 3M0TA 2CSQA 2L2PA 4LNPA 2EKHA 1UHCA 2D0NA 3FJ5A 2LJ0A 2KT8A 4OMLA 4LUEA 1EFNA 1NM7A 3VS0A 3TSWA 1ZUYA 1LCKA 1W70A 1H92A 4J9BA 5IHIA 4OMOA 1JU5C 1UFFA 1AWWA 4RTYA 4E6RA 2BZXA 2KGTA 4LE9A 2GNCA 2PTKA 3O5ZA 4JPBW 3M0SA 2SRCA 4IIMA 1YCSB 2L3SA 1ZSGA 3I5RA 1X6GA 1SEMA 2KR3A 2FPFA 1NYGA 2RQUA 3VS1A 2RQVA 4J9HA 2YUPA 4OMQA 1H8KA 1AWXA 1E6GA 1WIEA 4DEXA 2OI3A 2RPNA 1UGVA 2CH4A 1OPKA 4F17A 3I9QA 4HCKA 5IHKA 1PNJA 2O31A 3TVTA 2L3QA 3PVLA 1WFWA 4GLMA 2W0ZA 1OPLA 2K3BA 1SRLA 1ZBJA 5IHNA 2J06A 1E6HA 2EVRA 2GTJA 1X43A 2LMJA 4HVVA 2KRMA 2J6KA 2C0TA 2VWFA 2AK5A 2G6FX 1AOJA 2V1RA 3VS5A 1Y57A 4JJDA 2A36A 2P4RA 1ZX6A 2I0NA 4M4ZA 2K79A 3KFVA 3CQTA 2DL4A 4J9FA 2KXDA 3TSZA 1T3LA 3H0HA 1SPKA 5FWCA 2DM1A 1GBQA 4RTXA 1M30A 1X27A 2YUQA 4AFZC 2FG0A 3UATA 4Z8AA 1U5SA 2MIOA 4OMMA 2MCNA 4CC3A 1N5ZA 1GCQA 4J9GA 3U23A 2DA9A 2LJ3A 3NPFA 1S1NA 4AFUC 5L23A 1Z9ZA 3H41A 3I5SA 4X1VA 2ED1A 1OV3A 1CSKA 1FYNA 2HBWA 1IO6A 1TUCA 4KRTA 2AZVA 2DL3A 2KBTA 4RTTA 4J9DA 1TG0A 4J9CA 2LQWA 1KIKA 3EHQA 4HXJA 1G83A 1HSQA 1NEBA 4JJBA 3UA6A 1AZGB 2ABLA 1QWEA 3JV3A 2JS0A 3VS6A 3I35A 2JM9A 1MUZA 2SEMA 1VYTA 1I1JA 4R0KA 2EGAA 1Y0MA 4A63B 3GBQA 5IXBA 2EGCA 1YWPA 1SHFA 2K9GA 1ZUUA 2XMFA 1X2QA 1V1CA 1HJDA 1VYVA 5IH2A 1BU1A 1U06A 2AKKA 4AFSC 2X3XD 2LP5A 2HDAA 3H0FA 3M0PA 2KYBA 1SRMA 1U3OA 3SHWA 2J6FA 4LUDA 3VS3A 1QLYA 2DBKA 3NHNA 1AEYA 1ZUKA 3EG2A 4CC7A 4JZ3A 1PWTA 2KT1A 1JQQA 2JTEA 1K9AA 2NWMA 3VRZA 1QCFA 3THKA 3M0RA 1PHTA 1KJWA 3EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RQR A;  2V1Q A;  2JMA A;  1AVZ C;  4CC4 B;  1PKS A;  4DEY A;  1T0H A;  3UA7 A;  1VA7 A;  1WXB A;  1TUD A;  1NLP C;  1WXU A;  2DVJ A;  1GCQ C;  1WXT A;  3H0I A;  1WDX A;  2JS2 A;  1BK2 A;  1QKX A;  2F2V A;  1NLO C;  2K7A A;  2CSI A;  1RUW A;  2JMC A;  2LZ6 B;  1K0X A;  2K2M A;  2A37 A;  1UJ0 A;  1NEG A;  2ED0 A;  3PE0 A;  3QWX X;  2OJ2 A;  4Z89 A;  2DNU A;  1XOV A;  1KSW A;  2YUO A;  1UTI A;  1GFC A;  3VS7 A;  3R6N A;  4F14 A;  2EYW A;  2IIM A;  2MOX A;  2L3P A;  2JM8 A;  3SEM A;  1WX6 A;  1UE9 A;  5FWB A;  2ROL A;  2W10 A;  1SSH A;  3RBB B;  5GJW B;  2GGR A;  2O2O A;  2PZ1 A;  1K0S A;  2CUB A;  1UUE A;  2DYB A;  2O9S A;  2B86 A;  3EGU A;  5EC7 A;  1GRI A;  2DL8 A;  1ABQ A;  3VS2 A;  1MV3 A;  2EPD A;  5HCK A;  2HCK A;  2O9V A;  1UHF A;  2BZY A;  1OEB A;  2VKN A;  2DLP A;  2RQW A;  2F2X A;  3NMZ C;  2K6D A;  2HEQ A;  2LX7 A;  2AZS A;  2J7I A;  1JEG A;  1ABO A;  2FRW A;  2KRN A;  1GL5 A;  2JT4 A;  2YSQ A;  3VRY A;  1Z9Q A;  1A0N B;  2CT4 A;  4ZNX A;  1K4U S;  2YUN A;  1X69 A;  2DX1 A;  1PKT A;  1JXO A;  2J05 A;  4IIO A;  1G2B A;  1UG1 A;  3REB B;  2M0Y A;  1JO8 A;  1WLP B;  1ZLM A;  3ZL7 C;  2GTO A;  4CC2 A;  1UJY A;  4AG1 C;  1K1Z A;  1HD3 A;  1X6B A;  2CUD A;  3UF4 A;  1CKA A;  1PRM C;  2HSP A;  2KRS A;  2DE0 X;  4EIK A;  1E7O A;  2DMO A;  2D8H A;  2KYM A;  2CH4 W;  4J9E A;  2DBM A;  2FEI A;  3M0U A;  4RTU A;  1UDL A;  2BZ8 A;  2FRY A;  2FO0 A;  1MV0 B;  1K76 A;  2EBP A;  2KNB B;  1YN8 A;  4D8D A;  1W1F A;  2C0I A;  2LJ1 A;  1H3H A;  2EGE A;  2GBQ A;  2A08 A;  4OMN A;  1RI9 A;  1J3T A;  2ECZ A;  2M51 A;  1B07 A;  1GFD A;  5GJV B;  2DF6 A;  5ECA A;  2KRO A;  2JXB A;  1AWJ A;  2DJQ A;  2RN8 A;  2RF0 A;  2CRE A;  3EG3 A;  2A28 A;  2CDT A;  1YNZ A;  1T3S A;  2JW4 A;  1WA7 A;  2L0A A;  4WCI A;  1UEC A;  2CT3 A;  2KE9 A;  2DIL A;  2GQI A;  2D1X A;  2YT6 A;  1W6X A;  2X3W D;  2RQT A;  1M3A A;  4J9I A;  2LQN A;  3NGP A;  1VYU A;  2ENM A;  2H8H A;  1AZE A;  1B3Q A;  5IXF A;  2EYZ A;  4Y92 A;  4FSS A;  3VS4 A;  4D8K A;  1GCP A;  2RNA A;  1M8M A;  4RTV A;  5I11 A;  1NYF A;  1ARK A;  3IQL A;  2EYY A;  2YDL A;  1M3B A;  3A98 A;  1NG2 A;  3ULR B;  1KFZ A;  2VVK A;  1FMK A;  4HVU A;  2FPE A;  1M3C A;  1AD5 A;  4AG2 C;  2KXC A;  2EW3 A;  1QWF A;  4RTZ A;  2O88 A;  1BB9 A;  4F16 A;  2LNH B;  2E5K A;  1YP5 A;  3M0Q A;  1QKW A;  2DL5 A;  5I22 A;  2ROT A;  1RLQ C;  1RLP C;  2FPD A;  1AWO A;  2DRM A;  4LN2 A;  3RNJ A;  1I0C A;  3REA B;  2LCS A;  1YWO A;  1WI7 A;  3PVQ A;  4HVW A;  4RTW A;  3EG1 A;  1OOT A;  1GBR A;  4RUG A;  1M27 C;  1WYX A;  2C0O A;  2QDL A;  2DRK A;  2DL7 A;  4ESR A;  2AKL A;  1JXM A;  3C0C A;  4GBQ A;  2RMO A;  2D8J A;  4AFQ C;  2KEA A;  1T0J A;  2OAW A;  1PRL C;  1BBZ A;  4K11 A;  1SHG A;  2PNI A;  3LH5 A;  2F2W A;  4JZ4 A;  2EYX A;  4QT7 A;  5FW9 A;  2EQI A;  2BTT A;  3QWY A;  4ORZ A;  1I07 A;  4Z88 A;  3EHR A;  4JJC A;  1CKB A;  1X2K A;  4OMP A;  2ESW A;  2J6O A;  2NUZ A;  3M0T A;  2CSQ A;  2L2P A;  4LNP A;  2EKH A;  1UHC A;  2D0N A;  3FJ5 A;  2LJ0 A;  2KT8 A;  4OML A;  4LUE A;  1EFN A;  1NM7 A;  3VS0 A;  3TSW A;  1ZUY A;  1LCK A;  1W70 A;  1H92 A;  4J9B A;  5IHI A;  4OMO A;  1JU5 C;  1UFF A;  1AWW A;  4RTY A;  4E6R A;  2BZX A;  2KGT A;  4LE9 A;  2GNC A;  2PTK A;  3O5Z A;  4JPB W;  3M0S A;  2SRC A;  4IIM A;  1YCS B;  2L3S A;  1ZSG A;  3I5R A;  1X6G A;  1SEM A;  2KR3 A;  2FPF A;  1NYG A;  2RQU A;  3VS1 A;  2RQV A;  4J9H A;  2YUP A;  4OMQ A;  1H8K A;  1AWX A;  1E6G A;  1WIE A;  4DEX A;  2OI3 A;  2RPN A;  1UGV A;  2CH4 A;  1OPK A;  4F17 A;  3I9Q A;  4HCK A;  5IHK A;  1PNJ A;  2O31 A;  3TVT A;  2L3Q A;  3PVL A;  1WFW A;  4GLM A;  2W0Z A;  1OPL A;  2K3B A;  1SRL A;  1ZBJ A;  5IHN A;  2J06 A;  1E6H A;  2EVR A;  2GTJ A;  1X43 A;  2LMJ A;  4HVV A;  2KRM A;  2J6K A;  2C0T A;  2VWF A;  2AK5 A;  2G6F X;  1AOJ A;  2V1R A;  3VS5 A;  1Y57 A;  4JJD A;  2A36 A;  2P4R A;  1ZX6 A;  2I0N A;  4M4Z A;  2K79 A;  3KFV A;  3CQT A;  2DL4 A;  4J9F A;  2KXD A;  3TSZ A;  1T3L A;  3H0H A;  1SPK A;  5FWC A;  2DM1 A;  1GBQ A;  4RTX A;  1M30 A;  1X27 A;  2YUQ A;  4AFZ C;  2FG0 A;  3UAT A;  4Z8A A;  1U5S A;  2MIO A;  4OMM A;  2MCN A;  4CC3 A;  1N5Z A;  1GCQ A;  4J9G A;  3U23 A;  2DA9 A;  2LJ3 A;  3NPF A;  1S1N A;  4AFU C;  5L23 A;  1Z9Z A;  3H41 A;  3I5S A;  4X1V A;  2ED1 A;  1OV3 A;  1CSK A;  1FYN A;  2HBW A;  1IO6 A;  1TUC A;  4KRT A;  2AZV A;  2DL3 A;  2KBT A;  4RTT A;  4J9D A;  1TG0 A;  4J9C A;  2LQW A;  1KIK A;  3EHQ A;  4HXJ A;  1G83 A;  1HSQ A;  1NEB A;  4JJB A;  3UA6 A;  1AZG B;  2ABL A;  1QWE A;  3JV3 A;  2JS0 A;  3VS6 A;  3I35 A;  2JM9 A;  1MUZ A;  2SEM A;  1VYT A;  1I1J A;  4R0K A;  2EGA A;  1Y0M A;  4A63 B;  3GBQ A;  5IXB A;  2EGC A;  1YWP A;  1SHF A;  2K9G A;  1ZUU A;  2XMF A;  1X2Q A;  1V1C A;  1HJD A;  1VYV A;  5IH2 A;  1BU1 A;  1U06 A;  2AKK A;  4AFS C;  2X3X D;  2LP5 A;  2HDA A;  3H0F A;  3M0P A;  2KYB A;  1SRM A;  1U3O A;  3SHW A;  2J6F A;  4LUD A;  3VS3 A;  1QLY A;  2DBK A;  3NHN A;  1AEY A;  1ZUK A;  3EG2 A;  4CC7 A;  4JZ3 A;  1PWT A;  2KT1 A;  1JQQ A;  2JTE A;  1K9A A;  2NWM A;  3VRZ A;  1QCF A;  3THK A;  3M0R A;  1PHT A;  1KJW A;  3EG0 A; 
#chains in the Genus database with same CATH topology
 2JMA A;  5KH6 A;  1AVZ C;  3M57 A;  3JCM f;  1VQ4 A;  4GLK A;  4DEY A;  3UA7 A;  1YJN Q;  2V26 A;  3HFN A;  1TUD A;  1GCQ C;  1RAF B;  4OB2 B;  1WDX A;  5CKB A;  4LDW A;  1QKX A;  1Q7Y U;  4KH0 B;  4C0D B;  1VQ5 Q;  2LZ6 B;  3LWI A;  3EAE A;  1K0X A;  1YIJ Q;  3N5B B;  4MZM A;  3QWX X;  2OJ2 A;  2M9U A;  3QZ9 B;  3SWN C;  1N9S A;  5LJ3 f;  4XTZ A;  5KYU A;  1ZBX A;  5CVI A;  4M7D D;  2RI2 A;  2LDM A;  1UTI A;  5CO7 A;  3L2U A;  2JOY A;  3CCL T;  3VS7 A;  4F14 A;  2EYW A;  3PNW C;  3OYL A;  1LNX A;  5C0M A;  2L3P A;  3H8Z A;  1UE9 A;  1VQO Q;  1SSH A;  2PVG B;  4QVC A;  4HT9 A;  4MDX A;  3LYI A;  3C95 A;  4V2S A;  2O9S A;  3UWN A;  3WVE B;  4F04 B;  1GRI A;  3M58 A;  2DL8 A;  3CCS T;  2K5F A;  3OW2 S;  4BD3 A;  5KCH A;  5GAM j;  2O9V A;  1UHF A;  1VIF A;  4RMO A;  2DLP A;  3ER0 A;  3OS2 A;  3CCR T;  3NMZ C;  2E64 A;  1N8R C;  2AZS A;  3CXC A;  3HTR A;  1G3Y A;  2KRN A;  2ZPH B;  3C12 A;  4E7H A;  3CCU A;  2F5K A;  4E2F B;  4JRK A;  2EYQ A;  1RAA B;  1A0N B;  2CT4 A;  1M1K U;  4ZNX A;  2EQJ A;  5D6W A;  2DX1 A;  1Q82 R;  1VQP Q;  2XIC A;  5I21 A;  1JO8 A;  1WLP B;  5GAM d;  3ZL7 C;  1PD0 A;  1QVP A;  1U8R A;  2CP3 A;  1UGS B;  4AG1 C;  1N9R A;  3UPU A;  1K1Z A;  1X6B A;  2F69 A;  3UF4 A;  1PRM C;  2F1L A;  5CK9 A;  4EDU A;  4BE0 A;  1K8A C;  1FXX A;  2KYM A;  4PJO C;  2ZPF B;  1IHW A;  1YIT T;  3M0U A;  2LTO A;  4C8Q B;  2BZ8 A;  2FO0 A;  2X4X A;  1MV0 B;  3OYD A;  1EX4 A;  4E7I A;  4E7J A;  3CBP A;  1W2B S;  5CR2 A;  2L3R A;  1C6V X;  3WXM B;  2GBQ A;  4FYV B;  5GAO r;  2AHJ B;  1VQ7 T;  2OTL T;  2LNV A;  4WTO B;  4J8O A;  3CCQ A;  3MEA A;  1FMV A;  2DF6 A;  2QTX A;  5ECA A;  4ELZ C;  1G3S A;  1UB4 A;  4FW1 A;  5FU7 C;  2KRO A;  2MYS A;  2JXB A;  2O01 E;  5A0G A;  4PJO E;  4RCB A;  2RHY A;  1PSE A;  3CMA A;  2ZPI B;  1YNZ A;  4FYW B;  3HPW A;  1WA7 A;  2L0A A;  3I55 A;  2CT3 A;  5J3B A;  4X9C A;  3X26 B;  1W6X A;  3SFM A;  2X3W D;  3MPU B;  4JRP A;  4ZGE B;  4J9I A;  5LJ5 j;  1NJI C;  3OYG A;  1B3Q A;  2KDS A;  3G1J A;  3CPW A;  2EYZ A;  1D0X A;  3HRU A;  1EZZ B;  2EYY A;  3A98 A;  1M3B A;  1NG2 A;  2GFU A;  1KFZ A;  4HVU A;  3QYG B;  2O88 A;  4RTZ A;  1QWF A;  4RG8 A;  4QVD A;  2B8A A;  1VQM Q;  4PFO A;  4F16 A;  1YP5 A;  5I22 A;  2DTH A;  2ROT A;  1RLP C;  4KH1 B;  2DRM A;  2PUK B;  5LJ5 d;  2EQM A;  2EJ9 A;  2E6Z A;  1WI7 A;  1C0M A;  1WYX A;  3V7C A;  3QII A;  2QDL A;  4BAC A;  3EGX B;  1M2O A;  4JRI A;  2XID A;  4ZGD B;  1MMD A;  3V7R A;  1VQK Q;  3G6E Q;  3SD4 A;  4LDU A;  4J6Y A;  4C8Q A;  3EFR A;  2PNI A;  4C92 A;  1KC8 U;  2F2W A;  2BTT A;  2OX7 A;  1ACM B;  4Z88 A;  2HAX A;  1X2K A;  2BIV A;  2ESW A;  3TCJ A;  2ZZD A;  1F1B B;  2I2L A;  2Z0W A;  2L89 A;  3OYF A;  2QDY B;  2Y4Y A;  1QMC A;  3FJ5 A;  2HNI A;  2KT8 A;  4OML A;  4LUE A;  4BDZ A;  4M78 E;  1TXQ A;  4ANJ A;  1ZUY A;  5GMK e;  4LDY A;  4C8Q F;  1LCK A;  2COW A;  1H92 A;  3SWN B;  1K73 R;  4J9B A;  2RI5 A;  4OMO A;  3MEV A;  4FU6 A;  3JCM e;  2FZK B;  2KGT A;  4LE9 A;  4MDW A;  1NJI U;  4VUB A;  2QQB A;  2PTK A;  1Q7Y R;  2EWN A;  2K3X A;  2HD0 A;  1Y96 B;  2KR3 A;  1VQ5 A;  3MP1 A;  2OTJ Q;  1YIJ A;  1MMA A;  4M7D C;  5DM7 R;  3X20 B;  2LC4 A;  8ATC B;  4IUQ A;  2RPN A;  1OPK A;  4F17 A;  4HCK A;  3E19 A;  3CC7 Q;  3OMC A;  1QCN A;  2E12 A;  1VQL A;  2X4J A;  3CCV A;  4O5V A;  2LCC A;  1D0Y A;  1SRL A;  4ELY C;  2J06 A;  1G3T A;  1NBE B;  3A1P A;  4PJO G;  2DIG A;  1VQO A;  4TVR A;  2EJF A;  1KD1 R;  2KK4 A;  1OI1 A;  2AK5 A;  3EGX A;  3LW5 E;  4MZT A;  5HK0 A;  2I0N A;  4PNO A;  2KXD A;  1BIB A;  1T3L A;  4XAX B;  1ZSZ C;  1VQN T;  2CP7 A;  4XTX A;  1M30 A;  2YUQ A;  3G71 A;  2PU9 B;  4JJN K;  2FG0 A;  2QEX Q;  1M90 C;  9ATC B;  3JCM J;  2AT1 B;  1M1K R;  3JB9 H;  4OGE A;  4PJO B;  1N5Z A;  1GCQ A;  5KE3 A;  3OYC A;  3OQ5 A;  1VQP A;  2RK2 A;  2IVW A;  4PL6 A;  3JCM Q;  1FYN A;  1TWB A;  3OYI A;  2R5A A;  1VQ8 Q;  3X24 B;  2DZ9 A;  3GIB A;  4J9D A;  3SWN A;  2VYT A;  2HKN A;  5GAO p;  1HSQ A;  2DXU A;  3JRZ A;  2JS0 A;  1EIF A;  3I35 A;  3I56 T;  2HZY A;  2JM9 A;  5FU7 B;  3DLL A;  1Y07 A;  2EIF A;  2X4W A;  3BFM A;  3VKI A;  2K4Y A;  4PJM A;  2BUD A;  2E3H A;  3CCE Q;  1YWP A;  1SHF A;  4HT8 A;  2RHI A;  4HA8 A;  1HJD A;  1TUG B;  2QA4 Q;  1BU1 A;  2AKK A;  2COZ A;  2HDA A;  4IUV A;  1P92 A;  1SRM A;  2FL7 A;  1VQ9 T;  2J6F A;  4M77 E;  1SF9 A;  4Z02 A;  4FIB A;  2NUP A;  1VQ6 Q;  2KAF A;  3NHN A;  2WSF E;  4CC7 A;  2EQU A;  1QVF P;  4M78 G;  3SB2 A;  2KT1 A;  2M02 A;  3OS1 A;  1JJ2 S;  1LJO A;  1WJS A;  1MNE A;  1M8V A;  3M0R A;  4PJO D;  4BE2 A;  1C1A A;  2RQR A;  2V1Q A;  4FYX B;  3JB9 G;  4CC4 B;  1PKS A;  2X51 A;  4BI4 A;  1N8R R;  1WHL A;  1YFN A;  3RKX A;  1G5V A;  1NLP C;  1WXU A;  4E7Z A;  2MWP A;  1WXT A;  3H0I A;  4M75 G;  1M90 U;  1BK2 A;  4JUV A;  1TS9 A;  3JCM W;  2E4H A;  1RUW A;  2JMC A;  2K5L A;  3CD6 T;  1X75 C;  2JTM A;  1K9M U;  1YJW T;  2RHZ A;  2ED0 A;  3Q1J A;  3PE0 A;  1M2V B;  4BUG A;  1IGU A;  4D6W A;  5GAN g;  1WJR A;  1HK9 A;  1WZO A;  4ZN3 A;  4KGX B;  4LD9 K;  3R6N A;  7AT1 B;  1BKB A;  2K2V A;  3MO8 A;  1K8A R;  4FM4 B;  5J26 A;  2ROL A;  2W10 A;  3PT9 A;  1B7T A;  1OX8 A;  3EH2 A;  4QQ6 A;  1SKU B;  3MP6 A;  3V8J A;  1XQH A;  5AT1 B;  3EGU A;  5EC7 A;  4PJO F;  4FW2 A;  3OB9 A;  2QI2 A;  1ABQ A;  5M9O A;  2QQA A;  1VQK A;  3G6E A;  1OEB A;  3CXC P;  2E10 A;  4A4G A;  1YI2 A;  1YHQ Q;  2NLU A;  1KG1 A;  3CCQ T;  3G4S T;  4PJJ A;  1JEG A;  4XTY A;  5IN1 A;  2CP5 A;  1WHJ A;  2RH2 A;  2RJF A;  1Z9Q A;  2YUN A;  4N4G A;  1X69 A;  1JXO A;  2DO3 A;  2NYS A;  2A7Y A;  4J7I A;  4M7D B;  1UG1 A;  2M0Y A;  3E2U A;  1IB8 A;  2DD4 A;  2A0F B;  5LJ5 h;  2YWW A;  4M78 D;  1Q81 C;  1NJI R;  4J7F A;  3VU3 C;  3JCM c;  1QVG P;  4JDS A;  2HSP A;  2KRS A;  2YXY A;  3JB9 D;  2DE0 X;  2DMO A;  2D8H A;  3GF5 A;  2VGM A;  4J9E A;  1U1T A;  2DBM A;  2FEI A;  2HQX A;  3TU4 K;  3L42 A;  5GMK i;  1M9S A;  4RCC A;  1I5O B;  5GAO m;  3P8D A;  4D8D A;  3ZBD A;  1M2V A;  2RB6 A;  3CCL Q;  2C0I A;  2LJ1 A;  3HP9 A;  1QVF A;  4N4I A;  1H3H A;  1R0C B;  3E9F A;  1D1B A;  4QKU A;  2ECZ A;  4BDY A;  4NL3 A;  1ZSZ B;  4M77 G;  1B07 A;  3QZ5 B;  2XDD A;  3JAM E;  2KVQ G;  3L2R A;  4XU0 A;  2DVE A;  2K3Y A;  2KI7 A;  2RF0 A;  2V8J A;  3LWH A;  2GCX A;  3CC4 A;  3CCS Q;  1YJ9 T;  2A28 A;  1BI2 A;  3MET A;  1T3S A;  2RJD A;  4DBR A;  2CP6 A;  4PK4 A;  3CCR Q;  2FZG B;  2XKO C;  3CPW P;  3A8G B;  2RQT A;  4PJL A;  1VYU A;  2ENM A;  2H8H A;  5IXF A;  4FSS A;  4F7U E;  1FX7 A;  4D8K A;  1VIE A;  4LXC A;  1M8M A;  4RTV A;  5CKF A;  3CCJ A;  1PM3 A;  1FMW A;  3IQL A;  3QJ6 A;  3ULR B;  3BDU A;  3FC3 A;  3OYE A;  4A4F A;  3M0Q A;  5GAM g;  2DL5 A;  4XU2 A;  1PSF A;  4M7D A;  4C0F A;  4KUI A;  2YRC A;  2LCS A;  3GNF B;  1Q81 U;  1YWO A;  2HMA A;  4MML A;  4RTW A;  1KQS S;  1GBR A;  3ASK A;  1Y71 A;  1YIT Q;  2C0O A;  4M7A C;  3OS0 A;  1WPY A;  4IUU A;  1QP2 A;  3C0C A;  4A4H A;  3OYK A;  2RMO A;  2D8J A;  1N27 A;  2KEA A;  1T0J A;  1PRL C;  2DER A;  4M7D F;  4NL2 A;  2COY A;  3CCE A;  4BY6 C;  1VQ7 Q;  2OTL Q;  3GNG A;  2EYX A;  2PQW A;  4QT7 A;  5FW9 A;  2QA4 A;  1VQL T;  5CIU A;  2EQI A;  3CCV T;  4HCB A;  4KUD K;  3QDR B;  4OMP A;  1M4Z A;  2NUZ A;  2CSQ A;  1ZSZ A;  2L2P A;  1BI0 A;  5GAO n;  1V29 B;  2EKH A;  1VQ6 A;  1UHC A;  1QVG A;  4M77 D;  3OYH A;  2HKQ B;  1ZA2 B;  3GP8 A;  4M7A E;  1EFN A;  3VS0 A;  3CCM T;  1JB0 E;  5KYN A;  4B9X A;  5GAN 3;  1W70 A;  2YHT A;  2HQE A;  1JU5 C;  5GMK m;  1KC8 C;  3F70 A;  2FB7 A;  4E6R A;  2MI6 A;  3G71 T;  1AHJ B;  3NTK A;  1M90 R;  3O5Z A;  1UGR B;  2DFU A;  4IIM A;  4JLG A;  1YCS B;  2L3S A;  4QQD A;  3I5R A;  1M1F A;  2XU8 A;  2FPF A;  5EG2 A;  2RJE A;  3VS1 A;  4PLL A;  2RQV A;  4C0Z A;  3OYJ A;  1H8K A;  2LRQ A;  1E6G A;  4WF2 A;  3I9Q A;  3VYG A;  1OU9 A;  1PNJ A;  1SSF A;  2NUT B;  5LJ5 g;  5FRO A;  2W0Z A;  2EKO A;  3T9N A;  4LDV A;  2K3B A;  1H3Z A;  4E7S A;  1LOJ A;  5CQX A;  3VUB A;  1RAC B;  1RAE B;  1NE8 A;  2X4Y A;  1Y7X A;  2LMJ A;  2KRM A;  2MAM A;  2J6K A;  2V8K A;  2VWF A;  5LJ3 j;  2G6F X;  1AOJ A;  2V1R A;  3CC2 T;  3VS5 A;  2A36 A;  3QHS A;  1ZX6 A;  3MCA B;  3JCM d;  4M4Z A;  2K79 A;  2CZ6 B;  3H0H A;  5FWC A;  2O4X B;  3X25 B;  4F7U G;  3FJP A;  2V8I A;  4Z8A A;  2MIO A;  4OMM A;  2AIR B;  2E65 A;  3HFO A;  2QAZ A;  2X9H A;  3U23 A;  2DA9 A;  4IUP A;  4M78 C;  5LJ3 d;  3H41 A;  3I5S A;  2ED1 A;  3A8L B;  1CSK A;  2HBW A;  4KGZ B;  4C5I A;  1TUC A;  2RM4 A;  2KBT A;  4RTT A;  3OBW A;  2YLB A;  4XTU A;  4NS5 A;  1KIK A;  3OYA A;  1R0B G;  3KBG A;  2Y90 A;  1MHN A;  1SG5 A;  1XJW B;  4F7U B;  1QWE A;  2JTF A;  2K57 A;  3VS6 A;  5GAN 4;  4M75 C;  1MUZ A;  1VYT A;  3OBY A;  1AT1 B;  3FRN A;  5GAN h;  1ZUU A;  2XI9 A;  2XMF A;  3VYH B;  3LGF A;  1RAG B;  5IH2 A;  1U06 A;  4AFS C;  2HSE B;  5C6S A;  4NOY A;  3CCL A;  2JZ2 A;  5KYW B;  1S72 T;  1U3O A;  3NTH A;  1RL2 A;  2D6F A;  2NUT A;  4LUD A;  1YJN A;  2RI3 A;  2DBK A;  3CBM A;  3MP8 A;  1AEY A;  3EG2 A;  4M75 E;  2LQ8 A;  2Y4X A;  4M7A G;  1PWT A;  1JQQ A;  4JLI A;  3M4G A;  2RA2 A;  2DZC A;  4FSX A;  5KCO A;  3JB9 J;  1PHT A;  2MF2 A;  1GXI E;  3UDC A;  4X34 A;  3INZ A;  1YI2 T;  3CCR A;  3EG9 B;  1VQN Q;  3URG A;  5LJ5 e;  4DOW A;  1T0H A;  1WHG A;  1VA7 A;  4RKU E;  2P84 A;  3PTA A;  1W4S A;  1BI3 A;  2XD0 A;  2RO0 A;  1NLO C;  2CSI A;  4MMK A;  2K2M A;  4CI0 C;  2PVO B;  1IGQ A;  4M7A B;  4DQ2 A;  4A54 A;  2IG0 A;  4Z89 A;  2DNU A;  3PMI A;  2HBP A;  3J80 E;  1WNL A;  3EGD B;  3KUF A;  5GAN f;  5FLX E;  5A2Q E;  3MKD A;  4E7L A;  2YUO A;  3E1S A;  1Q81 R;  3CME T;  4BY6 B;  1GFC A;  4R56 A;  2IIM A;  3FB9 A;  3UT1 A;  3CPF A;  2L5Q A;  3I56 Q;  3GPL A;  1IZ6 A;  3TEE A;  5FWB A;  1U1S A;  2CKK A;  1FWZ A;  4HKE A;  2O2O A;  2PZ1 A;  1K9M C;  4ATO A;  1UUE A;  2XK0 A;  2B86 A;  3VS2 A;  4EMK C;  3NTI A;  4OF1 A;  2HCK A;  2BZY A;  1QCO A;  1DJ7 B;  1VQ9 Q;  4EMH A;  2K6D A;  5J39 A;  1VQ4 T;  1VQ7 A;  2LX7 A;  2E1H A;  5D7U A;  2XDP A;  2J7I A;  1GL5 A;  3OYB A;  5HY6 A;  5KYW A;  4M77 C;  2ZPE B;  2YSQ A;  5CQY A;  1PC0 A;  3VRY A;  1X01 A;  4F7U F;  3A5Z B;  3CC4 T;  4BB7 A;  1PKT A;  2J05 A;  2DET A;  1MMN A;  3REB B;  2WSC E;  1Y96 A;  4E7K A;  2ZPG B;  4M7A D;  2D0Q B;  1D3B B;  1O75 A;  1UJY A;  1HD3 A;  3EG9 A;  4EMG A;  2CUD A;  1CKA A;  3CD6 Q;  3PIP A;  4EIK A;  3CCJ T;  1YJW Q;  3RR6 A;  1Q82 U;  4KBM B;  4RTU A;  1UDL A;  1YBY A;  1K76 A;  2RJC A;  2KNB B;  5GAM h;  5CCA A;  1W1F A;  4C5H A;  4KGV B;  4A4E A;  2EGE A;  1LPL A;  2A08 A;  4OMN A;  4PFZ A;  1RI0 A;  3EFO B;  1HYO A;  2M51 A;  3EGD A;  4QVZ A;  1RAD B;  1GFD A;  5GJV B;  4Y28 E;  3M53 A;  1I5L A;  3CCU T;  2DD5 A;  5CKE A;  4JS4 A;  1NPP A;  1KQ2 A;  2DJQ A;  2RN8 A;  2M0O A;  3GOX A;  2CRE A;  4J5Y A;  4DA4 A;  2CDT A;  3S3N A;  4KT0 E;  4YTL A;  2M16 A;  1OU8 A;  2JW4 A;  4WCI A;  4HCC A;  2KE9 A;  4M78 B;  2DIL A;  4C5G A;  4M7A F;  4LDX A;  2YT6 A;  4PJO A;  2HL5 C;  3HRS A;  3CCQ Q;  3S6W A;  3G4S Q;  2LQN A;  1VQM A;  1TH7 A;  3NGP A;  4XTW A;  5KYX B;  1AZE A;  1OYX A;  4OB1 B;  3C94 A;  3MEW A;  4HCZ A;  3BY7 A;  2RNA A;  2HQH A;  3PMT A;  5I11 A;  3RER A;  4DOV A;  1ARK A;  4DBH A;  2OAU A;  4M75 B;  1FMK A;  1TU0 B;  4C92 C;  2FPE A;  1AD5 A;  4AG2 C;  2KXC A;  3JCM P;  1WQ7 A;  2ZAE A;  1K73 C;  2LNH B;  1R77 A;  1RLQ C;  1KHC A;  2FPD A;  3PGG A;  3DKM A;  5GAM f;  1AWO A;  4ME7 A;  1KC8 R;  1HXD A;  1WHK A;  1I4K 1;  3BW1 A;  4L5G A;  3M55 A;  5KE2 A;  1D3B A;  1BI1 A;  2VV5 A;  2E41 A;  5CAI A;  2QXF A;  4HVW A;  3EG1 A;  1OOT A;  5DLO A;  1BYM A;  4OB3 B;  1M27 C;  2MPX C;  4C8Q E;  2DL7 A;  2X35 A;  4OGC A;  1OZ2 A;  4ESR A;  4C92 E;  3OA6 A;  3CMA T;  1JXM A;  4EPC A;  3HSB A;  4GBQ A;  2VXE A;  3V7S A;  4XK8 E;  3I55 T;  1BBZ A;  2WAC A;  2BE7 D;  1SHG A;  2CS7 A;  1JJ2 A;  3SDZ A;  2C06 A;  2MMP A;  4JJC A;  5CKD A;  1CKB A;  2FZC B;  3A8H B;  3DLM A;  3EFO A;  1LVK A;  3A8O B;  3P8H A;  1YJ9 Q;  1UGQ B;  1KD1 C;  4B9W A;  1OUL A;  4LNP A;  5LJ3 h;  2D0N A;  2JN0 A;  4L59 A;  2LJ0 A;  3TSW A;  3L2V A;  3ZEH A;  3CXC S;  2OTJ A;  4N4H A;  4M75 D;  1JRI A;  1V76 A;  1G3W A;  3OYM A;  1UFF A;  4M78 A;  4II1 A;  4RTY A;  3LGL A;  2BZX A;  1VQN A;  1D09 B;  1Q86 C;  2H3E B;  2R57 A;  3X28 B;  3CC7 A;  5KYX A;  5CKH A;  1ZSG A;  3E9G A;  1X6G A;  1SEM A;  2IPO B;  2MWO A;  1NYG A;  2RQU A;  2XG8 D;  2DJZ A;  4M75 A;  3QDF A;  2QTV A;  2YUP A;  4EMK B;  1R8O B;  4CRI A;  1ZA1 B;  2DPP B;  5GAN e;  4M78 F;  1K73 U;  3OW2 P;  2OI3 A;  1UGV A;  3S3O A;  3O8V A;  3WVD B;  5IHK A;  4ZGJ B;  1QVG S;  3CBO A;  2O31 A;  3TVT A;  5LJ5 f;  1WFW A;  4GLM A;  4XQ3 A;  4ZTJ A;  2RHX A;  1ZBJ A;  1KQS P;  3JB9 F;  3I56 A;  4M77 B;  2EVR A;  2GTJ A;  2QEX A;  2DKG A;  4OB0 B;  1BCM A;  4M75 F;  2DXB A;  4JJD A;  2CP0 A;  2P4R A;  2VAS A;  1VQL Q;  4BI3 A;  3LH0 A;  3CCV Q;  3CQT A;  1GBQ A;  4OVA A;  4RTX A;  1VQ9 A;  1TSF A;  4AFZ C;  5GAN 8;  1VQ8 A;  3UAT A;  3LX7 A;  4JRQ A;  1YJN T;  1KD1 U;  3CCM Q;  4J9G A;  1VQ5 T;  2DEQ A;  2LJ3 A;  2CP2 A;  3NPF A;  1S1N A;  4AFU C;  5A0D A;  1Z9Z A;  2DXC A;  4BI8 B;  5L23 A;  2H3J A;  1YIJ T;  3CPW S;  1OV3 A;  3DB3 A;  2DEU A;  2KQW A;  2DL3 A;  3M56 A;  3G71 Q;  1W2B P;  2JJ9 A;  2F5T X;  2CZ1 B;  4J9C A;  2GFA A;  2M1H A;  2E3I A;  1Q86 U;  1AZG B;  2ABL A;  4B6M A;  3JV3 A;  1TOV A;  3JCM V;  4Y91 A;  4C8Q G;  3CD6 A;  1YJW A;  1I81 A;  4C92 G;  1VQO T;  3JSC A;  3OY9 A;  5FRM A;  4R0K A;  3ME9 A;  3VV0 A;  2EGA A;  1Y0M A;  4A63 B;  3GBQ A;  5IXB A;  1XNI A;  2EGC A;  1IRE B;  3OSS C;  4FT2 A;  3H0F A;  4EMK A;  5DLQ E;  2VB6 A;  3SHW A;  3V8K A;  1Q95 G;  4OP0 A;  2BKD N;  1WGS A;  3VS3 A;  5FRN A;  1MMG A;  1UGP B;  2G3R A;  1ZUK A;  4A53 A;  1K9M R;  3CC2 Q;  4M77 A;  2JTE A;  4C92 B;  4C5E A;  2KY9 A;  3M4Y A;  5GMK j;  1VQP T;  3RDV A;  1OZ3 A;  3JCM g;  5LL6 S;  2R5M A;  4J6W A;  3M5A A;  3G4S A;  1BIA A;  4IUR A;  1WXB A;  2DVJ A;  4MZP A;  3OW2 A;  2JS2 A;  2GQV A;  2F2V A;  2JUF A;  2K7A A;  1NZ9 A;  3L1A A;  4M77 F;  2A37 A;  1UJ0 A;  4RG2 A;  1M5Q 1;  1NEG A;  1D1C A;  1XTD A;  3OS5 A;  1KQS A;  1ZQ1 A;  1VUB A;  2DTI A;  5LJ3 g;  5GAN 6;  5D6X A;  1XOV A;  1KSW A;  5GAM e;  2PUO B;  5GAO q;  5D6Y A;  2QAS A;  1N8R U;  2DIQ A;  2MOX A;  2JM8 A;  3SEM A;  1YHQ A;  1WX6 A;  1KQ1 A;  2DXT A;  1O9S A;  3RBB B;  8AT1 B;  5GJW B;  2KMT A;  2GGR A;  5GAO l;  1K0S A;  4XU3 A;  2CUB A;  2DYB A;  2MK5 A;  2FHD A;  3JCM X;  1VOM A;  4KUL A;  1MV3 A;  2E6N A;  2EPD A;  5HKC A;  5HCK A;  4N0A C;  3RUX A;  4C8Q D;  3RMS A;  1B34 B;  2VKN A;  4C92 D;  2RQW A;  1S72 Q;  2F2X A;  3QSU A;  2BE9 B;  3JB9 I;  2HEQ A;  5HK3 A;  2LCL A;  3D7S B;  3ZFJ A;  1ABO A;  2FRW A;  2DYI A;  1K8A U;  2JT4 A;  1W2B A;  2A3L A;  4FT4 A;  2VGN A;  3VUZ A;  5FU6 C;  1K4U S;  1YJ9 A;  3DB4 A;  2FYK A;  4IIO A;  1G2B A;  1YI2 Q;  3FLG A;  2XDB A;  2E70 A;  2YLC A;  5KYY B;  1IHV A;  1ZLM A;  3BDL A;  2ZGW A;  1VQM T;  2GTO A;  4CC2 A;  1MGQ A;  1RAI B;  1G8X A;  3TRE A;  3M9Q A;  3MEU A;  2EFI A;  1E7O A;  3FIF A;  3V8L A;  2CH4 W;  3OYY A;  2DAQ A;  4AT1 B;  1N6A A;  3OMG A;  2RD1 A;  1JBM A;  3AT1 B;  2FRY A;  3MHX A;  2EBP A;  4C92 F;  1YN8 A;  2QGF B;  3CCS A;  3CME Q;  1VQK T;  3G6E T;  3PFS A;  1KHI A;  1WHH A;  1D1A A;  1RI9 A;  3HHT B;  1J3T A;  4IKF A;  1IXD A;  4A4K A;  3R6O A;  3BE3 A;  4Q5W A;  5GAN 7;  2P0K A;  4GY5 A;  3QPH A;  2O4X A;  3HKS A;  5GAN 2;  1AWJ A;  3HRT A;  3EG3 A;  1Q82 C;  3QJY A;  1MND A;  5LJ3 e;  2HL3 A;  3HL8 A;  1UEC A;  3GLX A;  2GQI A;  2D1X A;  4L6V 5;  3H9N A;  3P8B B;  2QG9 B;  1VQ4 Q;  6AT1 B;  1M3A A;  2NUP B;  3L2Z A;  1B34 A;  4Y92 A;  4E47 A;  3VS4 A;  3CC4 Q;  1GCP A;  4J83 A;  4BE1 A;  4FYY B;  1D0Z A;  3RMQ A;  1NYF A;  2YDL A;  1WHM A;  2WSE E;  2VVK A;  2VXF A;  1YIT A;  1M3C A;  1QQJ A;  4M7D E;  4F7U A;  3QG1 A;  3CCM A;  2EW3 A;  2CYZ B;  3QYH B;  2OTJ T;  1BB9 A;  2E5K A;  5GMK l;  1QKW A;  4OMF B;  4O6J A;  4AMC A;  4LN2 A;  4UC4 A;  2R58 A;  3RNJ A;  1I0C A;  3S3M A;  3REA B;  5KYY A;  1Q86 R;  2ZCF B;  3CC7 T;  2OTL A;  2DK3 A;  3RIR A;  3CCJ Q;  3L2Q A;  3PVQ A;  4C0D C;  4RUG A;  2LT4 A;  2QGG A;  4FL6 A;  2CGH A;  1PCX A;  5IAY A;  2DRK A;  2AKL A;  3MJX A;  1JJ2 P;  4AFQ C;  2P4T A;  2OAW A;  1RAB B;  4K11 A;  4XTV A;  3M59 A;  3LH5 A;  4JZ4 A;  5A0L A;  2LQK A;  4QW2 A;  2EQK A;  3QWY A;  3CCU Q;  4ORZ A;  1I07 A;  1TTH B;  2L8D A;  3EHR A;  2FVU A;  3A8M B;  2J6O A;  4FCY A;  3M0T A;  4PLI A;  3EH1 A;  2CZ0 B;  3FDR A;  2D9T A;  1IRX A;  2QEX T;  5IT9 E;  1OQK A;  1NM7 A;  3RKY A;  3CC2 A;  2P0P A;  5L8R E;  2QQR A;  4ZTF A;  1BCO A;  2QQ9 A;  4P5N A;  3VJP A;  5AYF A;  5IHI A;  4M7A A;  1AWW A;  3H6Z A;  3LLR A;  1VQ8 T;  3CEY A;  2GNC A;  2LX9 A;  4JPB W;  3M0S A;  2SRC A;  4PKC C;  1OX9 A;  1ZHI A;  2K5I A;  4QQG A;  4X9D A;  4DBF A;  2CZ7 B;  3AHU A;  4J9H A;  3OYN A;  4OMQ A;  1AWX A;  1WIE A;  2YRD A;  4DEX A;  2CH4 A;  3CCE T;  3RKW A;  2QA4 T;  2P0Q A;  2L3Q A;  3PVL A;  3C4S A;  1OPL A;  1WQW A;  4JS5 A;  5IHN A;  2LVM A;  1E6H A;  2GF7 A;  2ZPB B;  3CMA Q;  3L2W A;  1X43 A;  1QVF S;  3FEO A;  3KXT A;  5FU6 B;  1VQ6 T;  4C8Q C;  2PVD B;  4HVV A;  3I55 Q;  4LD6 A;  2C0T A;  2XHC A;  3M54 A;  1Y57 A;  3QBY A;  5GAN j;  3KFV A;  4J9F A;  2DL4 A;  3TSZ A;  1SPK A;  1S72 A;  2DM1 A;  3G7Z A;  2QK0 A;  1X27 A;  4ZN1 A;  2RHU A;  1U5S A;  1Q7Y C;  4DBQ A;  3RES A;  5GAN 5;  1X6O A;  3EFS A;  2MCN A;  3PIO A;  4CC3 A;  2EAY A;  4M7D G;  3QO3 A;  5GMK h;  5KYU B;  1H64 1;  2JVV A;  4X1V A;  5I2S A;  3JCM h;  5GAN d;  2VUB A;  4IUT A;  1IO6 A;  4KRT A;  2AZV A;  4XU1 A;  2YRV A;  1TG0 A;  2LQW A;  2QQS A;  3EHQ A;  4HXJ A;  1G83 A;  4PFP A;  1NEB A;  4JJB A;  3UA6 A;  3QKJ A;  2RK1 A;  2EJG A;  2SEM A;  2JNG A;  1M1G A;  1I1J A;  1PG5 B;  2E5Q A;  1NPR A;  4PJN A;  2LT1 A;  2ATC B;  2KSS A;  4J6X A;  2K9G A;  1X2Q A;  1V1C A;  1VYV A;  4R55 A;  1QW1 A;  4C0G A;  3CME A;  2X3X D;  1I8F A;  2LP5 A;  1KK7 A;  3QUI A;  3M0P A;  1YCY A;  1PD1 A;  3JCM b;  5DY9 A;  2KYB A;  4N0A A;  3NFC A;  1UEB A;  1YHQ T;  3TQ7 P;  3OSV A;  1M1K C;  1QLY A;  2QYZ A;  3J81 E;  5I2M A;  3J7A F;  4JZ3 A;  2DTO A;  1K9A A;  1QP3 A;  2NWM A;  3VRZ A;  1QCF A;  1RAH B;  3THK A;  1WJQ A;  1KJW A;  3EG0 A;  3QXE B;  2VC8 A; 
#chains in the Genus database with same CATH homology
 2RQR A;  2V1Q A;  2JMA A;  1AVZ C;  4CC4 B;  1PKS A;  4DEY A;  1T0H A;  3UA7 A;  1VA7 A;  1WXB A;  1TUD A;  1NLP C;  1WXU A;  2DVJ A;  1GCQ C;  1WXT A;  3H0I A;  1WDX A;  2JS2 A;  1BK2 A;  1QKX A;  2F2V A;  1NLO C;  2K7A A;  2CSI A;  1RUW A;  2JMC A;  2LZ6 B;  1K0X A;  2K2M A;  2A37 A;  1UJ0 A;  1NEG A;  2ED0 A;  3PE0 A;  3QWX X;  2OJ2 A;  4Z89 A;  2DNU A;  1XOV A;  1KSW A;  2YUO A;  1UTI A;  1GFC A;  3VS7 A;  3R6N A;  4F14 A;  2EYW A;  2IIM A;  2MOX A;  2L3P A;  2JM8 A;  3SEM A;  1WX6 A;  1UE9 A;  5FWB A;  2ROL A;  2W10 A;  1SSH A;  3RBB B;  5GJW B;  2GGR A;  2O2O A;  2PZ1 A;  1K0S A;  2CUB A;  1UUE A;  2DYB A;  2O9S A;  2B86 A;  3EGU A;  5EC7 A;  1GRI A;  2DL8 A;  1ABQ A;  3VS2 A;  1MV3 A;  2EPD A;  5HCK A;  2HCK A;  2O9V A;  1UHF A;  2BZY A;  1OEB A;  2VKN A;  2DLP A;  2RQW A;  2F2X A;  3NMZ C;  2K6D A;  2HEQ A;  2LX7 A;  2AZS A;  2J7I A;  1JEG A;  1ABO A;  2FRW A;  2KRN A;  1GL5 A;  2JT4 A;  2YSQ A;  3VRY A;  1Z9Q A;  1A0N B;  2CT4 A;  4ZNX A;  1K4U S;  2YUN A;  1X69 A;  2DX1 A;  1PKT A;  1JXO A;  2J05 A;  4IIO A;  1G2B A;  1UG1 A;  3REB B;  2M0Y A;  1JO8 A;  1WLP B;  1ZLM A;  3ZL7 C;  2GTO A;  4CC2 A;  1UJY A;  4AG1 C;  1K1Z A;  1HD3 A;  1X6B A;  2CUD A;  3UF4 A;  1CKA A;  1PRM C;  2HSP A;  2KRS A;  2DE0 X;  4EIK A;  1E7O A;  2DMO A;  2D8H A;  2KYM A;  2CH4 W;  4J9E A;  2DBM A;  2FEI A;  3M0U A;  4RTU A;  1UDL A;  2BZ8 A;  2FRY A;  2FO0 A;  1MV0 B;  1K76 A;  2EBP A;  2KNB B;  1YN8 A;  4D8D A;  1W1F A;  2C0I A;  2LJ1 A;  1H3H A;  2EGE A;  2GBQ A;  2A08 A;  4OMN A;  1RI9 A;  1J3T A;  2ECZ A;  2M51 A;  1B07 A;  1GFD A;  5GJV B;  2DF6 A;  5ECA A;  2KRO A;  2JXB A;  1AWJ A;  2DJQ A;  2RN8 A;  2RF0 A;  2CRE A;  3EG3 A;  2A28 A;  2CDT A;  1YNZ A;  1T3S A;  2JW4 A;  1WA7 A;  2L0A A;  4WCI A;  1UEC A;  2CT3 A;  2KE9 A;  2DIL A;  2GQI A;  2D1X A;  2YT6 A;  1W6X A;  2X3W D;  2RQT A;  1M3A A;  4J9I A;  2LQN A;  3NGP A;  1VYU A;  2ENM A;  2H8H A;  1AZE A;  1B3Q A;  5IXF A;  2EYZ A;  4Y92 A;  4FSS A;  3VS4 A;  4D8K A;  1GCP A;  2RNA A;  1M8M A;  4RTV A;  5I11 A;  1NYF A;  1ARK A;  3IQL A;  2EYY A;  2YDL A;  1M3B A;  3A98 A;  1NG2 A;  3ULR B;  1KFZ A;  2VVK A;  1FMK A;  4HVU A;  2FPE A;  1M3C A;  1AD5 A;  4AG2 C;  2KXC A;  2EW3 A;  1QWF A;  4RTZ A;  2O88 A;  1BB9 A;  4F16 A;  2LNH B;  2E5K A;  1YP5 A;  3M0Q A;  1QKW A;  2DL5 A;  5I22 A;  2ROT A;  1RLQ C;  1RLP C;  2FPD A;  1AWO A;  2DRM A;  4LN2 A;  3RNJ A;  1I0C A;  3REA B;  2LCS A;  1YWO A;  1WI7 A;  3PVQ A;  4HVW A;  4RTW A;  3EG1 A;  1OOT A;  1GBR A;  4RUG A;  1M27 C;  1WYX A;  2C0O A;  2QDL A;  2DRK A;  2DL7 A;  4ESR A;  2AKL A;  1JXM A;  3C0C A;  4GBQ A;  2RMO A;  2D8J A;  4AFQ C;  2KEA A;  1T0J A;  2OAW A;  1PRL C;  1BBZ A;  4K11 A;  1SHG A;  2PNI A;  3LH5 A;  2F2W A;  4JZ4 A;  2EYX A;  4QT7 A;  5FW9 A;  2EQI A;  2BTT A;  3QWY A;  4ORZ A;  1I07 A;  4Z88 A;  3EHR A;  4JJC A;  1CKB A;  1X2K A;  4OMP A;  2ESW A;  2J6O A;  2NUZ A;  3M0T A;  2CSQ A;  2L2P A;  4LNP A;  2EKH A;  1UHC A;  2D0N A;  3FJ5 A;  2LJ0 A;  2KT8 A;  4OML A;  4LUE A;  1EFN A;  1NM7 A;  3VS0 A;  3TSW A;  1ZUY A;  1LCK A;  1W70 A;  1H92 A;  4J9B A;  5IHI A;  4OMO A;  1JU5 C;  1UFF A;  1AWW A;  4RTY A;  4E6R A;  2BZX A;  2KGT A;  4LE9 A;  2GNC A;  2PTK A;  3O5Z A;  4JPB W;  3M0S A;  2SRC A;  4IIM A;  1YCS B;  2L3S A;  1ZSG A;  3I5R A;  1X6G A;  1SEM A;  2KR3 A;  2FPF A;  1NYG A;  2RQU A;  3VS1 A;  2RQV A;  4J9H A;  2YUP A;  4OMQ A;  1H8K A;  1AWX A;  1E6G A;  1WIE A;  4DEX A;  2OI3 A;  2RPN A;  1UGV A;  2CH4 A;  1OPK A;  4F17 A;  3I9Q A;  4HCK A;  5IHK A;  1PNJ A;  2O31 A;  3TVT A;  2L3Q A;  3PVL A;  1WFW A;  4GLM A;  2W0Z A;  1OPL A;  2K3B A;  1SRL A;  1ZBJ A;  5IHN A;  2J06 A;  1E6H A;  2EVR A;  2GTJ A;  1X43 A;  2LMJ A;  4HVV A;  2KRM A;  2J6K A;  2C0T A;  2VWF A;  2AK5 A;  2G6F X;  1AOJ A;  2V1R A;  3VS5 A;  1Y57 A;  4JJD A;  2A36 A;  2P4R A;  1ZX6 A;  2I0N A;  4M4Z A;  2K79 A;  3KFV A;  3CQT A;  2DL4 A;  4J9F A;  2KXD A;  3TSZ A;  1T3L A;  3H0H A;  1SPK A;  5FWC A;  2DM1 A;  1GBQ A;  4RTX A;  1M30 A;  1X27 A;  2YUQ A;  4AFZ C;  2FG0 A;  3UAT A;  4Z8A A;  1U5S A;  2MIO A;  4OMM A;  2MCN A;  4CC3 A;  1N5Z A;  1GCQ A;  4J9G A;  3U23 A;  2DA9 A;  2LJ3 A;  3NPF A;  1S1N A;  4AFU C;  5L23 A;  1Z9Z A;  3H41 A;  3I5S A;  4X1V A;  2ED1 A;  1OV3 A;  1CSK A;  1FYN A;  2HBW A;  1IO6 A;  1TUC A;  4KRT A;  2AZV A;  2DL3 A;  2KBT A;  4RTT A;  4J9D A;  1TG0 A;  4J9C A;  2LQW A;  1KIK A;  3EHQ A;  4HXJ A;  1G83 A;  1HSQ A;  1NEB A;  4JJB A;  3UA6 A;  1AZG B;  2ABL A;  1QWE A;  3JV3 A;  2JS0 A;  3VS6 A;  3I35 A;  2JM9 A;  1MUZ A;  2SEM A;  1VYT A;  1I1J A;  4R0K A;  2EGA A;  1Y0M A;  4A63 B;  3GBQ A;  5IXB A;  2EGC A;  1YWP A;  1SHF A;  2K9G A;  1ZUU A;  2XMF A;  1X2Q A;  1V1C A;  1HJD A;  1VYV A;  5IH2 A;  1BU1 A;  1U06 A;  2AKK A;  4AFS C;  2X3X D;  2LP5 A;  2HDA A;  3H0F A;  3M0P A;  2KYB A;  1SRM A;  1U3O A;  3SHW A;  2J6F A;  4LUD A;  3VS3 A;  1QLY A;  2DBK A;  3NHN A;  1AEY A;  1ZUK A;  3EG2 A;  4CC7 A;  4JZ3 A;  1PWT A;  2KT1 A;  1JQQ A;  2JTE A;  1K9A A;  2NWM A;  3VRZ A;  1QCF A;  3THK A;  3M0R A;  1PHT A;  1KJW A;  3EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...