2KRNA

High resolution structure of the second sh3 domain of cd2ap
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
b'GSMGRQCKVLFDYSPQNEDELELIVGDVIDVIEEVEEGWWSGTLNNKLGLFPSNFVKELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
molecule tags Signaling protein
source organism Mus musculus
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2krnA00
1WYXA 1QWFA 5IXFA 3VS3A 1M30A 2KRSA 1A0NB 1E7OA 3O5ZA 2KEAA 4A63B 2SRCA 1V1CA 3GBQA 3NHNA 2FPDA 4LE9A 1AD5A 1BU1A 1KSWA 2ABLA 1CSKA 2EQIA 1OOTA 4J9EA 3VS7A 1WXUA 3RNJA 1B3QA 1NLPC 1H92A 4J9DA 2EYYA 2JT4A 2J6FA 2CSIA 5IHIA 1ZUKA 1GFDA 2YT6A 1NEBA 3M0TA 2YDLA 1Y57A 2EKHA 1W1FA 2DF6A 2EVRA 2K3BA 1YN8A 4F16A 2KXDA 2YUNA 3I5RA 1RLQC 1ZUUA 1X6GA 1NLOC 1QCFA 4F14A 1J3TA 1UUEA 2F2XA 4OMQA 2XMFA 4QT7A 1TG0A 1NYGA 3UATA 2L0AA 1RLPC 4Y92A 2DBMA 2ESWA 2NWMA 2A08A 2DE0X 1GBRA 4DEXA 2B86A 5L23A 2HSPA 2RQWA 1GCQC 2M51A 2KYMA 1I07A 1QWEA 1JXOA 1VYTA 1PRMC 2EYZA 1UE9A 2ROTA 1WDXA 1ABOA 1UHCA 1M3AA 1I0CA 2ECZA 5GJWB 1X43A 2AKKA 2D8JA 3SEMA 1K4US 3A98A 1YCSB 1SSHA 2LZ6B 2YSQA 4WCIA 2D0NA 1TUCA 2FPEA 4D8KA 2L2PA 1X69A 1M3BA 2DLPA 1FYNA 1JU5C 1T0HA 3TSZA 1S1NA 1VYUA 5FWBA 4CC7A 5HCKA 3H41A 1I1JA 4CC3A 4HVWA 2DA9A 2CSQA 2F2VA 2CDTA 2RMOA 2JS0A 3M0QA 3VS0A 1U5SA 1AWXA 1BBZA 1T3SA 1PHTA 2K2MA 2MOXA 1T3LA 2JMAA 2K9GA 3REBB 4IIMA 4DEYA 1K0SA 1UGVA 1PNJA 4FSSA 2OJ2A 2GTOA 2EYWA 2RQTA 4HXJA 5FWCA 1OPKA 3EGUA 3QWXX 4JPBW 2CH4A 1XOVA 3PE0A 1VA7A 2LMJA 1U3OA 2FO0A 3EG2A 4J9IA 1BK2A 2YUOA 2K79A 2GTJA 2JXBA 2CT4A 2L3SA 1RI9A 4AG2C 1E6GA 3VRYA 2O9VA 2VWFA 2AZSA 1M3CA 2LJ3A 4JJCA 3I35A 2JM8A 4LUEA 2EYXA 3NGPA 3UF4A 2JM9A 4OMLA 1WFWA 2C0IA 2F2WA 1AZEA 1UG1A 1N5ZA 4OMPA 1JXMA 1KFZA 4JZ4A 1MUZA 3UA7A 2KRMA 4AFUC 2LJ0A 4LUDA 1WA7A 2KT1A 2DL7A 1GFCA 2P4RA 2KXCA 2LQNA 3EG1A 1SEMA 4Z8AA 4EIKA 4IIOA 1YWPA 1KJWA 1Z9ZA 1UFFA 2RQVA 4OMMA 2RQRA 2L3PA 1GRIA 2BZ8A 3QWYA 4JJBA 5ECAA 2FRWA 1T0JA 1AWJA 1RUWA 1X6BA 3H0IA 1AVZC 1ZX6A 3FJ5A 1H3HA 2GQIA 2J6OA 4AFSC 1PRLC 4ZNXA 1W70A 3CQTA 5IXBA 3VS1A 2JMCA 3VS6A 1Z9QA 1UDLA 2A37A 1NEGA 2RQUA 4AFQC 1GBQA 2KR3A 1X27A 2DBKA 4J9HA 1SHGA 1WI7A 3M0SA 1TUDA 1BB9A 4ORZA 1PWTA 2KNBB 4R0KA 2FRYA 2C0TA 2J7IA 2NUZA 1K9AA 1AZGB 2FG0A 2MCNA 2J6KA 4J9FA 3M0PA 2KGTA 1NYFA 4RTVA 2X3WD 2GNCA 2CUBA 2SEMA 4E6RA 2K6DA 1SHFA 3PVQA 5I11A 1K1ZA 3H0HA 2JW4A 1M27C 2O2OA 3THKA 1SRLA 1NM7A 1MV3A 2OAWA 2D8HA 2DL3A 2KT8A 2VVKA 2JTEA 1X2KA 3M0RA 4JZ3A 4AG1C 4HCKA 3EG0A 4RTXA 3EG3A 2V1RA 2J06A 4RTUA 2DJQA 4Z89A 4OMNA 1ZLMA 2EGAA 2E5KA 4OMOA 2AKLA 2W0ZA 1UJYA 2KBTA 1YP5A 2DM1A 1WLPB 1WX6A 3VS4A 4RTTA 2PNIA 5EC7A 1ABQA 3NPFA 1LCKA 1CKBA 2C0OA 2KE9A 3TSWA 2LNHB 2CT3A 3IQLA 1OV3A 3VS2A 1AWOA 1X2QA 1UTIA 1PKSA 1ZUYA 1IO6A 2VKNA 1ARKA 2EBPA 3SHWA 1YNZA 2EGEA 5I22A 2LX7A 1GCPA 2EGCA 2CREA 3M0UA 4J9BA 3U23A 2DNUA 3ZL7C 2O9SA 3EHQA 2QDLA 4F17A 1AEYA 1JEGA 1U06A 1NG2A 2OI3A 2DL8A 2DL5A 2ROLA 1QKWA 2LCSA 2D1XA 5IHKA 4AFZC 2JS2A 4X1VA 3NMZC 2HCKA 4HVUA 1MV0B 4ESRA 3PVLA 1QKXA 2DL4A 1KIKA 3TVTA 2PZ1A 3LH5A 1G83A 1G2BA 1AWWA 2K7AA 1W6XA 1HJDA 2RN8A 3REAB 2CUDA 2A36A 2DMOA 1PKTA 3VRZA 2CH4W 3ULRB 1CKAA 2BZXA 1ZBJA 2DVJA 4HVVA 2FPFA 3JV3A 4D8DA 2DRKA 2KYBA 2L3QA 1EFNA 4RTWA 4GLMA 2V1QA 2RNAA 3H0FA 2M0YA 3I5SA 1WXBA 1OEBA 4M4ZA 2LJ1A 5FW9A 1WXTA 2ED1A 5IH2A 2AZVA 4RTYA 2A28A 1K0XA 2RF0A 2GGRA 2DRMA 1JQQA 2J05A 4CC4B 3EHRA 2AK5A 2FEIA 4Z88A 4J9CA 2DX1A 2O88A 2ED0A 2IIMA 4RTZA 2HEQA 4CC2A 2ENMA 1JO8A 4LN2A 2LP5A 1AOJA 2MIOA 4J9GA 2RPNA 1VYVA 1HD3A 2KROA 2LQWA 2H8HA 2YUQA 2PTKA 2YUPA 2KRNA 2EPDA 3UA6A 2EW3A 4RUGA 2DILA 3I9QA 3KFVA 1M8MA 4K11A 1SRMA 2G6FX 1Y0MA 3R6NA 1GCQA 1HSQA 3C0CA 4JJDA 1YWOA 1B07A 1H8KA 5IHNA 2HBWA 2BTTA 2BZYA 2GBQA 4LNPA 2O31A 1K76A 1QLYA 1ZSGA 2X3XD 1SPKA 5GJVB 1GL5A 1E6HA 1WIEA 4KRTA 1UHFA 1OPLA 1UJ0A 4GBQA 2DYBA 1FMKA 1UECA 2I0NA 3RBBB 2W10A 2HDAA 3VS5A
chains in the Genus database with same CATH superfamily
1KQ1A 4E7HA 8AT1B 4DBQA 5GAMg 1QWFA 4XTYA 5FROA 3BY7A 2KRSA 4RCCA 2GFAA 2SRCA 1V1CA 2E3IA 4FU6A 3GLXA 3NHNA 2Y4YA 4LE9A 1AD5A 4B6MA 6AT1B 4C8QC 2COZA 2EJ9A 1B3QA 4M77C 5D6YA 2D6FA 5IHIA 1ZUKA 3SWNA 1LPLA 3M0TA 2EKHA 4J5YA 2KQWA 3CCJQ 4JDSA 1YN8A 5KYWB 3I5RA 3A8HB 1NJIC 2EQMA 4M7AF 1IGUA 2DD4A 4PLLA 5GANe 2ZPEB 2F2XA 2M1HA 4QT7A 1VQKT 1NPRA 1TG0A 5CVIA 2CYZB 1H641 2M9UA 5I2MA 1RLPC 2EAYA 2DBMA 5LJ3g 3SWNC 1Q81C 1G3YA 2BKDN 4DEXA 2B86A 2HSPA 1EX4A 4HCZA 1I07A 4C0GA 1JXOA 2XICA 1VYTA 1VQ5A 2RB6A 3UT1A 1RAEB 2GCXA 3E1SA 4AMCA 2X35A 4OP0A 3OBYA 1Y7XA 1YJNT 1YIJT 1YJWQ 3KUFA 1VQKQ 4L5GA 2D0NA 3I56T 3CC4Q 4ZGJB 3CCET 1JJ2S 5KYYB 1FYNA 3CBPA 3X24B 1P92A 2RHXA 2GFUA 5FWBA 3DB4A 3OYYA 3CMET 2XHCA 2L5QA 1I1JA 3OYFA 4CC3A 4PJOG 1W2BP 4M7DE 4FYWB 2RMOA 4M7AC 2K2MA 2MOXA 2JMAA 2K9GA 1K0SA 4IIMA 2WSFE 3CCVQ 5LJ3j 3CCRQ 2A3LA 2YRCA 2RQTA 4FM4B 5FWCA 2O4XA 1OPKA 3FB9A 4JPBW 2HKNA 3QWXX 1U8RA 2CH4A 2EWNA 2OAUA 1VA7A 2R5MA 2FO0A 3VYHB 4ZGDB 2GTJA 4FW2A 5GAOn 3OYDA 1RI9A 1S72A 5CQXA 3LWHA 2WSEE 4JJCA 2DEUA 1JJ2P 4LUEA 1RAGB 2E1HA 4OMLA 2C0IA 1I8FA 4OMPA 3SWNB 3CXCA 3J7AF 4JZ4A 2XKOC 3HFOA 2X4WA 3QSUA 4LUDA 1WA7A 2E6ZA 3OYAA 2YWWA 4PJMA 2HL5C 1VQ9Q 2RH2A 4C8QG 1KJWA 3FEOA 4HT8A 3JCMX 2RI3A 1GRIA 3AT1B 2OTLT 3JSCA 3CMEQ 3HFNA 1VQ6T 1XTDA 5FLXE 3TCJA 3G71Q 2L3RA 1IGQA 1ZX6A 5KE2A 1H3HA 2J6OA 1SKUB 2MMPA 4ZNXA 4EMKC 3PIPA 3I56Q 3A8GB 4ZN3A 3VS1A 1Z9QA 5HK0A 2YLBA 2LNVA 3HKSA 1GBQA 4C92E 1SHGA 4KT0E 3OYLA 1BB9A 3JCMd 1MMNA 3LLRA 3QDFA 1N9RA 3CCQQ 1LNXA 2EJFA 2D0QB 2RHIA 3PFSA 4XK8E 1OU8A 8ATCB 3M0PA 4RTVA 3V8KA 2X3WD 2GNCA 2OTLA 4TVRA 2SEMA 2K6DA 3GNGA 5GAOp 3THKA 1XNIA 1RACB 1WHLA 1BYMA 3MEVA 1MV3A 2D8HA 4OMFB 7AT1B 2QTVA 5KYUB 2BE7D 1ZSZB 3RMSA 4JZ3A 1IHVA 1QMCA 1BIBA 5J26A 3C94A 4N0AC 3V7CA 1KK7A 2AKLA 1WLPB 2P0KA 5J3BA 1OYXA 1YITQ 4WTOB 5GMKj 3EFOB 1ZSZA 5GAN4 5KCOA 2C0OA 2ZPFB 2CT3A 2E5QA 3EH1A 4PNOA 1UTIA 1HYOA 1PKSA 2F69A 4C0DC 3SHWA 3EG9B 1ZQ1A 3EAEA 4A54A 4JRPA 2LX7A 1GCPA 2EGCA 4J9BA 3U23A 2FL7A 4KH1B 1N8RU 4JRIA 4FYVB 5C6SA 3M56A 5GMKh 3J81E 2K57A 3CC2T 1NG2A 2GQVA 2XDBA 1VQLQ 5GAN5 4PKCC 2ROLA 1QKWA 3FDRA 5KYXB 5IHKA 1EIFA 4N4IA 3HSBA 2HL3A 5LJ3e 4IUQA 1VQ4A 5GAOr 4C92F 1Q86C 1MV0B 4ZGEB 3KXTA 4ESRA 3HPWA 3TVTA 5FRMA 2RO0A 3DLMA 4NL2A 4E7ZA 2K7AA 2RJDA 3F70A 1HJDA 1D3BA 4M7AG 3M54A 1W2BA 2CUDA 2CZ7B 3FLGA 3HP9A 3DB3A 3AHUA 2DMOA 1PKTA 4QQDA 1JB0E 2CH4W 1D0XA 3ULRB 4M7DG 2DAQA 1ZBJA 2VUBA 5GAMj 2DK3A 1M1KR 3JV3A 2DRKA 2KYBA 1Q7YC 4BI8B 1M90C 2PVOB 1EFNA 5LJ5d 4RTWA 2V1QA 4WF2A 2QXFA 3ZEHA 2LJ1A 4M78C 1WXTA 2ED1A 4OGEA 1VQ8T 3TREA 1VQ7Q 5GAN7 1ZA1B 2AK5A 4J8OA 1YIJA 3OA6A 2IIMA 2MYSA 1WJRA 2RD1A 1MNEA 2OTJA 1JO8A 2KVQG 2LP5A 2RM4A 2KROA 2YUQA 4M78G 4LDWA 2YUPA 3UWNA 2QGGA 2EPDA 1VQNQ 3KFVA 3QZ9B 4K11A 5DY9A 1GCQA 2HSEB 2YXYA 5D6XA 2PUOB 3E9FA 5GAN6 5LJ5e 4M75E 3CCEA 1H8KA 5LJ5h 1TTHB 2F5KA 2BZYA 4UC4A 2F5TX 3EGXB 4IUUA 1QVGS 1SPKA 3DLLA 1UHFA 1IB8A 5GMKm 4FL6A 3OYBA 3OYCA 3SFMA 2B8AA 3BW1A 3CC7A 2W10A 2LRQA 2HDAA 3CD6Q 1I5LA 1M30A 4EPCA 1QP2A 3G6EA 1Y71A 2V26A 4F7UE 4A63B 1W2BS 4BACA 1AT1B 2FPDA 3QJYA 4R56A 5GAMe 3TU4K 3QYGB 1CSKA 2DZCA 5KYUA 2D9TA 3RNJA 1AHJB 2FYKA 3FJPA 1XQHA 4M78A 2K2VA 2EYYA 1WGSA 2JT4A 1WHGA 2J6FA 4C0FA 2X9HA 5LJ3f 5DLOA 1W1FA 3CCMA 4PJNA 2MWOA 2K3BA 4JS4A 2KXDA 1DJ7B 2LCCA 3CMAT 1X6GA 3BDUA 1QCFA 2LT1A 4OMQA 2XMFA 4PJOC 2DIGA 2RK2A 4M7DB 3CCUT 4QW2A 3UATA 2AHJB 2XDPA 3EGDB 4C5EA 2ESWA 2DE0X 3V7SA 3H9NA 4M7AE 2DXBA 5L23A 2RQWA 3LX7A 1VUBA 3GIBA 4OB0B 2CP7A 1PRMC 2EYZA 4QVDA 1VQMQ 1UE9A 3MPUB 1WDXA 2NLUA 1ABOA 2IVWA 2I2LA 1M3AA 2ECZA 1M90R 1WZOA 1K73C 1K4US 2HD0A 4M77A 4QQGA 2RJFA 3QIIA 3DKMA 3CC2A 1YCSB 1SSHA 2LZ6B 4A4GA 2YSQA 4JRKA 2X4YA 3RKYA 2ZPBB 4F7UA 2DO3A 2YLCA 1TUCA 1RAHB 4E7LA 1X69A 1M3BA 2DLPA 2LVMA 4QQ6A 4FYXB 2V8IA 2LC4A 2HBPA 1S1NA 3ME9A 1VYUA 2CP6A 1XJWB 4NL3A 4HVWA 4MMLA 3CCUQ 3MEUA 2L89A 3VU3C 1V76A 4M7DD 4M77E 1AWXA 2EQKA 5A0DA 4OVAA 3REBB 4DEYA 4FSSA 2OJ2A 2GTOA 2MK5A 3QDRB 3OYHA 2EYWA 3EGUA 1X01A 3OSVA 3PE0A 1YJ9Q 3CCJA 4IUTA 2LMJA 3EG2A 4J9IA 1SF9A 4BE2A 2FZGB 3GP8A 4EMGA 1QVGP 4AG2C 3WXMB 1D3BB 3VRYA 4LXCA 3OW2A 2LJ3A 5GAOq 2VASA 4ATOA 2CS7A 2X4XA 2EYXA 3NGPA 3CPWS 5HK3A 2JM9A 4DOVA 3FC3A 4KGZB 1FMWA 1YITT 1UG1A 1K8AU 1JXMA 4FSXA 3UA7A 1VIFA 2KRMA 4AFUC 2LJ0A 4BDYA 4M75G 2KT1A 2DL7A 3ER0A 3A8OB 5KYWA 1B7TA 4IIOA 1Z9ZA 3ASKA 4M78E 3S3MA 1IREB 4DOWA 5A2QE 4E7KA 4BDZA 5ECAA 2FRWA 1YJWA 3GNFB 1T0JA 1AWJA 1RUWA 2AT1B 3FJ5A 2EQJA 4AFSC 1Q82R 3GPLA 3OYKA 1TSFA 1RL2A 5KYNA 1RABB 4BD3A 5IXBA 1Y96B 5EG2A 1N27A 2KR3A 1X27A 5IAYA 1C0MA 1S72T 3S3NA 3V8JA 4ORZA 4C8QE 1BI3A 2FRYA 1MNDA 2C0TA 2ZZDA 1JRIA 1VOMA 2J6KA 4IUVA 4J9FA 3OSSC 2KGTA 2YHTA 3PMIA 2AIRB 4E6RA 1SHFA 3PVQA 1K1ZA 1MHNA 1WQWA 2JW4A 2OX7A 2QQBA 2XDDA 1SRLA 4C8QA 4M78D 2ZAEA 4PJJA 1V29B 4RCBA 3L2VA 2DL3A 2VVKA 1IHWA 4AG1C 4HCKA 3EG0A 1N8RC 4DBRA 4RTXA 3EG3A 4HT9A 1VQPT 3CEYA 4Z89A 1ZLMA 2EGAA 2E5KA 1PG5B 2KBTA 4M7DC 1K8AC 5CKHA 5I21A 5EC7A 4J6YA 1KQSS 1K8AR 1YI2T 1VQNT 3OYMA 4PFOA 1RAIB 2KE9A 4M77G 4ME7A 1VQ9A 2LNHB 3M55A 3VS2A 4C0ZA 1Q81U 3HRTA 3JCMP 2QQ9A 2ZCFB 3Q1JA 3OYJA 2CREA 4OB1B 4BE0A 2DL5A 4PJOE 2KSSA 3QHSA 4J6XA 2D1XA 3EH2A 3OBWA 1OU9A 2M0OA 3NMZC 1TU0B 2DEQA 4PK4A 1M90U 1WJSA 3MJXA 4AT1B 2R58A 5IT9E 1YI2Q 1QVPA 1UB4A 5KH6A 3X28B 3OS1A 2DL4A 3HHTB 4HA8A 3LH5A 1G83A 1G2BA 3I55A 2WACA 2KMTA 1VQOQ 2JN0A 2DTOA 1IZ6A 4A53A 4IURA 1O9SA 4CRIA 5LJ3h 5CAIA 4XTWA 2QA4A 3VRZA 2M16A 3HL8A 4R55A 2E4HA 2QASA 4XQ3A 3P8HA 1M2VB 2M02A 1PD0A 1VQ8Q 5FRNA 5IH2A 4PFPA 4RTYA 2A28A 1QVFA 2NUTA 1K9MC 2DRMA 4CC4B 1O75A 1VIEA 3OMGA 1UGQB 2PVGB 2DX1A 3QG1A 5GANj 1HXDA 5D7UA 3CBMA 4LN2A 3MHXA 1Q86R 1AOJA 2O01E 2FZCB 4OGCA 5GANf 1VYVA 2XK0A 4V2SA 2LQWA 2KRNA 2GF7A 4KGVB 2K3XA 4RUGA 3URGA 5LJ5g 2MPXC 2QEXA 3UDCA 3FRNA 4DQ2A 1Y0MA 3OS2A 4JJDA 4C0DB 2DIQA 2KDSA 3LGFA 5L8RE 5GANd 1G8XA 1B07A 3QO3A 5IHNA 4O6JA 2BTTA 4A4FA 4LNPA 2E12A 1Y96A 2O31A 1VQ6Q 4HCBA 3JB9G 3SD4A 1I81A 5DM7R 1Q7YR 2DPPB 1UJ0A 2VGMA 4KH0B 1YJNQ 4GBQA 1FMKA 2QI2A 4IUPA 4NOYA 3M4GA 5HKCA 1UECA 2I0NA 3RBBB 1KD1R 4DBHA 1UGRB 4BI3A 1WYXA 4YTLA 3PMTA 3VS3A 3L2UA 3OS0A 2BUDA 1Y07A 1I5OB 2LTOA 5C0MA 1A0NB 2CGHA 2KEAA 3BDLA 1VQPQ 2Y90A 1VQ5Q 3OMCA 2ABLA 1OOTA 1WXUA 1LVKA 4VUBA 1H92A 4J9DA 3QUIA 2CSIA 1NEBA 2YDLA 4KULA 1Y57A 3CXCP 4KUIA 1VQKA 4II1A 1D09B 3OW2P 1PC0A 2EVRA 3JCMW 1KG1A 3CC4A 1WHHA 1VQOT 4EMHA 4F16A 2VB6A 2YUNA 1ZUUA 1M1GA 3QBYA 3CCVT 1NLOC 3EGXA 4LDYA 2KY9A 3PGGA 1OZ3A 3JCMh 2L0AA 1NBEB 2NWMA 5GAN8 4ZN1A 4M7AD 3GF5A 1KQSP 1VQNA 2K5IA 2NUPB 3VYGA 3CCRA 4PFZA 2QK0A 2JTFA 2HMAA 3G4ST 1UHCA 2PQWA 5GJWB 4HKEA 3RESA 2E65A 2QDYB 2FVUA 4RG8A 3A8MB 2ZGWA 3CMAQ 5GMKl 4J83A 1OX8A 3V7RA 1W4SA 3BE3A 3FIFA 4PJOB 3OW2S 4WCIA 1BIAA 1VQMT 2G3RA 1GXIE 2L2PA 3MKDA 4M75B 1T0HA 2HZYA 1RI0A 1IRXA 2QQRA 1H3ZA 2E3HA 3CCQT 5HCKA 3H41A 2DTIA 3VV0A 3P8DA 2DA9A 3OY9A 1ZBXA 2CSQA 2F2VA 2CDTA 2JS0A 3M0QA 3VS0A 1U5SA 1BBZA 4J6WA 1PHTA 1BKBA 3NFCA 1YHQQ 1T3LA 5GAOm 2RJCA 1UGVA 5FU7B 1N9SA 1SSFA 3CD6T 4BB7A 3CCMQ 3G71T 3G71A 1XOVA 2JOYA 3RR6A 1U3OA 2YRDA 1YHQT 1M1KC 2ATCB 5CIUA 2K79A 3I56A 4E7SA 2RHZA 2JXBA 2CT4A 2HQHA 1KD1C 2L3SA 1K73U 1TH7A 1E6GA 2HQEA 2KI7A 4FCYA 1U1SA 2O9VA 2DYIA 2AZSA 4Q5WA 3V8LA 5KE3A 3CCSQ 2KK4A 3VKIA 3CCQA 3NTIA 1QVFP 1YCYA 1AZEA 1KFZA 1M2OA 3CPFA 4LDUA 1VQMA 2QEXT 1GFCA 2P4RA 2KXCA 1SEMA 2MI6A 3D7SB 1UFFA 4OMMA 4ANJA 2L3PA 2OTJT 2BZ8A 3L2ZA 4BI4A 1R8OB 3CC2Q 5GAMd 4Y91A 3H0IA 4F04B 5J39A 3EFRA 5KCHA 1W70A 5A0GA 1WHJA 1KC8R 4EMKB 2BIVA 2EYQA 2JMCA 4M78B 3VS6A 2X4JA 1KC8C 1UDLA 4JLGA 1M1FA 1YITA 2E41A 4A4KA 3OYIA 2RQUA 3RKXA 3JCMJ 1D0ZA 4J9HA 1WI7A 4LD9K 3M0SA 1Q7YU 1TUDA 4C92D 2DXCA 1PWTA 1MGQA 2KNBB 4X9CA 2CZ1B 2RA2A 2VYTA 4JUVA 3G4SA 4R0KA 3QPHA 2DERA 2NUZA 1D1AA 4GLKA 4J7IA 9ATCB 2PUKB 1QW1A 1NYFA 5CQYA 1EZZB 4E7IA 2QAZA 5FU6B 4KBMB 2CUBA 4A4EA 4OB2B 4XAXB 5I11A 4M7DA 1TXQA 4MZTA 4ZTJA 4FIBA 1BCMA 2OAWA 4PL6A 1VQ4Q 2KT8A 4C92A 3M58A 3R6OA 3P8BB 4B9WA 3SDZA 5LJ5j 1BCOA 4JLIA 1D0YA 1Q82C 2J06A 4RTUA 1JJ2A 1Q82U 3E2UA 2VV5A 3EG9A 2DJQA 4OMNA 5CKDA 2FHDA 2W0ZA 1UJYA 1OI1A 1QP3A 1WX6A 3JB9D 3VS4A 2HAXA 4ELYC 2HKQB 3O8VA 4RTTA 2PNIA 4C5HA 5IN1A 3NPFA 2P0PA 2XD0A 1CKBA 4M78F 2EKOA 1PM3A 1B34A 1KHIA 3IQLA 1OV3A 3L1AA 4RMOA 1AWOA 1ZUYA 1IO6A 1TUGB 2E70A 2XU8A 1M8VA 5KYYA 2EGEA 3QKJA 5I22A 4P5NA 5HY6A 2DNUA 3RKWA 5GAOl 3ZL7C 2O9SA 5GMKe 3EHQA 4MZMA 3JCMV 2QDLA 1K73R 1AEYA 2XG8D 2OTLQ 3CCLA 1NE8A 2NUPA 2DL8A 1G3SA 4XU2A 1YIJQ 1YJWT 2Y4XA 2JS2A 3LYIA 2E64A 1VQ4T 1N8RR 4L59A 3C4SA 4HVUA 2FB7A 2YRVA 1G5VA 2O4XB 1QKXA 2IG0A 4N4GA 2PZ1A 2JNGA 1BI0A 2QYZA 1WHKA 3CCMT 1W6XA 3KBGA 4M7AB 1OX9A 3CCEQ 1BI1A 2LDMA 4DBFA 2RN8A 3REAB 2DD5A 4LDVA 4OF1A 2BZXA 4XTVA 3M5AA 4HVVA 4PLIA 3JCMg 4E7JA 3RDVA 4BY6B 3E9GA 3H0FA 4M4ZA 5M9OA 2C06A 5GAMh 4M75D 5I2SA 2RF0A 1JQQA 3L2RA 1VQLA 3EHRA 4MDXA 2FEIA 1RAAB 2DFUA 2DXUA 3JCMe 4J9CA 1FMVA 1OZ2A 3L2QA 3PIOA 2JUFA 2MIOA 1ZHIA 2A7YA 4ELZC 3OYEA 2PTKA 1LJOA 3MCAB 5CCAA 3UA6A 2EW3A 2BE9B 1M8MA 2G6FX 2MF2A 3UPUA 3NTKA 1M9SA 1HSQA 4C92C 1YJ9T 3CC4T 2LCLA 3JCMf 2HBWA 2XIDA 1FWZA 3CCJT 3HRSA 2GBQA 1X6OA 3MEAA 2QGFB 1QLYA 4N4HA 3QZ5B 2X3XD 1QCNA 5GJVB 3CCST 1JBMA 1WIEA 1OPLA 1RAFB 3M9QA 4BUGA 2DYBA 1VQ9T 1LOJA 2ZPHB 3A5ZB 4C92G 1TOVA 2L8DA 2F1LA 3EFSA 1YI2A 4C8QD 1K9MR 4M77D 3BFMA 1Q81R 5IXFA 2JJ9A 2VGNA 4C5GA 3META 5GANg 3PTAA 1E7OA 3O5ZA 3E19A 1ACMB 3GBQA 3I55Q 1U1TA 1BU1A 1M4ZA 1KSWA 2OTJQ 1IXDA 2EQIA 4J9EA 3VS7A 4C5IA 4XTZA 1NLPC 1PCXA 1I4K1 2DXTA 3CCVA 1GFDA 2YT6A 4F7UG 1X75C 2DF6A 4F7UF 3MP8A 4Z02A 2DKGA 3J80E 1C1AA 4B9XA 1RLQC 1ZSZC 1YFNA 2MWPA 1B34B 3VJPA 1S72Q 4KGXB 4F14A 1J3TA 1UUEA 2VXEA 3X26B 1KQSA 4XU3A 5CO7A 3L2WA 2E6NA 3L42A 2K3YA 2XI9A 2HQXA 1KD1U 1NYGA 3CCUA 3G1JA 1OQKA 4Y92A 2RI5A 3CC7Q 2A08A 1GBRA 2CP2A 1F1BB 3CD6A 3MP1A 4EMKA 1GCQC 4M75F 1VQ7T 1M5Q1 1VQLT 3SB2A 3G6EQ 2M51A 2KYMA 1WPYA 1MMAA 1QWEA 5LL6S 2ROTA 3RUXA 3A1PA 1I0CA 1X43A 2JTMA 1NJIU 2AKKA 3JCMQ 2D8JA 3SEMA 4BE1A 2NYSA 3G7ZA 3A98A 5FU7C 3CCLT 1NZ9A 4GY5A 1YJNA 1KHCA 3CMEA 1Q86U 3LW5E 4PJLA 2FPEA 4D8KA 3A8LB 2P4TA 2RK1A 2CZ6B 2Z0WA 1JU5C 3G6ET 3ZFJA 3RERA 3TSZA 1K9MU 4CC7A 3ZBDA 1WJQA 2QTXA 4PJOA 2MAMA 2QQAA 3QYHB 2EIFA 3HTRA 3QJ6A 2A0FB 3S3OA 4N0AA 3JCMb 2IPOB 1T3SA 1C6VX 1PNJA 2QA4T 4HXJA 3MP6A 2CP5A 2PU9B 3JAME 2EFIA 3EFOA 2H3JA 3M59A 4MDWA 3TEEA 4JJNK 1FXXA 1BK2A 2YUOA 4IKFA 4M75C 4M7AA 3MO8A 1QCOA 2VWFA 4XTUA 3CPWP 3OB9A 1M3CA 3I35A 2CKKA 2JM8A 4OB3B 1D1BA 4LDXA 3UF4A 2LQKA 4QKUA 1WFWA 2F2WA 5CR2A 1M2VA 4F7UB 1N5ZA 5KYXA 1MUZA 3GOXA 3VUBA 2NUTB 1OULA 4M75A 3LGLA 2LQNA 3EG1A 4Z8AA 4EIKA 4C92B 1YWPA 2RQVA 3X20B 2RQRA 3MEWA 5GAMf 2K4YA 1N6AA 1TS9A 3CMAA 3QWYA 2K5LA 4JJBA 3C12A 3PNWC 3N5BB 4FT2A 2E10A 5D6WA 1PSEA 2DTHA 1X6BA 1AVZC 2DJZA 1Q95G 2RHUA 3VUZA 1YJ9A 2GQIA 4L6V5 1QVFS 1PRLC 5GANh 1QVGA 2JZ2A 1M1KU 3CQTA 4HCCA 3OYGA 5CKFA 3C95A 2A37A 1NEGA 4QVZA 4AFQC 3RIRA 2DBKA 5CKEA 5GAN3 2KAFA 3H6ZA 3PT9A 2COYA 4LD6A 3H8ZA 4XU0A 4MZPA 3OQ5A 3NTHA 4PJOF 5LJ5f 1YHQA 3CXCS 2J7IA 5LJ3d 1K9AA 3WVEB 2COWA 1AZGB 2FG0A 2MCNA 4E2FB 1MMDA 2R5AA 3T9NA 2LT4A 1HK9A 1PSFA 3H0HA 1R77A 1M27C 2X51A 2O2OA 1NM7A 4EDUA 3M53A 2JTEA 1X2KA 3M0RA 1G3WA 4FT4A 2P0QA 1D1CA 4X9DA 3CPWA 3CCSA 1VQ7A 2V1RA 1FX7A 3WVDB 5CK9A 2EQUA 2P84A 4OMOA 2CP3A 3S6WA 1YP5A 2CP0A 2DM1A 4C8QB 3OS5A 1ABQA 3CC7T 4M77B 4Y28E 4QVCA 3LH0A 1LCKA 5CKBA 3M57A 3TSWA 3HRUA 1QQJA 3I55T 1R0BG 1X2QA 2VKNA 1VQ5T 1ARKA 2EBPA 1YNZA 3M4YA 3X25B 3M0UA 3EGDA 4D6WA 1VQ8A 3JCMc 4F17A 3CCRT 2WSCE 4JS5A 1JEGA 1U06A 3JB9F 2OI3A 3JB9I 1UEBA 1BI2A 2LCSA 2H3EB 4AFZC 5A0LA 4X1VA 4C8QF 4JRQA 5AT1B 2HCKA 4RKUE 1NJIR 4X34A 2RJEA 2VC8A 4ZTFA 1SG5A 1WHMA 3PVLA 4KUDK 1KIKA 5AYFA 3G4SQ 2ZPGB 2QEXQ 4E47A 1AWWA 4CI0C 2LQ8A 2PVDB 4MMKA 1WQ7A 2K5FA 2A36A 1VQ6A 3CBOA 4PJOD 2DZ9A 1CKAA 2DVJA 5FU6C 2V8KA 4M7DF 3QXEB 2FPFA 1KC8U 4D8DA 3OYNA 2L3QA 2HNIA 4GLMA 2RHYA 2RNAA 4O5VA 2M0YA 3I5SA 1WXBA 1OEBA 1RADB 5FW9A 3LWIA 1G3TA 3TQ7P 2AZVA 1K0XA 1PD1A 2ZPIB 1KQ2A 5GMKi 2GGRA 2J05A 1WNLA 3JB9J 1YBYA 4Z88A 3INZA 2O88A 1ZA2B 2ED0A 1VQPA 3RMQA 4RTZA 2HEQA 5DLQE 3JB9H 4FW1A 4DA4A 2EJGA 4CC2A 2ENMA 1UGSB 4J9GA 2RPNA 1HD3A 2LX9A 2H8HA 2R57A 2RI2A 2VXFA 2DILA 3I9QA 2FZKB 1SRMA 3R6NA 4BY6C 3C0CA 2QQSA 1YWOA 5GAN2 1VQOA 2DVEA 4RG2A 1NPPA 4J7FA 2QG9B 4A4HA 1R0CB 1K76A 1ZSGA 3CCLQ 2V8JA 2DETA 2QA4Q 1GL5A 1UGPB 1E6HA 4KRTA 4M77F 4XU1A 4FYYB 1MMGA 4XTXA 1TWBA 4NS5A 3JRZA 2JVVA 2CZ0B 3VS5A
chains in the Genus database with same CATH topology
1WYXA 1QWFA 5IXFA 3VS3A 1M30A 2KRSA 1A0NB 1E7OA 3O5ZA 2KEAA 4A63B 2SRCA 1V1CA 3GBQA 3NHNA 2FPDA 4LE9A 1AD5A 1BU1A 1KSWA 2ABLA 1CSKA 2EQIA 1OOTA 4J9EA 3VS7A 1WXUA 3RNJA 1B3QA 1NLPC 1H92A 4J9DA 2EYYA 2JT4A 2J6FA 2CSIA 5IHIA 1ZUKA 1GFDA 2YT6A 1NEBA 3M0TA 2YDLA 1Y57A 2EKHA 1W1FA 2DF6A 2EVRA 2K3BA 1YN8A 4F16A 2KXDA 2YUNA 3I5RA 1RLQC 1ZUUA 1X6GA 1NLOC 1QCFA 4F14A 1J3TA 1UUEA 2F2XA 4OMQA 2XMFA 4QT7A 1TG0A 1NYGA 3UATA 2L0AA 1RLPC 4Y92A 2DBMA 2ESWA 2NWMA 2A08A 2DE0X 1GBRA 4DEXA 2B86A 5L23A 2HSPA 2RQWA 1GCQC 2M51A 2KYMA 1I07A 1QWEA 1JXOA 1VYTA 1PRMC 2EYZA 1UE9A 2ROTA 1WDXA 1ABOA 1UHCA 1M3AA 1I0CA 2ECZA 5GJWB 1X43A 2AKKA 2D8JA 3SEMA 1K4US 3A98A 1YCSB 1SSHA 2LZ6B 2YSQA 4WCIA 2D0NA 1TUCA 2FPEA 4D8KA 2L2PA 1X69A 1M3BA 2DLPA 1FYNA 1JU5C 1T0HA 3TSZA 1S1NA 1VYUA 5FWBA 4CC7A 5HCKA 3H41A 1I1JA 4CC3A 4HVWA 2DA9A 2CSQA 2F2VA 2CDTA 2RMOA 2JS0A 3M0QA 3VS0A 1U5SA 1AWXA 1BBZA 1T3SA 1PHTA 2K2MA 2MOXA 1T3LA 2JMAA 2K9GA 3REBB 4IIMA 4DEYA 1K0SA 1UGVA 1PNJA 4FSSA 2OJ2A 2GTOA 2EYWA 2RQTA 4HXJA 5FWCA 1OPKA 3EGUA 3QWXX 4JPBW 2CH4A 1XOVA 3PE0A 1VA7A 2LMJA 1U3OA 2FO0A 3EG2A 4J9IA 1BK2A 2YUOA 2K79A 2GTJA 2JXBA 2CT4A 2L3SA 1RI9A 4AG2C 1E6GA 3VRYA 2O9VA 2VWFA 2AZSA 1M3CA 2LJ3A 4JJCA 3I35A 2JM8A 4LUEA 2EYXA 3NGPA 3UF4A 2JM9A 4OMLA 1WFWA 2C0IA 2F2WA 1AZEA 1UG1A 1N5ZA 4OMPA 1JXMA 1KFZA 4JZ4A 1MUZA 3UA7A 2KRMA 4AFUC 2LJ0A 4LUDA 1WA7A 2KT1A 2DL7A 1GFCA 2P4RA 2KXCA 2LQNA 3EG1A 1SEMA 4Z8AA 4EIKA 4IIOA 1YWPA 1KJWA 1Z9ZA 1UFFA 2RQVA 4OMMA 2RQRA 2L3PA 1GRIA 2BZ8A 3QWYA 4JJBA 5ECAA 2FRWA 1T0JA 1AWJA 1RUWA 1X6BA 3H0IA 1AVZC 1ZX6A 3FJ5A 1H3HA 2GQIA 2J6OA 4AFSC 1PRLC 4ZNXA 1W70A 3CQTA 5IXBA 3VS1A 2JMCA 3VS6A 1Z9QA 1UDLA 2A37A 1NEGA 2RQUA 4AFQC 1GBQA 2KR3A 1X27A 2DBKA 4J9HA 1SHGA 1WI7A 3M0SA 1TUDA 1BB9A 4ORZA 1PWTA 2KNBB 4R0KA 2FRYA 2C0TA 2J7IA 2NUZA 1K9AA 1AZGB 2FG0A 2MCNA 2J6KA 4J9FA 3M0PA 2KGTA 1NYFA 4RTVA 2X3WD 2GNCA 2CUBA 2SEMA 4E6RA 2K6DA 1SHFA 3PVQA 5I11A 1K1ZA 3H0HA 2JW4A 1M27C 2O2OA 3THKA 1SRLA 1NM7A 1MV3A 2OAWA 2D8HA 2DL3A 2KT8A 2VVKA 2JTEA 1X2KA 3M0RA 4JZ3A 4AG1C 4HCKA 3EG0A 4RTXA 3EG3A 2V1RA 2J06A 4RTUA 2DJQA 4Z89A 4OMNA 1ZLMA 2EGAA 2E5KA 4OMOA 2AKLA 2W0ZA 1UJYA 2KBTA 1YP5A 2DM1A 1WLPB 1WX6A 3VS4A 4RTTA 2PNIA 5EC7A 1ABQA 3NPFA 1LCKA 1CKBA 2C0OA 2KE9A 3TSWA 2LNHB 2CT3A 3IQLA 1OV3A 3VS2A 1AWOA 1X2QA 1UTIA 1PKSA 1ZUYA 1IO6A 2VKNA 1ARKA 2EBPA 3SHWA 1YNZA 2EGEA 5I22A 2LX7A 1GCPA 2EGCA 2CREA 3M0UA 4J9BA 3U23A 2DNUA 3ZL7C 2O9SA 3EHQA 2QDLA 4F17A 1AEYA 1JEGA 1U06A 1NG2A 2OI3A 2DL8A 2DL5A 2ROLA 1QKWA 2LCSA 2D1XA 5IHKA 4AFZC 2JS2A 4X1VA 3NMZC 2HCKA 4HVUA 1MV0B 4ESRA 3PVLA 1QKXA 2DL4A 1KIKA 3TVTA 2PZ1A 3LH5A 1G83A 1G2BA 1AWWA 2K7AA 1W6XA 1HJDA 2RN8A 3REAB 2CUDA 2A36A 2DMOA 1PKTA 3VRZA 2CH4W 3ULRB 1CKAA 2BZXA 1ZBJA 2DVJA 4HVVA 2FPFA 3JV3A 4D8DA 2DRKA 2KYBA 2L3QA 1EFNA 4RTWA 4GLMA 2V1QA 2RNAA 3H0FA 2M0YA 3I5SA 1WXBA 1OEBA 4M4ZA 2LJ1A 5FW9A 1WXTA 2ED1A 5IH2A 2AZVA 4RTYA 2A28A 1K0XA 2RF0A 2GGRA 2DRMA 1JQQA 2J05A 4CC4B 3EHRA 2AK5A 2FEIA 4Z88A 4J9CA 2DX1A 2O88A 2ED0A 2IIMA 4RTZA 2HEQA 4CC2A 2ENMA 1JO8A 4LN2A 2LP5A 1AOJA 2MIOA 4J9GA 2RPNA 1VYVA 1HD3A 2KROA 2LQWA 2H8HA 2YUQA 2PTKA 2YUPA 2KRNA 2EPDA 3UA6A 2EW3A 4RUGA 2DILA 3I9QA 3KFVA 1M8MA 4K11A 1SRMA 2G6FX 1Y0MA 3R6NA 1GCQA 1HSQA 3C0CA 4JJDA 1YWOA 1B07A 1H8KA 5IHNA 2HBWA 2BTTA 2BZYA 2GBQA 4LNPA 2O31A 1K76A 1QLYA 1ZSGA 2X3XD 1SPKA 5GJVB 1GL5A 1E6HA 1WIEA 4KRTA 1UHFA 1OPLA 1UJ0A 4GBQA 2DYBA 1FMKA 1UECA 2I0NA 3RBBB 2W10A 2HDAA 3VS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYX A;  1QWF A;  5IXF A;  3VS3 A;  1M30 A;  2KRS A;  1A0N B;  1E7O A;  3O5Z A;  2KEA A;  4A63 B;  2SRC A;  1V1C A;  3GBQ A;  3NHN A;  2FPD A;  4LE9 A;  1AD5 A;  1BU1 A;  1KSW A;  2ABL A;  1CSK A;  2EQI A;  1OOT A;  4J9E A;  3VS7 A;  1WXU A;  3RNJ A;  1B3Q A;  1NLP C;  1H92 A;  4J9D A;  2EYY A;  2JT4 A;  2J6F A;  2CSI A;  5IHI A;  1ZUK A;  1GFD A;  2YT6 A;  1NEB A;  3M0T A;  2YDL A;  1Y57 A;  2EKH A;  1W1F A;  2DF6 A;  2EVR A;  2K3B A;  1YN8 A;  4F16 A;  2KXD A;  2YUN A;  3I5R A;  1RLQ C;  1ZUU A;  1X6G A;  1NLO C;  1QCF A;  4F14 A;  1J3T A;  1UUE A;  2F2X A;  4OMQ A;  2XMF A;  4QT7 A;  1TG0 A;  1NYG A;  3UAT A;  2L0A A;  1RLP C;  4Y92 A;  2DBM A;  2ESW A;  2NWM A;  2A08 A;  2DE0 X;  1GBR A;  4DEX A;  2B86 A;  5L23 A;  2HSP A;  2RQW A;  1GCQ C;  2M51 A;  2KYM A;  1I07 A;  1QWE A;  1JXO A;  1VYT A;  1PRM C;  2EYZ A;  1UE9 A;  2ROT A;  1WDX A;  1ABO A;  1UHC A;  1M3A A;  1I0C A;  2ECZ A;  5GJW B;  1X43 A;  2AKK A;  2D8J A;  3SEM A;  1K4U S;  3A98 A;  1YCS B;  1SSH A;  2LZ6 B;  2YSQ A;  4WCI A;  2D0N A;  1TUC A;  2FPE A;  4D8K A;  2L2P A;  1X69 A;  1M3B A;  2DLP A;  1FYN A;  1JU5 C;  1T0H A;  3TSZ A;  1S1N A;  1VYU A;  5FWB A;  4CC7 A;  5HCK A;  3H41 A;  1I1J A;  4CC3 A;  4HVW A;  2DA9 A;  2CSQ A;  2F2V A;  2CDT A;  2RMO A;  2JS0 A;  3M0Q A;  3VS0 A;  1U5S A;  1AWX A;  1BBZ A;  1T3S A;  1PHT A;  2K2M A;  2MOX A;  1T3L A;  2JMA A;  2K9G A;  3REB B;  4IIM A;  4DEY A;  1K0S A;  1UGV A;  1PNJ A;  4FSS A;  2OJ2 A;  2GTO A;  2EYW A;  2RQT A;  4HXJ A;  5FWC A;  1OPK A;  3EGU A;  3QWX X;  4JPB W;  2CH4 A;  1XOV A;  3PE0 A;  1VA7 A;  2LMJ A;  1U3O A;  2FO0 A;  3EG2 A;  4J9I A;  1BK2 A;  2YUO A;  2K79 A;  2GTJ A;  2JXB A;  2CT4 A;  2L3S A;  1RI9 A;  4AG2 C;  1E6G A;  3VRY A;  2O9V A;  2VWF A;  2AZS A;  1M3C A;  2LJ3 A;  4JJC A;  3I35 A;  2JM8 A;  4LUE A;  2EYX A;  3NGP A;  3UF4 A;  2JM9 A;  4OML A;  1WFW A;  2C0I A;  2F2W A;  1AZE A;  1UG1 A;  1N5Z A;  4OMP A;  1JXM A;  1KFZ A;  4JZ4 A;  1MUZ A;  3UA7 A;  2KRM A;  4AFU C;  2LJ0 A;  4LUD A;  1WA7 A;  2KT1 A;  2DL7 A;  1GFC A;  2P4R A;  2KXC A;  2LQN A;  3EG1 A;  1SEM A;  4Z8A A;  4EIK A;  4IIO A;  1YWP A;  1KJW A;  1Z9Z A;  1UFF A;  2RQV A;  4OMM A;  2RQR A;  2L3P A;  1GRI A;  2BZ8 A;  3QWY A;  4JJB A;  5ECA A;  2FRW A;  1T0J A;  1AWJ A;  1RUW A;  1X6B A;  3H0I A;  1AVZ C;  1ZX6 A;  3FJ5 A;  1H3H A;  2GQI A;  2J6O A;  4AFS C;  1PRL C;  4ZNX A;  1W70 A;  3CQT A;  5IXB A;  3VS1 A;  2JMC A;  3VS6 A;  1Z9Q A;  1UDL A;  2A37 A;  1NEG A;  2RQU A;  4AFQ C;  1GBQ A;  2KR3 A;  1X27 A;  2DBK A;  4J9H A;  1SHG A;  1WI7 A;  3M0S A;  1TUD A;  1BB9 A;  4ORZ A;  1PWT A;  2KNB B;  4R0K A;  2FRY A;  2C0T A;  2J7I A;  2NUZ A;  1K9A A;  1AZG B;  2FG0 A;  2MCN A;  2J6K A;  4J9F A;  3M0P A;  2KGT A;  1NYF A;  4RTV A;  2X3W D;  2GNC A;  2CUB A;  2SEM A;  4E6R A;  2K6D A;  1SHF A;  3PVQ A;  5I11 A;  1K1Z A;  3H0H A;  2JW4 A;  1M27 C;  2O2O A;  3THK A;  1SRL A;  1NM7 A;  1MV3 A;  2OAW A;  2D8H A;  2DL3 A;  2KT8 A;  2VVK A;  2JTE A;  1X2K A;  3M0R A;  4JZ3 A;  4AG1 C;  4HCK A;  3EG0 A;  4RTX A;  3EG3 A;  2V1R A;  2J06 A;  4RTU A;  2DJQ A;  4Z89 A;  4OMN A;  1ZLM A;  2EGA A;  2E5K A;  4OMO A;  2AKL A;  2W0Z A;  1UJY A;  2KBT A;  1YP5 A;  2DM1 A;  1WLP B;  1WX6 A;  3VS4 A;  4RTT A;  2PNI A;  5EC7 A;  1ABQ A;  3NPF A;  1LCK A;  1CKB A;  2C0O A;  2KE9 A;  3TSW A;  2LNH B;  2CT3 A;  3IQL A;  1OV3 A;  3VS2 A;  1AWO A;  1X2Q A;  1UTI A;  1PKS A;  1ZUY A;  1IO6 A;  2VKN A;  1ARK A;  2EBP A;  3SHW A;  1YNZ A;  2EGE A;  5I22 A;  2LX7 A;  1GCP A;  2EGC A;  2CRE A;  3M0U A;  4J9B A;  3U23 A;  2DNU A;  3ZL7 C;  2O9S A;  3EHQ A;  2QDL A;  4F17 A;  1AEY A;  1JEG A;  1U06 A;  1NG2 A;  2OI3 A;  2DL8 A;  2DL5 A;  2ROL A;  1QKW A;  2LCS A;  2D1X A;  5IHK A;  4AFZ C;  2JS2 A;  4X1V A;  3NMZ C;  2HCK A;  4HVU A;  1MV0 B;  4ESR A;  3PVL A;  1QKX A;  2DL4 A;  1KIK A;  3TVT A;  2PZ1 A;  3LH5 A;  1G83 A;  1G2B A;  1AWW A;  2K7A A;  1W6X A;  1HJD A;  2RN8 A;  3REA B;  2CUD A;  2A36 A;  2DMO A;  1PKT A;  3VRZ A;  2CH4 W;  3ULR B;  1CKA A;  2BZX A;  1ZBJ A;  2DVJ A;  4HVV A;  2FPF A;  3JV3 A;  4D8D A;  2DRK A;  2KYB A;  2L3Q A;  1EFN A;  4RTW A;  4GLM A;  2V1Q A;  2RNA A;  3H0F A;  2M0Y A;  3I5S A;  1WXB A;  1OEB A;  4M4Z A;  2LJ1 A;  5FW9 A;  1WXT A;  2ED1 A;  5IH2 A;  2AZV A;  4RTY A;  2A28 A;  1K0X A;  2RF0 A;  2GGR A;  2DRM A;  1JQQ A;  2J05 A;  4CC4 B;  3EHR A;  2AK5 A;  2FEI A;  4Z88 A;  4J9C A;  2DX1 A;  2O88 A;  2ED0 A;  2IIM A;  4RTZ A;  2HEQ A;  4CC2 A;  2ENM A;  1JO8 A;  4LN2 A;  2LP5 A;  1AOJ A;  2MIO A;  4J9G A;  2RPN A;  1VYV A;  1HD3 A;  2KRO A;  2LQW A;  2H8H A;  2YUQ A;  2PTK A;  2YUP A;  2KRN A;  2EPD A;  3UA6 A;  2EW3 A;  4RUG A;  2DIL A;  3I9Q A;  3KFV A;  1M8M A;  4K11 A;  1SRM A;  2G6F X;  1Y0M A;  3R6N A;  1GCQ A;  1HSQ A;  3C0C A;  4JJD A;  1YWO A;  1B07 A;  1H8K A;  5IHN A;  2HBW A;  2BTT A;  2BZY A;  2GBQ A;  4LNP A;  2O31 A;  1K76 A;  1QLY A;  1ZSG A;  2X3X D;  1SPK A;  5GJV B;  1GL5 A;  1E6H A;  1WIE A;  4KRT A;  1UHF A;  1OPL A;  1UJ0 A;  4GBQ A;  2DYB A;  1FMK A;  1UEC A;  2I0N A;  3RBB B;  2W10 A;  2HDA A;  3VS5 A; 
#chains in the Genus database with same CATH topology
 1KQ1 A;  4E7H A;  8AT1 B;  4DBQ A;  5GAM g;  1QWF A;  4XTY A;  5FRO A;  3BY7 A;  2KRS A;  4RCC A;  2GFA A;  2SRC A;  1V1C A;  2E3I A;  4FU6 A;  3GLX A;  3NHN A;  2Y4Y A;  4LE9 A;  1AD5 A;  4B6M A;  6AT1 B;  4C8Q C;  2COZ A;  2EJ9 A;  1B3Q A;  4M77 C;  5D6Y A;  2D6F A;  5IHI A;  1ZUK A;  3SWN A;  1LPL A;  3M0T A;  2EKH A;  4J5Y A;  2KQW A;  3CCJ Q;  4JDS A;  1YN8 A;  5KYW B;  3I5R A;  3A8H B;  1NJI C;  2EQM A;  4M7A F;  1IGU A;  2DD4 A;  4PLL A;  5GAN e;  2ZPE B;  2F2X A;  2M1H A;  4QT7 A;  1VQK T;  1NPR A;  1TG0 A;  5CVI A;  2CYZ B;  1H64 1;  2M9U A;  5I2M A;  1RLP C;  2EAY A;  2DBM A;  5LJ3 g;  3SWN C;  1Q81 C;  1G3Y A;  2BKD N;  4DEX A;  2B86 A;  2HSP A;  1EX4 A;  4HCZ A;  1I07 A;  4C0G A;  1JXO A;  2XIC A;  1VYT A;  1VQ5 A;  2RB6 A;  3UT1 A;  1RAE B;  2GCX A;  3E1S A;  4AMC A;  2X35 A;  4OP0 A;  3OBY A;  1Y7X A;  1YJN T;  1YIJ T;  1YJW Q;  3KUF A;  1VQK Q;  4L5G A;  2D0N A;  3I56 T;  3CC4 Q;  4ZGJ B;  3CCE T;  1JJ2 S;  5KYY B;  1FYN A;  3CBP A;  3X24 B;  1P92 A;  2RHX A;  2GFU A;  5FWB A;  3DB4 A;  3OYY A;  3CME T;  2XHC A;  2L5Q A;  1I1J A;  3OYF A;  4CC3 A;  4PJO G;  1W2B P;  4M7D E;  4FYW B;  2RMO A;  4M7A C;  2K2M A;  2MOX A;  2JMA A;  2K9G A;  1K0S A;  4IIM A;  2WSF E;  3CCV Q;  5LJ3 j;  3CCR Q;  2A3L A;  2YRC A;  2RQT A;  4FM4 B;  5FWC A;  2O4X A;  1OPK A;  3FB9 A;  4JPB W;  2HKN A;  3QWX X;  1U8R A;  2CH4 A;  2EWN A;  2OAU A;  1VA7 A;  2R5M A;  2FO0 A;  3VYH B;  4ZGD B;  2GTJ A;  4FW2 A;  5GAO n;  3OYD A;  1RI9 A;  1S72 A;  5CQX A;  3LWH A;  2WSE E;  4JJC A;  2DEU A;  1JJ2 P;  4LUE A;  1RAG B;  2E1H A;  4OML A;  2C0I A;  1I8F A;  4OMP A;  3SWN B;  3CXC A;  3J7A F;  4JZ4 A;  2XKO C;  3HFO A;  2X4W A;  3QSU A;  4LUD A;  1WA7 A;  2E6Z A;  3OYA A;  2YWW A;  4PJM A;  2HL5 C;  1VQ9 Q;  2RH2 A;  4C8Q G;  1KJW A;  3FEO A;  4HT8 A;  3JCM X;  2RI3 A;  1GRI A;  3AT1 B;  2OTL T;  3JSC A;  3CME Q;  3HFN A;  1VQ6 T;  1XTD A;  5FLX E;  3TCJ A;  3G71 Q;  2L3R A;  1IGQ A;  1ZX6 A;  5KE2 A;  1H3H A;  2J6O A;  1SKU B;  2MMP A;  4ZNX A;  4EMK C;  3PIP A;  3I56 Q;  3A8G B;  4ZN3 A;  3VS1 A;  1Z9Q A;  5HK0 A;  2YLB A;  2LNV A;  3HKS A;  1GBQ A;  4C92 E;  1SHG A;  4KT0 E;  3OYL A;  1BB9 A;  3JCM d;  1MMN A;  3LLR A;  3QDF A;  1N9R A;  3CCQ Q;  1LNX A;  2EJF A;  2D0Q B;  2RHI A;  3PFS A;  4XK8 E;  1OU8 A;  8ATC B;  3M0P A;  4RTV A;  3V8K A;  2X3W D;  2GNC A;  2OTL A;  4TVR A;  2SEM A;  2K6D A;  3GNG A;  5GAO p;  3THK A;  1XNI A;  1RAC B;  1WHL A;  1BYM A;  3MEV A;  1MV3 A;  2D8H A;  4OMF B;  7AT1 B;  2QTV A;  5KYU B;  2BE7 D;  1ZSZ B;  3RMS A;  4JZ3 A;  1IHV A;  1QMC A;  1BIB A;  5J26 A;  3C94 A;  4N0A C;  3V7C A;  1KK7 A;  2AKL A;  1WLP B;  2P0K A;  5J3B A;  1OYX A;  1YIT Q;  4WTO B;  5GMK j;  3EFO B;  1ZSZ A;  5GAN 4;  5KCO A;  2C0O A;  2ZPF B;  2CT3 A;  2E5Q A;  3EH1 A;  4PNO A;  1UTI A;  1HYO A;  1PKS A;  2F69 A;  4C0D C;  3SHW A;  3EG9 B;  1ZQ1 A;  3EAE A;  4A54 A;  4JRP A;  2LX7 A;  1GCP A;  2EGC A;  4J9B A;  3U23 A;  2FL7 A;  4KH1 B;  1N8R U;  4JRI A;  4FYV B;  5C6S A;  3M56 A;  5GMK h;  3J81 E;  2K57 A;  3CC2 T;  1NG2 A;  2GQV A;  2XDB A;  1VQL Q;  5GAN 5;  4PKC C;  2ROL A;  1QKW A;  3FDR A;  5KYX B;  5IHK A;  1EIF A;  4N4I A;  3HSB A;  2HL3 A;  5LJ3 e;  4IUQ A;  1VQ4 A;  5GAO r;  4C92 F;  1Q86 C;  1MV0 B;  4ZGE B;  3KXT A;  4ESR A;  3HPW A;  3TVT A;  5FRM A;  2RO0 A;  3DLM A;  4NL2 A;  4E7Z A;  2K7A A;  2RJD A;  3F70 A;  1HJD A;  1D3B A;  4M7A G;  3M54 A;  1W2B A;  2CUD A;  2CZ7 B;  3FLG A;  3HP9 A;  3DB3 A;  3AHU A;  2DMO A;  1PKT A;  4QQD A;  1JB0 E;  2CH4 W;  1D0X A;  3ULR B;  4M7D G;  2DAQ A;  1ZBJ A;  2VUB A;  5GAM j;  2DK3 A;  1M1K R;  3JV3 A;  2DRK A;  2KYB A;  1Q7Y C;  4BI8 B;  1M90 C;  2PVO B;  1EFN A;  5LJ5 d;  4RTW A;  2V1Q A;  4WF2 A;  2QXF A;  3ZEH A;  2LJ1 A;  4M78 C;  1WXT A;  2ED1 A;  4OGE A;  1VQ8 T;  3TRE A;  1VQ7 Q;  5GAN 7;  1ZA1 B;  2AK5 A;  4J8O A;  1YIJ A;  3OA6 A;  2IIM A;  2MYS A;  1WJR A;  2RD1 A;  1MNE A;  2OTJ A;  1JO8 A;  2KVQ G;  2LP5 A;  2RM4 A;  2KRO A;  2YUQ A;  4M78 G;  4LDW A;  2YUP A;  3UWN A;  2QGG A;  2EPD A;  1VQN Q;  3KFV A;  3QZ9 B;  4K11 A;  5DY9 A;  1GCQ A;  2HSE B;  2YXY A;  5D6X A;  2PUO B;  3E9F A;  5GAN 6;  5LJ5 e;  4M75 E;  3CCE A;  1H8K A;  5LJ5 h;  1TTH B;  2F5K A;  2BZY A;  4UC4 A;  2F5T X;  3EGX B;  4IUU A;  1QVG S;  1SPK A;  3DLL A;  1UHF A;  1IB8 A;  5GMK m;  4FL6 A;  3OYB A;  3OYC A;  3SFM A;  2B8A A;  3BW1 A;  3CC7 A;  2W10 A;  2LRQ A;  2HDA A;  3CD6 Q;  1I5L A;  1M30 A;  4EPC A;  1QP2 A;  3G6E A;  1Y71 A;  2V26 A;  4F7U E;  4A63 B;  1W2B S;  4BAC A;  1AT1 B;  2FPD A;  3QJY A;  4R56 A;  5GAM e;  3TU4 K;  3QYG B;  1CSK A;  2DZC A;  5KYU A;  2D9T A;  3RNJ A;  1AHJ B;  2FYK A;  3FJP A;  1XQH A;  4M78 A;  2K2V A;  2EYY A;  1WGS A;  2JT4 A;  1WHG A;  2J6F A;  4C0F A;  2X9H A;  5LJ3 f;  5DLO A;  1W1F A;  3CCM A;  4PJN A;  2MWO A;  2K3B A;  4JS4 A;  2KXD A;  1DJ7 B;  2LCC A;  3CMA T;  1X6G A;  3BDU A;  1QCF A;  2LT1 A;  4OMQ A;  2XMF A;  4PJO C;  2DIG A;  2RK2 A;  4M7D B;  3CCU T;  4QW2 A;  3UAT A;  2AHJ B;  2XDP A;  3EGD B;  4C5E A;  2ESW A;  2DE0 X;  3V7S A;  3H9N A;  4M7A E;  2DXB A;  5L23 A;  2RQW A;  3LX7 A;  1VUB A;  3GIB A;  4OB0 B;  2CP7 A;  1PRM C;  2EYZ A;  4QVD A;  1VQM Q;  1UE9 A;  3MPU B;  1WDX A;  2NLU A;  1ABO A;  2IVW A;  2I2L A;  1M3A A;  2ECZ A;  1M90 R;  1WZO A;  1K73 C;  1K4U S;  2HD0 A;  4M77 A;  4QQG A;  2RJF A;  3QII A;  3DKM A;  3CC2 A;  1YCS B;  1SSH A;  2LZ6 B;  4A4G A;  2YSQ A;  4JRK A;  2X4Y A;  3RKY A;  2ZPB B;  4F7U A;  2DO3 A;  2YLC A;  1TUC A;  1RAH B;  4E7L A;  1X69 A;  1M3B A;  2DLP A;  2LVM A;  4QQ6 A;  4FYX B;  2V8I A;  2LC4 A;  2HBP A;  1S1N A;  3ME9 A;  1VYU A;  2CP6 A;  1XJW B;  4NL3 A;  4HVW A;  4MML A;  3CCU Q;  3MEU A;  2L89 A;  3VU3 C;  1V76 A;  4M7D D;  4M77 E;  1AWX A;  2EQK A;  5A0D A;  4OVA A;  3REB B;  4DEY A;  4FSS A;  2OJ2 A;  2GTO A;  2MK5 A;  3QDR B;  3OYH A;  2EYW A;  3EGU A;  1X01 A;  3OSV A;  3PE0 A;  1YJ9 Q;  3CCJ A;  4IUT A;  2LMJ A;  3EG2 A;  4J9I A;  1SF9 A;  4BE2 A;  2FZG B;  3GP8 A;  4EMG A;  1QVG P;  4AG2 C;  3WXM B;  1D3B B;  3VRY A;  4LXC A;  3OW2 A;  2LJ3 A;  5GAO q;  2VAS A;  4ATO A;  2CS7 A;  2X4X A;  2EYX A;  3NGP A;  3CPW S;  5HK3 A;  2JM9 A;  4DOV A;  3FC3 A;  4KGZ B;  1FMW A;  1YIT T;  1UG1 A;  1K8A U;  1JXM A;  4FSX A;  3UA7 A;  1VIF A;  2KRM A;  4AFU C;  2LJ0 A;  4BDY A;  4M75 G;  2KT1 A;  2DL7 A;  3ER0 A;  3A8O B;  5KYW A;  1B7T A;  4IIO A;  1Z9Z A;  3ASK A;  4M78 E;  3S3M A;  1IRE B;  4DOW A;  5A2Q E;  4E7K A;  4BDZ A;  5ECA A;  2FRW A;  1YJW A;  3GNF B;  1T0J A;  1AWJ A;  1RUW A;  2AT1 B;  3FJ5 A;  2EQJ A;  4AFS C;  1Q82 R;  3GPL A;  3OYK A;  1TSF A;  1RL2 A;  5KYN A;  1RAB B;  4BD3 A;  5IXB A;  1Y96 B;  5EG2 A;  1N27 A;  2KR3 A;  1X27 A;  5IAY A;  1C0M A;  1S72 T;  3S3N A;  3V8J A;  4ORZ A;  4C8Q E;  1BI3 A;  2FRY A;  1MND A;  2C0T A;  2ZZD A;  1JRI A;  1VOM A;  2J6K A;  4IUV A;  4J9F A;  3OSS C;  2KGT A;  2YHT A;  3PMI A;  2AIR B;  4E6R A;  1SHF A;  3PVQ A;  1K1Z A;  1MHN A;  1WQW A;  2JW4 A;  2OX7 A;  2QQB A;  2XDD A;  1SRL A;  4C8Q A;  4M78 D;  2ZAE A;  4PJJ A;  1V29 B;  4RCB A;  3L2V A;  2DL3 A;  2VVK A;  1IHW A;  4AG1 C;  4HCK A;  3EG0 A;  1N8R C;  4DBR A;  4RTX A;  3EG3 A;  4HT9 A;  1VQP T;  3CEY A;  4Z89 A;  1ZLM A;  2EGA A;  2E5K A;  1PG5 B;  2KBT A;  4M7D C;  1K8A C;  5CKH A;  5I21 A;  5EC7 A;  4J6Y A;  1KQS S;  1K8A R;  1YI2 T;  1VQN T;  3OYM A;  4PFO A;  1RAI B;  2KE9 A;  4M77 G;  4ME7 A;  1VQ9 A;  2LNH B;  3M55 A;  3VS2 A;  4C0Z A;  1Q81 U;  3HRT A;  3JCM P;  2QQ9 A;  2ZCF B;  3Q1J A;  3OYJ A;  2CRE A;  4OB1 B;  4BE0 A;  2DL5 A;  4PJO E;  2KSS A;  3QHS A;  4J6X A;  2D1X A;  3EH2 A;  3OBW A;  1OU9 A;  2M0O A;  3NMZ C;  1TU0 B;  2DEQ A;  4PK4 A;  1M90 U;  1WJS A;  3MJX A;  4AT1 B;  2R58 A;  5IT9 E;  1YI2 Q;  1QVP A;  1UB4 A;  5KH6 A;  3X28 B;  3OS1 A;  2DL4 A;  3HHT B;  4HA8 A;  3LH5 A;  1G83 A;  1G2B A;  3I55 A;  2WAC A;  2KMT A;  1VQO Q;  2JN0 A;  2DTO A;  1IZ6 A;  4A53 A;  4IUR A;  1O9S A;  4CRI A;  5LJ3 h;  5CAI A;  4XTW A;  2QA4 A;  3VRZ A;  2M16 A;  3HL8 A;  4R55 A;  2E4H A;  2QAS A;  4XQ3 A;  3P8H A;  1M2V B;  2M02 A;  1PD0 A;  1VQ8 Q;  5FRN A;  5IH2 A;  4PFP A;  4RTY A;  2A28 A;  1QVF A;  2NUT A;  1K9M C;  2DRM A;  4CC4 B;  1O75 A;  1VIE A;  3OMG A;  1UGQ B;  2PVG B;  2DX1 A;  3QG1 A;  5GAN j;  1HXD A;  5D7U A;  3CBM A;  4LN2 A;  3MHX A;  1Q86 R;  1AOJ A;  2O01 E;  2FZC B;  4OGC A;  5GAN f;  1VYV A;  2XK0 A;  4V2S A;  2LQW A;  2KRN A;  2GF7 A;  4KGV B;  2K3X A;  4RUG A;  3URG A;  5LJ5 g;  2MPX C;  2QEX A;  3UDC A;  3FRN A;  4DQ2 A;  1Y0M A;  3OS2 A;  4JJD A;  4C0D B;  2DIQ A;  2KDS A;  3LGF A;  5L8R E;  5GAN d;  1G8X A;  1B07 A;  3QO3 A;  5IHN A;  4O6J A;  2BTT A;  4A4F A;  4LNP A;  2E12 A;  1Y96 A;  2O31 A;  1VQ6 Q;  4HCB A;  3JB9 G;  3SD4 A;  1I81 A;  5DM7 R;  1Q7Y R;  2DPP B;  1UJ0 A;  2VGM A;  4KH0 B;  1YJN Q;  4GBQ A;  1FMK A;  2QI2 A;  4IUP A;  4NOY A;  3M4G A;  5HKC A;  1UEC A;  2I0N A;  3RBB B;  1KD1 R;  4DBH A;  1UGR B;  4BI3 A;  1WYX A;  4YTL A;  3PMT A;  3VS3 A;  3L2U A;  3OS0 A;  2BUD A;  1Y07 A;  1I5O B;  2LTO A;  5C0M A;  1A0N B;  2CGH A;  2KEA A;  3BDL A;  1VQP Q;  2Y90 A;  1VQ5 Q;  3OMC A;  2ABL A;  1OOT A;  1WXU A;  1LVK A;  4VUB A;  1H92 A;  4J9D A;  3QUI A;  2CSI A;  1NEB A;  2YDL A;  4KUL A;  1Y57 A;  3CXC P;  4KUI A;  1VQK A;  4II1 A;  1D09 B;  3OW2 P;  1PC0 A;  2EVR A;  3JCM W;  1KG1 A;  3CC4 A;  1WHH A;  1VQO T;  4EMH A;  4F16 A;  2VB6 A;  2YUN A;  1ZUU A;  1M1G A;  3QBY A;  3CCV T;  1NLO C;  3EGX A;  4LDY A;  2KY9 A;  3PGG A;  1OZ3 A;  3JCM h;  2L0A A;  1NBE B;  2NWM A;  5GAN 8;  4ZN1 A;  4M7A D;  3GF5 A;  1KQS P;  1VQN A;  2K5I A;  2NUP B;  3VYG A;  3CCR A;  4PFZ A;  2QK0 A;  2JTF A;  2HMA A;  3G4S T;  1UHC A;  2PQW A;  5GJW B;  4HKE A;  3RES A;  2E65 A;  2QDY B;  2FVU A;  4RG8 A;  3A8M B;  2ZGW A;  3CMA Q;  5GMK l;  4J83 A;  1OX8 A;  3V7R A;  1W4S A;  3BE3 A;  3FIF A;  4PJO B;  3OW2 S;  4WCI A;  1BIA A;  1VQM T;  2G3R A;  1GXI E;  2L2P A;  3MKD A;  4M75 B;  1T0H A;  2HZY A;  1RI0 A;  1IRX A;  2QQR A;  1H3Z A;  2E3H A;  3CCQ T;  5HCK A;  3H41 A;  2DTI A;  3VV0 A;  3P8D A;  2DA9 A;  3OY9 A;  1ZBX A;  2CSQ A;  2F2V A;  2CDT A;  2JS0 A;  3M0Q A;  3VS0 A;  1U5S A;  1BBZ A;  4J6W A;  1PHT A;  1BKB A;  3NFC A;  1YHQ Q;  1T3L A;  5GAO m;  2RJC A;  1UGV A;  5FU7 B;  1N9S A;  1SSF A;  3CD6 T;  4BB7 A;  3CCM Q;  3G71 T;  3G71 A;  1XOV A;  2JOY A;  3RR6 A;  1U3O A;  2YRD A;  1YHQ T;  1M1K C;  2ATC B;  5CIU A;  2K79 A;  3I56 A;  4E7S A;  2RHZ A;  2JXB A;  2CT4 A;  2HQH A;  1KD1 C;  2L3S A;  1K73 U;  1TH7 A;  1E6G A;  2HQE A;  2KI7 A;  4FCY A;  1U1S A;  2O9V A;  2DYI A;  2AZS A;  4Q5W A;  3V8L A;  5KE3 A;  3CCS Q;  2KK4 A;  3VKI A;  3CCQ A;  3NTI A;  1QVF P;  1YCY A;  1AZE A;  1KFZ A;  1M2O A;  3CPF A;  4LDU A;  1VQM A;  2QEX T;  1GFC A;  2P4R A;  2KXC A;  1SEM A;  2MI6 A;  3D7S B;  1UFF A;  4OMM A;  4ANJ A;  2L3P A;  2OTJ T;  2BZ8 A;  3L2Z A;  4BI4 A;  1R8O B;  3CC2 Q;  5GAM d;  4Y91 A;  3H0I A;  4F04 B;  5J39 A;  3EFR A;  5KCH A;  1W70 A;  5A0G A;  1WHJ A;  1KC8 R;  4EMK B;  2BIV A;  2EYQ A;  2JMC A;  4M78 B;  3VS6 A;  2X4J A;  1KC8 C;  1UDL A;  4JLG A;  1M1F A;  1YIT A;  2E41 A;  4A4K A;  3OYI A;  2RQU A;  3RKX A;  3JCM J;  1D0Z A;  4J9H A;  1WI7 A;  4LD9 K;  3M0S A;  1Q7Y U;  1TUD A;  4C92 D;  2DXC A;  1PWT A;  1MGQ A;  2KNB B;  4X9C A;  2CZ1 B;  2RA2 A;  2VYT A;  4JUV A;  3G4S A;  4R0K A;  3QPH A;  2DER A;  2NUZ A;  1D1A A;  4GLK A;  4J7I A;  9ATC B;  2PUK B;  1QW1 A;  1NYF A;  5CQY A;  1EZZ B;  4E7I A;  2QAZ A;  5FU6 B;  4KBM B;  2CUB A;  4A4E A;  4OB2 B;  4XAX B;  5I11 A;  4M7D A;  1TXQ A;  4MZT A;  4ZTJ A;  4FIB A;  1BCM A;  2OAW A;  4PL6 A;  1VQ4 Q;  2KT8 A;  4C92 A;  3M58 A;  3R6O A;  3P8B B;  4B9W A;  3SDZ A;  5LJ5 j;  1BCO A;  4JLI A;  1D0Y A;  1Q82 C;  2J06 A;  4RTU A;  1JJ2 A;  1Q82 U;  3E2U A;  2VV5 A;  3EG9 A;  2DJQ A;  4OMN A;  5CKD A;  2FHD A;  2W0Z A;  1UJY A;  1OI1 A;  1QP3 A;  1WX6 A;  3JB9 D;  3VS4 A;  2HAX A;  4ELY C;  2HKQ B;  3O8V A;  4RTT A;  2PNI A;  4C5H A;  5IN1 A;  3NPF A;  2P0P A;  2XD0 A;  1CKB A;  4M78 F;  2EKO A;  1PM3 A;  1B34 A;  1KHI A;  3IQL A;  1OV3 A;  3L1A A;  4RMO A;  1AWO A;  1ZUY A;  1IO6 A;  1TUG B;  2E70 A;  2XU8 A;  1M8V A;  5KYY A;  2EGE A;  3QKJ A;  5I22 A;  4P5N A;  5HY6 A;  2DNU A;  3RKW A;  5GAO l;  3ZL7 C;  2O9S A;  5GMK e;  3EHQ A;  4MZM A;  3JCM V;  2QDL A;  1K73 R;  1AEY A;  2XG8 D;  2OTL Q;  3CCL A;  1NE8 A;  2NUP A;  2DL8 A;  1G3S A;  4XU2 A;  1YIJ Q;  1YJW T;  2Y4X A;  2JS2 A;  3LYI A;  2E64 A;  1VQ4 T;  1N8R R;  4L59 A;  3C4S A;  4HVU A;  2FB7 A;  2YRV A;  1G5V A;  2O4X B;  1QKX A;  2IG0 A;  4N4G A;  2PZ1 A;  2JNG A;  1BI0 A;  2QYZ A;  1WHK A;  3CCM T;  1W6X A;  3KBG A;  4M7A B;  1OX9 A;  3CCE Q;  1BI1 A;  2LDM A;  4DBF A;  2RN8 A;  3REA B;  2DD5 A;  4LDV A;  4OF1 A;  2BZX A;  4XTV A;  3M5A A;  4HVV A;  4PLI A;  3JCM g;  4E7J A;  3RDV A;  4BY6 B;  3E9G A;  3H0F A;  4M4Z A;  5M9O A;  2C06 A;  5GAM h;  4M75 D;  5I2S A;  2RF0 A;  1JQQ A;  3L2R A;  1VQL A;  3EHR A;  4MDX A;  2FEI A;  1RAA B;  2DFU A;  2DXU A;  3JCM e;  4J9C A;  1FMV A;  1OZ2 A;  3L2Q A;  3PIO A;  2JUF A;  2MIO A;  1ZHI A;  2A7Y A;  4ELZ C;  3OYE A;  2PTK A;  1LJO A;  3MCA B;  5CCA A;  3UA6 A;  2EW3 A;  2BE9 B;  1M8M A;  2G6F X;  2MF2 A;  3UPU A;  3NTK A;  1M9S A;  1HSQ A;  4C92 C;  1YJ9 T;  3CC4 T;  2LCL A;  3JCM f;  2HBW A;  2XID A;  1FWZ A;  3CCJ T;  3HRS A;  2GBQ A;  1X6O A;  3MEA A;  2QGF B;  1QLY A;  4N4H A;  3QZ5 B;  2X3X D;  1QCN A;  5GJV B;  3CCS T;  1JBM A;  1WIE A;  1OPL A;  1RAF B;  3M9Q A;  4BUG A;  2DYB A;  1VQ9 T;  1LOJ A;  2ZPH B;  3A5Z B;  4C92 G;  1TOV A;  2L8D A;  2F1L A;  3EFS A;  1YI2 A;  4C8Q D;  1K9M R;  4M77 D;  3BFM A;  1Q81 R;  5IXF A;  2JJ9 A;  2VGN A;  4C5G A;  3MET A;  5GAN g;  3PTA A;  1E7O A;  3O5Z A;  3E19 A;  1ACM B;  3GBQ A;  3I55 Q;  1U1T A;  1BU1 A;  1M4Z A;  1KSW A;  2OTJ Q;  1IXD A;  2EQI A;  4J9E A;  3VS7 A;  4C5I A;  4XTZ A;  1NLP C;  1PCX A;  1I4K 1;  2DXT A;  3CCV A;  1GFD A;  2YT6 A;  4F7U G;  1X75 C;  2DF6 A;  4F7U F;  3MP8 A;  4Z02 A;  2DKG A;  3J80 E;  1C1A A;  4B9X A;  1RLQ C;  1ZSZ C;  1YFN A;  2MWP A;  1B34 B;  3VJP A;  1S72 Q;  4KGX B;  4F14 A;  1J3T A;  1UUE A;  2VXE A;  3X26 B;  1KQS A;  4XU3 A;  5CO7 A;  3L2W A;  2E6N A;  3L42 A;  2K3Y A;  2XI9 A;  2HQX A;  1KD1 U;  1NYG A;  3CCU A;  3G1J A;  1OQK A;  4Y92 A;  2RI5 A;  3CC7 Q;  2A08 A;  1GBR A;  2CP2 A;  1F1B B;  3CD6 A;  3MP1 A;  4EMK A;  1GCQ C;  4M75 F;  1VQ7 T;  1M5Q 1;  1VQL T;  3SB2 A;  3G6E Q;  2M51 A;  2KYM A;  1WPY A;  1MMA A;  1QWE A;  5LL6 S;  2ROT A;  3RUX A;  3A1P A;  1I0C A;  1X43 A;  2JTM A;  1NJI U;  2AKK A;  3JCM Q;  2D8J A;  3SEM A;  4BE1 A;  2NYS A;  3G7Z A;  3A98 A;  5FU7 C;  3CCL T;  1NZ9 A;  4GY5 A;  1YJN A;  1KHC A;  3CME A;  1Q86 U;  3LW5 E;  4PJL A;  2FPE A;  4D8K A;  3A8L B;  2P4T A;  2RK1 A;  2CZ6 B;  2Z0W A;  1JU5 C;  3G6E T;  3ZFJ A;  3RER A;  3TSZ A;  1K9M U;  4CC7 A;  3ZBD A;  1WJQ A;  2QTX A;  4PJO A;  2MAM A;  2QQA A;  3QYH B;  2EIF A;  3HTR A;  3QJ6 A;  2A0F B;  3S3O A;  4N0A A;  3JCM b;  2IPO B;  1T3S A;  1C6V X;  1PNJ A;  2QA4 T;  4HXJ A;  3MP6 A;  2CP5 A;  2PU9 B;  3JAM E;  2EFI A;  3EFO A;  2H3J A;  3M59 A;  4MDW A;  3TEE A;  4JJN K;  1FXX A;  1BK2 A;  2YUO A;  4IKF A;  4M75 C;  4M7A A;  3MO8 A;  1QCO A;  2VWF A;  4XTU A;  3CPW P;  3OB9 A;  1M3C A;  3I35 A;  2CKK A;  2JM8 A;  4OB3 B;  1D1B A;  4LDX A;  3UF4 A;  2LQK A;  4QKU A;  1WFW A;  2F2W A;  5CR2 A;  1M2V A;  4F7U B;  1N5Z A;  5KYX A;  1MUZ A;  3GOX A;  3VUB A;  2NUT B;  1OUL A;  4M75 A;  3LGL A;  2LQN A;  3EG1 A;  4Z8A A;  4EIK A;  4C92 B;  1YWP A;  2RQV A;  3X20 B;  2RQR A;  3MEW A;  5GAM f;  2K4Y A;  1N6A A;  1TS9 A;  3CMA A;  3QWY A;  2K5L A;  4JJB A;  3C12 A;  3PNW C;  3N5B B;  4FT2 A;  2E10 A;  5D6W A;  1PSE A;  2DTH A;  1X6B A;  1AVZ C;  2DJZ A;  1Q95 G;  2RHU A;  3VUZ A;  1YJ9 A;  2GQI A;  4L6V 5;  1QVF S;  1PRL C;  5GAN h;  1QVG A;  2JZ2 A;  1M1K U;  3CQT A;  4HCC A;  3OYG A;  5CKF A;  3C95 A;  2A37 A;  1NEG A;  4QVZ A;  4AFQ C;  3RIR A;  2DBK A;  5CKE A;  5GAN 3;  2KAF A;  3H6Z A;  3PT9 A;  2COY A;  4LD6 A;  3H8Z A;  4XU0 A;  4MZP A;  3OQ5 A;  3NTH A;  4PJO F;  5LJ5 f;  1YHQ A;  3CXC S;  2J7I A;  5LJ3 d;  1K9A A;  3WVE B;  2COW A;  1AZG B;  2FG0 A;  2MCN A;  4E2F B;  1MMD A;  2R5A A;  3T9N A;  2LT4 A;  1HK9 A;  1PSF A;  3H0H A;  1R77 A;  1M27 C;  2X51 A;  2O2O A;  1NM7 A;  4EDU A;  3M53 A;  2JTE A;  1X2K A;  3M0R A;  1G3W A;  4FT4 A;  2P0Q A;  1D1C A;  4X9D A;  3CPW A;  3CCS A;  1VQ7 A;  2V1R A;  1FX7 A;  3WVD B;  5CK9 A;  2EQU A;  2P84 A;  4OMO A;  2CP3 A;  3S6W A;  1YP5 A;  2CP0 A;  2DM1 A;  4C8Q B;  3OS5 A;  1ABQ A;  3CC7 T;  4M77 B;  4Y28 E;  4QVC A;  3LH0 A;  1LCK A;  5CKB A;  3M57 A;  3TSW A;  3HRU A;  1QQJ A;  3I55 T;  1R0B G;  1X2Q A;  2VKN A;  1VQ5 T;  1ARK A;  2EBP A;  1YNZ A;  3M4Y A;  3X25 B;  3M0U A;  3EGD A;  4D6W A;  1VQ8 A;  3JCM c;  4F17 A;  3CCR T;  2WSC E;  4JS5 A;  1JEG A;  1U06 A;  3JB9 F;  2OI3 A;  3JB9 I;  1UEB A;  1BI2 A;  2LCS A;  2H3E B;  4AFZ C;  5A0L A;  4X1V A;  4C8Q F;  4JRQ A;  5AT1 B;  2HCK A;  4RKU E;  1NJI R;  4X34 A;  2RJE A;  2VC8 A;  4ZTF A;  1SG5 A;  1WHM A;  3PVL A;  4KUD K;  1KIK A;  5AYF A;  3G4S Q;  2ZPG B;  2QEX Q;  4E47 A;  1AWW A;  4CI0 C;  2LQ8 A;  2PVD B;  4MMK A;  1WQ7 A;  2K5F A;  2A36 A;  1VQ6 A;  3CBO A;  4PJO D;  2DZ9 A;  1CKA A;  2DVJ A;  5FU6 C;  2V8K A;  4M7D F;  3QXE B;  2FPF A;  1KC8 U;  4D8D A;  3OYN A;  2L3Q A;  2HNI A;  4GLM A;  2RHY A;  2RNA A;  4O5V A;  2M0Y A;  3I5S A;  1WXB A;  1OEB A;  1RAD B;  5FW9 A;  3LWI A;  1G3T A;  3TQ7 P;  2AZV A;  1K0X A;  1PD1 A;  2ZPI B;  1KQ2 A;  5GMK i;  2GGR A;  2J05 A;  1WNL A;  3JB9 J;  1YBY A;  4Z88 A;  3INZ A;  2O88 A;  1ZA2 B;  2ED0 A;  1VQP A;  3RMQ A;  4RTZ A;  2HEQ A;  5DLQ E;  3JB9 H;  4FW1 A;  4DA4 A;  2EJG A;  4CC2 A;  2ENM A;  1UGS B;  4J9G A;  2RPN A;  1HD3 A;  2LX9 A;  2H8H A;  2R57 A;  2RI2 A;  2VXF A;  2DIL A;  3I9Q A;  2FZK B;  1SRM A;  3R6N A;  4BY6 C;  3C0C A;  2QQS A;  1YWO A;  5GAN 2;  1VQO A;  2DVE A;  4RG2 A;  1NPP A;  4J7F A;  2QG9 B;  4A4H A;  1R0C B;  1K76 A;  1ZSG A;  3CCL Q;  2V8J A;  2DET A;  2QA4 Q;  1GL5 A;  1UGP B;  1E6H A;  4KRT A;  4M77 F;  4XU1 A;  4FYY B;  1MMG A;  4XTX A;  1TWB A;  4NS5 A;  3JRZ A;  2JVV A;  2CZ0 B;  3VS5 A; 
#chains in the Genus database with same CATH homology
 1WYX A;  1QWF A;  5IXF A;  3VS3 A;  1M30 A;  2KRS A;  1A0N B;  1E7O A;  3O5Z A;  2KEA A;  4A63 B;  2SRC A;  1V1C A;  3GBQ A;  3NHN A;  2FPD A;  4LE9 A;  1AD5 A;  1BU1 A;  1KSW A;  2ABL A;  1CSK A;  2EQI A;  1OOT A;  4J9E A;  3VS7 A;  1WXU A;  3RNJ A;  1B3Q A;  1NLP C;  1H92 A;  4J9D A;  2EYY A;  2JT4 A;  2J6F A;  2CSI A;  5IHI A;  1ZUK A;  1GFD A;  2YT6 A;  1NEB A;  3M0T A;  2YDL A;  1Y57 A;  2EKH A;  1W1F A;  2DF6 A;  2EVR A;  2K3B A;  1YN8 A;  4F16 A;  2KXD A;  2YUN A;  3I5R A;  1RLQ C;  1ZUU A;  1X6G A;  1NLO C;  1QCF A;  4F14 A;  1J3T A;  1UUE A;  2F2X A;  4OMQ A;  2XMF A;  4QT7 A;  1TG0 A;  1NYG A;  3UAT A;  2L0A A;  1RLP C;  4Y92 A;  2DBM A;  2ESW A;  2NWM A;  2A08 A;  2DE0 X;  1GBR A;  4DEX A;  2B86 A;  5L23 A;  2HSP A;  2RQW A;  1GCQ C;  2M51 A;  2KYM A;  1I07 A;  1QWE A;  1JXO A;  1VYT A;  1PRM C;  2EYZ A;  1UE9 A;  2ROT A;  1WDX A;  1ABO A;  1UHC A;  1M3A A;  1I0C A;  2ECZ A;  5GJW B;  1X43 A;  2AKK A;  2D8J A;  3SEM A;  1K4U S;  3A98 A;  1YCS B;  1SSH A;  2LZ6 B;  2YSQ A;  4WCI A;  2D0N A;  1TUC A;  2FPE A;  4D8K A;  2L2P A;  1X69 A;  1M3B A;  2DLP A;  1FYN A;  1JU5 C;  1T0H A;  3TSZ A;  1S1N A;  1VYU A;  5FWB A;  4CC7 A;  5HCK A;  3H41 A;  1I1J A;  4CC3 A;  4HVW A;  2DA9 A;  2CSQ A;  2F2V A;  2CDT A;  2RMO A;  2JS0 A;  3M0Q A;  3VS0 A;  1U5S A;  1AWX A;  1BBZ A;  1T3S A;  1PHT A;  2K2M A;  2MOX A;  1T3L A;  2JMA A;  2K9G A;  3REB B;  4IIM A;  4DEY A;  1K0S A;  1UGV A;  1PNJ A;  4FSS A;  2OJ2 A;  2GTO A;  2EYW A;  2RQT A;  4HXJ A;  5FWC A;  1OPK A;  3EGU A;  3QWX X;  4JPB W;  2CH4 A;  1XOV A;  3PE0 A;  1VA7 A;  2LMJ A;  1U3O A;  2FO0 A;  3EG2 A;  4J9I A;  1BK2 A;  2YUO A;  2K79 A;  2GTJ A;  2JXB A;  2CT4 A;  2L3S A;  1RI9 A;  4AG2 C;  1E6G A;  3VRY A;  2O9V A;  2VWF A;  2AZS A;  1M3C A;  2LJ3 A;  4JJC A;  3I35 A;  2JM8 A;  4LUE A;  2EYX A;  3NGP A;  3UF4 A;  2JM9 A;  4OML A;  1WFW A;  2C0I A;  2F2W A;  1AZE A;  1UG1 A;  1N5Z A;  4OMP A;  1JXM A;  1KFZ A;  4JZ4 A;  1MUZ A;  3UA7 A;  2KRM A;  4AFU C;  2LJ0 A;  4LUD A;  1WA7 A;  2KT1 A;  2DL7 A;  1GFC A;  2P4R A;  2KXC A;  2LQN A;  3EG1 A;  1SEM A;  4Z8A A;  4EIK A;  4IIO A;  1YWP A;  1KJW A;  1Z9Z A;  1UFF A;  2RQV A;  4OMM A;  2RQR A;  2L3P A;  1GRI A;  2BZ8 A;  3QWY A;  4JJB A;  5ECA A;  2FRW A;  1T0J A;  1AWJ A;  1RUW A;  1X6B A;  3H0I A;  1AVZ C;  1ZX6 A;  3FJ5 A;  1H3H A;  2GQI A;  2J6O A;  4AFS C;  1PRL C;  4ZNX A;  1W70 A;  3CQT A;  5IXB A;  3VS1 A;  2JMC A;  3VS6 A;  1Z9Q A;  1UDL A;  2A37 A;  1NEG A;  2RQU A;  4AFQ C;  1GBQ A;  2KR3 A;  1X27 A;  2DBK A;  4J9H A;  1SHG A;  1WI7 A;  3M0S A;  1TUD A;  1BB9 A;  4ORZ A;  1PWT A;  2KNB B;  4R0K A;  2FRY A;  2C0T A;  2J7I A;  2NUZ A;  1K9A A;  1AZG B;  2FG0 A;  2MCN A;  2J6K A;  4J9F A;  3M0P A;  2KGT A;  1NYF A;  4RTV A;  2X3W D;  2GNC A;  2CUB A;  2SEM A;  4E6R A;  2K6D A;  1SHF A;  3PVQ A;  5I11 A;  1K1Z A;  3H0H A;  2JW4 A;  1M27 C;  2O2O A;  3THK A;  1SRL A;  1NM7 A;  1MV3 A;  2OAW A;  2D8H A;  2DL3 A;  2KT8 A;  2VVK A;  2JTE A;  1X2K A;  3M0R A;  4JZ3 A;  4AG1 C;  4HCK A;  3EG0 A;  4RTX A;  3EG3 A;  2V1R A;  2J06 A;  4RTU A;  2DJQ A;  4Z89 A;  4OMN A;  1ZLM A;  2EGA A;  2E5K A;  4OMO A;  2AKL A;  2W0Z A;  1UJY A;  2KBT A;  1YP5 A;  2DM1 A;  1WLP B;  1WX6 A;  3VS4 A;  4RTT A;  2PNI A;  5EC7 A;  1ABQ A;  3NPF A;  1LCK A;  1CKB A;  2C0O A;  2KE9 A;  3TSW A;  2LNH B;  2CT3 A;  3IQL A;  1OV3 A;  3VS2 A;  1AWO A;  1X2Q A;  1UTI A;  1PKS A;  1ZUY A;  1IO6 A;  2VKN A;  1ARK A;  2EBP A;  3SHW A;  1YNZ A;  2EGE A;  5I22 A;  2LX7 A;  1GCP A;  2EGC A;  2CRE A;  3M0U A;  4J9B A;  3U23 A;  2DNU A;  3ZL7 C;  2O9S A;  3EHQ A;  2QDL A;  4F17 A;  1AEY A;  1JEG A;  1U06 A;  1NG2 A;  2OI3 A;  2DL8 A;  2DL5 A;  2ROL A;  1QKW A;  2LCS A;  2D1X A;  5IHK A;  4AFZ C;  2JS2 A;  4X1V A;  3NMZ C;  2HCK A;  4HVU A;  1MV0 B;  4ESR A;  3PVL A;  1QKX A;  2DL4 A;  1KIK A;  3TVT A;  2PZ1 A;  3LH5 A;  1G83 A;  1G2B A;  1AWW A;  2K7A A;  1W6X A;  1HJD A;  2RN8 A;  3REA B;  2CUD A;  2A36 A;  2DMO A;  1PKT A;  3VRZ A;  2CH4 W;  3ULR B;  1CKA A;  2BZX A;  1ZBJ A;  2DVJ A;  4HVV A;  2FPF A;  3JV3 A;  4D8D A;  2DRK A;  2KYB A;  2L3Q A;  1EFN A;  4RTW A;  4GLM A;  2V1Q A;  2RNA A;  3H0F A;  2M0Y A;  3I5S A;  1WXB A;  1OEB A;  4M4Z A;  2LJ1 A;  5FW9 A;  1WXT A;  2ED1 A;  5IH2 A;  2AZV A;  4RTY A;  2A28 A;  1K0X A;  2RF0 A;  2GGR A;  2DRM A;  1JQQ A;  2J05 A;  4CC4 B;  3EHR A;  2AK5 A;  2FEI A;  4Z88 A;  4J9C A;  2DX1 A;  2O88 A;  2ED0 A;  2IIM A;  4RTZ A;  2HEQ A;  4CC2 A;  2ENM A;  1JO8 A;  4LN2 A;  2LP5 A;  1AOJ A;  2MIO A;  4J9G A;  2RPN A;  1VYV A;  1HD3 A;  2KRO A;  2LQW A;  2H8H A;  2YUQ A;  2PTK A;  2YUP A;  2KRN A;  2EPD A;  3UA6 A;  2EW3 A;  4RUG A;  2DIL A;  3I9Q A;  3KFV A;  1M8M A;  4K11 A;  1SRM A;  2G6F X;  1Y0M A;  3R6N A;  1GCQ A;  1HSQ A;  3C0C A;  4JJD A;  1YWO A;  1B07 A;  1H8K A;  5IHN A;  2HBW A;  2BTT A;  2BZY A;  2GBQ A;  4LNP A;  2O31 A;  1K76 A;  1QLY A;  1ZSG A;  2X3X D;  1SPK A;  5GJV B;  1GL5 A;  1E6H A;  1WIE A;  4KRT A;  1UHF A;  1OPL A;  1UJ0 A;  4GBQ A;  2DYB A;  1FMK A;  1UEC A;  2I0N A;  3RBB B;  2W10 A;  2HDA A;  3VS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...