2KRNA

High resolution structure of the second sh3 domain of cd2ap
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
GSMGRQCKVLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krnA00
4RUGA 1U5SA 1QKWA 1X27A 1M3CA 1YWOA 3R6NA 2AKKA 2JS0A 4OMMA 4AFZC 2EBPA 2O31A 5I22A 1U06A 2LNHB 2A37A 1X2KA 1WI7A 4OMOA 2JT4A 2EYWA 1OEBA 2DA9A 4IIMA 1KFZA 1VYVA 2AK5A 1AWJA 2V1RA 1WXBA 2DL3A 2DL8A 1B3QA 3I5RA 4JZ4A 1YNZA 4GBQA 1FMKA 2J6FA 2EKHA 2YUOA 1V1CA 2KT1A 1SHFA 1AZGB 2DL4A 2A36A 1PHTA 2YUQA 2DL7A 2ED0A 3EG1A 3SHWA 2FRWA 2AZSA 4CC7A 2JS2A 2KT8A 3PVLA 2HCKA 1HJDA 4RTTA 3VS6A 3TVTA 1N5ZA 3TSZA 2CREA 2BTTA 2KROA 5IH2A 1X43A 2F2XA 2GTJA 2RQTA 2YT6A 2I0NA 1G83A 1G2BA 1UHFA 2XMFA 3M0PA 1RLPC 1JEGA 1MUZA 1QWFA 2CT3A 1K0XA 2JW4A 4CC3A 1ZBJA 5IXBA 4JZ3A 1WXTA 4AFSC 4E6RA 2RN8A 4LUDA 1NM7A 2YUPA 2HEQA 5FW9A 2EYZA 2ED1A 1X2QA 1AWXA 1WYXA 1QKXA 3M0UA 1H3HA 2O9VA 1WLPB 2J06A 2JM8A 5ECAA 4Z8AA 4CC4B 1OOTA 1WXUA 3SEMA 2C0TA 1SHGA 2ECZA 1Z9ZA 2DVJA 2AKLA 2DBKA 1WDXA 2V1QA 2CUDA 1K76A 1M8MA 2JMCA 4Z89A 4RTVA 2J7IA 2L2PA 3QWXX 1YWPA 2EVRA 2KNBB 3FJ5A 2HBWA 2LP5A 5GJVB 4LNPA 2OI3A 1SRLA 3QWYA 1ZUKA 2KGTA 2OAWA 3VRYA 2BZYA 1GFCA 1TG0A 1UHCA 4JJCA 1GBQA 4AFUC 2KR3A 3M0RA 2KRMA 1T0JA 2DF6A 2DMOA 2L0AA 2L3PA 1XOVA 2ABLA 1NLOC 1KIKA 1BBZA 4RTWA 4J9GA 5FWBA 3UA6A 3REBB 1T3LA 4F14A 3M0QA 1NEGA 2LJ1A 3JV3A 2W10A 2EGEA 2EYXA 2NWMA 1TUDA 1KJWA 2H8HA 1OPKA 1ZUUA 2K3BA 3EG0A 3NHNA 1GCPA 2ROLA 1M3AA 1NEBA 2EQIA 4F17A 1MV0B 2LX7A 4HVUA 1WIEA 1GFDA 1AEYA 4J9HA 2LJ0A 1SRMA 3M0SA 2L3QA 2K2MA 2C0OA 1VYTA 1HSQA 2SRCA 2VWFA 2KYBA 3VS1A 4LE9A 2K6DA 2VKNA 1YCSB 2J05A 2DX1A 2JXBA 3EG2A 4R0KA 1K0SA 1I1JA 1H92A 1UJ0A 2YSQA 1UECA 2GNCA 2PZ1A 2DRMA 4RTUA 4AFQC 2GBQA 4HVWA 1YN8A 2LCSA 1UJYA 4A63B 2P4RA 2DNUA 5GJWB 2J6OA 1FYNA 2MCNA 5FWCA 2EGCA 1GBRA 5IHNA 4J9CA 2LZ6B 2K9GA 1M3BA 2KEAA 1OPLA 1JU5C 2GGRA 1WA7A 1EFNA 1BU1A 1E6HA 1B07A 1I07A 3UA7A 1K4US 3IQLA 2K79A 3I5SA 2A08A 1ZUYA 4RTYA 2EPDA 2ESWA 2KXCA 2M0YA 2RQRA 1JO8A 1TUCA 1ABOA 1A0NB 4QT7A 2EW3A 4HXJA 4D8DA 3CQTA 3O5ZA 4AG2C 1AOJA 1AWWA 5IHKA 2JM9A 2W0ZA 4IIOA 1NG2A 1S1NA 2LJ3A 3EHRA 4Y92A 4AG1C 4ESRA 4F16A 5IXFA 3RBBB 4RTZA 2QDLA 4JJBA 1UGVA 3GBQA 1PKSA 1VYUA 2DLPA 4LUEA 1M27C 2X3XD 4X1VA 4CC2A 3A98A 4M4ZA 1AWOA 3U23A 1CSKA 1UG1A 1M30A 2RQVA 4JJDA 4OMQA 3NPFA 1ABQA 1U3OA 2O9SA 2FG0A 2G6FX 4JPBW 2X3WD 2LMJA 1UTIA 4J9DA 1JXMA 3VS2A 2YDLA 1GL5A 2HDAA 2LQWA 4DEXA 4OMPA 2CT4A 1T3SA 1LCKA 1PNJA 2DBMA 1ZLMA 2E5KA 3EHQA 1RI9A 2RPNA 3LH5A 2CSQA 1KSWA 2KRSA 3VS7A 1PWTA 1VA7A 4D8KA 1X6BA 2OJ2A 1BB9A 4DEYA 1NYGA 2CH4W 3C0CA 1ARKA 2YUNA 5I11A 2RMOA 2DILA 1CKAA 3UATA 1SEMA 1K9AA 1NLPC 2FPFA 1JQQA 2PTKA 3ULRB 3VS3A 2K7AA 2JTEA 4ORZA 2DYBA 1PRLC 2CUBA 2F2VA 4J9EA 1BK2A 4GLMA 4KRTA 3EGUA 1UE9A 2C0IA 1AD5A 4J9BA 1UDLA 1WX6A 1CKBA 3H0IA 1X6GA 2DJQA 2KBTA 2CSIA 1T0HA 3PE0A 2DRKA 2IIMA 2KRNA 3RNJA 2BZXA 3VS5A 1RLQC 1JXOA 4J9FA 2FO0A 2BZ8A 4ZNXA 1HD3A 2RF0A 2FPDA 1K1ZA 2O88A 1X69A 2GTOA 2D0NA 2FPEA 2M51A 1QCFA 1WFWA 2SEMA 1PRMC 2FRYA 2DM1A 1E6GA 2ROTA 2DE0X 4OMLA 2DL5A 3NGPA 4Z88A 1GRIA 4FSSA 5HCKA 2VVKA 3H0FA 4HCKA 2J6KA 1GCQC 2A28A 3I9QA 4RTXA 1PKTA 1QLYA 1Y0MA 3THKA 3VRZA 2KXDA 5EC7A 1IO6A 2FEIA 1ZSGA 2MIOA 1E7OA 1QWEA 1SSHA 2NUZA 1Z9QA 2AZVA 5L23A 2JMAA 3H0HA 2HSPA 1OV3A 3VS0A 2O2OA 3KFVA 1W70A 3M0TA 4HVVA 2GQIA 1UFFA 2D8JA 3H41A 1UUEA 2MOXA 3UF4A 1J3TA 1Y57A 3TSWA 2PNIA 4K11A 4OMNA 1AVZC 1W1FA 2LQNA 3NMZC 5IHIA 1SPKA 1AZEA 1YP5A 2RNAA 3ZL7C 1GCQA 4J9IA 2ENMA 2KYMA 4WCIA 1W6XA 2RQWA 4LN2A 1MV3A 2D1XA 2EYYA 2D8HA 1RUWA 1ZX6A 3I35A 3PVQA 2EGAA 2RQUA 3REAB 2B86A 2L3SA 1H8KA 2CDTA 4EIKA 2KE9A 1I0CA 2CH4A 3EG3A 1NYFA 3VS4A 2F2WA
chains in the Genus database with same CATH superfamily
1VQNQ 4FSXA 4C8QA 1X27A 3BW1A 2K5LA 4ZN3A 2AKKA 3CMEA 2QQSA 2JUFA 2JS0A 5LL6S 5GMKm 2A37A 3CBOA 2AHJB 2QGFB 3FC3A 1WI7A 4M78B 3A8MB 2E12A 2JT4A 2EYWA 4IIMA 1KFZA 4FYYB 1VYVA 1WXBA 3L2QA 4N0AA 5CR2A 2RJFA 4M78F 3JCMX 4JZ4A 3TREA 5CKFA 2LRQA 1W2BS 4HKEA 1V1CA 4FT4A 3OYGA 1SHFA 2PUOB 3OW2A 3M54A 3CCJT 1PHTA 2F5TX 3CC2A 3CPWS 4HT9A 2H3EB 5I2SA 3V8JA 1KC8C 1M90R 4J83A 3VS6A 4ELYC 1N5ZA 2KROA 5IH2A 2F2XA 2YT6A 3MHXA 2I0NA 1G83A 1HK9A 3CBMA 2CT3A 3OB9A 1LJOA 2ZZDA 3EGDA 3HPWA 1K0XA 3CCSA 2JW4A 2EJ9A 2DXCA 1KQSP 3SDZA 3EFSA 1NM7A 4FCYA 2PVOB 2EYZA 2ED1A 4XTUA 3TCJA 2O9VA 3G6ET 1WLPB 2HZYA 2J06A 4Z8AA 1Q81R 2DJZA 2XDDA 3OMCA 2GFUA 2AT1B 1VQPQ 4A4KA 1WXUA 3E1SA 3JCMe 1OYXA 1VQMT 1VQLT 2RK2A 3EG9A 2ECZA 3CCJQ 2X51A 1Z9ZA 2AKLA 2LQKA 2V1QA 4PKCC 2CUDA 4IUPA 4DBRA 1YWPA 2KNBB 2XD0A 3F70A 2HBWA 1YI2T 2DZ9A 4OVAA 4M75A 2XHCA 5CK9A 2KGTA 2BZYA 1TH7A 1RAIB 1UHCA 4JJCA 1TU0B 1XTDA 2EQJA 2RJEA 4M78C 2NLUA 2OTJA 4RTWA 2DIQA 4J9GA 1O75A 3LYIA 2A0FB 1V29B 4ZGDB 4M75B 3OYMA 1VQ6T 3META 3LGFA 3RKWA 2EYXA 3HRSA 3SFMA 1TUDA 2KK4A 4LXCA 1OPKA 1ZUUA 2K3BA 3PFSA 3EG0A 1ZA1B 2JN0A 3CCEQ 1VQPT 4M77A 2LX7A 5I21A 1YIJQ 3ZBDA 5A0DA 2CZ6B 3RESA 1IREB 1N9SA 2RJCA 2L3QA 3CCET 2CP2A 3MP8A 4E7IA 2LCLA 5AT1B 2SRCA 3CCST 3MEVA 2VWFA 2QASA 2L3RA 4LE9A 2VKNA 3M58A 8ATCB 1YCSB 4F04B 2DX1A 2JXBA 3EG2A 4R0KA 1JB0E 2X4YA 1D1AA 3CMAT 1UJ0A 2YSQA 1ACMB 4II1A 1WGSA 1PG5B 2M9UA 4EDUA 4NL2A 1K73U 4FM4B 4M7AA 1N8RC 1WQ7A 2DNUA 4XTYA 1B34A 2KMTA 3QJ6A 1FYNA 2L89A 5FWCA 5IHNA 3X26B 2GF7A 3JRZA 3NTIA 1M3BA 2EWNA 4JLGA 4M78D 2PU9B 1BU1A 2E3IA 4J6XA 2M02A 4EMHA 1BCOA 2V8JA 2ESWA 1IZ6A 2O01E 1JO8A 3HKSA 4PFPA 1KHCA 3A5ZB 2DKGA 2EW3A 2YRVA 1VQLA 4E7HA 3M4YA 1OZ3A 3O5ZA 4AG2C 3CCVA 2MI6A 4RKUE 5IHKA 2ZPIB 1U1SA 1G8XA 4BACA 4PJOF 1OI1A 4KGVB 4Y92A 1Y7XA 1RADB 2F1LA 4R56A 3DLLA 2R5AA 4LUEA 5GAOm 2HBPA 2X3XD 4CC2A 2HAXA 1WNLA 4M4ZA 3U23A 1CSKA 1UG1A 2X4WA 4DQ2A 1O9SA 4N4IA 3OYEA 1WJRA 4VUBA 1ABQA 2G6FX 5DM7R 2X3WD 1Q7YR 2JZ2A 5GMKe 2ZPFB 1UTIA 1QCOA 4A4FA 2DXTA 3FIFA 4XK8E 1LOJA 2E65A 2YDLA 1YJWQ 1SG5A 1KHIA 2HDAA 3CCJA 2E64A 4DEXA 1JJ2A 3E9FA 2CT4A 3H8ZA 4MDWA 4QQ6A 2M1HA 2QAZA 1LCKA 3LH5A 1G3SA 2JTMA 1QQJA 4A53A 1VUBA 2CSQA 2DIGA 3GIBA 5A0GA 2OJ2A 1BB9A 2E5QA 1NYGA 2O4XB 1ARKA 1K73C 3S3NA 1C6VX 2XU8A 1SEMA 1K9AA 1TS9A 4PJNA 5FRMA 1KQ2A 3FJPA 2PVDB 3LGLA 5D7UA 2K7AA 1ZSZB 5HKCA 4ORZA 1X01A 1VQMA 1EIFA 1Q95G 4F7UA 5FROA 3JCMJ 5HK0A 3JCMc 1CKBA 3H0IA 3SWNC 1KD1U 2DTOA 1X6GA 4Z02A 1D09B 3G6EQ 5LJ3g 3CCLQ 1Q7YU 4DA4A 2FO0A 2BZ8A 2K4YA 2FZKB 2RB6A 1K1ZA 2O88A 4M75D 5GAMg 2GTOA 2DFUA 1QCFA 1OULA 3QPHA 5KYWA 3EG9B 3EGDB 1VQ5T 1VQ8T 5KE3A 4OMLA 4MMLA 4FSSA 1XNIA 1VQ9Q 1KK7A 2CGHA 2YXYA 1KQSA 1RAHB 1Y0MA 1I81A 2K3YA 2X35A 3CD6T 1IO6A 3EGXB 1Q86C 2MIOA 4JRQA 4XU0A 4C8QB 1OX8A 5L23A 4M75E 3H0HA 4M77B 2EFIA 3VS0A 2QG9B 1R0BG 3OW2P 4WTOB 2XDPA 2D8JA 1HYOA 2YRCA 2WSCE 1Y57A 1AVZC 3PT9A 1W1FA 2LQNA 4RG2A 3CMET 2RQWA 1MV3A 3V7CA 3PVQA 3LW5E 3REAB 2B86A 4BI8B 2KE9A 2CH4A 4OP0A 3CCRT 1WZOA 4C92E 2F2WA 3OYCA 5DLQE 2QYZA 4D6WA 2E1HA 4IURA 5LJ3f 2ZCFB 8AT1B 4PJOD 4X9CA 5GANj 4M75G 1TWBA 2K57A 2FB7A 2O31A 2LNHB 1VOMA 3RR6A 3SD4A 5CO7A 4F7UG 1BI2A 1M1FA 2HKQB 2NUPB 1P92A 1RL2A 2RI3A 1NJIU 1TOVA 1YFNA 4C8QC 2AK5A 4PJOG 1AWJA 2V1RA 5KE2A 3OA6A 5GANf 2DL3A 3CXCS 2RA2A 3EFOB 3QXEB 3CCQQ 1Q82R 1YNZA 4GBQA 1FMKA 4EMKC 1I5OB 2EKHA 3BDUA 3L2ZA 1YIJA 3UDCA 3JCMQ 2A36A 4C92F 2R58A 2RK1A 2YUQA 3LH0A 3EG1A 3SHWA 2JS2A 2KT8A 3PVLA 4FU6A 2CP3A 1C1AA 1NJIC 3CCMQ 3TVTA 1D3BB 1WHMA 3JSCA 3TSZA 4QVCA 2RQTA 3LLRA 5GAN2 2ATCB 3JB9G 1G2BA 4E7SA 3M0PA 4KGXB 3HRUA 1QWFA 3PIPA 3OY9A 3QYGB 4CC3A 4XU1A 2X4XA 2LX9A 2YUPA 4BE2A 5FW9A 4X9DA 3S3MA 1X2QA 1AWXA 1H3HA 1QKXA 4YTLA 4M7DA 2DD5A 3S6WA 2CP7A 2QK0A 3UPUA 2PQWA 1OOTA 3JCMh 3SEMA 2D9TA 1M1KC 1QCNA 2P0PA 1D3BA 2FL7A 4M7AG 2DBKA 3OYHA 4WF2A 5KCOA 1WDXA 3CXCP 3J7AF 1K76A 2LQ8A 4Z89A 2F5KA 1W4SA 4RTVA 5C0MA 3FJ5A 3I56T 5CCAA 5GANd 1GXIE 2LVMA 4M7DC 1PSEA 4LNPA 1SRLA 3RKXA 3OS1A 2OAWA 3E19A 1GBQA 1N27A 4AFUC 2NUPA 4OGCA 2D0QB 2DF6A 2DMOA 3OBYA 2JJ9A 2ABLA 1NLOC 3CXCA 4HA8A 3UA6A 3REBB 4C8QF 2QEXA 2IG0A 5DLOA 5LJ3e 1ZBXA 2K2VA 2LC4A 2EGEA 2LNVA 1KJWA 4EMGA 1D1BA 1S72A 3ZEHA 1VQ7T 2BE9B 2QA4Q 1VQ4T 4M7AC 3EH1A 4HVUA 2VUBA 1VQ7A 2ZPHB 2LJ0A 1SRMA 5J26A 2RI5A 2ZPBB 3M57A 1HSQA 3I56A 3CCUT 3DB4A 5GAMj 1UB4A 1R77A 2EJFA 2Y90A 2XICA 1BIAA 1I1JA 1WHHA 1H92A 4J7IA 4XAXB 2JVVA 2PZ1A 2DRMA 4FIBA 4AFQC 3CMEQ 2GBQA 1K9MC 3MKDA 4OB0B 5FU6B 4HVWA 2PUKB 1C0MA 1UJYA 4A63B 4FW2A 3SWNA 2QEXT 4PLLA 5LJ5f 1LPLA 4LDVA 5GJWB 2DD4A 3CD6Q 2MCNA 3OS0A 1VIEA 3QYHB 2K9GA 2RM4A 3CCSQ 3FRNA 2HMAA 2RHUA 1EFNA 2CZ1B 4MZTA 1B07A 1I07A 1K4US 3IQLA 3JCMf 5GAMh 2ZPEB 2A08A 1ZUYA 1YCYA 1QP3A 4RTYA 1N9RA 2Y4XA 1Y71A 3VU3C 3AHUA 1ABOA 1QVGA 4QT7A 4HXJA 5GMKj 3G71A 3CQTA 5GAMe 4BY6B 3OYNA 1AOJA 4M75C 1AWWA 1D0ZA 4OGEA 3JB9I 2JM9A 4IIOA 1VQ6Q 1RABB 1S1NA 3EHRA 1X75C 2K5FA 5IXFA 1M1KU 2QDLA 4JJBA 1QVFS 3MEAA 3GBQA 1VQ9A 2KVQG 2DTHA 2FYKA 1VYUA 2DLPA 1KG1A 3BE3A 4FL6A 1IGUA 3A98A 2IVWA 1AWOA 3QKJA 2JNGA 4OMQA 5GAOp 3CCEA 2LMJA 5GAMd 3P8BB 3VS2A 2M16A 5GMKi 1JRIA 2QA4T 1VQ4Q 3A8GB 2COYA 3MCAB 2BUDA 1BCMA 1PNJA 4M77F 1ZLMA 2E4HA 2FVUA 2RPNA 1M1KR 3DB3A 1U1TA 4GLKA 1N8RU 3X28B 2KRSA 3VS7A 1PWTA 3CPWA 4IUUA 5KYNA 2BIVA 1AT1B 4DEYA 3JB9J 3C0CA 1N6AA 5I11A 1IHVA 2DILA 2GQVA 3HFNA 3A8LB 5IAYA 4X34A 3JCMg 3JCMb 2EJGA 2DPPB 4N4GA 5KYWB 4LD9K 1FX7A 5CQYA 2DXBA 1BK2A 3GOXA 2COZA 3UT1A 3BFMA 2QGGA 3Q1JA 2DEUA 4M7AD 1K8AR 2EYQA 1SKUB 3VYHB 2C06A 1H641 2DETA 1T0HA 3VYGA 1OZ2A 2KRNA 1VQNA 3RNJA 3VS5A 1RLQC 1JXOA 4J9FA 3G71Q 4C5IA 2EKOA 4QW2A 4C92C 2CZ7B 2D0NA 3VJPA 2FPEA 2DYIA 2M51A 2SEMA 5CQXA 4C0GA 1IRXA 5CKDA 1R8OB 4M7AE 4HCKA 3A8HB 1PKTA 4AMCA 3I56Q 2HKNA 3LWHA 3WVDB 5LJ3h 5EC7A 4PJOA 1RAAB 3X20B 2DVEA 5GAN3 1Z9QA 3CBPA 4L5GA 2O2OA 3M0TA 3HTRA 1UFFA 3H41A 1YITT 4M7DB 3JAME 5KYXA 3TSWA 1ZQ1A 2PNIA 4OMNA 4M7DE 3JCMW 4C5GA 3QO3A 5CKHA 1YP5A 2COWA 2RNAA 2ENMA 1M2VB 5FU6C 4LN2A 2EIFA 2MK5A 3I35A 2RQUA 4DBFA 4UC4A 4C0DC 3OYLA 4EMKA 5FU7C 2L3SA 1H8KA 1I0CA 5FLXE 2RHYA 3EG3A 4E6RA 1BI3A 2E70A 4RUGA 1U5SA 4PFZA 1M3CA 1KD1C 1YWOA 3R6NA 4JRIA 3G4SQ 4KGZB 4OMMA 4PLIA 4J7FA 4AFZC 4JUVA 1NJIR 5I22A 2F69A 4J5YA 1IGQA 1YIJT 3CCRQ 3S3OA 2EQMA 1YHQA 3KBGA 1VQ5Q 4ZGJB 1VQ8Q 3X24B 2DA9A 4KUIA 3KXTA 1M2OA 4L6V5 4Q5WA 3E9GA 3I5RA 5KYYB 4HCBA 1LVKA 1KQSS 4MDXA 3BY7A 3MPUB 1AZGB 2CP6A 1NZ9A 2DL7A 3P8DA 2X4JA 4RG8A 2E41A 3BDLA 4M77G 4CC7A 3CC7Q 1HJDA 4RTTA 5GAN7 1PC0A 2CREA 2BTTA 4E2FB 1YJ9T 3RIRA 2XMFA 4M78A 2RH2A 3CCUA 4M78E 3L2RA 1QVGS 1G5VA 5IXBA 1UGRB 1ZA2B 4LUDA 2VYTA 2HEQA 1WYXA 3M0UA 1PD0A 1WQWA 2JM8A 5ECAA 5GANe 5GAOl 3SB2A 4CC4B 1VQMQ 1Q82U 1BI1A 2L5QA 4LDWA 2C0TA 1SHGA 5DY9A 3A1PA 5GAN5 2NUTA 3RMQA 3O8VA 1RAEB 2JMCA 1UEBA 5GAN8 4Y91A 2J7IA 4OMFB 4ZTJA 2OTLT 2KSSA 3OBWA 4KULA 2QQRA 4OF1A 4ATOA 3VRYA 2E6NA 1QVPA 5LJ5e 1TG0A 2HL3A 2KR3A 3M0RA 2HL5C 2KRMA 2YRDA 5IN1A 1T0JA 4B9WA 2L0AA 1YHQT 2L3PA 1XOVA 2OAUA 4JLIA 1BYMA 1KIKA 1BBZA 3L2UA 2VC8A 1RACB 2PVGB 4PJLA 3QUIA 1NEGA 4XTXA 4C8QE 1WHJA 2CKKA 2FHDA 3CCLA 2NWMA 1BI0A 3TEEA 3QJYA 1TTHB 4PJOC 4F7UE 2DK3A 4F17A 3CC2Q 2GFAA 1LNXA 1YITQ 4KT0E 4PJOE 2K2MA 1VYTA 3A8OB 1VQKQ 4EPCA 2KYBA 3SWNB 4QQDA 4E7KA 2K6DA 1YI2A 5CAIA 1YJ9A 2J05A 3H6ZA 1K0SA 4FYWB 4C0ZA 2QDYB 3HP9A 4L59A 1G3TA 1K8AC 4GY5A 1PCXA 2BKDN 3FEOA 2QQAA 1M2VA 4RTUA 2HQXA 2LCCA 2VV5A 1NBEB 1XJWB 3MP1A 5HY6A 1YN8A 2Z0WA 2LCSA 2VXFA 5CKEA 5IT9E 2MYSA 1Q86U 1VQNT 1W2BP 2OTLA 4HT8A 3GF5A 2J6OA 2WSEE 1IB8A 1GBRA 4KUDK 3CCLT 1Q86R 5AYFA 4M77C 9ATCB 1K8AU 1OPLA 1JU5C 2GGRA 1WA7A 2K3XA 1MMDA 2QTXA 3UA7A 5I2MA 2QEXQ 3I55A 2HD0A 3OSVA 4N4HA 3M55A 3J81E 2RO0A 2WSFE 1TUCA 3C4SA 2LDMA 3ME9A 1A0NB 4D8DA 4ZTFA 3CMAQ 1MMAA 4A4GA 1X6OA 3GNGA 2LJ3A 1MHNA 5CKBA 4AG1C 4C92B 2CYZB 3RBBB 2X9HA 5KYUA 1M1GA 1TUGB 2ZAEA 2BE7D 1UGVA 3M56A 1PKSA 1UGSB 1YHQQ 4M7DD 4MZMA 5LJ3j 3FDRA 4PNOA 1JJ2P 5D6YA 2M0OA 3NTKA 4DBQA 4RCCA 2RQVA 4JJDA 3PTAA 3NPFA 1U3OA 2A3LA 2LTOA 4HCZA 2XI9A 5A2QE 3RDVA 1JXMA 2QQBA 1YJNA 2HNIA 1RI0A 2LQWA 5GANg 4OMPA 1K9MU 1RI9A 3JB9F 2P0QA 3G1JA 3OYYA 3OW2S 1KSWA 1Q81C 1VA7A 4D8KA 4JJNK 1X6BA 5EG2A 5C6SA 3VV0A 3JCMV 2CH4W 4BB7A 2RMOA 2OTJQ 4PJMA 2QTVA 1VQ7Q 3ULRB 3VS3A 4QVDA 3OQ5A 2DYBA 3OYBA 3OYFA 2D6FA 2VGMA 4J9EA 4CRIA 1IHWA 4KRTA 4OB3B 2C0IA 1TXQA 3MJXA 2MAMA 3D7SB 1WX6A 3V7RA 1M4ZA 2DJQA 4M7DG 2CSIA 4M75F 1RAFB 2DRKA 2IIMA 1V76A 3WVEB 2A7YA 3CPFA 4FT2A 4PFOA 1VQLQ 1FMVA 4ZNXA 1HD3A 4E7LA 1X69A 1I8FA 5D6WA 1UGPB 1KC8R 1M90C 3CCRA 1H3ZA 4AT1B 2HQEA 2DO3A 1WFWA 1I4K1 3DLMA 2FRYA 2KDSA 2RJDA 1E6GA 4BY6C 4RMOA 2EAYA 1VQ6A 2ROTA 3OYIA 3M9QA 3QDRB 2DL5A 1GRIA 5HCKA 3H0FA 2J6KA 1GCQC 4RTXA 1VQ5A 1VQ8A 4CI0C 1QLYA 1QW1A 1XQHA 3MEUA 5KYUB 4HCCA 3THKA 3VRZA 2KXDA 1OU9A 2DTIA 5LJ5h 5KCHA 2NUZA 4DOVA 2CZ0B 5FU7B 2AZVA 2JMAA 1OV3A 3G4SA 1VQPA 3M59A 1B7TA 3C12A 1MMGA 4HVVA 4B6MA 2GQIA 3OYDA 3UF4A 1OU8A 7AT1B 5GANh 5M9OA 3RKYA 4JRPA 3MP6A 5IHIA 3LX7A 1SPKA 1GCQA 4J9IA 4M77E 2D1XA 1DJ7B 2D8HA 2R57A 1RUWA 1ZX6A 1ZHIA 2EGAA 3CCUQ 5L8RE 1Q82C 4J8OA 2CDTA 3EGXA 4EIKA 5D6XA 3VKIA 4C0DB 4J6WA 3VS4A 2P84A 4FW1A 5A0LA 1QKWA 4RCBA 4LDYA 1M8VA 3MEWA 4O6JA 2KY9A 3V7SA 2YHTA 3CC7A 3JCMP 2EBPA 1U06A 1BKBA 1X2KA 3QDFA 3WXMB 3NFCA 4MZPA 4OMOA 2HQHA 3I55T 1OEBA 1MNEA 2ZGWA 3VUBA 2DL8A 1B3QA 1U8RA 1JJ2S 4C0FA 4BD3A 3M53A 2J6FA 2YUOA 1Q81U 3JCMd 5HK3A 2KT1A 2JTFA 2DL4A 2QA4A 2ED0A 3L42A 3PNWC 2FRWA 3OS2A 2AZSA 2KAFA 4IUQA 4XU2A 3MO8A 2HCKA 1MMNA 4A4HA 3L1AA 3E2UA 3QZ9B 3CCVQ 1X43A 2GTJA 4LD6A 4A4EA 3JB9H 5GAN6 2RHZA 2YLBA 1UHFA 1W2BA 1RLPC 4ANJA 3X25B 1JEGA 4XU3A 1MUZA 3URGA 4A54A 1ZBJA 2R5MA 2VASA 4JZ3A 1S72Q 1WXTA 4AFSC 1QMCA 1WJSA 5GAN4 2RN8A 1OQKA 2HSEB 4TVRA 5LJ5g 4NL3A 3CC7T 1SF9A 1JBMA 1EZZB 4PK4A 5KYYA 4JDSA 2XKOC 2MF2A 3J80E 4BDZA 4BUGA 3VUZA 6AT1B 2DAQA 3G71T 1YI2Q 2LT1A 2CS7A 1HXDA 2MWPA 2DVJA 1VQ4A 3R6OA 2AIRB 1YJNQ 1NPPA 3T9NA 1F1BB 2XK0A 2YLCA 1M8MA 2VXEA 2K5IA 1YJ9Q 4B9XA 1KQ1A 2L2PA 3QWXX 4FYXB 2EVRA 3CC4T 1VQOQ 2LP5A 4F7UB 5GJVB 2OI3A 3EFRA 1FMWA 4NS5A 2RD1A 4E7JA 3QWYA 1ZUKA 3G4ST 3DKMA 1NE8A 1MNDA 2DERA 1GFCA 1M5Q1 1WPYA 3M5AA 3N5BB 4JRKA 3EH2A 1IXDA 3GLXA 3NTHA 1PM3A 2I2LA 3QSUA 2QI2A 4ZGEB 3CCMA 2NUTB 1PD1A 3TU4K 2E6ZA 5FWBA 3P8HA 1T3LA 4F14A 4ELZC 3M0QA 2LJ1A 1R0CB 3JV3A 5GAOr 2W10A 4C5EA 2H8HA 3QIIA 1VQ9T 2LT4A 3NHNA 2CP5A 3I55Q 1GCPA 2ROLA 5KH6A 3HFOA 1M3AA 1VIFA 1Y96B 2OTJT 3CMAA 1NEBA 2EQIA 1MV0B 2B8AA 3QG1A 2G3RA 4M7AB 1WIEA 2EQKA 1GFDA 1AEYA 4J9HA 2XDBA 3OMGA 3ASKA 2E10A 3M0SA 4C92G 2VB6A 4KH0B 2C0OA 3CC4A 1KC8U 3VS1A 2KI7A 2QXFA 1D0XA 3C94A 4ZN1A 4J6YA 4N0AC 4P5NA 4FYVB 4Y28E 3HSBA 2H3JA 3RERA 3PMTA 1VQOA 1UECA 2GNCA 3CD6A 4F7UF 1G3WA 4IKFA 1Y07A 3QZ5B 3KUFA 1QVGP 1TSFA 1G3YA 2P4RA 2MPXC 3CC2T 5FRNA 1WJQA 4C8QD 2DZCA 5GMKh 2GCXA 3G7ZA 2XG8D 2EGCA 5KYXB 1BIBA 4J9CA 2LZ6B 4EMKB 4OB1B 3L2VA 1PSFA 3V8KA 2KEAA 3HRTA 4NOYA 4R55A 3PIOA 5CIUA 3OYAA 1EX4A 1E6HA 2VGNA 2K79A 3I5SA 2IPOB 3QHSA 2MWOA 4BI4A 4PJOB 1Q7YC 2EPDA 2KXCA 2M0YA 2RQRA 4MMKA 3RMSA 2QQ9A 2V26A 1MGQA 1YJWT 1D0YA 4C92D 1K73R 2W0ZA 1NG2A 1QP2A 4LDUA 4ESRA 4F16A 1YITA 3UWNA 4QKUA 4RTZA 4IUVA 1S72T 3PMIA 3OSSC 2DXUA 1M27C 4X1VA 1Y96A 5J3BA 3G6EA 4LDXA 4BDYA 3V8LA 3CCVT 3JB9D 1M30A 5J39A 2O4XA 4QQGA 1WHLA 4XTZA 2O9SA 2FG0A 3L2WA 4JPBW 4C92A 4E7ZA 4IUTA 4KBMB 1RAGB 2OTLQ 4J9DA 4O5VA 3CPWP 2CP0A 2XIDA 4C8QG 3QBYA 1GL5A 5LJ5j 1T3SA 3CCQT 2WACA 2DBMA 3GP8A 2E5KA 3EHQA 3EAEA 1VQOT 1AHJB 1FWZA 5LJ3d 3LWIA 2L8DA 2P0KA 3EFOA 5GAMf 1UGQB 1YJNT 4DOWA 2YUNA 4ME7A 1CKAA 3UATA 1NLPC 2FZGB 2FPFA 4DBHA 3OYJA 1JQQA 2PTKA 2JTEA 4M78G 1PRLC 5GAOq 1VQKA 4M7AF 2CUBA 2F2VA 4QVZA 4GLMA 3EGUA 1UE9A 5GAOn 5GMKl 3ER0A 3INZA 1AD5A 4J9BA 4OB2B 1UDLA 2KBTA 2MMPA 3H9NA 4KH1B 1FXXA 2EQUA 1D1CA 2JOYA 1K9MR 3PE0A 2V8KA 5CVIA 2RI2A 3M4GA 2BZXA 4BI3A 4E47A 2V8IA 1N8RR 2RF0A 2FPDA 3GPLA 1B34B 1ZSZA 1YJWA 4V2SA 3CEYA 4M77D 1PRMC 2DM1A 4XTWA 2ZPGB 3GNFB 2DE0X 3NGPA 4PJJA 4Z88A 2VVKA 4M7DF 1M9SA 3AT1B 2A28A 1OX9A 2E3HA 3I9QA 3CCMT 3CC4Q 3PGGA 3FLGA 3TQ7P 2FEIA 2RHIA 1ZSGA 3CCQA 1SSFA 4JS4A 1E7OA 3HL8A 1QWEA 1SSHA 1QVFP 4BE0A 5LJ5d 3C95A 2Y4YA 4JS5A 2DEQA 2HSPA 3OS5A 1M90U 2NYSA 3ZFJA 3KFVA 1W70A 4XTVA 2KQWA 1WHGA 1UUEA 2MOXA 1I5LA 2YWWA 1J3TA 2OX7A 4C5HA 4K11A 3FB9A 3NMZC 1AZEA 3ZL7C 4PL6A 3HHTB 2KYMA 4WCIA 1WHKA 1W6XA 2FZCB 2EYYA 3RUXA 3OYKA 1YBYA 1VQKT 4XQ3A 1NPRA 4BE1A 2RHXA 1QVFA 1KD1R 2P4TA 1ZSZC 1NYFA
chains in the Genus database with same CATH topology
4RUGA 1U5SA 1QKWA 1X27A 1M3CA 1YWOA 3R6NA 2AKKA 2JS0A 4OMMA 4AFZC 2EBPA 2O31A 5I22A 1U06A 2LNHB 2A37A 1X2KA 1WI7A 4OMOA 2JT4A 2EYWA 1OEBA 2DA9A 4IIMA 1KFZA 1VYVA 2AK5A 1AWJA 2V1RA 1WXBA 2DL3A 2DL8A 1B3QA 3I5RA 4JZ4A 1YNZA 4GBQA 1FMKA 2J6FA 2EKHA 2YUOA 1V1CA 2KT1A 1SHFA 1AZGB 2DL4A 2A36A 1PHTA 2YUQA 2DL7A 2ED0A 3EG1A 3SHWA 2FRWA 2AZSA 4CC7A 2JS2A 2KT8A 3PVLA 2HCKA 1HJDA 4RTTA 3VS6A 3TVTA 1N5ZA 3TSZA 2CREA 2BTTA 2KROA 5IH2A 1X43A 2F2XA 2GTJA 2RQTA 2YT6A 2I0NA 1G83A 1G2BA 1UHFA 2XMFA 3M0PA 1RLPC 1JEGA 1MUZA 1QWFA 2CT3A 1K0XA 2JW4A 4CC3A 1ZBJA 5IXBA 4JZ3A 1WXTA 4AFSC 4E6RA 2RN8A 4LUDA 1NM7A 2YUPA 2HEQA 5FW9A 2EYZA 2ED1A 1X2QA 1AWXA 1WYXA 1QKXA 3M0UA 1H3HA 2O9VA 1WLPB 2J06A 2JM8A 5ECAA 4Z8AA 4CC4B 1OOTA 1WXUA 3SEMA 2C0TA 1SHGA 2ECZA 1Z9ZA 2DVJA 2AKLA 2DBKA 1WDXA 2V1QA 2CUDA 1K76A 1M8MA 2JMCA 4Z89A 4RTVA 2J7IA 2L2PA 3QWXX 1YWPA 2EVRA 2KNBB 3FJ5A 2HBWA 2LP5A 5GJVB 4LNPA 2OI3A 1SRLA 3QWYA 1ZUKA 2KGTA 2OAWA 3VRYA 2BZYA 1GFCA 1TG0A 1UHCA 4JJCA 1GBQA 4AFUC 2KR3A 3M0RA 2KRMA 1T0JA 2DF6A 2DMOA 2L0AA 2L3PA 1XOVA 2ABLA 1NLOC 1KIKA 1BBZA 4RTWA 4J9GA 5FWBA 3UA6A 3REBB 1T3LA 4F14A 3M0QA 1NEGA 2LJ1A 3JV3A 2W10A 2EGEA 2EYXA 2NWMA 1TUDA 1KJWA 2H8HA 1OPKA 1ZUUA 2K3BA 3EG0A 3NHNA 1GCPA 2ROLA 1M3AA 1NEBA 2EQIA 4F17A 1MV0B 2LX7A 4HVUA 1WIEA 1GFDA 1AEYA 4J9HA 2LJ0A 1SRMA 3M0SA 2L3QA 2K2MA 2C0OA 1VYTA 1HSQA 2SRCA 2VWFA 2KYBA 3VS1A 4LE9A 2K6DA 2VKNA 1YCSB 2J05A 2DX1A 2JXBA 3EG2A 4R0KA 1K0SA 1I1JA 1H92A 1UJ0A 2YSQA 1UECA 2GNCA 2PZ1A 2DRMA 4RTUA 4AFQC 2GBQA 4HVWA 1YN8A 2LCSA 1UJYA 4A63B 2P4RA 2DNUA 5GJWB 2J6OA 1FYNA 2MCNA 5FWCA 2EGCA 1GBRA 5IHNA 4J9CA 2LZ6B 2K9GA 1M3BA 2KEAA 1OPLA 1JU5C 2GGRA 1WA7A 1EFNA 1BU1A 1E6HA 1B07A 1I07A 3UA7A 1K4US 3IQLA 2K79A 3I5SA 2A08A 1ZUYA 4RTYA 2EPDA 2ESWA 2KXCA 2M0YA 2RQRA 1JO8A 1TUCA 1ABOA 1A0NB 4QT7A 2EW3A 4HXJA 4D8DA 3CQTA 3O5ZA 4AG2C 1AOJA 1AWWA 5IHKA 2JM9A 2W0ZA 4IIOA 1NG2A 1S1NA 2LJ3A 3EHRA 4Y92A 4AG1C 4ESRA 4F16A 5IXFA 3RBBB 4RTZA 2QDLA 4JJBA 1UGVA 3GBQA 1PKSA 1VYUA 2DLPA 4LUEA 1M27C 2X3XD 4X1VA 4CC2A 3A98A 4M4ZA 1AWOA 3U23A 1CSKA 1UG1A 1M30A 2RQVA 4JJDA 4OMQA 3NPFA 1ABQA 1U3OA 2O9SA 2FG0A 2G6FX 4JPBW 2X3WD 2LMJA 1UTIA 4J9DA 1JXMA 3VS2A 2YDLA 1GL5A 2HDAA 2LQWA 4DEXA 4OMPA 2CT4A 1T3SA 1LCKA 1PNJA 2DBMA 1ZLMA 2E5KA 3EHQA 1RI9A 2RPNA 3LH5A 2CSQA 1KSWA 2KRSA 3VS7A 1PWTA 1VA7A 4D8KA 1X6BA 2OJ2A 1BB9A 4DEYA 1NYGA 2CH4W 3C0CA 1ARKA 2YUNA 5I11A 2RMOA 2DILA 1CKAA 3UATA 1SEMA 1K9AA 1NLPC 2FPFA 1JQQA 2PTKA 3ULRB 3VS3A 2K7AA 2JTEA 4ORZA 2DYBA 1PRLC 2CUBA 2F2VA 4J9EA 1BK2A 4GLMA 4KRTA 3EGUA 1UE9A 2C0IA 1AD5A 4J9BA 1UDLA 1WX6A 1CKBA 3H0IA 1X6GA 2DJQA 2KBTA 2CSIA 1T0HA 3PE0A 2DRKA 2IIMA 2KRNA 3RNJA 2BZXA 3VS5A 1RLQC 1JXOA 4J9FA 2FO0A 2BZ8A 4ZNXA 1HD3A 2RF0A 2FPDA 1K1ZA 2O88A 1X69A 2GTOA 2D0NA 2FPEA 2M51A 1QCFA 1WFWA 2SEMA 1PRMC 2FRYA 2DM1A 1E6GA 2ROTA 2DE0X 4OMLA 2DL5A 3NGPA 4Z88A 1GRIA 4FSSA 5HCKA 2VVKA 3H0FA 4HCKA 2J6KA 1GCQC 2A28A 3I9QA 4RTXA 1PKTA 1QLYA 1Y0MA 3THKA 3VRZA 2KXDA 5EC7A 1IO6A 2FEIA 1ZSGA 2MIOA 1E7OA 1QWEA 1SSHA 2NUZA 1Z9QA 2AZVA 5L23A 2JMAA 3H0HA 2HSPA 1OV3A 3VS0A 2O2OA 3KFVA 1W70A 3M0TA 4HVVA 2GQIA 1UFFA 2D8JA 3H41A 1UUEA 2MOXA 3UF4A 1J3TA 1Y57A 3TSWA 2PNIA 4K11A 4OMNA 1AVZC 1W1FA 2LQNA 3NMZC 5IHIA 1SPKA 1AZEA 1YP5A 2RNAA 3ZL7C 1GCQA 4J9IA 2ENMA 2KYMA 4WCIA 1W6XA 2RQWA 4LN2A 1MV3A 2D1XA 2EYYA 2D8HA 1RUWA 1ZX6A 3I35A 3PVQA 2EGAA 2RQUA 3REAB 2B86A 2L3SA 1H8KA 2CDTA 4EIKA 2KE9A 1I0CA 2CH4A 3EG3A 1NYFA 3VS4A 2F2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUG A;  1U5S A;  1QKW A;  1X27 A;  1M3C A;  1YWO A;  3R6N A;  2AKK A;  2JS0 A;  4OMM A;  4AFZ C;  2EBP A;  2O31 A;  5I22 A;  1U06 A;  2LNH B;  2A37 A;  1X2K A;  1WI7 A;  4OMO A;  2JT4 A;  2EYW A;  1OEB A;  2DA9 A;  4IIM A;  1KFZ A;  1VYV A;  2AK5 A;  1AWJ A;  2V1R A;  1WXB A;  2DL3 A;  2DL8 A;  1B3Q A;  3I5R A;  4JZ4 A;  1YNZ A;  4GBQ A;  1FMK A;  2J6F A;  2EKH A;  2YUO A;  1V1C A;  2KT1 A;  1SHF A;  1AZG B;  2DL4 A;  2A36 A;  1PHT A;  2YUQ A;  2DL7 A;  2ED0 A;  3EG1 A;  3SHW A;  2FRW A;  2AZS A;  4CC7 A;  2JS2 A;  2KT8 A;  3PVL A;  2HCK A;  1HJD A;  4RTT A;  3VS6 A;  3TVT A;  1N5Z A;  3TSZ A;  2CRE A;  2BTT A;  2KRO A;  5IH2 A;  1X43 A;  2F2X A;  2GTJ A;  2RQT A;  2YT6 A;  2I0N A;  1G83 A;  1G2B A;  1UHF A;  2XMF A;  3M0P A;  1RLP C;  1JEG A;  1MUZ A;  1QWF A;  2CT3 A;  1K0X A;  2JW4 A;  4CC3 A;  1ZBJ A;  5IXB A;  4JZ3 A;  1WXT A;  4AFS C;  4E6R A;  2RN8 A;  4LUD A;  1NM7 A;  2YUP A;  2HEQ A;  5FW9 A;  2EYZ A;  2ED1 A;  1X2Q A;  1AWX A;  1WYX A;  1QKX A;  3M0U A;  1H3H A;  2O9V A;  1WLP B;  2J06 A;  2JM8 A;  5ECA A;  4Z8A A;  4CC4 B;  1OOT A;  1WXU A;  3SEM A;  2C0T A;  1SHG A;  2ECZ A;  1Z9Z A;  2DVJ A;  2AKL A;  2DBK A;  1WDX A;  2V1Q A;  2CUD A;  1K76 A;  1M8M A;  2JMC A;  4Z89 A;  4RTV A;  2J7I A;  2L2P A;  3QWX X;  1YWP A;  2EVR A;  2KNB B;  3FJ5 A;  2HBW A;  2LP5 A;  5GJV B;  4LNP A;  2OI3 A;  1SRL A;  3QWY A;  1ZUK A;  2KGT A;  2OAW A;  3VRY A;  2BZY A;  1GFC A;  1TG0 A;  1UHC A;  4JJC A;  1GBQ A;  4AFU C;  2KR3 A;  3M0R A;  2KRM A;  1T0J A;  2DF6 A;  2DMO A;  2L0A A;  2L3P A;  1XOV A;  2ABL A;  1NLO C;  1KIK A;  1BBZ A;  4RTW A;  4J9G A;  5FWB A;  3UA6 A;  3REB B;  1T3L A;  4F14 A;  3M0Q A;  1NEG A;  2LJ1 A;  3JV3 A;  2W10 A;  2EGE A;  2EYX A;  2NWM A;  1TUD A;  1KJW A;  2H8H A;  1OPK A;  1ZUU A;  2K3B A;  3EG0 A;  3NHN A;  1GCP A;  2ROL A;  1M3A A;  1NEB A;  2EQI A;  4F17 A;  1MV0 B;  2LX7 A;  4HVU A;  1WIE A;  1GFD A;  1AEY A;  4J9H A;  2LJ0 A;  1SRM A;  3M0S A;  2L3Q A;  2K2M A;  2C0O A;  1VYT A;  1HSQ A;  2SRC A;  2VWF A;  2KYB A;  3VS1 A;  4LE9 A;  2K6D A;  2VKN A;  1YCS B;  2J05 A;  2DX1 A;  2JXB A;  3EG2 A;  4R0K A;  1K0S A;  1I1J A;  1H92 A;  1UJ0 A;  2YSQ A;  1UEC A;  2GNC A;  2PZ1 A;  2DRM A;  4RTU A;  4AFQ C;  2GBQ A;  4HVW A;  1YN8 A;  2LCS A;  1UJY A;  4A63 B;  2P4R A;  2DNU A;  5GJW B;  2J6O A;  1FYN A;  2MCN A;  5FWC A;  2EGC A;  1GBR A;  5IHN A;  4J9C A;  2LZ6 B;  2K9G A;  1M3B A;  2KEA A;  1OPL A;  1JU5 C;  2GGR A;  1WA7 A;  1EFN A;  1BU1 A;  1E6H A;  1B07 A;  1I07 A;  3UA7 A;  1K4U S;  3IQL A;  2K79 A;  3I5S A;  2A08 A;  1ZUY A;  4RTY A;  2EPD A;  2ESW A;  2KXC A;  2M0Y A;  2RQR A;  1JO8 A;  1TUC A;  1ABO A;  1A0N B;  4QT7 A;  2EW3 A;  4HXJ A;  4D8D A;  3CQT A;  3O5Z A;  4AG2 C;  1AOJ A;  1AWW A;  5IHK A;  2JM9 A;  2W0Z A;  4IIO A;  1NG2 A;  1S1N A;  2LJ3 A;  3EHR A;  4Y92 A;  4AG1 C;  4ESR A;  4F16 A;  5IXF A;  3RBB B;  4RTZ A;  2QDL A;  4JJB A;  1UGV A;  3GBQ A;  1PKS A;  1VYU A;  2DLP A;  4LUE A;  1M27 C;  2X3X D;  4X1V A;  4CC2 A;  3A98 A;  4M4Z A;  1AWO A;  3U23 A;  1CSK A;  1UG1 A;  1M30 A;  2RQV A;  4JJD A;  4OMQ A;  3NPF A;  1ABQ A;  1U3O A;  2O9S A;  2FG0 A;  2G6F X;  4JPB W;  2X3W D;  2LMJ A;  1UTI A;  4J9D A;  1JXM A;  3VS2 A;  2YDL A;  1GL5 A;  2HDA A;  2LQW A;  4DEX A;  4OMP A;  2CT4 A;  1T3S A;  1LCK A;  1PNJ A;  2DBM A;  1ZLM A;  2E5K A;  3EHQ A;  1RI9 A;  2RPN A;  3LH5 A;  2CSQ A;  1KSW A;  2KRS A;  3VS7 A;  1PWT A;  1VA7 A;  4D8K A;  1X6B A;  2OJ2 A;  1BB9 A;  4DEY A;  1NYG A;  2CH4 W;  3C0C A;  1ARK A;  2YUN A;  5I11 A;  2RMO A;  2DIL A;  1CKA A;  3UAT A;  1SEM A;  1K9A A;  1NLP C;  2FPF A;  1JQQ A;  2PTK A;  3ULR B;  3VS3 A;  2K7A A;  2JTE A;  4ORZ A;  2DYB A;  1PRL C;  2CUB A;  2F2V A;  4J9E A;  1BK2 A;  4GLM A;  4KRT A;  3EGU A;  1UE9 A;  2C0I A;  1AD5 A;  4J9B A;  1UDL A;  1WX6 A;  1CKB A;  3H0I A;  1X6G A;  2DJQ A;  2KBT A;  2CSI A;  1T0H A;  3PE0 A;  2DRK A;  2IIM A;  2KRN A;  3RNJ A;  2BZX A;  3VS5 A;  1RLQ C;  1JXO A;  4J9F A;  2FO0 A;  2BZ8 A;  4ZNX A;  1HD3 A;  2RF0 A;  2FPD A;  1K1Z A;  2O88 A;  1X69 A;  2GTO A;  2D0N A;  2FPE A;  2M51 A;  1QCF A;  1WFW A;  2SEM A;  1PRM C;  2FRY A;  2DM1 A;  1E6G A;  2ROT A;  2DE0 X;  4OML A;  2DL5 A;  3NGP A;  4Z88 A;  1GRI A;  4FSS A;  5HCK A;  2VVK A;  3H0F A;  4HCK A;  2J6K A;  1GCQ C;  2A28 A;  3I9Q A;  4RTX A;  1PKT A;  1QLY A;  1Y0M A;  3THK A;  3VRZ A;  2KXD A;  5EC7 A;  1IO6 A;  2FEI A;  1ZSG A;  2MIO A;  1E7O A;  1QWE A;  1SSH A;  2NUZ A;  1Z9Q A;  2AZV A;  5L23 A;  2JMA A;  3H0H A;  2HSP A;  1OV3 A;  3VS0 A;  2O2O A;  3KFV A;  1W70 A;  3M0T A;  4HVV A;  2GQI A;  1UFF A;  2D8J A;  3H41 A;  1UUE A;  2MOX A;  3UF4 A;  1J3T A;  1Y57 A;  3TSW A;  2PNI A;  4K11 A;  4OMN A;  1AVZ C;  1W1F A;  2LQN A;  3NMZ C;  5IHI A;  1SPK A;  1AZE A;  1YP5 A;  2RNA A;  3ZL7 C;  1GCQ A;  4J9I A;  2ENM A;  2KYM A;  4WCI A;  1W6X A;  2RQW A;  4LN2 A;  1MV3 A;  2D1X A;  2EYY A;  2D8H A;  1RUW A;  1ZX6 A;  3I35 A;  3PVQ A;  2EGA A;  2RQU A;  3REA B;  2B86 A;  2L3S A;  1H8K A;  2CDT A;  4EIK A;  2KE9 A;  1I0C A;  2CH4 A;  3EG3 A;  1NYF A;  3VS4 A;  2F2W A; 
#chains in the Genus database with same CATH topology
 1VQN Q;  4FSX A;  4C8Q A;  1X27 A;  3BW1 A;  2K5L A;  4ZN3 A;  2AKK A;  3CME A;  2QQS A;  2JUF A;  2JS0 A;  5LL6 S;  5GMK m;  2A37 A;  3CBO A;  2AHJ B;  2QGF B;  3FC3 A;  1WI7 A;  4M78 B;  3A8M B;  2E12 A;  2JT4 A;  2EYW A;  4IIM A;  1KFZ A;  4FYY B;  1VYV A;  1WXB A;  3L2Q A;  4N0A A;  5CR2 A;  2RJF A;  4M78 F;  3JCM X;  4JZ4 A;  3TRE A;  5CKF A;  2LRQ A;  1W2B S;  4HKE A;  1V1C A;  4FT4 A;  3OYG A;  1SHF A;  2PUO B;  3OW2 A;  3M54 A;  3CCJ T;  1PHT A;  2F5T X;  3CC2 A;  3CPW S;  4HT9 A;  2H3E B;  5I2S A;  3V8J A;  1KC8 C;  1M90 R;  4J83 A;  3VS6 A;  4ELY C;  1N5Z A;  2KRO A;  5IH2 A;  2F2X A;  2YT6 A;  3MHX A;  2I0N A;  1G83 A;  1HK9 A;  3CBM A;  2CT3 A;  3OB9 A;  1LJO A;  2ZZD A;  3EGD A;  3HPW A;  1K0X A;  3CCS A;  2JW4 A;  2EJ9 A;  2DXC A;  1KQS P;  3SDZ A;  3EFS A;  1NM7 A;  4FCY A;  2PVO B;  2EYZ A;  2ED1 A;  4XTU A;  3TCJ A;  2O9V A;  3G6E T;  1WLP B;  2HZY A;  2J06 A;  4Z8A A;  1Q81 R;  2DJZ A;  2XDD A;  3OMC A;  2GFU A;  2AT1 B;  1VQP Q;  4A4K A;  1WXU A;  3E1S A;  3JCM e;  1OYX A;  1VQM T;  1VQL T;  2RK2 A;  3EG9 A;  2ECZ A;  3CCJ Q;  2X51 A;  1Z9Z A;  2AKL A;  2LQK A;  2V1Q A;  4PKC C;  2CUD A;  4IUP A;  4DBR A;  1YWP A;  2KNB B;  2XD0 A;  3F70 A;  2HBW A;  1YI2 T;  2DZ9 A;  4OVA A;  4M75 A;  2XHC A;  5CK9 A;  2KGT A;  2BZY A;  1TH7 A;  1RAI B;  1UHC A;  4JJC A;  1TU0 B;  1XTD A;  2EQJ A;  2RJE A;  4M78 C;  2NLU A;  2OTJ A;  4RTW A;  2DIQ A;  4J9G A;  1O75 A;  3LYI A;  2A0F B;  1V29 B;  4ZGD B;  4M75 B;  3OYM A;  1VQ6 T;  3MET A;  3LGF A;  3RKW A;  2EYX A;  3HRS A;  3SFM A;  1TUD A;  2KK4 A;  4LXC A;  1OPK A;  1ZUU A;  2K3B A;  3PFS A;  3EG0 A;  1ZA1 B;  2JN0 A;  3CCE Q;  1VQP T;  4M77 A;  2LX7 A;  5I21 A;  1YIJ Q;  3ZBD A;  5A0D A;  2CZ6 B;  3RES A;  1IRE B;  1N9S A;  2RJC A;  2L3Q A;  3CCE T;  2CP2 A;  3MP8 A;  4E7I A;  2LCL A;  5AT1 B;  2SRC A;  3CCS T;  3MEV A;  2VWF A;  2QAS A;  2L3R A;  4LE9 A;  2VKN A;  3M58 A;  8ATC B;  1YCS B;  4F04 B;  2DX1 A;  2JXB A;  3EG2 A;  4R0K A;  1JB0 E;  2X4Y A;  1D1A A;  3CMA T;  1UJ0 A;  2YSQ A;  1ACM B;  4II1 A;  1WGS A;  1PG5 B;  2M9U A;  4EDU A;  4NL2 A;  1K73 U;  4FM4 B;  4M7A A;  1N8R C;  1WQ7 A;  2DNU A;  4XTY A;  1B34 A;  2KMT A;  3QJ6 A;  1FYN A;  2L89 A;  5FWC A;  5IHN A;  3X26 B;  2GF7 A;  3JRZ A;  3NTI A;  1M3B A;  2EWN A;  4JLG A;  4M78 D;  2PU9 B;  1BU1 A;  2E3I A;  4J6X A;  2M02 A;  4EMH A;  1BCO A;  2V8J A;  2ESW A;  1IZ6 A;  2O01 E;  1JO8 A;  3HKS A;  4PFP A;  1KHC A;  3A5Z B;  2DKG A;  2EW3 A;  2YRV A;  1VQL A;  4E7H A;  3M4Y A;  1OZ3 A;  3O5Z A;  4AG2 C;  3CCV A;  2MI6 A;  4RKU E;  5IHK A;  2ZPI B;  1U1S A;  1G8X A;  4BAC A;  4PJO F;  1OI1 A;  4KGV B;  4Y92 A;  1Y7X A;  1RAD B;  2F1L A;  4R56 A;  3DLL A;  2R5A A;  4LUE A;  5GAO m;  2HBP A;  2X3X D;  4CC2 A;  2HAX A;  1WNL A;  4M4Z A;  3U23 A;  1CSK A;  1UG1 A;  2X4W A;  4DQ2 A;  1O9S A;  4N4I A;  3OYE A;  1WJR A;  4VUB A;  1ABQ A;  2G6F X;  5DM7 R;  2X3W D;  1Q7Y R;  2JZ2 A;  5GMK e;  2ZPF B;  1UTI A;  1QCO A;  4A4F A;  2DXT A;  3FIF A;  4XK8 E;  1LOJ A;  2E65 A;  2YDL A;  1YJW Q;  1SG5 A;  1KHI A;  2HDA A;  3CCJ A;  2E64 A;  4DEX A;  1JJ2 A;  3E9F A;  2CT4 A;  3H8Z A;  4MDW A;  4QQ6 A;  2M1H A;  2QAZ A;  1LCK A;  3LH5 A;  1G3S A;  2JTM A;  1QQJ A;  4A53 A;  1VUB A;  2CSQ A;  2DIG A;  3GIB A;  5A0G A;  2OJ2 A;  1BB9 A;  2E5Q A;  1NYG A;  2O4X B;  1ARK A;  1K73 C;  3S3N A;  1C6V X;  2XU8 A;  1SEM A;  1K9A A;  1TS9 A;  4PJN A;  5FRM A;  1KQ2 A;  3FJP A;  2PVD B;  3LGL A;  5D7U A;  2K7A A;  1ZSZ B;  5HKC A;  4ORZ A;  1X01 A;  1VQM A;  1EIF A;  1Q95 G;  4F7U A;  5FRO A;  3JCM J;  5HK0 A;  3JCM c;  1CKB A;  3H0I A;  3SWN C;  1KD1 U;  2DTO A;  1X6G A;  4Z02 A;  1D09 B;  3G6E Q;  5LJ3 g;  3CCL Q;  1Q7Y U;  4DA4 A;  2FO0 A;  2BZ8 A;  2K4Y A;  2FZK B;  2RB6 A;  1K1Z A;  2O88 A;  4M75 D;  5GAM g;  2GTO A;  2DFU A;  1QCF A;  1OUL A;  3QPH A;  5KYW A;  3EG9 B;  3EGD B;  1VQ5 T;  1VQ8 T;  5KE3 A;  4OML A;  4MML A;  4FSS A;  1XNI A;  1VQ9 Q;  1KK7 A;  2CGH A;  2YXY A;  1KQS A;  1RAH B;  1Y0M A;  1I81 A;  2K3Y A;  2X35 A;  3CD6 T;  1IO6 A;  3EGX B;  1Q86 C;  2MIO A;  4JRQ A;  4XU0 A;  4C8Q B;  1OX8 A;  5L23 A;  4M75 E;  3H0H A;  4M77 B;  2EFI A;  3VS0 A;  2QG9 B;  1R0B G;  3OW2 P;  4WTO B;  2XDP A;  2D8J A;  1HYO A;  2YRC A;  2WSC E;  1Y57 A;  1AVZ C;  3PT9 A;  1W1F A;  2LQN A;  4RG2 A;  3CME T;  2RQW A;  1MV3 A;  3V7C A;  3PVQ A;  3LW5 E;  3REA B;  2B86 A;  4BI8 B;  2KE9 A;  2CH4 A;  4OP0 A;  3CCR T;  1WZO A;  4C92 E;  2F2W A;  3OYC A;  5DLQ E;  2QYZ A;  4D6W A;  2E1H A;  4IUR A;  5LJ3 f;  2ZCF B;  8AT1 B;  4PJO D;  4X9C A;  5GAN j;  4M75 G;  1TWB A;  2K57 A;  2FB7 A;  2O31 A;  2LNH B;  1VOM A;  3RR6 A;  3SD4 A;  5CO7 A;  4F7U G;  1BI2 A;  1M1F A;  2HKQ B;  2NUP B;  1P92 A;  1RL2 A;  2RI3 A;  1NJI U;  1TOV A;  1YFN A;  4C8Q C;  2AK5 A;  4PJO G;  1AWJ A;  2V1R A;  5KE2 A;  3OA6 A;  5GAN f;  2DL3 A;  3CXC S;  2RA2 A;  3EFO B;  3QXE B;  3CCQ Q;  1Q82 R;  1YNZ A;  4GBQ A;  1FMK A;  4EMK C;  1I5O B;  2EKH A;  3BDU A;  3L2Z A;  1YIJ A;  3UDC A;  3JCM Q;  2A36 A;  4C92 F;  2R58 A;  2RK1 A;  2YUQ A;  3LH0 A;  3EG1 A;  3SHW A;  2JS2 A;  2KT8 A;  3PVL A;  4FU6 A;  2CP3 A;  1C1A A;  1NJI C;  3CCM Q;  3TVT A;  1D3B B;  1WHM A;  3JSC A;  3TSZ A;  4QVC A;  2RQT A;  3LLR A;  5GAN 2;  2ATC B;  3JB9 G;  1G2B A;  4E7S A;  3M0P A;  4KGX B;  3HRU A;  1QWF A;  3PIP A;  3OY9 A;  3QYG B;  4CC3 A;  4XU1 A;  2X4X A;  2LX9 A;  2YUP A;  4BE2 A;  5FW9 A;  4X9D A;  3S3M A;  1X2Q A;  1AWX A;  1H3H A;  1QKX A;  4YTL A;  4M7D A;  2DD5 A;  3S6W A;  2CP7 A;  2QK0 A;  3UPU A;  2PQW A;  1OOT A;  3JCM h;  3SEM A;  2D9T A;  1M1K C;  1QCN A;  2P0P A;  1D3B A;  2FL7 A;  4M7A G;  2DBK A;  3OYH A;  4WF2 A;  5KCO A;  1WDX A;  3CXC P;  3J7A F;  1K76 A;  2LQ8 A;  4Z89 A;  2F5K A;  1W4S A;  4RTV A;  5C0M A;  3FJ5 A;  3I56 T;  5CCA A;  5GAN d;  1GXI E;  2LVM A;  4M7D C;  1PSE A;  4LNP A;  1SRL A;  3RKX A;  3OS1 A;  2OAW A;  3E19 A;  1GBQ A;  1N27 A;  4AFU C;  2NUP A;  4OGC A;  2D0Q B;  2DF6 A;  2DMO A;  3OBY A;  2JJ9 A;  2ABL A;  1NLO C;  3CXC A;  4HA8 A;  3UA6 A;  3REB B;  4C8Q F;  2QEX A;  2IG0 A;  5DLO A;  5LJ3 e;  1ZBX A;  2K2V A;  2LC4 A;  2EGE A;  2LNV A;  1KJW A;  4EMG A;  1D1B A;  1S72 A;  3ZEH A;  1VQ7 T;  2BE9 B;  2QA4 Q;  1VQ4 T;  4M7A C;  3EH1 A;  4HVU A;  2VUB A;  1VQ7 A;  2ZPH B;  2LJ0 A;  1SRM A;  5J26 A;  2RI5 A;  2ZPB B;  3M57 A;  1HSQ A;  3I56 A;  3CCU T;  3DB4 A;  5GAM j;  1UB4 A;  1R77 A;  2EJF A;  2Y90 A;  2XIC A;  1BIA A;  1I1J A;  1WHH A;  1H92 A;  4J7I A;  4XAX B;  2JVV A;  2PZ1 A;  2DRM A;  4FIB A;  4AFQ C;  3CME Q;  2GBQ A;  1K9M C;  3MKD A;  4OB0 B;  5FU6 B;  4HVW A;  2PUK B;  1C0M A;  1UJY A;  4A63 B;  4FW2 A;  3SWN A;  2QEX T;  4PLL A;  5LJ5 f;  1LPL A;  4LDV A;  5GJW B;  2DD4 A;  3CD6 Q;  2MCN A;  3OS0 A;  1VIE A;  3QYH B;  2K9G A;  2RM4 A;  3CCS Q;  3FRN A;  2HMA A;  2RHU A;  1EFN A;  2CZ1 B;  4MZT A;  1B07 A;  1I07 A;  1K4U S;  3IQL A;  3JCM f;  5GAM h;  2ZPE B;  2A08 A;  1ZUY A;  1YCY A;  1QP3 A;  4RTY A;  1N9R A;  2Y4X A;  1Y71 A;  3VU3 C;  3AHU A;  1ABO A;  1QVG A;  4QT7 A;  4HXJ A;  5GMK j;  3G71 A;  3CQT A;  5GAM e;  4BY6 B;  3OYN A;  1AOJ A;  4M75 C;  1AWW A;  1D0Z A;  4OGE A;  3JB9 I;  2JM9 A;  4IIO A;  1VQ6 Q;  1RAB B;  1S1N A;  3EHR A;  1X75 C;  2K5F A;  5IXF A;  1M1K U;  2QDL A;  4JJB A;  1QVF S;  3MEA A;  3GBQ A;  1VQ9 A;  2KVQ G;  2DTH A;  2FYK A;  1VYU A;  2DLP A;  1KG1 A;  3BE3 A;  4FL6 A;  1IGU A;  3A98 A;  2IVW A;  1AWO A;  3QKJ A;  2JNG A;  4OMQ A;  5GAO p;  3CCE A;  2LMJ A;  5GAM d;  3P8B B;  3VS2 A;  2M16 A;  5GMK i;  1JRI A;  2QA4 T;  1VQ4 Q;  3A8G B;  2COY A;  3MCA B;  2BUD A;  1BCM A;  1PNJ A;  4M77 F;  1ZLM A;  2E4H A;  2FVU A;  2RPN A;  1M1K R;  3DB3 A;  1U1T A;  4GLK A;  1N8R U;  3X28 B;  2KRS A;  3VS7 A;  1PWT A;  3CPW A;  4IUU A;  5KYN A;  2BIV A;  1AT1 B;  4DEY A;  3JB9 J;  3C0C A;  1N6A A;  5I11 A;  1IHV A;  2DIL A;  2GQV A;  3HFN A;  3A8L B;  5IAY A;  4X34 A;  3JCM g;  3JCM b;  2EJG A;  2DPP B;  4N4G A;  5KYW B;  4LD9 K;  1FX7 A;  5CQY A;  2DXB A;  1BK2 A;  3GOX A;  2COZ A;  3UT1 A;  3BFM A;  2QGG A;  3Q1J A;  2DEU A;  4M7A D;  1K8A R;  2EYQ A;  1SKU B;  3VYH B;  2C06 A;  1H64 1;  2DET A;  1T0H A;  3VYG A;  1OZ2 A;  2KRN A;  1VQN A;  3RNJ A;  3VS5 A;  1RLQ C;  1JXO A;  4J9F A;  3G71 Q;  4C5I A;  2EKO A;  4QW2 A;  4C92 C;  2CZ7 B;  2D0N A;  3VJP A;  2FPE A;  2DYI A;  2M51 A;  2SEM A;  5CQX A;  4C0G A;  1IRX A;  5CKD A;  1R8O B;  4M7A E;  4HCK A;  3A8H B;  1PKT A;  4AMC A;  3I56 Q;  2HKN A;  3LWH A;  3WVD B;  5LJ3 h;  5EC7 A;  4PJO A;  1RAA B;  3X20 B;  2DVE A;  5GAN 3;  1Z9Q A;  3CBP A;  4L5G A;  2O2O A;  3M0T A;  3HTR A;  1UFF A;  3H41 A;  1YIT T;  4M7D B;  3JAM E;  5KYX A;  3TSW A;  1ZQ1 A;  2PNI A;  4OMN A;  4M7D E;  3JCM W;  4C5G A;  3QO3 A;  5CKH A;  1YP5 A;  2COW A;  2RNA A;  2ENM A;  1M2V B;  5FU6 C;  4LN2 A;  2EIF A;  2MK5 A;  3I35 A;  2RQU A;  4DBF A;  4UC4 A;  4C0D C;  3OYL A;  4EMK A;  5FU7 C;  2L3S A;  1H8K A;  1I0C A;  5FLX E;  2RHY A;  3EG3 A;  4E6R A;  1BI3 A;  2E70 A;  4RUG A;  1U5S A;  4PFZ A;  1M3C A;  1KD1 C;  1YWO A;  3R6N A;  4JRI A;  3G4S Q;  4KGZ B;  4OMM A;  4PLI A;  4J7F A;  4AFZ C;  4JUV A;  1NJI R;  5I22 A;  2F69 A;  4J5Y A;  1IGQ A;  1YIJ T;  3CCR Q;  3S3O A;  2EQM A;  1YHQ A;  3KBG A;  1VQ5 Q;  4ZGJ B;  1VQ8 Q;  3X24 B;  2DA9 A;  4KUI A;  3KXT A;  1M2O A;  4L6V 5;  4Q5W A;  3E9G A;  3I5R A;  5KYY B;  4HCB A;  1LVK A;  1KQS S;  4MDX A;  3BY7 A;  3MPU B;  1AZG B;  2CP6 A;  1NZ9 A;  2DL7 A;  3P8D A;  2X4J A;  4RG8 A;  2E41 A;  3BDL A;  4M77 G;  4CC7 A;  3CC7 Q;  1HJD A;  4RTT A;  5GAN 7;  1PC0 A;  2CRE A;  2BTT A;  4E2F B;  1YJ9 T;  3RIR A;  2XMF A;  4M78 A;  2RH2 A;  3CCU A;  4M78 E;  3L2R A;  1QVG S;  1G5V A;  5IXB A;  1UGR B;  1ZA2 B;  4LUD A;  2VYT A;  2HEQ A;  1WYX A;  3M0U A;  1PD0 A;  1WQW A;  2JM8 A;  5ECA A;  5GAN e;  5GAO l;  3SB2 A;  4CC4 B;  1VQM Q;  1Q82 U;  1BI1 A;  2L5Q A;  4LDW A;  2C0T A;  1SHG A;  5DY9 A;  3A1P A;  5GAN 5;  2NUT A;  3RMQ A;  3O8V A;  1RAE B;  2JMC A;  1UEB A;  5GAN 8;  4Y91 A;  2J7I A;  4OMF B;  4ZTJ A;  2OTL T;  2KSS A;  3OBW A;  4KUL A;  2QQR A;  4OF1 A;  4ATO A;  3VRY A;  2E6N A;  1QVP A;  5LJ5 e;  1TG0 A;  2HL3 A;  2KR3 A;  3M0R A;  2HL5 C;  2KRM A;  2YRD A;  5IN1 A;  1T0J A;  4B9W A;  2L0A A;  1YHQ T;  2L3P A;  1XOV A;  2OAU A;  4JLI A;  1BYM A;  1KIK A;  1BBZ A;  3L2U A;  2VC8 A;  1RAC B;  2PVG B;  4PJL A;  3QUI A;  1NEG A;  4XTX A;  4C8Q E;  1WHJ A;  2CKK A;  2FHD A;  3CCL A;  2NWM A;  1BI0 A;  3TEE A;  3QJY A;  1TTH B;  4PJO C;  4F7U E;  2DK3 A;  4F17 A;  3CC2 Q;  2GFA A;  1LNX A;  1YIT Q;  4KT0 E;  4PJO E;  2K2M A;  1VYT A;  3A8O B;  1VQK Q;  4EPC A;  2KYB A;  3SWN B;  4QQD A;  4E7K A;  2K6D A;  1YI2 A;  5CAI A;  1YJ9 A;  2J05 A;  3H6Z A;  1K0S A;  4FYW B;  4C0Z A;  2QDY B;  3HP9 A;  4L59 A;  1G3T A;  1K8A C;  4GY5 A;  1PCX A;  2BKD N;  3FEO A;  2QQA A;  1M2V A;  4RTU A;  2HQX A;  2LCC A;  2VV5 A;  1NBE B;  1XJW B;  3MP1 A;  5HY6 A;  1YN8 A;  2Z0W A;  2LCS A;  2VXF A;  5CKE A;  5IT9 E;  2MYS A;  1Q86 U;  1VQN T;  1W2B P;  2OTL A;  4HT8 A;  3GF5 A;  2J6O A;  2WSE E;  1IB8 A;  1GBR A;  4KUD K;  3CCL T;  1Q86 R;  5AYF A;  4M77 C;  9ATC B;  1K8A U;  1OPL A;  1JU5 C;  2GGR A;  1WA7 A;  2K3X A;  1MMD A;  2QTX A;  3UA7 A;  5I2M A;  2QEX Q;  3I55 A;  2HD0 A;  3OSV A;  4N4H A;  3M55 A;  3J81 E;  2RO0 A;  2WSF E;  1TUC A;  3C4S A;  2LDM A;  3ME9 A;  1A0N B;  4D8D A;  4ZTF A;  3CMA Q;  1MMA A;  4A4G A;  1X6O A;  3GNG A;  2LJ3 A;  1MHN A;  5CKB A;  4AG1 C;  4C92 B;  2CYZ B;  3RBB B;  2X9H A;  5KYU A;  1M1G A;  1TUG B;  2ZAE A;  2BE7 D;  1UGV A;  3M56 A;  1PKS A;  1UGS B;  1YHQ Q;  4M7D D;  4MZM A;  5LJ3 j;  3FDR A;  4PNO A;  1JJ2 P;  5D6Y A;  2M0O A;  3NTK A;  4DBQ A;  4RCC A;  2RQV A;  4JJD A;  3PTA A;  3NPF A;  1U3O A;  2A3L A;  2LTO A;  4HCZ A;  2XI9 A;  5A2Q E;  3RDV A;  1JXM A;  2QQB A;  1YJN A;  2HNI A;  1RI0 A;  2LQW A;  5GAN g;  4OMP A;  1K9M U;  1RI9 A;  3JB9 F;  2P0Q A;  3G1J A;  3OYY A;  3OW2 S;  1KSW A;  1Q81 C;  1VA7 A;  4D8K A;  4JJN K;  1X6B A;  5EG2 A;  5C6S A;  3VV0 A;  3JCM V;  2CH4 W;  4BB7 A;  2RMO A;  2OTJ Q;  4PJM A;  2QTV A;  1VQ7 Q;  3ULR B;  3VS3 A;  4QVD A;  3OQ5 A;  2DYB A;  3OYB A;  3OYF A;  2D6F A;  2VGM A;  4J9E A;  4CRI A;  1IHW A;  4KRT A;  4OB3 B;  2C0I A;  1TXQ A;  3MJX A;  2MAM A;  3D7S B;  1WX6 A;  3V7R A;  1M4Z A;  2DJQ A;  4M7D G;  2CSI A;  4M75 F;  1RAF B;  2DRK A;  2IIM A;  1V76 A;  3WVE B;  2A7Y A;  3CPF A;  4FT2 A;  4PFO A;  1VQL Q;  1FMV A;  4ZNX A;  1HD3 A;  4E7L A;  1X69 A;  1I8F A;  5D6W A;  1UGP B;  1KC8 R;  1M90 C;  3CCR A;  1H3Z A;  4AT1 B;  2HQE A;  2DO3 A;  1WFW A;  1I4K 1;  3DLM A;  2FRY A;  2KDS A;  2RJD A;  1E6G A;  4BY6 C;  4RMO A;  2EAY A;  1VQ6 A;  2ROT A;  3OYI A;  3M9Q A;  3QDR B;  2DL5 A;  1GRI A;  5HCK A;  3H0F A;  2J6K A;  1GCQ C;  4RTX A;  1VQ5 A;  1VQ8 A;  4CI0 C;  1QLY A;  1QW1 A;  1XQH A;  3MEU A;  5KYU B;  4HCC A;  3THK A;  3VRZ A;  2KXD A;  1OU9 A;  2DTI A;  5LJ5 h;  5KCH A;  2NUZ A;  4DOV A;  2CZ0 B;  5FU7 B;  2AZV A;  2JMA A;  1OV3 A;  3G4S A;  1VQP A;  3M59 A;  1B7T A;  3C12 A;  1MMG A;  4HVV A;  4B6M A;  2GQI A;  3OYD A;  3UF4 A;  1OU8 A;  7AT1 B;  5GAN h;  5M9O A;  3RKY A;  4JRP A;  3MP6 A;  5IHI A;  3LX7 A;  1SPK A;  1GCQ A;  4J9I A;  4M77 E;  2D1X A;  1DJ7 B;  2D8H A;  2R57 A;  1RUW A;  1ZX6 A;  1ZHI A;  2EGA A;  3CCU Q;  5L8R E;  1Q82 C;  4J8O A;  2CDT A;  3EGX A;  4EIK A;  5D6X A;  3VKI A;  4C0D B;  4J6W A;  3VS4 A;  2P84 A;  4FW1 A;  5A0L A;  1QKW A;  4RCB A;  4LDY A;  1M8V A;  3MEW A;  4O6J A;  2KY9 A;  3V7S A;  2YHT A;  3CC7 A;  3JCM P;  2EBP A;  1U06 A;  1BKB A;  1X2K A;  3QDF A;  3WXM B;  3NFC A;  4MZP A;  4OMO A;  2HQH A;  3I55 T;  1OEB A;  1MNE A;  2ZGW A;  3VUB A;  2DL8 A;  1B3Q A;  1U8R A;  1JJ2 S;  4C0F A;  4BD3 A;  3M53 A;  2J6F A;  2YUO A;  1Q81 U;  3JCM d;  5HK3 A;  2KT1 A;  2JTF A;  2DL4 A;  2QA4 A;  2ED0 A;  3L42 A;  3PNW C;  2FRW A;  3OS2 A;  2AZS A;  2KAF A;  4IUQ A;  4XU2 A;  3MO8 A;  2HCK A;  1MMN A;  4A4H A;  3L1A A;  3E2U A;  3QZ9 B;  3CCV Q;  1X43 A;  2GTJ A;  4LD6 A;  4A4E A;  3JB9 H;  5GAN 6;  2RHZ A;  2YLB A;  1UHF A;  1W2B A;  1RLP C;  4ANJ A;  3X25 B;  1JEG A;  4XU3 A;  1MUZ A;  3URG A;  4A54 A;  1ZBJ A;  2R5M A;  2VAS A;  4JZ3 A;  1S72 Q;  1WXT A;  4AFS C;  1QMC A;  1WJS A;  5GAN 4;  2RN8 A;  1OQK A;  2HSE B;  4TVR A;  5LJ5 g;  4NL3 A;  3CC7 T;  1SF9 A;  1JBM A;  1EZZ B;  4PK4 A;  5KYY A;  4JDS A;  2XKO C;  2MF2 A;  3J80 E;  4BDZ A;  4BUG A;  3VUZ A;  6AT1 B;  2DAQ A;  3G71 T;  1YI2 Q;  2LT1 A;  2CS7 A;  1HXD A;  2MWP A;  2DVJ A;  1VQ4 A;  3R6O A;  2AIR B;  1YJN Q;  1NPP A;  3T9N A;  1F1B B;  2XK0 A;  2YLC A;  1M8M A;  2VXE A;  2K5I A;  1YJ9 Q;  4B9X A;  1KQ1 A;  2L2P A;  3QWX X;  4FYX B;  2EVR A;  3CC4 T;  1VQO Q;  2LP5 A;  4F7U B;  5GJV B;  2OI3 A;  3EFR A;  1FMW A;  4NS5 A;  2RD1 A;  4E7J A;  3QWY A;  1ZUK A;  3G4S T;  3DKM A;  1NE8 A;  1MND A;  2DER A;  1GFC A;  1M5Q 1;  1WPY A;  3M5A A;  3N5B B;  4JRK A;  3EH2 A;  1IXD A;  3GLX A;  3NTH A;  1PM3 A;  2I2L A;  3QSU A;  2QI2 A;  4ZGE B;  3CCM A;  2NUT B;  1PD1 A;  3TU4 K;  2E6Z A;  5FWB A;  3P8H A;  1T3L A;  4F14 A;  4ELZ C;  3M0Q A;  2LJ1 A;  1R0C B;  3JV3 A;  5GAO r;  2W10 A;  4C5E A;  2H8H A;  3QII A;  1VQ9 T;  2LT4 A;  3NHN A;  2CP5 A;  3I55 Q;  1GCP A;  2ROL A;  5KH6 A;  3HFO A;  1M3A A;  1VIF A;  1Y96 B;  2OTJ T;  3CMA A;  1NEB A;  2EQI A;  1MV0 B;  2B8A A;  3QG1 A;  2G3R A;  4M7A B;  1WIE A;  2EQK A;  1GFD A;  1AEY A;  4J9H A;  2XDB A;  3OMG A;  3ASK A;  2E10 A;  3M0S A;  4C92 G;  2VB6 A;  4KH0 B;  2C0O A;  3CC4 A;  1KC8 U;  3VS1 A;  2KI7 A;  2QXF A;  1D0X A;  3C94 A;  4ZN1 A;  4J6Y A;  4N0A C;  4P5N A;  4FYV B;  4Y28 E;  3HSB A;  2H3J A;  3RER A;  3PMT A;  1VQO A;  1UEC A;  2GNC A;  3CD6 A;  4F7U F;  1G3W A;  4IKF A;  1Y07 A;  3QZ5 B;  3KUF A;  1QVG P;  1TSF A;  1G3Y A;  2P4R A;  2MPX C;  3CC2 T;  5FRN A;  1WJQ A;  4C8Q D;  2DZC A;  5GMK h;  2GCX A;  3G7Z A;  2XG8 D;  2EGC A;  5KYX B;  1BIB A;  4J9C A;  2LZ6 B;  4EMK B;  4OB1 B;  3L2V A;  1PSF A;  3V8K A;  2KEA A;  3HRT A;  4NOY A;  4R55 A;  3PIO A;  5CIU A;  3OYA A;  1EX4 A;  1E6H A;  2VGN A;  2K79 A;  3I5S A;  2IPO B;  3QHS A;  2MWO A;  4BI4 A;  4PJO B;  1Q7Y C;  2EPD A;  2KXC A;  2M0Y A;  2RQR A;  4MMK A;  3RMS A;  2QQ9 A;  2V26 A;  1MGQ A;  1YJW T;  1D0Y A;  4C92 D;  1K73 R;  2W0Z A;  1NG2 A;  1QP2 A;  4LDU A;  4ESR A;  4F16 A;  1YIT A;  3UWN A;  4QKU A;  4RTZ A;  4IUV A;  1S72 T;  3PMI A;  3OSS C;  2DXU A;  1M27 C;  4X1V A;  1Y96 A;  5J3B A;  3G6E A;  4LDX A;  4BDY A;  3V8L A;  3CCV T;  3JB9 D;  1M30 A;  5J39 A;  2O4X A;  4QQG A;  1WHL A;  4XTZ A;  2O9S A;  2FG0 A;  3L2W A;  4JPB W;  4C92 A;  4E7Z A;  4IUT A;  4KBM B;  1RAG B;  2OTL Q;  4J9D A;  4O5V A;  3CPW P;  2CP0 A;  2XID A;  4C8Q G;  3QBY A;  1GL5 A;  5LJ5 j;  1T3S A;  3CCQ T;  2WAC A;  2DBM A;  3GP8 A;  2E5K A;  3EHQ A;  3EAE A;  1VQO T;  1AHJ B;  1FWZ A;  5LJ3 d;  3LWI A;  2L8D A;  2P0K A;  3EFO A;  5GAM f;  1UGQ B;  1YJN T;  4DOW A;  2YUN A;  4ME7 A;  1CKA A;  3UAT A;  1NLP C;  2FZG B;  2FPF A;  4DBH A;  3OYJ A;  1JQQ A;  2PTK A;  2JTE A;  4M78 G;  1PRL C;  5GAO q;  1VQK A;  4M7A F;  2CUB A;  2F2V A;  4QVZ A;  4GLM A;  3EGU A;  1UE9 A;  5GAO n;  5GMK l;  3ER0 A;  3INZ A;  1AD5 A;  4J9B A;  4OB2 B;  1UDL A;  2KBT A;  2MMP A;  3H9N A;  4KH1 B;  1FXX A;  2EQU A;  1D1C A;  2JOY A;  1K9M R;  3PE0 A;  2V8K A;  5CVI A;  2RI2 A;  3M4G A;  2BZX A;  4BI3 A;  4E47 A;  2V8I A;  1N8R R;  2RF0 A;  2FPD A;  3GPL A;  1B34 B;  1ZSZ A;  1YJW A;  4V2S A;  3CEY A;  4M77 D;  1PRM C;  2DM1 A;  4XTW A;  2ZPG B;  3GNF B;  2DE0 X;  3NGP A;  4PJJ A;  4Z88 A;  2VVK A;  4M7D F;  1M9S A;  3AT1 B;  2A28 A;  1OX9 A;  2E3H A;  3I9Q A;  3CCM T;  3CC4 Q;  3PGG A;  3FLG A;  3TQ7 P;  2FEI A;  2RHI A;  1ZSG A;  3CCQ A;  1SSF A;  4JS4 A;  1E7O A;  3HL8 A;  1QWE A;  1SSH A;  1QVF P;  4BE0 A;  5LJ5 d;  3C95 A;  2Y4Y A;  4JS5 A;  2DEQ A;  2HSP A;  3OS5 A;  1M90 U;  2NYS A;  3ZFJ A;  3KFV A;  1W70 A;  4XTV A;  2KQW A;  1WHG A;  1UUE A;  2MOX A;  1I5L A;  2YWW A;  1J3T A;  2OX7 A;  4C5H A;  4K11 A;  3FB9 A;  3NMZ C;  1AZE A;  3ZL7 C;  4PL6 A;  3HHT B;  2KYM A;  4WCI A;  1WHK A;  1W6X A;  2FZC B;  2EYY A;  3RUX A;  3OYK A;  1YBY A;  1VQK T;  4XQ3 A;  1NPR A;  4BE1 A;  2RHX A;  1QVF A;  1KD1 R;  2P4T A;  1ZSZ C;  1NYF A; 
#chains in the Genus database with same CATH homology
 4RUG A;  1U5S A;  1QKW A;  1X27 A;  1M3C A;  1YWO A;  3R6N A;  2AKK A;  2JS0 A;  4OMM A;  4AFZ C;  2EBP A;  2O31 A;  5I22 A;  1U06 A;  2LNH B;  2A37 A;  1X2K A;  1WI7 A;  4OMO A;  2JT4 A;  2EYW A;  1OEB A;  2DA9 A;  4IIM A;  1KFZ A;  1VYV A;  2AK5 A;  1AWJ A;  2V1R A;  1WXB A;  2DL3 A;  2DL8 A;  1B3Q A;  3I5R A;  4JZ4 A;  1YNZ A;  4GBQ A;  1FMK A;  2J6F A;  2EKH A;  2YUO A;  1V1C A;  2KT1 A;  1SHF A;  1AZG B;  2DL4 A;  2A36 A;  1PHT A;  2YUQ A;  2DL7 A;  2ED0 A;  3EG1 A;  3SHW A;  2FRW A;  2AZS A;  4CC7 A;  2JS2 A;  2KT8 A;  3PVL A;  2HCK A;  1HJD A;  4RTT A;  3VS6 A;  3TVT A;  1N5Z A;  3TSZ A;  2CRE A;  2BTT A;  2KRO A;  5IH2 A;  1X43 A;  2F2X A;  2GTJ A;  2RQT A;  2YT6 A;  2I0N A;  1G83 A;  1G2B A;  1UHF A;  2XMF A;  3M0P A;  1RLP C;  1JEG A;  1MUZ A;  1QWF A;  2CT3 A;  1K0X A;  2JW4 A;  4CC3 A;  1ZBJ A;  5IXB A;  4JZ3 A;  1WXT A;  4AFS C;  4E6R A;  2RN8 A;  4LUD A;  1NM7 A;  2YUP A;  2HEQ A;  5FW9 A;  2EYZ A;  2ED1 A;  1X2Q A;  1AWX A;  1WYX A;  1QKX A;  3M0U A;  1H3H A;  2O9V A;  1WLP B;  2J06 A;  2JM8 A;  5ECA A;  4Z8A A;  4CC4 B;  1OOT A;  1WXU A;  3SEM A;  2C0T A;  1SHG A;  2ECZ A;  1Z9Z A;  2DVJ A;  2AKL A;  2DBK A;  1WDX A;  2V1Q A;  2CUD A;  1K76 A;  1M8M A;  2JMC A;  4Z89 A;  4RTV A;  2J7I A;  2L2P A;  3QWX X;  1YWP A;  2EVR A;  2KNB B;  3FJ5 A;  2HBW A;  2LP5 A;  5GJV B;  4LNP A;  2OI3 A;  1SRL A;  3QWY A;  1ZUK A;  2KGT A;  2OAW A;  3VRY A;  2BZY A;  1GFC A;  1TG0 A;  1UHC A;  4JJC A;  1GBQ A;  4AFU C;  2KR3 A;  3M0R A;  2KRM A;  1T0J A;  2DF6 A;  2DMO A;  2L0A A;  2L3P A;  1XOV A;  2ABL A;  1NLO C;  1KIK A;  1BBZ A;  4RTW A;  4J9G A;  5FWB A;  3UA6 A;  3REB B;  1T3L A;  4F14 A;  3M0Q A;  1NEG A;  2LJ1 A;  3JV3 A;  2W10 A;  2EGE A;  2EYX A;  2NWM A;  1TUD A;  1KJW A;  2H8H A;  1OPK A;  1ZUU A;  2K3B A;  3EG0 A;  3NHN A;  1GCP A;  2ROL A;  1M3A A;  1NEB A;  2EQI A;  4F17 A;  1MV0 B;  2LX7 A;  4HVU A;  1WIE A;  1GFD A;  1AEY A;  4J9H A;  2LJ0 A;  1SRM A;  3M0S A;  2L3Q A;  2K2M A;  2C0O A;  1VYT A;  1HSQ A;  2SRC A;  2VWF A;  2KYB A;  3VS1 A;  4LE9 A;  2K6D A;  2VKN A;  1YCS B;  2J05 A;  2DX1 A;  2JXB A;  3EG2 A;  4R0K A;  1K0S A;  1I1J A;  1H92 A;  1UJ0 A;  2YSQ A;  1UEC A;  2GNC A;  2PZ1 A;  2DRM A;  4RTU A;  4AFQ C;  2GBQ A;  4HVW A;  1YN8 A;  2LCS A;  1UJY A;  4A63 B;  2P4R A;  2DNU A;  5GJW B;  2J6O A;  1FYN A;  2MCN A;  5FWC A;  2EGC A;  1GBR A;  5IHN A;  4J9C A;  2LZ6 B;  2K9G A;  1M3B A;  2KEA A;  1OPL A;  1JU5 C;  2GGR A;  1WA7 A;  1EFN A;  1BU1 A;  1E6H A;  1B07 A;  1I07 A;  3UA7 A;  1K4U S;  3IQL A;  2K79 A;  3I5S A;  2A08 A;  1ZUY A;  4RTY A;  2EPD A;  2ESW A;  2KXC A;  2M0Y A;  2RQR A;  1JO8 A;  1TUC A;  1ABO A;  1A0N B;  4QT7 A;  2EW3 A;  4HXJ A;  4D8D A;  3CQT A;  3O5Z A;  4AG2 C;  1AOJ A;  1AWW A;  5IHK A;  2JM9 A;  2W0Z A;  4IIO A;  1NG2 A;  1S1N A;  2LJ3 A;  3EHR A;  4Y92 A;  4AG1 C;  4ESR A;  4F16 A;  5IXF A;  3RBB B;  4RTZ A;  2QDL A;  4JJB A;  1UGV A;  3GBQ A;  1PKS A;  1VYU A;  2DLP A;  4LUE A;  1M27 C;  2X3X D;  4X1V A;  4CC2 A;  3A98 A;  4M4Z A;  1AWO A;  3U23 A;  1CSK A;  1UG1 A;  1M30 A;  2RQV A;  4JJD A;  4OMQ A;  3NPF A;  1ABQ A;  1U3O A;  2O9S A;  2FG0 A;  2G6F X;  4JPB W;  2X3W D;  2LMJ A;  1UTI A;  4J9D A;  1JXM A;  3VS2 A;  2YDL A;  1GL5 A;  2HDA A;  2LQW A;  4DEX A;  4OMP A;  2CT4 A;  1T3S A;  1LCK A;  1PNJ A;  2DBM A;  1ZLM A;  2E5K A;  3EHQ A;  1RI9 A;  2RPN A;  3LH5 A;  2CSQ A;  1KSW A;  2KRS A;  3VS7 A;  1PWT A;  1VA7 A;  4D8K A;  1X6B A;  2OJ2 A;  1BB9 A;  4DEY A;  1NYG A;  2CH4 W;  3C0C A;  1ARK A;  2YUN A;  5I11 A;  2RMO A;  2DIL A;  1CKA A;  3UAT A;  1SEM A;  1K9A A;  1NLP C;  2FPF A;  1JQQ A;  2PTK A;  3ULR B;  3VS3 A;  2K7A A;  2JTE A;  4ORZ A;  2DYB A;  1PRL C;  2CUB A;  2F2V A;  4J9E A;  1BK2 A;  4GLM A;  4KRT A;  3EGU A;  1UE9 A;  2C0I A;  1AD5 A;  4J9B A;  1UDL A;  1WX6 A;  1CKB A;  3H0I A;  1X6G A;  2DJQ A;  2KBT A;  2CSI A;  1T0H A;  3PE0 A;  2DRK A;  2IIM A;  2KRN A;  3RNJ A;  2BZX A;  3VS5 A;  1RLQ C;  1JXO A;  4J9F A;  2FO0 A;  2BZ8 A;  4ZNX A;  1HD3 A;  2RF0 A;  2FPD A;  1K1Z A;  2O88 A;  1X69 A;  2GTO A;  2D0N A;  2FPE A;  2M51 A;  1QCF A;  1WFW A;  2SEM A;  1PRM C;  2FRY A;  2DM1 A;  1E6G A;  2ROT A;  2DE0 X;  4OML A;  2DL5 A;  3NGP A;  4Z88 A;  1GRI A;  4FSS A;  5HCK A;  2VVK A;  3H0F A;  4HCK A;  2J6K A;  1GCQ C;  2A28 A;  3I9Q A;  4RTX A;  1PKT A;  1QLY A;  1Y0M A;  3THK A;  3VRZ A;  2KXD A;  5EC7 A;  1IO6 A;  2FEI A;  1ZSG A;  2MIO A;  1E7O A;  1QWE A;  1SSH A;  2NUZ A;  1Z9Q A;  2AZV A;  5L23 A;  2JMA A;  3H0H A;  2HSP A;  1OV3 A;  3VS0 A;  2O2O A;  3KFV A;  1W70 A;  3M0T A;  4HVV A;  2GQI A;  1UFF A;  2D8J A;  3H41 A;  1UUE A;  2MOX A;  3UF4 A;  1J3T A;  1Y57 A;  3TSW A;  2PNI A;  4K11 A;  4OMN A;  1AVZ C;  1W1F A;  2LQN A;  3NMZ C;  5IHI A;  1SPK A;  1AZE A;  1YP5 A;  2RNA A;  3ZL7 C;  1GCQ A;  4J9I A;  2ENM A;  2KYM A;  4WCI A;  1W6X A;  2RQW A;  4LN2 A;  1MV3 A;  2D1X A;  2EYY A;  2D8H A;  1RUW A;  1ZX6 A;  3I35 A;  3PVQ A;  2EGA A;  2RQU A;  3REA B;  2B86 A;  2L3S A;  1H8K A;  2CDT A;  4EIK A;  2KE9 A;  1I0C A;  2CH4 A;  3EG3 A;  1NYF A;  3VS4 A;  2F2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...