2KROA

Rdc refined high resolution structure of the third sh3 domain of cd2ap
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kroA00
1B3QA 1ABQA 3VS0A 3EHRA 2KR3A 3M0UA 1X2QA 4CC2A 1ZBJA 1AZGB 3I9QA 2HSPA 1T3SA 1U06A 2DRKA 5EC7A 4A63B 2K3BA 2D8HA 4K11A 4Y92A 1G2BA 4J9BA 1SSHA 1WXUA 2DILA 4M4ZA 4FSSA 1VYVA 1K1ZA 1OPKA 2EQIA 2O9SA 4J9FA 3REAB 2ED1A 2J6KA 1PWTA 3IQLA 1FMKA 3I35A 1H92A 2RF0A 4F14A 5ECAA 4LN2A 5IXBA 2LQNA 1WIEA 2SRCA 1PRMC 2O31A 2W10A 1SHFA 2AKLA 1CSKA 4J9IA 3UA6A 2ENMA 1V1CA 2DYBA 5GJWB 3VRZA 2LP5A 1YWOA 2L2PA 1I0CA 2VKNA 3TSWA 2X3WD 1N5ZA 4R0KA 4J9EA 3CQTA 2BTTA 1CKAA 2O88A 1T3LA 2G6FX 1G83A 1QCFA 2EGAA 2KXCA 3LH5A 2L3QA 1A0NB 1VYTA 1GCQA 2EGCA 1GFDA 2P4RA 1FYNA 3RNJA 2LZ6B 4IIOA 1TUCA 2CT4A 2JS0A 2JMAA 2LJ0A 3QWYA 1VYUA 2KT1A 1H8KA 1PNJA 2HEQA 1YCSB 2FEIA 2CUBA 2QDLA 2J06A 2V1RA 4AG2C 5I11A 3NMZC 3PVQA 2K79A 2EGEA 2OI3A 2B86A 2A28A 1PRLC 1QKXA 2DJQA 1HD3A 5HCKA 2RQRA 4CC3A 1ZSGA 4WCIA 2CSIA 4RTWA 3NHNA 3M0SA 1BB9A 2L0AA 1RUWA 4JJCA 1UGVA 2D0NA 2ECZA 2KE9A 1WXBA 5IH2A 2KRNA 1KFZA 2EYYA 1K0SA 1UHFA 1OV3A 2X3XD 3VS3A 4RTUA 2NWMA 2OAWA 4OMPA 2DMOA 5IXFA 3QWXX 1ZUKA 4RTXA 2ROTA 1LCKA 2YUOA 2KEAA 2H8HA 4OMMA 2KBTA 5L23A 4EIKA 2D8JA 2RN8A 4DEYA 1HSQA 1JU5C 4J9HA 2CDTA 1NYFA 2M0YA 2O2OA 3PE0A 4HCKA 2RPNA 3H0FA 4CC7A 1AEYA 2V1QA 2D1XA 2DL4A 1NG2A 4AFUC 1JXOA 1ZLMA 1UDLA 2DBKA 1WLPB 2HDAA 1QWEA 1Z9ZA 2M51A 3H0HA 3M0TA 4LE9A 1WFWA 2FPEA 4GBQA 1UUEA 1WYXA 2CSQA 1W70A 4J9DA 1WI7A 1M3BA 2EBPA 1SRLA 2FPDA 2FRYA 2J6OA 4Z88A 3ULRB 1K9AA 2MIOA 1RI9A 2RQVA 1CKBA 5FW9A 1GCQC 2DVJA 2LX7A 4AFQC 2DX1A 2O9VA 5FWBA 4ESRA 4AFZC 1AWJA 1M27C 2PZ1A 1ZUUA 2RQWA 2CT3A 4Z8AA 4HXJA 2ABLA 2JM8A 1GBQA 1UTIA 4RTYA 2RQTA 3EHQA 4J9GA 4CC4B 2LMJA 4X1VA 1UFFA 2FRWA 2K9GA 5I22A 2KT8A 3EG3A 1HJDA 2F2VA 2HCKA 1I07A 2AZSA 2VVKA 3UA7A 2EYZA 2JTEA 3EG2A 3TVTA 2AK5A 2RNAA 2EYXA 3NPFA 2FPFA 1JEGA 1KJWA 1NYGA 2C0TA 3A98A 2EYWA 3VS6A 1T0HA 4D8KA 1AWWA 1AWOA 2IIMA 2A37A 3JV3A 1GL5A 1MV3A 1SRMA 1BU1A 2E5KA 4LUEA 4JJDA 2KYBA 4E6RA 4RTVA 5IHNA 2MOXA 3REBB 1Y0MA 1Z9QA 2J6FA 1E6HA 2LQWA 2LCSA 3GBQA 1ARKA 4OMQA 3C0CA 2F2WA 2JT4A 4JJBA 2KGTA 4OMOA 4KRTA 3U23A 1AD5A 1E7OA 2SEMA 1U5SA 4QT7A 2JM9A 2C0OA 2DNUA 1K76A 4JPBW 1AZEA 4J9CA 1Y57A 1IO6A 3UATA 2KRSA 5GJVB 5IHIA 2LJ1A 2GTOA 1RLPC 1BK2A 2K7AA 2OJ2A 4HVUA 1OOTA 1W1FA 1B07A 2AZVA 2PTKA 1U3OA 2KROA 4RTZA 1M30A 2W0ZA 2DRMA 3ZL7C 2EPDA 2F2XA 1WX6A 4IIMA 4ORZA 3H41A 4HVWA 2LNHB 2JXBA 1S1NA 1MV0B 2CH4W 1K4US 1GFCA 1UJ0A 1GCPA 2DE0X 3THKA 5IHKA 2YT6A 1AOJA 2CUDA 4OMLA 2DL8A 1QLYA 1X6GA 2CH4A 4D8DA 1UECA 2JMCA 1EFNA 1X2KA 1QWFA 2C0IA 2YDLA 4F16A 1GBRA 2DL7A 2DBMA 1WA7A 3FJ5A 2JW4A 1X69A 2RQUA 2BZ8A 2KNBB 2CREA 1MUZA 2YUQA 1E6GA 1K0XA 2KYMA 1YNZA 1RLQC 1X43A 2EKHA 1XOVA 2PNIA 2I0NA 2A08A 1UE9A 4RUGA 1JO8A 3PVLA 4F17A 2DL3A 2JS2A 1NLOC 2BZYA 1NLPC 1X6BA 2DF6A 2RMOA 3SEMA 2YSQA 2BZXA 2KRMA 2J05A 2L3PA 1PKSA 1UHCA 2FO0A 2K2MA 2YUPA 2GNCA 3EG1A 1X27A 2DA9A 1NEBA 3RBBB 2GBQA 3VS4A 2L3SA 3VS2A 1SHGA 1TG0A 3EG0A 1SPKA 2AKKA 1ZX6A 3R6NA 3TSZA 3VS7A 1QKWA 3SHWA 1WXTA 2FG0A 3UF4A 3VS5A 2ED0A 2K6DA 1M8MA 1AVZC 4Z89A 2DLPA 2NUZA 1KIKA 2MCNA 2DL5A 4DEXA 3EGUA 3VRYA 2EW3A 2A36A 2GTJA 1I1JA 3M0PA 1JQQA 1M3AA 1BBZA 2GQIA 3I5RA 1YWPA 3KFVA 4ZNXA 2YUNA 2LJ3A 4AFSC 1SEMA 1TUDA 1H3HA 4JZ3A 2VWFA 2XMFA 1VA7A 1PHTA 1UJYA 2DM1A 2KXDA 2EVRA 1NM7A 3I5SA 3M0QA 4AG1C 1PKTA 1AWXA 1KSWA 4LUDA 5FWCA 1JXMA 3NGPA 4OMNA 2HBWA 1OEBA 2ESWA 3O5ZA 2J7IA 1GRIA 3VS1A 3H0IA 4JZ4A 1OPLA 1UG1A 1W6XA 1YN8A 1J3TA 4HVVA 2ROLA 2GGRA 1YP5A 4GLMA 1WDXA 1M3CA 1NEGA 1ZUYA 3M0RA 4RTTA 4LNPA 1T0JA 1ABOA
chains in the Genus database with same CATH superfamily
1ABQA 2QA4A 2E10A 3TQ7P 3FB9A 1UGSB 3LW5E 1AZGB 5I21A 2HSPA 1U06A 1Q86U 4DBQA 4A63B 1YJ9T 3CC7Q 2DEQA 4N0AC 2JOYA 4OB0B 4J9BA 4M7AB 4XU2A 1D0YA 4NL2A 4M4ZA 5LJ5g 1K1ZA 3EFOB 3P8HA 2EQIA 2Y4XA 4J9FA 5GAMh 3CCJT 5GAN2 1FMKA 3I35A 3ZEHA 3CCET 4M7AD 4OMFB 4II1A 4XQ3A 3OYNA 5CIUA 1N8RR 4WTOB 2AT1B 3C95A 5CCAA 1G3YA 2W10A 4LXCA 4J9IA 4MZPA 5CKEA 3UA6A 1RABB 4ZGJB 1QVFS 5GJWB 1I0CA 1Y7XA 1YJNQ 4M77A 1QVFP 3INZA 4JRPA 4R0KA 3CPWS 3CCMT 2GFAA 1W2BP 2G6FX 1VQNQ 1VQPQ 1QCFA 2FL7A 2QEXQ 4IUQA 1VQ5Q 3L42A 1GCQA 2VYTA 2EGCA 2P4RA 1FYNA 3RNJA 2LZ6B 3LH0A 2JTFA 4IIOA 2CT4A 2X4JA 4M7AG 2LJ0A 4C0DC 1VYUA 2KT1A 4MDXA 2FEIA 5EG2A 2COYA 3VUZA 4MMKA 2DXBA 3QXEB 5LJ3h 2B86A 3JCMd 1FMVA 3OYCA 5GMKe 1G3WA 3WVDB 5HCKA 2RQRA 3MP8A 3EH2A 4CC3A 4WCIA 2CSIA 5A0LA 2OX7A 3M0SA 3UT1A 2E6ZA 2OTJT 2L0AA 1RUWA 4M78D 2D0NA 4C0FA 1K0SA 2MAMA 1MGQA 1UHFA 1M1KC 2DPPB 3LWHA 2NWMA 3VU3C 3QWXX 1PSEA 4B6MA 4PJOC 3GLXA 4XTVA 1WJQA 4ZGDB 3CMAA 3CPFA 2YUOA 4OMMA 4ELZC 2FB7A 4C92D 4XU0A 4M7DB 1Q82R 1YJWA 2RPNA 4C92A 2CP5A 1U1TA 2V1QA 2D1XA 2CYZB 4C92B 4R56A 1K9MC 1KG1A 4IUVA 1VQLA 3MP1A 3M4GA 4M7DE 1OZ2A 3M0TA 4OB3B 5LJ3g 3CEYA 4QQGA 1VQ7A 2ZPFB 5GAOm 1WYXA 2EQJA 4M75B 3WXMB 3GIBA 4BI4A 1K73C 3MO8A 4RG2A 2A3LA 1Q7YU 3VV0A 4M75C 3ULRB 4C8QA 2MIOA 1RI9A 1Q82U 1VQ9T 3NTKA 4F7UB 2DERA 2LX7A 4AFQC 2K4YA 2KMTA 3A8MB 3MJXA 4EMKB 2B8AA 2KVQG 1M27C 4NL3A 2WSEE 3RMQA 2HAXA 3CPWA 2RQTA 4CC4B 2LMJA 4FCYA 1B34A 2KT8A 3EG3A 2X35A 5GANf 2KAFA 3OYAA 1I07A 2AZSA 4VUBA 3EG2A 2JTEA 2X9HA 4EMHA 3MCAB 2OTJQ 1KQSS 4ANJA 1RAAB 3A98A 3I56A 2EYWA 3G4SQ 4D8KA 4CI0C 5KYYB 1AWOA 1ZSZB 1VOMA 3QYHB 1GL5A 2RB6A 1MV3A 1BIAA 1BU1A 2E5KA 3H8ZA 3HFNA 1VQOT 4PJOE 3GF5A 2KYBA 4E6RA 4RTVA 2XI9A 1OX9A 1Z9QA 1E6HA 3EFSA 4L6V5 3GBQA 1WNLA 2PUKB 1I81A 4OMOA 4C5GA 1M5Q1 3U23A 2SEMA 1DJ7B 2QDYB 2JM9A 2C0OA 1AZEA 1IO6A 3UATA 2LJ1A 2GTOA 5A0DA 2LT1A 4HVUA 1B07A 2AZVA 2PTKA 2KROA 4RTZA 5IT9E 3EAEA 4M7AE 5GMKh 2DRMA 3V7RA 2F5KA 1ZQ1A 2XICA 2EPDA 3GP8A 1YHQA 1K9MR 4BDZA 2JXBA 1S1NA 2CH4W 4KGVB 1UJ0A 1BCOA 2CKKA 3THKA 4BI8B 1U8RA 5IHKA 2YT6A 3AHUA 4M7DD 2CUDA 4C8QC 2EQKA 3HL8A 2DL8A 2DXUA 2E5QA 5KH6A 1VQMQ 3E19A 1LVKA 1MMAA 3OMGA 4C5EA 4FM4B 1WA7A 1N27A 2RQUA 1W2BA 2BZ8A 3JB9D 2XDBA 1VQ5A 4KUIA 3JCMh 1NPRA 4F7UE 1RLQC 1X43A 3CMAT 4IKFA 3PIOA 1UE9A 4JJNK 9ATCB 3L2UA 3EG9A 4IUUA 2M0OA 2RI3A 2E70A 2NUTA 1R0BG 2CP6A 4A54A 1QQJA 2AIRB 3SDZA 2LRQA 2BIVA 1X27A 5KYWB 4BY6C 1SHGA 1KD1U 4XU3A 2CP7A 1WHJA 3R6NA 3G6ET 2K5FA 5GAMf 1WXTA 4JRIA 3UF4A 1KC8C 2ED0A 4M7AC 4X9DA 1WZOA 1ZA1B 1KQSA 2ZPIB 2ZZDA 3KXTA 3H9NA 4PJJA 2DL5A 4DEXA 5A2QE 4ZGEB 3CBPA 2E12A 2A36A 1VQ7Q 2ZPEB 3EGDB 2MYSA 4Z02A 4MZTA 4RCBA 4X34A 3CCSA 3CCQA 2DVEA 2QQ9A 1TTHB 1PD0A 4EPCA 2P0PA 4N4IA 3CXCS 1NM7A 1OYXA 1PKTA 3OSVA 5GAN4 4PFZA 4PJOB 3NGPA 4OMNA 1VQ9A 3O5ZA 2JN0A 1GRIA 5CKFA 3TREA 3VS1A 1WPYA 3H0IA 1QVGA 2XKOC 4C5IA 6AT1B 2MF2A 5J39A 4PJMA 1VQ4A 4JLGA 4M77C 3V7CA 4GLMA 2E4HA 2VV5A 2KY9A 4FT2A 3HRTA 4E2FB 1VQMA 3FRNA 1YFNA 8AT1B 3UPUA 4FL6A 2RK1A 1TS9A 3RESA 3EHRA 2KR3A 3S3OA 1QCOA 2VXFA 1YJ9A 1OULA 1M8VA 3G71T 4OF1A 4ZTFA 2LTOA 1K8AU 4R55A 4BDYA 3LGLA 2DRKA 5EC7A 3PTAA 1W2BS 3OB9A 2D8HA 4K11A 2QA4T 3EFOA 3JCMX 1G2BA 1RAEB 1VYVA 5HK3A 2O9SA 4FT4A 4C8QG 2J6KA 3IQLA 2RO0A 5C0MA 1H92A 2RF0A 2IG0A 3META 5IXBA 1WIEA 3HRUA 1PRMC 2EJFA 4C92E 1IRXA 5DY9A 1M2VB 1SHFA 2AKLA 4PJOA 2L3RA 4LDUA 1EIFA 3VRZA 2LP5A 3OS1A 2VKNA 3TSWA 2DXCA 2ZAEA 1N5ZA 4PJOF 2KDSA 4A53A 1T3LA 1MMGA 4WF2A 1G83A 2EGAA 3JB9I 2HQHA 3LH5A 2L3QA 1A0NB 2RHZA 5FRNA 1QP2A 3OYKA 2OTJA 4J6XA 2XG8D 4C0ZA 2JMAA 4A4GA 1SSFA 1TWBA 1PNJA 3A8OB 2XK0A 2HEQA 2CUBA 2RD1A 3PIPA 1SKUB 1R77A 3CD6T 3HKSA 2PQWA 4AG2C 5I11A 3NMZC 4IUPA 2EGEA 1RAHB 4E7LA 1PRLC 2MI6A 2KQWA 3GNFB 4XTXA 5KE2A 3CXCA 5CAIA 1YJNT 4F7UA 3CBMA 3CMEQ 3MEVA 4JJCA 1FX7A 2KE9A 3DLLA 1WXBA 1N9SA 3FC3A 2RI5A 4Q5WA 3CPWP 3Q1JA 4A4KA 1OV3A 2X3XD 2IVWA 4OMPA 3QG1A 4JRKA 3CCJQ 1B34B 2PVDB 2WSCE 2ROTA 4LD9K 1LCKA 2AHJB 2YRCA 4X9CA 5L23A 2Z0WA 2DD5A 2RN8A 5I2SA 4JLIA 3H0FA 3JSCA 1VQ8A 2ZPHB 5A0GA 5KYYA 4AFUC 1HXDA 1ZLMA 4MZMA 4RKUE 2E3HA 4N0AA 4KH0B 4DA4A 1WLPB 2NUPB 4C0GA 1Z9ZA 1VUBA 3G4SA 1VQNT 4PFOA 2KK4A 1WFWA 3JB9F 4FSXA 2CSQA 2CZ0B 4J9DA 4MMLA 4GY5A 3QYGB 3PNWC 3PFSA 1GXIE 1KQSP 3CCST 1YBYA 3OYLA 4HKEA 1MNEA 3CCVQ 4Z88A 1K9AA 2DJZA 2RQVA 2QQBA 2E6NA 4CRIA 2DVJA 3G71Q 4YTLA 2WACA 3I56Q 5FWBA 4AFZC 5KYXB 4OB2B 2K3YA 1ZUUA 5FU7B 1UTIA 4RTYA 3EGXA 5KYXA 1VQ4Q 3EHQA 4J9GA 2RJFA 3M5AA 2FRWA 4QQDA 5I22A 1Q86C 2VGNA 1IGUA 5FRMA 2A0FB 3QDFA 3L2WA 2HCKA 3TEEA 3A1PA 2EYZA 2GCXA 2FPFA 2O01E 2H3EB 3D7SB 1T0HA 1LPLA 2BUDA 1S72A 1RADB 2V8KA 3OY9A 3OYIA 1QVGP 2P0KA 1IZ6A 1SRMA 3CCVA 5GANe 1YIJQ 4M78E 4E47A 5GAOl 4JJDA 4LDWA 5IHNA 2QGFB 3REBB 4MDWA 1Y0MA 2J6FA 2RHUA 1IXDA 2LQKA 4HT8A 2LQWA 2LCSA 3L2VA 3C0CA 4D6WA 3RDVA 5KCHA 3CMAQ 1AD5A 3QUIA 4QT7A 4JPBW 4C8QB 1QMCA 1I5OB 4M78G 2JZ2A 1IGQA 5GJVB 1V76A 2XDDA 3TCJA 5C6SA 2LQ8A 1F1BB 3H6ZA 3O8VA 3QKJA 2W0ZA 1G8XA 2YWWA 2F2XA 1WX6A 2QK0A 4IIMA 1YITT 5CVIA 2H3JA 2WSFE 2K57A 1WHHA 1K4US 3SWNB 2QTVA 1GFCA 2YRDA 3QJYA 1D1CA 1OQKA 3E2UA 3L2QA 2CZ7B 2D9TA 2DKGA 1OZ3A 1AOJA 5GAN8 1YIJT 3F70A 4QVZA 3EH1A 1QLYA 1X6GA 3KUFA 3E9FA 1YI2Q 4D8DA 1X2KA 1QWFA 2C0IA 4F16A 3CCRQ 3CCLQ 4KT0E 4C8QF 1JRIA 1W4SA 3GOXA 4LD6A 2KNBB 1M1KU 2EIFA 2YUQA 3LLRA 5LJ3j 2K5LA 2QEXA 2F1LA 1MHNA 1I8FA 4HCCA 1XOVA 4EMGA 2PNIA 3ZFJA 1VQ9Q 1ACMB 3M53A 2CP2A 3OYFA 1SG5A 2LCLA 1NLOC 2P84A 1BIBA 1X6BA 1Q86R 2ZPGB 2C06A 2OTLA 2BZXA 1KC8R 2KRMA 5CR2A 2L3PA 1UHCA 2CZ6B 3I56T 1C6VX 2FO0A 1WJRA 2LX9A 4UC4A 5J26A 3QSUA 2GNCA 3CCLA 2E1HA 4Y91A 3SWNC 3G4ST 1VQNA 3RBBB 2L3SA 1TSFA 1TG0A 5DLOA 3CCSQ 1NE8A 2EYQA 2I2LA 4TVRA 5D7UA 2DIQA 3L2ZA 1RAIB 1HYOA 1M8MA 2K3XA 4Z89A 4J6WA 2DLPA 1RAGB 3OQ5A 2MCNA 3OBYA 1Q7YC 2DTIA 3JAME 4AT1B 3EGDA 4ELYC 3AT1B 5GAOq 4A4HA 5LL6S 3CD6Q 1C1AA 1OU8A 2GTJA 4KULA 4DOVA 1M3AA 4L59A 3R6OA 3KFVA 5M9OA 4V2SA 2YUNA 4AFSC 2MWPA 3SD4A 4BB7A 4HCBA 4EDUA 2DZCA 1PHTA 1H3ZA 4M75D 2D6FA 4BE1A 4RMOA 1UB4A 2KXDA 2RA2A 4LDXA 1OU9A 3JCMb 4OP0A 4C8QD 2DTHA 4KUDK 4XTZA 2X4YA 1OEBA 2ESWA 2HNIA 1QW1A 2J7IA 4E7HA 2QAZA 2M9UA 1OPLA 4QVCA 2BE7D 2XDPA 1YN8A 2QTXA 3CC2T 1Y96A 2V26A 4HVVA 2ROLA 2GGRA 1YP5A 1NJIC 3EFRA 4PK4A 1ZUYA 1M90C 4LNPA 2V8IA 2VASA 1BI0A 3CCRA 3BW1A 1T0JA 2FZGB 1D3BB 1VQ6A 2E65A 4M7AF 3M0UA 2EQMA 3CCMQ 4XAXB 1Q81U 4FYWB 1D3BA 3I9QA 1AHJB 3OYGA 1T3SA 3CC2Q 2K3BA 3G1JA 2VUBA 4Y92A 4ZN1A 3JCMe 1SSHA 3PGGA 4FSSA 1VQLQ 4J7IA 3V7SA 1KHIA 1ZHIA 3REAB 1IB8A 1M4ZA 3OBWA 4F14A 1HK9A 5ECAA 4M78A 2LQNA 1M2VA 2SRCA 1KQ2A 1CSKA 2EWNA 2DYBA 1NBEB 2L2PA 4AMCA 2RK2A 1P92A 3JB9H 2X3WD 1QVGS 3CCJA 2LVMA 2MWOA 1N9RA 1Y96B 2BTTA 2O88A 3CCLT 1RACB 4FW2A 4DOWA 2KXCA 5FROA 2HD0A 2RM4A 1K9MU 2E64A 1TUCA 4PL6A 1K8AR 4BY6B 1H8KA 2G3RA 2QASA 2PUOB 5DLQE 1VQ7T 2J06A 2V1RA 3FEOA 2QYZA 3X28B 1OI1A 3PVQA 2K79A 2RJEA 2OI3A 1QKXA 4M77D 1XNIA 3CMEA 2DJQA 5CK9A 1Q82C 2HMAA 1ZSGA 3OA6A 4RTWA 3MP6A 4ZN3A 1UGPB 2QQAA 4B9XA 1WHLA 3JB9J 2ECZA 4OGEA 1KFZA 2E41A 2DEUA 4A4EA 3OYMA 1PD1A 2OAWA 5IXFA 3OYHA 3CCRT 3X20B 4RTXA 2LNVA 2COZA 1YJNA 1QVPA 3VKIA 2KBTA 4EIKA 1VQ6T 4DEYA 1HSQA 1JU5C 4J9HA 2M0YA 2O2OA 3HP9A 4HCKA 4M77G 3DLMA 4FYYB 4CC7A 4M7DA 2DK3A 4N4GA 1M1GA 3P8DA 1VQ8Q 2HDAA 4BUGA 1YITQ 4F7UG 2P4TA 2M51A 2R5AA 1BI1A 2EJGA 1N8RU 1VQMT 4LE9A 1Q95G 1W70A 4M7DG 1VQ4T 2EBPA 3MEWA 2EFIA 1VQKQ 5GMKj 3URGA 5GAMe 4PLIA 2K2VA 2QI2A 3CCVT 3BDUA 1OX8A 1YJ9Q 2FRYA 2J6OA 3QPHA 3CC4A 4E7JA 2XIDA 2DX1A 2O9VA 3RUXA 3EGXB 2PZ1A 2RQWA 4Z8AA 4HXJA 2ABLA 3OMCA 1GBQA 2QXFA 1KHCA 4E7KA 1K8AC 1EZZB 2DYIA 3C94A 3UDCA 3NTHA 2F2VA 2VVKA 3UA7A 2RHIA 2JJ9A 4QKUA 3TVTA 3M9QA 2AK5A 3SFMA 3OS5A 2EYXA 1NYGA 2C0TA 3G7ZA 2BKDN 1AWWA 2O4XA 2E3IA 4B9WA 3JV3A 4HCZA 1TOVA 5FU6C 2FZCB 1ZSZA 4PJNA 5LJ5h 2YXYA 2X51A 3QZ9B 3DB4A 3ME9A 1VQ8T 2LDMA 1FXXA 4A4FA 3FLGA 2QG9B 3GNGA 4F04B 2JT4A 4J83A 4L5GA 5J3BA 4FU6A 4OGCA 4KBMB 3UWNA 2DNUA 1K76A 4ATOA 4O5VA 1K73U 1Y57A 1KK7A 2KRSA 4JDSA 4HT9A 4PKCC 1YIJA 2K7AA 1OOTA 1W1FA 2RJCA 4EMKA 3I55Q 1M2OA 3RKWA 2DAQA 1JBMA 5GAN6 3ZL7C 5HKCA 2COWA 3OW2P 5AT1B 2X4WA 3BFMA 3L2RA 3CC7A 1G3SA 4HVWA 2LNHB 1MV0B 3X25B 2IPOB 3OS0A 4JRQA 1XTDA 2LCCA 4OMLA 1N6AA 3PMTA 3ZBDA 5HK0A 2JVVA 5CKBA 4JS4A 2CH4A 1VQLT 3G6EA 1UECA 1GBRA 4QQ6A 5AYFA 1WHGA 1KD1R 2PVGB 3FJ5A 2JW4A 4J8OA 1Q7YR 2CREA 3P8BB 2MMPA 2M16A 2OTLQ 1E6GA 1S72Q 1O9SA 3X24B 1YNZA 1TU0B 4J7FA 1JJ2A 3EG9B 4RUGA 5GAOn 1KQ1A 4F17A 2V8JA 2JS2A 1NLPC 3V8KA 3JCMQ 2DZ9A 3OYJA 2DF6A 3I55T 2RMOA 3SEMA 1PCXA 4DBRA 1VQPT 1NZ9A 2J05A 1PKSA 2CGHA 2K2MA 3EG1A 1D1BA 2DA9A 1NEBA 4NS5A 1YI2A 3VS4A 3VS2A 3A5ZB 2Y90A 4BACA 1SPKA 1ZX6A 3CXCP 3G71A 3LYIA 3TSZA 2PU9B 5KYWA 3SHWA 1S72T 2FG0A 2OTLT 2Y4YA 4DBFA 3VS5A 4XU1A 2K5IA 2K6DA 5GAMg 3BDLA 3JCMc 1UGQB 3OSSC 1UGRB 1RI0A 2DETA 1G3TA 3EGUA 3JCMW 1M90R 2EW3A 2EJ9A 1VIFA 1I1JA 3M0PA 3QZ5B 3I5RA 5L8RE 5LJ5d 2HL3A 1TUGB 1YWPA 4F7UF 1I5LA 4ZNXA 2DO3A 3PT9A 5FLXE 1BCMA 1IHWA 1TUDA 1UEBA 1H3HA 2XU8A 5CQYA 2XMFA 3TU4K 1VA7A 4PJOG 3CCEA 2CZ1B 1UJYA 4M75F 5CKHA 3FDRA 3M0QA 2RH2A 4C5HA 3CCQT 1AWXA 4JUVA 1H641 5CKDA 3CCUQ 5D6YA 2YHTA 2HBWA 1QVFA 2GF7A 4C92F 5GAMj 2JUFA 3S6WA 3RR6A 1TXQA 1C0MA 1UG1A 4BE0A 4XTYA 2XD0A 4M77F 1JB0E 4M7DF 1J3TA 1BYMA 1WDXA 1M3CA 4RTTA 1NEGA 2YLCA 3M0RA 3KBGA 1KD1C 1ABOA 4FW1A 4M78C 1B3QA 3CCUA 1D1AA 3VS0A 4PNOA 1D09B 2HZYA 1X2QA 4CC2A 1QP3A 2JNGA 1ZBJA 1FMWA 4OB1B 3HHTB 4XTUA 2HQXA 1Y07A 4JS5A 3S3MA 1WXUA 2DILA 2QEXT 3CC4T 1YI2T 3I55A 1OPKA 2ED1A 4M7AA 3ASKA 1PWTA 3HFOA 2QGGA 4LDYA 3JCMJ 4LN2A 4FIBA 3E1SA 1WHMA 2M02A 2O31A 3A8GB 3FJPA 4M77B 5IAYA 2ENMA 1V1CA 1G5VA 1VQKT 1TH7A 1SF9A 1YWOA 2VC8A 4J9EA 2YLBA 1V29B 3CQTA 3JRZA 1WQWA 2R58A 1CKAA 3J81E 3JCMV 5GMKi 3MPUB 3QO3A 2HL5C 3RMSA 1VYTA 3CC7T 3V8JA 5LJ5e 1GFDA 1Q81R 1R0CB 1WHKA 5LJ3d 2JS0A 3G6EQ 3QWYA 2NUPA 7AT1B 1YCSB 5DM7R 2HSEB 2HKNA 2VXEA 5KCOA 1X6OA 2QDLA 3OYDA 3OS2A 3CMET 4ZTJA 1IREB 1YHQT 3CCMA 2F5TX 2A28A 3VYHB 1VQ6Q 2ATCB 1HD3A 3RIRA 3CBOA 3BE3A 3JB9G 3NHNA 2KSSA 2KI7A 2BE9B 3M54A 4KGXB 4DQ2A 1M9SA 1BB9A 1PSFA 2OAUA 1UGVA 5IH2A 2KRNA 2EYYA 5FU6B 4GLKA 3OYEA 5LJ5f 2EKOA 5CQXA 3VS3A 4RTUA 3VYGA 1WGSA 2R57A 1IHVA 2DMOA 1VIEA 1ZUKA 4LDVA 1FWZA 2KEAA 2H8HA 4Y28E 3JCMf 1YCYA 2EAYA 3BY7A 1MNDA 2D8JA 2CDTA 1NYFA 1ZBXA 3PE0A 5GAMd 3M56A 4FYXB 3JCMg 4RCCA 1AEYA 4PJLA 1WQ7A 2DL4A 1NG2A 1JXOA 5KE3A 1UDLA 2DBKA 4DBHA 1YJWQ 1QWEA 1U1SA 3H0HA 2RI2A 3MEUA 4J6YA 3CCUT 1X75C 2L8DA 3QDRB 2GFUA 3CD6A 1LOJA 4M78F 2FPEA 4GBQA 1UUEA 3L1AA 1KC8U 1WI7A 2D0QB 1M3BA 3VUBA 5GANj 2RHYA 3DKMA 3RKYA 1SRLA 5LJ5j 2FPDA 3NTIA 1NJIU 4PJOD 2QA4Q 3HTRA 1CKBA 5FW9A 1GCQC 5GAN7 2MK5A 4ESRA 5KYNA 1AWJA 4E7IA 4C92C 4HA8A 3M55A 2CT3A 1XJWB 2JM8A 3OW2A 2CS7A 2M1HA 1Q81C 4PLLA 4X1VA 4N4HA 1VQOQ 4O6JA 1UFFA 2VGMA 3QJ6A 2K9GA 2VB6A 4KGZB 1VQOA 2NLUA 4RG8A 1HJDA 2DIGA 2FVUA 1PM3A 2R5MA 1D0ZA 2RNAA 3NPFA 1O75A 1MMNA 1BI3A 1JEGA 1KJWA 4BI3A 3VS6A 5KYUA 3S3NA 4M75E 2IIMA 2A37A 3HPWA 1YITA 2RHXA 3E9GA 5KYUB 2PVOB 3C4SA 1K73R 4LUEA 2F69A 1Y71A 2MOXA 1VQKA 4XTWA 1BI2A 1VQPA 3LX7A 2FHDA 4P5NA 3RKXA 3MKDA 3JCMP 2P0QA 1YJWT 4M75A 4OMQA 4M7DC 1ARKA 2F2WA 5GAOp 2DXTA 4JJBA 2KGTA 4M77E 4KRTA 2ZGWA 3OYBA 2JTMA 1E7OA 2GQVA 1U5SA 4IURA 4J9CA 1NPPA 2LT4A 5IHIA 2NUTB 4E7SA 1RLPC 1BK2A 3J80E 2OJ2A 3C12A 1U3OA 1M30A 1B7TA 3T9NA 2ZPBB 5I2MA 3VJPA 3FIFA 5GMKm 4ORZA 5GAN5 3DB3A 3H41A 2DD4A 4ME7A 2QQRA 2NYSA 3HRSA 1GCPA 2DE0X 2FYKA 1VQ5T 4EMKC 5IN1A 1PG5B 4XK8E 3SWNA 3A8LB 1XQHA 2MPXC 3LWIA 4QW2A 2O4XB 2XHCA 1MMDA 3N5BB 5GANd 1D0XA 2JMCA 1EFNA 3WVEB 2YDLA 3ER0A 5GANh 2DL7A 1ZA2B 1X01A 2DBMA 1X69A 3NFCA 3M58A 1LNXA 3QBYA 5GMKl 1AT1B 2HQEA 2HBPA 2CP3A 1MUZA 4QVDA 1K0XA 2KYMA 1PC0A 2EKHA 1R8OB 2I0NA 2A08A 5CO7A 1JO8A 1RAFB 1ZSZC 3QIIA 3A8HB 8ATCB 3PVLA 2DL3A 5D6XA 5D6WA 2BZYA 5HY6A 2RJDA 2HKQB 2YSQA 3CCEQ 5FU7C 3OW2S 2YUPA 2L89A 2DTOA 2GBQA 1M90U 4NOYA 3EG0A 2AKKA 1N8RC 4BD3A 2L5QA 3VS7A 1QKWA 1I4K1 3QHSA 1RL2A 1AVZC 2LC4A 4FYVB 4C92G 4PFPA 2NUZA 1KIKA 3CC2A 1YHQQ 2X4XA 5GAN3 3VRYA 5GANg 5LJ3e 4C8QE 1JQQA 2GQIA 1BBZA 3HSBA 1EX4A 1NJIR 3LGFA 3M57A 2LJ3A 1SEMA 4C0DB 2EQUA 1WJSA 4JZ3A 2VWFA 2DFUA 1JJ2S 3V8LA 2DM1A 2EVRA 4M78B 3SB2A 1JJ2P 3I5SA 2FZKB 4AG1C 2CP0A 4OVAA 5GAOr 4J5YA 4BE2A 1KSWA 4LUDA 5FWCA 1JXMA 4KH1B 3PMIA 3MEAA 1LJOA 1QCNA 3M59A 3M4YA 4JZ4A 4IUTA 1W6XA 2YRVA 3X26B 4E7ZA 5LJ3f 2A7YA 3OYYA 3GPLA 2QQSA 3J7AF 2ZCFB 3CC4Q 3MHXA 3CCQQ 4M75G 1M1KR 3RERA 1BKBA 1M1FA
chains in the Genus database with same CATH topology
1B3QA 1ABQA 3VS0A 3EHRA 2KR3A 3M0UA 1X2QA 4CC2A 1ZBJA 1AZGB 3I9QA 2HSPA 1T3SA 1U06A 2DRKA 5EC7A 4A63B 2K3BA 2D8HA 4K11A 4Y92A 1G2BA 4J9BA 1SSHA 1WXUA 2DILA 4M4ZA 4FSSA 1VYVA 1K1ZA 1OPKA 2EQIA 2O9SA 4J9FA 3REAB 2ED1A 2J6KA 1PWTA 3IQLA 1FMKA 3I35A 1H92A 2RF0A 4F14A 5ECAA 4LN2A 5IXBA 2LQNA 1WIEA 2SRCA 1PRMC 2O31A 2W10A 1SHFA 2AKLA 1CSKA 4J9IA 3UA6A 2ENMA 1V1CA 2DYBA 5GJWB 3VRZA 2LP5A 1YWOA 2L2PA 1I0CA 2VKNA 3TSWA 2X3WD 1N5ZA 4R0KA 4J9EA 3CQTA 2BTTA 1CKAA 2O88A 1T3LA 2G6FX 1G83A 1QCFA 2EGAA 2KXCA 3LH5A 2L3QA 1A0NB 1VYTA 1GCQA 2EGCA 1GFDA 2P4RA 1FYNA 3RNJA 2LZ6B 4IIOA 1TUCA 2CT4A 2JS0A 2JMAA 2LJ0A 3QWYA 1VYUA 2KT1A 1H8KA 1PNJA 2HEQA 1YCSB 2FEIA 2CUBA 2QDLA 2J06A 2V1RA 4AG2C 5I11A 3NMZC 3PVQA 2K79A 2EGEA 2OI3A 2B86A 2A28A 1PRLC 1QKXA 2DJQA 1HD3A 5HCKA 2RQRA 4CC3A 1ZSGA 4WCIA 2CSIA 4RTWA 3NHNA 3M0SA 1BB9A 2L0AA 1RUWA 4JJCA 1UGVA 2D0NA 2ECZA 2KE9A 1WXBA 5IH2A 2KRNA 1KFZA 2EYYA 1K0SA 1UHFA 1OV3A 2X3XD 3VS3A 4RTUA 2NWMA 2OAWA 4OMPA 2DMOA 5IXFA 3QWXX 1ZUKA 4RTXA 2ROTA 1LCKA 2YUOA 2KEAA 2H8HA 4OMMA 2KBTA 5L23A 4EIKA 2D8JA 2RN8A 4DEYA 1HSQA 1JU5C 4J9HA 2CDTA 1NYFA 2M0YA 2O2OA 3PE0A 4HCKA 2RPNA 3H0FA 4CC7A 1AEYA 2V1QA 2D1XA 2DL4A 1NG2A 4AFUC 1JXOA 1ZLMA 1UDLA 2DBKA 1WLPB 2HDAA 1QWEA 1Z9ZA 2M51A 3H0HA 3M0TA 4LE9A 1WFWA 2FPEA 4GBQA 1UUEA 1WYXA 2CSQA 1W70A 4J9DA 1WI7A 1M3BA 2EBPA 1SRLA 2FPDA 2FRYA 2J6OA 4Z88A 3ULRB 1K9AA 2MIOA 1RI9A 2RQVA 1CKBA 5FW9A 1GCQC 2DVJA 2LX7A 4AFQC 2DX1A 2O9VA 5FWBA 4ESRA 4AFZC 1AWJA 1M27C 2PZ1A 1ZUUA 2RQWA 2CT3A 4Z8AA 4HXJA 2ABLA 2JM8A 1GBQA 1UTIA 4RTYA 2RQTA 3EHQA 4J9GA 4CC4B 2LMJA 4X1VA 1UFFA 2FRWA 2K9GA 5I22A 2KT8A 3EG3A 1HJDA 2F2VA 2HCKA 1I07A 2AZSA 2VVKA 3UA7A 2EYZA 2JTEA 3EG2A 3TVTA 2AK5A 2RNAA 2EYXA 3NPFA 2FPFA 1JEGA 1KJWA 1NYGA 2C0TA 3A98A 2EYWA 3VS6A 1T0HA 4D8KA 1AWWA 1AWOA 2IIMA 2A37A 3JV3A 1GL5A 1MV3A 1SRMA 1BU1A 2E5KA 4LUEA 4JJDA 2KYBA 4E6RA 4RTVA 5IHNA 2MOXA 3REBB 1Y0MA 1Z9QA 2J6FA 1E6HA 2LQWA 2LCSA 3GBQA 1ARKA 4OMQA 3C0CA 2F2WA 2JT4A 4JJBA 2KGTA 4OMOA 4KRTA 3U23A 1AD5A 1E7OA 2SEMA 1U5SA 4QT7A 2JM9A 2C0OA 2DNUA 1K76A 4JPBW 1AZEA 4J9CA 1Y57A 1IO6A 3UATA 2KRSA 5GJVB 5IHIA 2LJ1A 2GTOA 1RLPC 1BK2A 2K7AA 2OJ2A 4HVUA 1OOTA 1W1FA 1B07A 2AZVA 2PTKA 1U3OA 2KROA 4RTZA 1M30A 2W0ZA 2DRMA 3ZL7C 2EPDA 2F2XA 1WX6A 4IIMA 4ORZA 3H41A 4HVWA 2LNHB 2JXBA 1S1NA 1MV0B 2CH4W 1K4US 1GFCA 1UJ0A 1GCPA 2DE0X 3THKA 5IHKA 2YT6A 1AOJA 2CUDA 4OMLA 2DL8A 1QLYA 1X6GA 2CH4A 4D8DA 1UECA 2JMCA 1EFNA 1X2KA 1QWFA 2C0IA 2YDLA 4F16A 1GBRA 2DL7A 2DBMA 1WA7A 3FJ5A 2JW4A 1X69A 2RQUA 2BZ8A 2KNBB 2CREA 1MUZA 2YUQA 1E6GA 1K0XA 2KYMA 1YNZA 1RLQC 1X43A 2EKHA 1XOVA 2PNIA 2I0NA 2A08A 1UE9A 4RUGA 1JO8A 3PVLA 4F17A 2DL3A 2JS2A 1NLOC 2BZYA 1NLPC 1X6BA 2DF6A 2RMOA 3SEMA 2YSQA 2BZXA 2KRMA 2J05A 2L3PA 1PKSA 1UHCA 2FO0A 2K2MA 2YUPA 2GNCA 3EG1A 1X27A 2DA9A 1NEBA 3RBBB 2GBQA 3VS4A 2L3SA 3VS2A 1SHGA 1TG0A 3EG0A 1SPKA 2AKKA 1ZX6A 3R6NA 3TSZA 3VS7A 1QKWA 3SHWA 1WXTA 2FG0A 3UF4A 3VS5A 2ED0A 2K6DA 1M8MA 1AVZC 4Z89A 2DLPA 2NUZA 1KIKA 2MCNA 2DL5A 4DEXA 3EGUA 3VRYA 2EW3A 2A36A 2GTJA 1I1JA 3M0PA 1JQQA 1M3AA 1BBZA 2GQIA 3I5RA 1YWPA 3KFVA 4ZNXA 2YUNA 2LJ3A 4AFSC 1SEMA 1TUDA 1H3HA 4JZ3A 2VWFA 2XMFA 1VA7A 1PHTA 1UJYA 2DM1A 2KXDA 2EVRA 1NM7A 3I5SA 3M0QA 4AG1C 1PKTA 1AWXA 1KSWA 4LUDA 5FWCA 1JXMA 3NGPA 4OMNA 2HBWA 1OEBA 2ESWA 3O5ZA 2J7IA 1GRIA 3VS1A 3H0IA 4JZ4A 1OPLA 1UG1A 1W6XA 1YN8A 1J3TA 4HVVA 2ROLA 2GGRA 1YP5A 4GLMA 1WDXA 1M3CA 1NEGA 1ZUYA 3M0RA 4RTTA 4LNPA 1T0JA 1ABOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B3Q A;  1ABQ A;  3VS0 A;  3EHR A;  2KR3 A;  3M0U A;  1X2Q A;  4CC2 A;  1ZBJ A;  1AZG B;  3I9Q A;  2HSP A;  1T3S A;  1U06 A;  2DRK A;  5EC7 A;  4A63 B;  2K3B A;  2D8H A;  4K11 A;  4Y92 A;  1G2B A;  4J9B A;  1SSH A;  1WXU A;  2DIL A;  4M4Z A;  4FSS A;  1VYV A;  1K1Z A;  1OPK A;  2EQI A;  2O9S A;  4J9F A;  3REA B;  2ED1 A;  2J6K A;  1PWT A;  3IQL A;  1FMK A;  3I35 A;  1H92 A;  2RF0 A;  4F14 A;  5ECA A;  4LN2 A;  5IXB A;  2LQN A;  1WIE A;  2SRC A;  1PRM C;  2O31 A;  2W10 A;  1SHF A;  2AKL A;  1CSK A;  4J9I A;  3UA6 A;  2ENM A;  1V1C A;  2DYB A;  5GJW B;  3VRZ A;  2LP5 A;  1YWO A;  2L2P A;  1I0C A;  2VKN A;  3TSW A;  2X3W D;  1N5Z A;  4R0K A;  4J9E A;  3CQT A;  2BTT A;  1CKA A;  2O88 A;  1T3L A;  2G6F X;  1G83 A;  1QCF A;  2EGA A;  2KXC A;  3LH5 A;  2L3Q A;  1A0N B;  1VYT A;  1GCQ A;  2EGC A;  1GFD A;  2P4R A;  1FYN A;  3RNJ A;  2LZ6 B;  4IIO A;  1TUC A;  2CT4 A;  2JS0 A;  2JMA A;  2LJ0 A;  3QWY A;  1VYU A;  2KT1 A;  1H8K A;  1PNJ A;  2HEQ A;  1YCS B;  2FEI A;  2CUB A;  2QDL A;  2J06 A;  2V1R A;  4AG2 C;  5I11 A;  3NMZ C;  3PVQ A;  2K79 A;  2EGE A;  2OI3 A;  2B86 A;  2A28 A;  1PRL C;  1QKX A;  2DJQ A;  1HD3 A;  5HCK A;  2RQR A;  4CC3 A;  1ZSG A;  4WCI A;  2CSI A;  4RTW A;  3NHN A;  3M0S A;  1BB9 A;  2L0A A;  1RUW A;  4JJC A;  1UGV A;  2D0N A;  2ECZ A;  2KE9 A;  1WXB A;  5IH2 A;  2KRN A;  1KFZ A;  2EYY A;  1K0S A;  1UHF A;  1OV3 A;  2X3X D;  3VS3 A;  4RTU A;  2NWM A;  2OAW A;  4OMP A;  2DMO A;  5IXF A;  3QWX X;  1ZUK A;  4RTX A;  2ROT A;  1LCK A;  2YUO A;  2KEA A;  2H8H A;  4OMM A;  2KBT A;  5L23 A;  4EIK A;  2D8J A;  2RN8 A;  4DEY A;  1HSQ A;  1JU5 C;  4J9H A;  2CDT A;  1NYF A;  2M0Y A;  2O2O A;  3PE0 A;  4HCK A;  2RPN A;  3H0F A;  4CC7 A;  1AEY A;  2V1Q A;  2D1X A;  2DL4 A;  1NG2 A;  4AFU C;  1JXO A;  1ZLM A;  1UDL A;  2DBK A;  1WLP B;  2HDA A;  1QWE A;  1Z9Z A;  2M51 A;  3H0H A;  3M0T A;  4LE9 A;  1WFW A;  2FPE A;  4GBQ A;  1UUE A;  1WYX A;  2CSQ A;  1W70 A;  4J9D A;  1WI7 A;  1M3B A;  2EBP A;  1SRL A;  2FPD A;  2FRY A;  2J6O A;  4Z88 A;  3ULR B;  1K9A A;  2MIO A;  1RI9 A;  2RQV A;  1CKB A;  5FW9 A;  1GCQ C;  2DVJ A;  2LX7 A;  4AFQ C;  2DX1 A;  2O9V A;  5FWB A;  4ESR A;  4AFZ C;  1AWJ A;  1M27 C;  2PZ1 A;  1ZUU A;  2RQW A;  2CT3 A;  4Z8A A;  4HXJ A;  2ABL A;  2JM8 A;  1GBQ A;  1UTI A;  4RTY A;  2RQT A;  3EHQ A;  4J9G A;  4CC4 B;  2LMJ A;  4X1V A;  1UFF A;  2FRW A;  2K9G A;  5I22 A;  2KT8 A;  3EG3 A;  1HJD A;  2F2V A;  2HCK A;  1I07 A;  2AZS A;  2VVK A;  3UA7 A;  2EYZ A;  2JTE A;  3EG2 A;  3TVT A;  2AK5 A;  2RNA A;  2EYX A;  3NPF A;  2FPF A;  1JEG A;  1KJW A;  1NYG A;  2C0T A;  3A98 A;  2EYW A;  3VS6 A;  1T0H A;  4D8K A;  1AWW A;  1AWO A;  2IIM A;  2A37 A;  3JV3 A;  1GL5 A;  1MV3 A;  1SRM A;  1BU1 A;  2E5K A;  4LUE A;  4JJD A;  2KYB A;  4E6R A;  4RTV A;  5IHN A;  2MOX A;  3REB B;  1Y0M A;  1Z9Q A;  2J6F A;  1E6H A;  2LQW A;  2LCS A;  3GBQ A;  1ARK A;  4OMQ A;  3C0C A;  2F2W A;  2JT4 A;  4JJB A;  2KGT A;  4OMO A;  4KRT A;  3U23 A;  1AD5 A;  1E7O A;  2SEM A;  1U5S A;  4QT7 A;  2JM9 A;  2C0O A;  2DNU A;  1K76 A;  4JPB W;  1AZE A;  4J9C A;  1Y57 A;  1IO6 A;  3UAT A;  2KRS A;  5GJV B;  5IHI A;  2LJ1 A;  2GTO A;  1RLP C;  1BK2 A;  2K7A A;  2OJ2 A;  4HVU A;  1OOT A;  1W1F A;  1B07 A;  2AZV A;  2PTK A;  1U3O A;  2KRO A;  4RTZ A;  1M30 A;  2W0Z A;  2DRM A;  3ZL7 C;  2EPD A;  2F2X A;  1WX6 A;  4IIM A;  4ORZ A;  3H41 A;  4HVW A;  2LNH B;  2JXB A;  1S1N A;  1MV0 B;  2CH4 W;  1K4U S;  1GFC A;  1UJ0 A;  1GCP A;  2DE0 X;  3THK A;  5IHK A;  2YT6 A;  1AOJ A;  2CUD A;  4OML A;  2DL8 A;  1QLY A;  1X6G A;  2CH4 A;  4D8D A;  1UEC A;  2JMC A;  1EFN A;  1X2K A;  1QWF A;  2C0I A;  2YDL A;  4F16 A;  1GBR A;  2DL7 A;  2DBM A;  1WA7 A;  3FJ5 A;  2JW4 A;  1X69 A;  2RQU A;  2BZ8 A;  2KNB B;  2CRE A;  1MUZ A;  2YUQ A;  1E6G A;  1K0X A;  2KYM A;  1YNZ A;  1RLQ C;  1X43 A;  2EKH A;  1XOV A;  2PNI A;  2I0N A;  2A08 A;  1UE9 A;  4RUG A;  1JO8 A;  3PVL A;  4F17 A;  2DL3 A;  2JS2 A;  1NLO C;  2BZY A;  1NLP C;  1X6B A;  2DF6 A;  2RMO A;  3SEM A;  2YSQ A;  2BZX A;  2KRM A;  2J05 A;  2L3P A;  1PKS A;  1UHC A;  2FO0 A;  2K2M A;  2YUP A;  2GNC A;  3EG1 A;  1X27 A;  2DA9 A;  1NEB A;  3RBB B;  2GBQ A;  3VS4 A;  2L3S A;  3VS2 A;  1SHG A;  1TG0 A;  3EG0 A;  1SPK A;  2AKK A;  1ZX6 A;  3R6N A;  3TSZ A;  3VS7 A;  1QKW A;  3SHW A;  1WXT A;  2FG0 A;  3UF4 A;  3VS5 A;  2ED0 A;  2K6D A;  1M8M A;  1AVZ C;  4Z89 A;  2DLP A;  2NUZ A;  1KIK A;  2MCN A;  2DL5 A;  4DEX A;  3EGU A;  3VRY A;  2EW3 A;  2A36 A;  2GTJ A;  1I1J A;  3M0P A;  1JQQ A;  1M3A A;  1BBZ A;  2GQI A;  3I5R A;  1YWP A;  3KFV A;  4ZNX A;  2YUN A;  2LJ3 A;  4AFS C;  1SEM A;  1TUD A;  1H3H A;  4JZ3 A;  2VWF A;  2XMF A;  1VA7 A;  1PHT A;  1UJY A;  2DM1 A;  2KXD A;  2EVR A;  1NM7 A;  3I5S A;  3M0Q A;  4AG1 C;  1PKT A;  1AWX A;  1KSW A;  4LUD A;  5FWC A;  1JXM A;  3NGP A;  4OMN A;  2HBW A;  1OEB A;  2ESW A;  3O5Z A;  2J7I A;  1GRI A;  3VS1 A;  3H0I A;  4JZ4 A;  1OPL A;  1UG1 A;  1W6X A;  1YN8 A;  1J3T A;  4HVV A;  2ROL A;  2GGR A;  1YP5 A;  4GLM A;  1WDX A;  1M3C A;  1NEG A;  1ZUY A;  3M0R A;  4RTT A;  4LNP A;  1T0J A;  1ABO A; 
#chains in the Genus database with same CATH topology
 1ABQ A;  2QA4 A;  2E10 A;  3TQ7 P;  3FB9 A;  1UGS B;  3LW5 E;  1AZG B;  5I21 A;  2HSP A;  1U06 A;  1Q86 U;  4DBQ A;  4A63 B;  1YJ9 T;  3CC7 Q;  2DEQ A;  4N0A C;  2JOY A;  4OB0 B;  4J9B A;  4M7A B;  4XU2 A;  1D0Y A;  4NL2 A;  4M4Z A;  5LJ5 g;  1K1Z A;  3EFO B;  3P8H A;  2EQI A;  2Y4X A;  4J9F A;  5GAM h;  3CCJ T;  5GAN 2;  1FMK A;  3I35 A;  3ZEH A;  3CCE T;  4M7A D;  4OMF B;  4II1 A;  4XQ3 A;  3OYN A;  5CIU A;  1N8R R;  4WTO B;  2AT1 B;  3C95 A;  5CCA A;  1G3Y A;  2W10 A;  4LXC A;  4J9I A;  4MZP A;  5CKE A;  3UA6 A;  1RAB B;  4ZGJ B;  1QVF S;  5GJW B;  1I0C A;  1Y7X A;  1YJN Q;  4M77 A;  1QVF P;  3INZ A;  4JRP A;  4R0K A;  3CPW S;  3CCM T;  2GFA A;  1W2B P;  2G6F X;  1VQN Q;  1VQP Q;  1QCF A;  2FL7 A;  2QEX Q;  4IUQ A;  1VQ5 Q;  3L42 A;  1GCQ A;  2VYT A;  2EGC A;  2P4R A;  1FYN A;  3RNJ A;  2LZ6 B;  3LH0 A;  2JTF A;  4IIO A;  2CT4 A;  2X4J A;  4M7A G;  2LJ0 A;  4C0D C;  1VYU A;  2KT1 A;  4MDX A;  2FEI A;  5EG2 A;  2COY A;  3VUZ A;  4MMK A;  2DXB A;  3QXE B;  5LJ3 h;  2B86 A;  3JCM d;  1FMV A;  3OYC A;  5GMK e;  1G3W A;  3WVD B;  5HCK A;  2RQR A;  3MP8 A;  3EH2 A;  4CC3 A;  4WCI A;  2CSI A;  5A0L A;  2OX7 A;  3M0S A;  3UT1 A;  2E6Z A;  2OTJ T;  2L0A A;  1RUW A;  4M78 D;  2D0N A;  4C0F A;  1K0S A;  2MAM A;  1MGQ A;  1UHF A;  1M1K C;  2DPP B;  3LWH A;  2NWM A;  3VU3 C;  3QWX X;  1PSE A;  4B6M A;  4PJO C;  3GLX A;  4XTV A;  1WJQ A;  4ZGD B;  3CMA A;  3CPF A;  2YUO A;  4OMM A;  4ELZ C;  2FB7 A;  4C92 D;  4XU0 A;  4M7D B;  1Q82 R;  1YJW A;  2RPN A;  4C92 A;  2CP5 A;  1U1T A;  2V1Q A;  2D1X A;  2CYZ B;  4C92 B;  4R56 A;  1K9M C;  1KG1 A;  4IUV A;  1VQL A;  3MP1 A;  3M4G A;  4M7D E;  1OZ2 A;  3M0T A;  4OB3 B;  5LJ3 g;  3CEY A;  4QQG A;  1VQ7 A;  2ZPF B;  5GAO m;  1WYX A;  2EQJ A;  4M75 B;  3WXM B;  3GIB A;  4BI4 A;  1K73 C;  3MO8 A;  4RG2 A;  2A3L A;  1Q7Y U;  3VV0 A;  4M75 C;  3ULR B;  4C8Q A;  2MIO A;  1RI9 A;  1Q82 U;  1VQ9 T;  3NTK A;  4F7U B;  2DER A;  2LX7 A;  4AFQ C;  2K4Y A;  2KMT A;  3A8M B;  3MJX A;  4EMK B;  2B8A A;  2KVQ G;  1M27 C;  4NL3 A;  2WSE E;  3RMQ A;  2HAX A;  3CPW A;  2RQT A;  4CC4 B;  2LMJ A;  4FCY A;  1B34 A;  2KT8 A;  3EG3 A;  2X35 A;  5GAN f;  2KAF A;  3OYA A;  1I07 A;  2AZS A;  4VUB A;  3EG2 A;  2JTE A;  2X9H A;  4EMH A;  3MCA B;  2OTJ Q;  1KQS S;  4ANJ A;  1RAA B;  3A98 A;  3I56 A;  2EYW A;  3G4S Q;  4D8K A;  4CI0 C;  5KYY B;  1AWO A;  1ZSZ B;  1VOM A;  3QYH B;  1GL5 A;  2RB6 A;  1MV3 A;  1BIA A;  1BU1 A;  2E5K A;  3H8Z A;  3HFN A;  1VQO T;  4PJO E;  3GF5 A;  2KYB A;  4E6R A;  4RTV A;  2XI9 A;  1OX9 A;  1Z9Q A;  1E6H A;  3EFS A;  4L6V 5;  3GBQ A;  1WNL A;  2PUK B;  1I81 A;  4OMO A;  4C5G A;  1M5Q 1;  3U23 A;  2SEM A;  1DJ7 B;  2QDY B;  2JM9 A;  2C0O A;  1AZE A;  1IO6 A;  3UAT A;  2LJ1 A;  2GTO A;  5A0D A;  2LT1 A;  4HVU A;  1B07 A;  2AZV A;  2PTK A;  2KRO A;  4RTZ A;  5IT9 E;  3EAE A;  4M7A E;  5GMK h;  2DRM A;  3V7R A;  2F5K A;  1ZQ1 A;  2XIC A;  2EPD A;  3GP8 A;  1YHQ A;  1K9M R;  4BDZ A;  2JXB A;  1S1N A;  2CH4 W;  4KGV B;  1UJ0 A;  1BCO A;  2CKK A;  3THK A;  4BI8 B;  1U8R A;  5IHK A;  2YT6 A;  3AHU A;  4M7D D;  2CUD A;  4C8Q C;  2EQK A;  3HL8 A;  2DL8 A;  2DXU A;  2E5Q A;  5KH6 A;  1VQM Q;  3E19 A;  1LVK A;  1MMA A;  3OMG A;  4C5E A;  4FM4 B;  1WA7 A;  1N27 A;  2RQU A;  1W2B A;  2BZ8 A;  3JB9 D;  2XDB A;  1VQ5 A;  4KUI A;  3JCM h;  1NPR A;  4F7U E;  1RLQ C;  1X43 A;  3CMA T;  4IKF A;  3PIO A;  1UE9 A;  4JJN K;  9ATC B;  3L2U A;  3EG9 A;  4IUU A;  2M0O A;  2RI3 A;  2E70 A;  2NUT A;  1R0B G;  2CP6 A;  4A54 A;  1QQJ A;  2AIR B;  3SDZ A;  2LRQ A;  2BIV A;  1X27 A;  5KYW B;  4BY6 C;  1SHG A;  1KD1 U;  4XU3 A;  2CP7 A;  1WHJ A;  3R6N A;  3G6E T;  2K5F A;  5GAM f;  1WXT A;  4JRI A;  3UF4 A;  1KC8 C;  2ED0 A;  4M7A C;  4X9D A;  1WZO A;  1ZA1 B;  1KQS A;  2ZPI B;  2ZZD A;  3KXT A;  3H9N A;  4PJJ A;  2DL5 A;  4DEX A;  5A2Q E;  4ZGE B;  3CBP A;  2E12 A;  2A36 A;  1VQ7 Q;  2ZPE B;  3EGD B;  2MYS A;  4Z02 A;  4MZT A;  4RCB A;  4X34 A;  3CCS A;  3CCQ A;  2DVE A;  2QQ9 A;  1TTH B;  1PD0 A;  4EPC A;  2P0P A;  4N4I A;  3CXC S;  1NM7 A;  1OYX A;  1PKT A;  3OSV A;  5GAN 4;  4PFZ A;  4PJO B;  3NGP A;  4OMN A;  1VQ9 A;  3O5Z A;  2JN0 A;  1GRI A;  5CKF A;  3TRE A;  3VS1 A;  1WPY A;  3H0I A;  1QVG A;  2XKO C;  4C5I A;  6AT1 B;  2MF2 A;  5J39 A;  4PJM A;  1VQ4 A;  4JLG A;  4M77 C;  3V7C A;  4GLM A;  2E4H A;  2VV5 A;  2KY9 A;  4FT2 A;  3HRT A;  4E2F B;  1VQM A;  3FRN A;  1YFN A;  8AT1 B;  3UPU A;  4FL6 A;  2RK1 A;  1TS9 A;  3RES A;  3EHR A;  2KR3 A;  3S3O A;  1QCO A;  2VXF A;  1YJ9 A;  1OUL A;  1M8V A;  3G71 T;  4OF1 A;  4ZTF A;  2LTO A;  1K8A U;  4R55 A;  4BDY A;  3LGL A;  2DRK A;  5EC7 A;  3PTA A;  1W2B S;  3OB9 A;  2D8H A;  4K11 A;  2QA4 T;  3EFO A;  3JCM X;  1G2B A;  1RAE B;  1VYV A;  5HK3 A;  2O9S A;  4FT4 A;  4C8Q G;  2J6K A;  3IQL A;  2RO0 A;  5C0M A;  1H92 A;  2RF0 A;  2IG0 A;  3MET A;  5IXB A;  1WIE A;  3HRU A;  1PRM C;  2EJF A;  4C92 E;  1IRX A;  5DY9 A;  1M2V B;  1SHF A;  2AKL A;  4PJO A;  2L3R A;  4LDU A;  1EIF A;  3VRZ A;  2LP5 A;  3OS1 A;  2VKN A;  3TSW A;  2DXC A;  2ZAE A;  1N5Z A;  4PJO F;  2KDS A;  4A53 A;  1T3L A;  1MMG A;  4WF2 A;  1G83 A;  2EGA A;  3JB9 I;  2HQH A;  3LH5 A;  2L3Q A;  1A0N B;  2RHZ A;  5FRN A;  1QP2 A;  3OYK A;  2OTJ A;  4J6X A;  2XG8 D;  4C0Z A;  2JMA A;  4A4G A;  1SSF A;  1TWB A;  1PNJ A;  3A8O B;  2XK0 A;  2HEQ A;  2CUB A;  2RD1 A;  3PIP A;  1SKU B;  1R77 A;  3CD6 T;  3HKS A;  2PQW A;  4AG2 C;  5I11 A;  3NMZ C;  4IUP A;  2EGE A;  1RAH B;  4E7L A;  1PRL C;  2MI6 A;  2KQW A;  3GNF B;  4XTX A;  5KE2 A;  3CXC A;  5CAI A;  1YJN T;  4F7U A;  3CBM A;  3CME Q;  3MEV A;  4JJC A;  1FX7 A;  2KE9 A;  3DLL A;  1WXB A;  1N9S A;  3FC3 A;  2RI5 A;  4Q5W A;  3CPW P;  3Q1J A;  4A4K A;  1OV3 A;  2X3X D;  2IVW A;  4OMP A;  3QG1 A;  4JRK A;  3CCJ Q;  1B34 B;  2PVD B;  2WSC E;  2ROT A;  4LD9 K;  1LCK A;  2AHJ B;  2YRC A;  4X9C A;  5L23 A;  2Z0W A;  2DD5 A;  2RN8 A;  5I2S A;  4JLI A;  3H0F A;  3JSC A;  1VQ8 A;  2ZPH B;  5A0G A;  5KYY A;  4AFU C;  1HXD A;  1ZLM A;  4MZM A;  4RKU E;  2E3H A;  4N0A A;  4KH0 B;  4DA4 A;  1WLP B;  2NUP B;  4C0G A;  1Z9Z A;  1VUB A;  3G4S A;  1VQN T;  4PFO A;  2KK4 A;  1WFW A;  3JB9 F;  4FSX A;  2CSQ A;  2CZ0 B;  4J9D A;  4MML A;  4GY5 A;  3QYG B;  3PNW C;  3PFS A;  1GXI E;  1KQS P;  3CCS T;  1YBY A;  3OYL A;  4HKE A;  1MNE A;  3CCV Q;  4Z88 A;  1K9A A;  2DJZ A;  2RQV A;  2QQB A;  2E6N A;  4CRI A;  2DVJ A;  3G71 Q;  4YTL A;  2WAC A;  3I56 Q;  5FWB A;  4AFZ C;  5KYX B;  4OB2 B;  2K3Y A;  1ZUU A;  5FU7 B;  1UTI A;  4RTY A;  3EGX A;  5KYX A;  1VQ4 Q;  3EHQ A;  4J9G A;  2RJF A;  3M5A A;  2FRW A;  4QQD A;  5I22 A;  1Q86 C;  2VGN A;  1IGU A;  5FRM A;  2A0F B;  3QDF A;  3L2W A;  2HCK A;  3TEE A;  3A1P A;  2EYZ A;  2GCX A;  2FPF A;  2O01 E;  2H3E B;  3D7S B;  1T0H A;  1LPL A;  2BUD A;  1S72 A;  1RAD B;  2V8K A;  3OY9 A;  3OYI A;  1QVG P;  2P0K A;  1IZ6 A;  1SRM A;  3CCV A;  5GAN e;  1YIJ Q;  4M78 E;  4E47 A;  5GAO l;  4JJD A;  4LDW A;  5IHN A;  2QGF B;  3REB B;  4MDW A;  1Y0M A;  2J6F A;  2RHU A;  1IXD A;  2LQK A;  4HT8 A;  2LQW A;  2LCS A;  3L2V A;  3C0C A;  4D6W A;  3RDV A;  5KCH A;  3CMA Q;  1AD5 A;  3QUI A;  4QT7 A;  4JPB W;  4C8Q B;  1QMC A;  1I5O B;  4M78 G;  2JZ2 A;  1IGQ A;  5GJV B;  1V76 A;  2XDD A;  3TCJ A;  5C6S A;  2LQ8 A;  1F1B B;  3H6Z A;  3O8V A;  3QKJ A;  2W0Z A;  1G8X A;  2YWW A;  2F2X A;  1WX6 A;  2QK0 A;  4IIM A;  1YIT T;  5CVI A;  2H3J A;  2WSF E;  2K57 A;  1WHH A;  1K4U S;  3SWN B;  2QTV A;  1GFC A;  2YRD A;  3QJY A;  1D1C A;  1OQK A;  3E2U A;  3L2Q A;  2CZ7 B;  2D9T A;  2DKG A;  1OZ3 A;  1AOJ A;  5GAN 8;  1YIJ T;  3F70 A;  4QVZ A;  3EH1 A;  1QLY A;  1X6G A;  3KUF A;  3E9F A;  1YI2 Q;  4D8D A;  1X2K A;  1QWF A;  2C0I A;  4F16 A;  3CCR Q;  3CCL Q;  4KT0 E;  4C8Q F;  1JRI A;  1W4S A;  3GOX A;  4LD6 A;  2KNB B;  1M1K U;  2EIF A;  2YUQ A;  3LLR A;  5LJ3 j;  2K5L A;  2QEX A;  2F1L A;  1MHN A;  1I8F A;  4HCC A;  1XOV A;  4EMG A;  2PNI A;  3ZFJ A;  1VQ9 Q;  1ACM B;  3M53 A;  2CP2 A;  3OYF A;  1SG5 A;  2LCL A;  1NLO C;  2P84 A;  1BIB A;  1X6B A;  1Q86 R;  2ZPG B;  2C06 A;  2OTL A;  2BZX A;  1KC8 R;  2KRM A;  5CR2 A;  2L3P A;  1UHC A;  2CZ6 B;  3I56 T;  1C6V X;  2FO0 A;  1WJR A;  2LX9 A;  4UC4 A;  5J26 A;  3QSU A;  2GNC A;  3CCL A;  2E1H A;  4Y91 A;  3SWN C;  3G4S T;  1VQN A;  3RBB B;  2L3S A;  1TSF A;  1TG0 A;  5DLO A;  3CCS Q;  1NE8 A;  2EYQ A;  2I2L A;  4TVR A;  5D7U A;  2DIQ A;  3L2Z A;  1RAI B;  1HYO A;  1M8M A;  2K3X A;  4Z89 A;  4J6W A;  2DLP A;  1RAG B;  3OQ5 A;  2MCN A;  3OBY A;  1Q7Y C;  2DTI A;  3JAM E;  4AT1 B;  3EGD A;  4ELY C;  3AT1 B;  5GAO q;  4A4H A;  5LL6 S;  3CD6 Q;  1C1A A;  1OU8 A;  2GTJ A;  4KUL A;  4DOV A;  1M3A A;  4L59 A;  3R6O A;  3KFV A;  5M9O A;  4V2S A;  2YUN A;  4AFS C;  2MWP A;  3SD4 A;  4BB7 A;  4HCB A;  4EDU A;  2DZC A;  1PHT A;  1H3Z A;  4M75 D;  2D6F A;  4BE1 A;  4RMO A;  1UB4 A;  2KXD A;  2RA2 A;  4LDX A;  1OU9 A;  3JCM b;  4OP0 A;  4C8Q D;  2DTH A;  4KUD K;  4XTZ A;  2X4Y A;  1OEB A;  2ESW A;  2HNI A;  1QW1 A;  2J7I A;  4E7H A;  2QAZ A;  2M9U A;  1OPL A;  4QVC A;  2BE7 D;  2XDP A;  1YN8 A;  2QTX A;  3CC2 T;  1Y96 A;  2V26 A;  4HVV A;  2ROL A;  2GGR A;  1YP5 A;  1NJI C;  3EFR A;  4PK4 A;  1ZUY A;  1M90 C;  4LNP A;  2V8I A;  2VAS A;  1BI0 A;  3CCR A;  3BW1 A;  1T0J A;  2FZG B;  1D3B B;  1VQ6 A;  2E65 A;  4M7A F;  3M0U A;  2EQM A;  3CCM Q;  4XAX B;  1Q81 U;  4FYW B;  1D3B A;  3I9Q A;  1AHJ B;  3OYG A;  1T3S A;  3CC2 Q;  2K3B A;  3G1J A;  2VUB A;  4Y92 A;  4ZN1 A;  3JCM e;  1SSH A;  3PGG A;  4FSS A;  1VQL Q;  4J7I A;  3V7S A;  1KHI A;  1ZHI A;  3REA B;  1IB8 A;  1M4Z A;  3OBW A;  4F14 A;  1HK9 A;  5ECA A;  4M78 A;  2LQN A;  1M2V A;  2SRC A;  1KQ2 A;  1CSK A;  2EWN A;  2DYB A;  1NBE B;  2L2P A;  4AMC A;  2RK2 A;  1P92 A;  3JB9 H;  2X3W D;  1QVG S;  3CCJ A;  2LVM A;  2MWO A;  1N9R A;  1Y96 B;  2BTT A;  2O88 A;  3CCL T;  1RAC B;  4FW2 A;  4DOW A;  2KXC A;  5FRO A;  2HD0 A;  2RM4 A;  1K9M U;  2E64 A;  1TUC A;  4PL6 A;  1K8A R;  4BY6 B;  1H8K A;  2G3R A;  2QAS A;  2PUO B;  5DLQ E;  1VQ7 T;  2J06 A;  2V1R A;  3FEO A;  2QYZ A;  3X28 B;  1OI1 A;  3PVQ A;  2K79 A;  2RJE A;  2OI3 A;  1QKX A;  4M77 D;  1XNI A;  3CME A;  2DJQ A;  5CK9 A;  1Q82 C;  2HMA A;  1ZSG A;  3OA6 A;  4RTW A;  3MP6 A;  4ZN3 A;  1UGP B;  2QQA A;  4B9X A;  1WHL A;  3JB9 J;  2ECZ A;  4OGE A;  1KFZ A;  2E41 A;  2DEU A;  4A4E A;  3OYM A;  1PD1 A;  2OAW A;  5IXF A;  3OYH A;  3CCR T;  3X20 B;  4RTX A;  2LNV A;  2COZ A;  1YJN A;  1QVP A;  3VKI A;  2KBT A;  4EIK A;  1VQ6 T;  4DEY A;  1HSQ A;  1JU5 C;  4J9H A;  2M0Y A;  2O2O A;  3HP9 A;  4HCK A;  4M77 G;  3DLM A;  4FYY B;  4CC7 A;  4M7D A;  2DK3 A;  4N4G A;  1M1G A;  3P8D A;  1VQ8 Q;  2HDA A;  4BUG A;  1YIT Q;  4F7U G;  2P4T A;  2M51 A;  2R5A A;  1BI1 A;  2EJG A;  1N8R U;  1VQM T;  4LE9 A;  1Q95 G;  1W70 A;  4M7D G;  1VQ4 T;  2EBP A;  3MEW A;  2EFI A;  1VQK Q;  5GMK j;  3URG A;  5GAM e;  4PLI A;  2K2V A;  2QI2 A;  3CCV T;  3BDU A;  1OX8 A;  1YJ9 Q;  2FRY A;  2J6O A;  3QPH A;  3CC4 A;  4E7J A;  2XID A;  2DX1 A;  2O9V A;  3RUX A;  3EGX B;  2PZ1 A;  2RQW A;  4Z8A A;  4HXJ A;  2ABL A;  3OMC A;  1GBQ A;  2QXF A;  1KHC A;  4E7K A;  1K8A C;  1EZZ B;  2DYI A;  3C94 A;  3UDC A;  3NTH A;  2F2V A;  2VVK A;  3UA7 A;  2RHI A;  2JJ9 A;  4QKU A;  3TVT A;  3M9Q A;  2AK5 A;  3SFM A;  3OS5 A;  2EYX A;  1NYG A;  2C0T A;  3G7Z A;  2BKD N;  1AWW A;  2O4X A;  2E3I A;  4B9W A;  3JV3 A;  4HCZ A;  1TOV A;  5FU6 C;  2FZC B;  1ZSZ A;  4PJN A;  5LJ5 h;  2YXY A;  2X51 A;  3QZ9 B;  3DB4 A;  3ME9 A;  1VQ8 T;  2LDM A;  1FXX A;  4A4F A;  3FLG A;  2QG9 B;  3GNG A;  4F04 B;  2JT4 A;  4J83 A;  4L5G A;  5J3B A;  4FU6 A;  4OGC A;  4KBM B;  3UWN A;  2DNU A;  1K76 A;  4ATO A;  4O5V A;  1K73 U;  1Y57 A;  1KK7 A;  2KRS A;  4JDS A;  4HT9 A;  4PKC C;  1YIJ A;  2K7A A;  1OOT A;  1W1F A;  2RJC A;  4EMK A;  3I55 Q;  1M2O A;  3RKW A;  2DAQ A;  1JBM A;  5GAN 6;  3ZL7 C;  5HKC A;  2COW A;  3OW2 P;  5AT1 B;  2X4W A;  3BFM A;  3L2R A;  3CC7 A;  1G3S A;  4HVW A;  2LNH B;  1MV0 B;  3X25 B;  2IPO B;  3OS0 A;  4JRQ A;  1XTD A;  2LCC A;  4OML A;  1N6A A;  3PMT A;  3ZBD A;  5HK0 A;  2JVV A;  5CKB A;  4JS4 A;  2CH4 A;  1VQL T;  3G6E A;  1UEC A;  1GBR A;  4QQ6 A;  5AYF A;  1WHG A;  1KD1 R;  2PVG B;  3FJ5 A;  2JW4 A;  4J8O A;  1Q7Y R;  2CRE A;  3P8B B;  2MMP A;  2M16 A;  2OTL Q;  1E6G A;  1S72 Q;  1O9S A;  3X24 B;  1YNZ A;  1TU0 B;  4J7F A;  1JJ2 A;  3EG9 B;  4RUG A;  5GAO n;  1KQ1 A;  4F17 A;  2V8J A;  2JS2 A;  1NLP C;  3V8K A;  3JCM Q;  2DZ9 A;  3OYJ A;  2DF6 A;  3I55 T;  2RMO A;  3SEM A;  1PCX A;  4DBR A;  1VQP T;  1NZ9 A;  2J05 A;  1PKS A;  2CGH A;  2K2M A;  3EG1 A;  1D1B A;  2DA9 A;  1NEB A;  4NS5 A;  1YI2 A;  3VS4 A;  3VS2 A;  3A5Z B;  2Y90 A;  4BAC A;  1SPK A;  1ZX6 A;  3CXC P;  3G71 A;  3LYI A;  3TSZ A;  2PU9 B;  5KYW A;  3SHW A;  1S72 T;  2FG0 A;  2OTL T;  2Y4Y A;  4DBF A;  3VS5 A;  4XU1 A;  2K5I A;  2K6D A;  5GAM g;  3BDL A;  3JCM c;  1UGQ B;  3OSS C;  1UGR B;  1RI0 A;  2DET A;  1G3T A;  3EGU A;  3JCM W;  1M90 R;  2EW3 A;  2EJ9 A;  1VIF A;  1I1J A;  3M0P A;  3QZ5 B;  3I5R A;  5L8R E;  5LJ5 d;  2HL3 A;  1TUG B;  1YWP A;  4F7U F;  1I5L A;  4ZNX A;  2DO3 A;  3PT9 A;  5FLX E;  1BCM A;  1IHW A;  1TUD A;  1UEB A;  1H3H A;  2XU8 A;  5CQY A;  2XMF A;  3TU4 K;  1VA7 A;  4PJO G;  3CCE A;  2CZ1 B;  1UJY A;  4M75 F;  5CKH A;  3FDR A;  3M0Q A;  2RH2 A;  4C5H A;  3CCQ T;  1AWX A;  4JUV A;  1H64 1;  5CKD A;  3CCU Q;  5D6Y A;  2YHT A;  2HBW A;  1QVF A;  2GF7 A;  4C92 F;  5GAM j;  2JUF A;  3S6W A;  3RR6 A;  1TXQ A;  1C0M A;  1UG1 A;  4BE0 A;  4XTY A;  2XD0 A;  4M77 F;  1JB0 E;  4M7D F;  1J3T A;  1BYM A;  1WDX A;  1M3C A;  4RTT A;  1NEG A;  2YLC A;  3M0R A;  3KBG A;  1KD1 C;  1ABO A;  4FW1 A;  4M78 C;  1B3Q A;  3CCU A;  1D1A A;  3VS0 A;  4PNO A;  1D09 B;  2HZY A;  1X2Q A;  4CC2 A;  1QP3 A;  2JNG A;  1ZBJ A;  1FMW A;  4OB1 B;  3HHT B;  4XTU A;  2HQX A;  1Y07 A;  4JS5 A;  3S3M A;  1WXU A;  2DIL A;  2QEX T;  3CC4 T;  1YI2 T;  3I55 A;  1OPK A;  2ED1 A;  4M7A A;  3ASK A;  1PWT A;  3HFO A;  2QGG A;  4LDY A;  3JCM J;  4LN2 A;  4FIB A;  3E1S A;  1WHM A;  2M02 A;  2O31 A;  3A8G B;  3FJP A;  4M77 B;  5IAY A;  2ENM A;  1V1C A;  1G5V A;  1VQK T;  1TH7 A;  1SF9 A;  1YWO A;  2VC8 A;  4J9E A;  2YLB A;  1V29 B;  3CQT A;  3JRZ A;  1WQW A;  2R58 A;  1CKA A;  3J81 E;  3JCM V;  5GMK i;  3MPU B;  3QO3 A;  2HL5 C;  3RMS A;  1VYT A;  3CC7 T;  3V8J A;  5LJ5 e;  1GFD A;  1Q81 R;  1R0C B;  1WHK A;  5LJ3 d;  2JS0 A;  3G6E Q;  3QWY A;  2NUP A;  7AT1 B;  1YCS B;  5DM7 R;  2HSE B;  2HKN A;  2VXE A;  5KCO A;  1X6O A;  2QDL A;  3OYD A;  3OS2 A;  3CME T;  4ZTJ A;  1IRE B;  1YHQ T;  3CCM A;  2F5T X;  2A28 A;  3VYH B;  1VQ6 Q;  2ATC B;  1HD3 A;  3RIR A;  3CBO A;  3BE3 A;  3JB9 G;  3NHN A;  2KSS A;  2KI7 A;  2BE9 B;  3M54 A;  4KGX B;  4DQ2 A;  1M9S A;  1BB9 A;  1PSF A;  2OAU A;  1UGV A;  5IH2 A;  2KRN A;  2EYY A;  5FU6 B;  4GLK A;  3OYE A;  5LJ5 f;  2EKO A;  5CQX A;  3VS3 A;  4RTU A;  3VYG A;  1WGS A;  2R57 A;  1IHV A;  2DMO A;  1VIE A;  1ZUK A;  4LDV A;  1FWZ A;  2KEA A;  2H8H A;  4Y28 E;  3JCM f;  1YCY A;  2EAY A;  3BY7 A;  1MND A;  2D8J A;  2CDT A;  1NYF A;  1ZBX A;  3PE0 A;  5GAM d;  3M56 A;  4FYX B;  3JCM g;  4RCC A;  1AEY A;  4PJL A;  1WQ7 A;  2DL4 A;  1NG2 A;  1JXO A;  5KE3 A;  1UDL A;  2DBK A;  4DBH A;  1YJW Q;  1QWE A;  1U1S A;  3H0H A;  2RI2 A;  3MEU A;  4J6Y A;  3CCU T;  1X75 C;  2L8D A;  3QDR B;  2GFU A;  3CD6 A;  1LOJ A;  4M78 F;  2FPE A;  4GBQ A;  1UUE A;  3L1A A;  1KC8 U;  1WI7 A;  2D0Q B;  1M3B A;  3VUB A;  5GAN j;  2RHY A;  3DKM A;  3RKY A;  1SRL A;  5LJ5 j;  2FPD A;  3NTI A;  1NJI U;  4PJO D;  2QA4 Q;  3HTR A;  1CKB A;  5FW9 A;  1GCQ C;  5GAN 7;  2MK5 A;  4ESR A;  5KYN A;  1AWJ A;  4E7I A;  4C92 C;  4HA8 A;  3M55 A;  2CT3 A;  1XJW B;  2JM8 A;  3OW2 A;  2CS7 A;  2M1H A;  1Q81 C;  4PLL A;  4X1V A;  4N4H A;  1VQO Q;  4O6J A;  1UFF A;  2VGM A;  3QJ6 A;  2K9G A;  2VB6 A;  4KGZ B;  1VQO A;  2NLU A;  4RG8 A;  1HJD A;  2DIG A;  2FVU A;  1PM3 A;  2R5M A;  1D0Z A;  2RNA A;  3NPF A;  1O75 A;  1MMN A;  1BI3 A;  1JEG A;  1KJW A;  4BI3 A;  3VS6 A;  5KYU A;  3S3N A;  4M75 E;  2IIM A;  2A37 A;  3HPW A;  1YIT A;  2RHX A;  3E9G A;  5KYU B;  2PVO B;  3C4S A;  1K73 R;  4LUE A;  2F69 A;  1Y71 A;  2MOX A;  1VQK A;  4XTW A;  1BI2 A;  1VQP A;  3LX7 A;  2FHD A;  4P5N A;  3RKX A;  3MKD A;  3JCM P;  2P0Q A;  1YJW T;  4M75 A;  4OMQ A;  4M7D C;  1ARK A;  2F2W A;  5GAO p;  2DXT A;  4JJB A;  2KGT A;  4M77 E;  4KRT A;  2ZGW A;  3OYB A;  2JTM A;  1E7O A;  2GQV A;  1U5S A;  4IUR A;  4J9C A;  1NPP A;  2LT4 A;  5IHI A;  2NUT B;  4E7S A;  1RLP C;  1BK2 A;  3J80 E;  2OJ2 A;  3C12 A;  1U3O A;  1M30 A;  1B7T A;  3T9N A;  2ZPB B;  5I2M A;  3VJP A;  3FIF A;  5GMK m;  4ORZ A;  5GAN 5;  3DB3 A;  3H41 A;  2DD4 A;  4ME7 A;  2QQR A;  2NYS A;  3HRS A;  1GCP A;  2DE0 X;  2FYK A;  1VQ5 T;  4EMK C;  5IN1 A;  1PG5 B;  4XK8 E;  3SWN A;  3A8L B;  1XQH A;  2MPX C;  3LWI A;  4QW2 A;  2O4X B;  2XHC A;  1MMD A;  3N5B B;  5GAN d;  1D0X A;  2JMC A;  1EFN A;  3WVE B;  2YDL A;  3ER0 A;  5GAN h;  2DL7 A;  1ZA2 B;  1X01 A;  2DBM A;  1X69 A;  3NFC A;  3M58 A;  1LNX A;  3QBY A;  5GMK l;  1AT1 B;  2HQE A;  2HBP A;  2CP3 A;  1MUZ A;  4QVD A;  1K0X A;  2KYM A;  1PC0 A;  2EKH A;  1R8O B;  2I0N A;  2A08 A;  5CO7 A;  1JO8 A;  1RAF B;  1ZSZ C;  3QII A;  3A8H B;  8ATC B;  3PVL A;  2DL3 A;  5D6X A;  5D6W A;  2BZY A;  5HY6 A;  2RJD A;  2HKQ B;  2YSQ A;  3CCE Q;  5FU7 C;  3OW2 S;  2YUP A;  2L89 A;  2DTO A;  2GBQ A;  1M90 U;  4NOY A;  3EG0 A;  2AKK A;  1N8R C;  4BD3 A;  2L5Q A;  3VS7 A;  1QKW A;  1I4K 1;  3QHS A;  1RL2 A;  1AVZ C;  2LC4 A;  4FYV B;  4C92 G;  4PFP A;  2NUZ A;  1KIK A;  3CC2 A;  1YHQ Q;  2X4X A;  5GAN 3;  3VRY A;  5GAN g;  5LJ3 e;  4C8Q E;  1JQQ A;  2GQI A;  1BBZ A;  3HSB A;  1EX4 A;  1NJI R;  3LGF A;  3M57 A;  2LJ3 A;  1SEM A;  4C0D B;  2EQU A;  1WJS A;  4JZ3 A;  2VWF A;  2DFU A;  1JJ2 S;  3V8L A;  2DM1 A;  2EVR A;  4M78 B;  3SB2 A;  1JJ2 P;  3I5S A;  2FZK B;  4AG1 C;  2CP0 A;  4OVA A;  5GAO r;  4J5Y A;  4BE2 A;  1KSW A;  4LUD A;  5FWC A;  1JXM A;  4KH1 B;  3PMI A;  3MEA A;  1LJO A;  1QCN A;  3M59 A;  3M4Y A;  4JZ4 A;  4IUT A;  1W6X A;  2YRV A;  3X26 B;  4E7Z A;  5LJ3 f;  2A7Y A;  3OYY A;  3GPL A;  2QQS A;  3J7A F;  2ZCF B;  3CC4 Q;  3MHX A;  3CCQ Q;  4M75 G;  1M1K R;  3RER A;  1BKB A;  1M1F A; 
#chains in the Genus database with same CATH homology
 1B3Q A;  1ABQ A;  3VS0 A;  3EHR A;  2KR3 A;  3M0U A;  1X2Q A;  4CC2 A;  1ZBJ A;  1AZG B;  3I9Q A;  2HSP A;  1T3S A;  1U06 A;  2DRK A;  5EC7 A;  4A63 B;  2K3B A;  2D8H A;  4K11 A;  4Y92 A;  1G2B A;  4J9B A;  1SSH A;  1WXU A;  2DIL A;  4M4Z A;  4FSS A;  1VYV A;  1K1Z A;  1OPK A;  2EQI A;  2O9S A;  4J9F A;  3REA B;  2ED1 A;  2J6K A;  1PWT A;  3IQL A;  1FMK A;  3I35 A;  1H92 A;  2RF0 A;  4F14 A;  5ECA A;  4LN2 A;  5IXB A;  2LQN A;  1WIE A;  2SRC A;  1PRM C;  2O31 A;  2W10 A;  1SHF A;  2AKL A;  1CSK A;  4J9I A;  3UA6 A;  2ENM A;  1V1C A;  2DYB A;  5GJW B;  3VRZ A;  2LP5 A;  1YWO A;  2L2P A;  1I0C A;  2VKN A;  3TSW A;  2X3W D;  1N5Z A;  4R0K A;  4J9E A;  3CQT A;  2BTT A;  1CKA A;  2O88 A;  1T3L A;  2G6F X;  1G83 A;  1QCF A;  2EGA A;  2KXC A;  3LH5 A;  2L3Q A;  1A0N B;  1VYT A;  1GCQ A;  2EGC A;  1GFD A;  2P4R A;  1FYN A;  3RNJ A;  2LZ6 B;  4IIO A;  1TUC A;  2CT4 A;  2JS0 A;  2JMA A;  2LJ0 A;  3QWY A;  1VYU A;  2KT1 A;  1H8K A;  1PNJ A;  2HEQ A;  1YCS B;  2FEI A;  2CUB A;  2QDL A;  2J06 A;  2V1R A;  4AG2 C;  5I11 A;  3NMZ C;  3PVQ A;  2K79 A;  2EGE A;  2OI3 A;  2B86 A;  2A28 A;  1PRL C;  1QKX A;  2DJQ A;  1HD3 A;  5HCK A;  2RQR A;  4CC3 A;  1ZSG A;  4WCI A;  2CSI A;  4RTW A;  3NHN A;  3M0S A;  1BB9 A;  2L0A A;  1RUW A;  4JJC A;  1UGV A;  2D0N A;  2ECZ A;  2KE9 A;  1WXB A;  5IH2 A;  2KRN A;  1KFZ A;  2EYY A;  1K0S A;  1UHF A;  1OV3 A;  2X3X D;  3VS3 A;  4RTU A;  2NWM A;  2OAW A;  4OMP A;  2DMO A;  5IXF A;  3QWX X;  1ZUK A;  4RTX A;  2ROT A;  1LCK A;  2YUO A;  2KEA A;  2H8H A;  4OMM A;  2KBT A;  5L23 A;  4EIK A;  2D8J A;  2RN8 A;  4DEY A;  1HSQ A;  1JU5 C;  4J9H A;  2CDT A;  1NYF A;  2M0Y A;  2O2O A;  3PE0 A;  4HCK A;  2RPN A;  3H0F A;  4CC7 A;  1AEY A;  2V1Q A;  2D1X A;  2DL4 A;  1NG2 A;  4AFU C;  1JXO A;  1ZLM A;  1UDL A;  2DBK A;  1WLP B;  2HDA A;  1QWE A;  1Z9Z A;  2M51 A;  3H0H A;  3M0T A;  4LE9 A;  1WFW A;  2FPE A;  4GBQ A;  1UUE A;  1WYX A;  2CSQ A;  1W70 A;  4J9D A;  1WI7 A;  1M3B A;  2EBP A;  1SRL A;  2FPD A;  2FRY A;  2J6O A;  4Z88 A;  3ULR B;  1K9A A;  2MIO A;  1RI9 A;  2RQV A;  1CKB A;  5FW9 A;  1GCQ C;  2DVJ A;  2LX7 A;  4AFQ C;  2DX1 A;  2O9V A;  5FWB A;  4ESR A;  4AFZ C;  1AWJ A;  1M27 C;  2PZ1 A;  1ZUU A;  2RQW A;  2CT3 A;  4Z8A A;  4HXJ A;  2ABL A;  2JM8 A;  1GBQ A;  1UTI A;  4RTY A;  2RQT A;  3EHQ A;  4J9G A;  4CC4 B;  2LMJ A;  4X1V A;  1UFF A;  2FRW A;  2K9G A;  5I22 A;  2KT8 A;  3EG3 A;  1HJD A;  2F2V A;  2HCK A;  1I07 A;  2AZS A;  2VVK A;  3UA7 A;  2EYZ A;  2JTE A;  3EG2 A;  3TVT A;  2AK5 A;  2RNA A;  2EYX A;  3NPF A;  2FPF A;  1JEG A;  1KJW A;  1NYG A;  2C0T A;  3A98 A;  2EYW A;  3VS6 A;  1T0H A;  4D8K A;  1AWW A;  1AWO A;  2IIM A;  2A37 A;  3JV3 A;  1GL5 A;  1MV3 A;  1SRM A;  1BU1 A;  2E5K A;  4LUE A;  4JJD A;  2KYB A;  4E6R A;  4RTV A;  5IHN A;  2MOX A;  3REB B;  1Y0M A;  1Z9Q A;  2J6F A;  1E6H A;  2LQW A;  2LCS A;  3GBQ A;  1ARK A;  4OMQ A;  3C0C A;  2F2W A;  2JT4 A;  4JJB A;  2KGT A;  4OMO A;  4KRT A;  3U23 A;  1AD5 A;  1E7O A;  2SEM A;  1U5S A;  4QT7 A;  2JM9 A;  2C0O A;  2DNU A;  1K76 A;  4JPB W;  1AZE A;  4J9C A;  1Y57 A;  1IO6 A;  3UAT A;  2KRS A;  5GJV B;  5IHI A;  2LJ1 A;  2GTO A;  1RLP C;  1BK2 A;  2K7A A;  2OJ2 A;  4HVU A;  1OOT A;  1W1F A;  1B07 A;  2AZV A;  2PTK A;  1U3O A;  2KRO A;  4RTZ A;  1M30 A;  2W0Z A;  2DRM A;  3ZL7 C;  2EPD A;  2F2X A;  1WX6 A;  4IIM A;  4ORZ A;  3H41 A;  4HVW A;  2LNH B;  2JXB A;  1S1N A;  1MV0 B;  2CH4 W;  1K4U S;  1GFC A;  1UJ0 A;  1GCP A;  2DE0 X;  3THK A;  5IHK A;  2YT6 A;  1AOJ A;  2CUD A;  4OML A;  2DL8 A;  1QLY A;  1X6G A;  2CH4 A;  4D8D A;  1UEC A;  2JMC A;  1EFN A;  1X2K A;  1QWF A;  2C0I A;  2YDL A;  4F16 A;  1GBR A;  2DL7 A;  2DBM A;  1WA7 A;  3FJ5 A;  2JW4 A;  1X69 A;  2RQU A;  2BZ8 A;  2KNB B;  2CRE A;  1MUZ A;  2YUQ A;  1E6G A;  1K0X A;  2KYM A;  1YNZ A;  1RLQ C;  1X43 A;  2EKH A;  1XOV A;  2PNI A;  2I0N A;  2A08 A;  1UE9 A;  4RUG A;  1JO8 A;  3PVL A;  4F17 A;  2DL3 A;  2JS2 A;  1NLO C;  2BZY A;  1NLP C;  1X6B A;  2DF6 A;  2RMO A;  3SEM A;  2YSQ A;  2BZX A;  2KRM A;  2J05 A;  2L3P A;  1PKS A;  1UHC A;  2FO0 A;  2K2M A;  2YUP A;  2GNC A;  3EG1 A;  1X27 A;  2DA9 A;  1NEB A;  3RBB B;  2GBQ A;  3VS4 A;  2L3S A;  3VS2 A;  1SHG A;  1TG0 A;  3EG0 A;  1SPK A;  2AKK A;  1ZX6 A;  3R6N A;  3TSZ A;  3VS7 A;  1QKW A;  3SHW A;  1WXT A;  2FG0 A;  3UF4 A;  3VS5 A;  2ED0 A;  2K6D A;  1M8M A;  1AVZ C;  4Z89 A;  2DLP A;  2NUZ A;  1KIK A;  2MCN A;  2DL5 A;  4DEX A;  3EGU A;  3VRY A;  2EW3 A;  2A36 A;  2GTJ A;  1I1J A;  3M0P A;  1JQQ A;  1M3A A;  1BBZ A;  2GQI A;  3I5R A;  1YWP A;  3KFV A;  4ZNX A;  2YUN A;  2LJ3 A;  4AFS C;  1SEM A;  1TUD A;  1H3H A;  4JZ3 A;  2VWF A;  2XMF A;  1VA7 A;  1PHT A;  1UJY A;  2DM1 A;  2KXD A;  2EVR A;  1NM7 A;  3I5S A;  3M0Q A;  4AG1 C;  1PKT A;  1AWX A;  1KSW A;  4LUD A;  5FWC A;  1JXM A;  3NGP A;  4OMN A;  2HBW A;  1OEB A;  2ESW A;  3O5Z A;  2J7I A;  1GRI A;  3VS1 A;  3H0I A;  4JZ4 A;  1OPL A;  1UG1 A;  1W6X A;  1YN8 A;  1J3T A;  4HVV A;  2ROL A;  2GGR A;  1YP5 A;  4GLM A;  1WDX A;  1M3C A;  1NEG A;  1ZUY A;  3M0R A;  4RTT A;  4LNP A;  1T0J A;  1ABO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...