2KROA

Rdc refined high resolution structure of the third sh3 domain of cd2ap
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
b'GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kroA00
2CH4W 2AKLA 1MV0B 3VRYA 4OMNA 4ESRA 1QCFA 5EC7A 4HCKA 1T3LA 3NHNA 2C0TA 1LCKA 4JZ4A 5IHIA 1TG0A 2RF0A 1Z9ZA 1W6XA 4ORZA 1GBRA 2D0NA 4GLMA 2MIOA 2JS0A 1JU5C 2EVRA 4J9IA 5ECAA 2LZ6B 4GBQA 3H0IA 4ZNXA 1VA7A 1XOVA 2KBTA 1UECA 1Y0MA 4LUDA 2LQNA 2GTOA 2K79A 1SEMA 2JM8A 4OMLA 2X3WD 1MV3A 1WXUA 4K11A 2B86A 1CKAA 2EYYA 2DL5A 1I1JA 4RTVA 2CUBA 2I0NA 2KRMA 2LX7A 2JXBA 4J9HA 1T0HA 4JJDA 3UATA 1I07A 2H8HA 3RNJA 1BB9A 1G83A 1UDLA 1OPKA 3VRZA 1AZGB 1AD5A 2M0YA 3I5SA 5FWCA 4F16A 1K0XA 4J9BA 2FRYA 1UJYA 1AOJA 2DBKA 4IIMA 2P4RA 1X2QA 2C0OA 2DJQA 1WXTA 2EW3A 3QWXX 2DNUA 2DBMA 4EIKA 2YT6A 2EYZA 2OI3A 1B07A 2EGEA 1RI9A 2K7AA 1KJWA 3R6NA 1GFDA 2KRSA 1AZEA 4AG2C 3UA7A 2K6DA 1ARKA 1EFNA 1AWWA 3THKA 2ED0A 3VS2A 1ABOA 2L2PA 1QKWA 2PZ1A 4JJBA 2KGTA 2BZXA 1ZUKA 3KFVA 2CH4A 2RQVA 4RTWA 1WXBA 1WFWA 2DLPA 3EG1A 1KIKA 2EBPA 5IHKA 4F14A 3EG3A 2CUDA 1HJDA 4D8KA 2LMJA 4X1VA 1UFFA 1I0CA 2KRNA 1PWTA 4CC4B 5GJVB 2FG0A 1NG2A 2FRWA 1A0NB 1NYGA 1M3CA 2YDLA 2ENMA 3PVLA 1CSKA 2EQIA 3RBBB 2L0AA 3H0FA 2AK5A 1JXOA 2W0ZA 2DILA 2CSIA 3UA6A 1PRMC 4IIOA 3M0RA 5HCKA 1N5ZA 3H41A 4OMQA 1FYNA 1YP5A 2JT4A 3QWYA 1J3TA 2EGAA 1HD3A 2KYBA 5FWBA 4Y92A 1AWXA 3M0TA 1GCQA 2KT8A 2EPDA 1Z9QA 2DMOA 4QT7A 2RQUA 4LE9A 4JPBW 2F2VA 3FJ5A 1GBQA 4KRTA 1BBZA 3TSZA 3M0QA 2J6KA 1SPKA 3VS1A 4A63B 1JXMA 3VS6A 5IXFA 2XMFA 2L3PA 2E5KA 2RNAA 2ROTA 3I5RA 2GQIA 2GNCA 2YUPA 1PRLC 2GGRA 1V1CA 3I9QA 2KXDA 2PTKA 1SRMA 2ECZA 3VS3A 1X43A 1YWOA 2JM9A 3NGPA 5IHNA 1RUWA 3EG0A 2OAWA 2CT3A 1K9AA 1W70A 2LJ0A 4LN2A 2EGCA 3VS0A 1NLOC 4CC3A 2J06A 1JQQA 1SHGA 3M0PA 2AZSA 2AZVA 1K76A 4CC7A 1U3OA 1S1NA 2DVJA 1TUCA 2JTEA 3I35A 4J9FA 3EGUA 1QLYA 2LP5A 1WYXA 2CSQA 1Y57A 1GRIA 2KNBB 5I22A 1TUDA 2VKNA 4AFZC 2F2XA 2J05A 2FPDA 5IXBA 2DL7A 2JMCA 2SEMA 2KEAA 3IQLA 1X2KA 3M0SA 1NEBA 5L23A 3C0CA 1M3AA 1GCQC 2J7IA 1ZUYA 1SHFA 2C0IA 3JV3A 2KXCA 3SEMA 2DYBA 4JZ3A 4J9DA 3TVTA 1ZSGA 4DEYA 2A28A 1E6GA 1M27C 3UF4A 2EYXA 5IH2A 3O5ZA 2FEIA 1KSWA 2HCKA 2J6FA 3EHQA 1PKSA 2VVKA 4D8DA 4Z88A 3VS4A 2YUOA 4RTXA 1YNZA 2HEQA 1RLPC 3SHWA 1UUEA 4AFQC 2LQWA 4AFSC 3LH5A 2K3BA 2RQWA 1JEGA 1OV3A 3ULRB 1GL5A 1UE9A 3M0UA 3H0HA 4HVWA 1OOTA 2LNHB 2O88A 2V1RA 1ZUUA 1AWOA 3VS5A 2SRCA 1ZLMA 2KYMA 2A08A 1T0JA 2O31A 3U23A 1M30A 4R0KA 1KFZA 1GFCA 3CQTA 2M51A 1QKXA 2L3QA 2FPFA 3TSWA 2PNIA 2YSQA 1MUZA 3EG2A 2JMAA 4AFUC 2DRMA 1NYFA 1QWFA 4CC2A 4HVUA 3REAB 1BU1A 4RTZA 1ABQA 1UGVA 2ESWA 2CT4A 4WCIA 1AEYA 1M8MA 1UG1A 4RUGA 2LCSA 3VS7A 1AVZC 1U06A 1T3SA 1VYUA 2HBWA 2DL3A 1YWPA 4DEXA 2BZYA 1PHTA 2O9SA 2RMOA 4HXJA 1RLQC 2HSPA 2IIMA 2KE9A 3REBB 2JS2A 4FSSA 1K0SA 4AG1C 2X3XD 3PE0A 4J9GA 2ED1A 4OMOA 2MOXA 1UTIA 4Z8AA 1X69A 2VWFA 2RPNA 1VYVA 1WIEA 2D1XA 1OPLA 1K1ZA 4J9EA 3ZL7C 2DL8A 1X6BA 2YUQA 4RTTA 2DRKA 1M3BA 1CKBA 1X27A 4LUEA 1GCPA 1WA7A 4HVVA 4RTYA 1UJ0A 2FO0A 2A37A 1K4US 2GBQA 2RN8A 1AWJA 2O2OA 1WLPB 2DA9A 1X6GA 1E7OA 3NMZC 4JJCA 2O9VA 2OJ2A 1U5SA 1H92A 2RQTA 1JO8A 1SRLA 4OMPA 5GJWB 1WI7A 2DE0X 2CDTA 1YN8A 4LNPA 3A98A 1BK2A 1WDXA 1PNJA 1QWEA 2F2WA 1HSQA 2BZ8A 1UHFA 4RTUA 2K2MA 2G6FX 3PVQA 1SSHA 2RQRA 2KR3A 2L3SA 1H8KA 1NEGA 1NLPC 2D8JA 2EYWA 2HDAA 2DF6A 2YUNA 2D8HA 1YCSB 1UHCA 1H3HA 4J9CA 2EKHA 1VYTA 5I11A 1B3QA 1NM7A 3EHRA 2LJ3A 1WX6A 4F17A 1ZX6A 1ZBJA 1W1FA 2V1QA 4Z89A 4E6RA 2MCNA 2A36A 3NPFA 1E6HA 2K9GA 2GTJA 2NWMA 2W10A 1G2BA 5FW9A 4M4ZA 2BTTA 2KT1A 1IO6A 2J6OA 1OEBA 2DL4A 4OMMA 2DM1A 2QDLA 2JW4A 1FMKA 2ABLA 2AKKA 2CREA 3GBQA 2NUZA 2LJ1A 2DX1A 2FPEA 2ROLA 1PKTA 2KROA
chains in the Genus database with same CATH superfamily
1M2OA 2DXCA 1XJWB 3E9FA 3CMEQ 1IZ6A 2QDYB 3G4SQ 4ESRA 3HKSA 1M1KU 1VQOQ 2DXUA 1T3LA 4M75E 1N8RC 5IHIA 1W2BA 2RF0A 2DERA 2D0NA 5LJ3g 1FX7A 2JS0A 1JU5C 5KYWA 4J9IA 2E1HA 4GBQA 5KCOA 2YRDA 2DIGA 4JS5A 2MPXC 2LNVA 4M77C 1W2BS 3A8HB 2K79A 2QK0A 2H3EB 2CP5A 4K11A 4Y91A 1WHHA 2DL5A 5GAN5 4RTVA 3J80E 2WSFE 1LPLA 2CUBA 1N8RR 2JXBA 3S3MA 4J9HA 1T0HA 1MNDA 3UATA 1I07A 1VQ4T 4J7FA 1QVGP 2OTLQ 1NJIC 2M0YA 5FWCA 1K0XA 2QTVA 1M90C 1R0BG 2DBKA 1U8RA 1D0YA 4IIMA 1KQSA 3CXCA 1X6OA 2C0OA 3EG9B 3WXMB 1OZ3A 4MDXA 1YFNA 2EYZA 2XHCA 1RI9A 2HQXA 1GFDA 3M59A 3PMIA 1EFNA 1AWWA 2IPOB 3HP9A 1KQSS 1NJIR 4PJMA 1PCXA 3CXCS 2RI5A 3OYFA 4RTWA 1WXBA 3OW2P 2EBPA 3EG3A 2QA4Q 1YIJT 4DQ2A 3JCMd 1VQPA 3PT9A 3OYHA 2LMJA 1I0CA 1PWTA 3FC3A 2K57A 3CCQT 1NG2A 2FRWA 1A0NB 1D0ZA 1W4SA 2KAFA 5GAMh 2ENMA 3PVLA 4B9XA 4EDUA 3QG1A 4PK4A 2W0ZA 5GAN8 4BI4A 3V7SA 3UWNA 3CCQA 4PJLA 5GAOq 1H641 1MMGA 2E6ZA 4XTUA 3UA6A 1PRMC 2DYIA 3QWYA 1J3TA 1HD3A 1AWXA 4FYYB 2GCXA 3JCMg 5KCHA 2E10A 3WVEB 1Z9QA 2ZPGB 2F2VA 3FJ5A 3VUZA 2PUKB 1BBZA 3TSZA 2J6KA 5GMKl 1JXMA 2L3PA 2XG8D 5LJ3f 2RNAA 4HCBA 3OSSC 2ZPHB 4M75B 2YHTA 2GNCA 3QHSA 3L2VA 1PRLC 3LGLA 1V1CA 3I9QA 1YI2T 2PTKA 1SRMA 2YXYA 2ECZA 3VS3A 2HZYA 1ZA2B 3NGPA 5IHNA 3JCMc 2DXTA 1WZOA 3EG0A 2NUPA 4M78E 3CCUT 4C0DC 3S6WA 1K9AA 2LJ0A 3OYIA 4JRKA 2D0QB 4FM4B 3M0PA 2AZSA 3CBPA 4J6YA 4X34A 5KYXB 2DVJA 2RHYA 4EMKC 4ZN1A 3OBYA 3TEEA 1I5LA 1WYXA 3CCUA 2FZGB 5I22A 2JJ9A 3HSBA 2A0FB 2VKNA 4O6JA 3OYYA 2FPDA 4L6V5 4LD9K 2RO0A 2DL7A 2O4XA 4QQGA 1BI2A 1X2KA 3QDFA 3C0CA 1M3AA 4RKUE 1GCQC 1WHKA 2BE7D 2E65A 3A8LB 4GLKA 2C0IA 3JV3A 3CCJT 4CI0C 3QYHB 2DYBA 4JZ3A 2Y4XA 3D7SB 4DEYA 4FYVB 3CCEQ 3UF4A 1TOVA 2ZPIB 1VQ7A 4F7UA 2VVKA 1PSEA 4Z88A 3CCJA 2P0QA 4J5YA 1NJIU 4IUVA 3LWIA 2P0PA 2HEQA 1YCYA 3EH1A 4M77A 1Q82U 4AFSC 2E41A 1GL5A 4VUBA 3G7ZA 2DAQA 3G6EQ 2QXFA 5DLQE 3JB9J 2V8KA 1OOTA 1MMDA 2LNHB 2V1RA 1ZUUA 7AT1B 4NOYA 4A54A 5GAMj 1NE8A 2KSSA 2A08A 2VASA 2EJFA 1QCOA 3MO8A 1ACMB 1KFZA 1K73C 3MJXA 3JB9F 1N9SA 1OULA 3SWNC 1D09B 2L3QA 1RAIB 2BUDA 3M58A 3TSWA 2PNIA 3CD6A 1IB8A 1VQ5T 1NYFA 4CC2A 5LJ5e 4A53A 4HVUA 1C1AA 1M2VA 4RTZA 5IAYA 2CT4A 2GFAA 4C0GA 3CMAT 1M8MA 2YRCA 3JCMf 2DZCA 4XU2A 1UG1A 4RUGA 4XK8E 3TQ7P 4Y28E 2LT4A 1H3ZA 1V76A 1U06A 1VYUA 2DL3A 1JJ2A 2E4HA 4DEXA 2BZYA 2EWNA 4M77D 1VQ5A 2O9SA 2RMOA 3E1SA 1QCNA 2HSPA 3CMAA 2I2LA 2KE9A 1G8XA 5FRNA 5CKFA 2FYKA 5CAIA 1VQ9T 1YBYA 5KYUB 3ZBDA 1VYVA 3OMCA 4J9EA 1K1ZA 2RHUA 3ZL7C 4KH0B 4RTTA 3M57A 2DRKA 1YJ9T 4LUEA 4V2SA 1B34B 3H9NA 2XDDA 4KULA 4M78B 4QW2A 1KQ1A 4LD6A 5CK9A 3CCVT 1IGUA 2O2OA 1VQ9A 2IG0A 1WLPB 2RJCA 5GAN6 4JJCA 3I55T 1QP2A 4F7UG 1LOJA 1YJ9A 2COZA 1JO8A 2RQTA 3TREA 4OMPA 5GJWB 1WI7A 5GANd 2COYA 2CZ6B 5CVIA 1OX8A 3CCVA 4LNPA 4E7LA 2F2WA 5CKHA 1K9MC 1UHFA 4NL2A 4RTUA 3L2WA 4RMOA 5GAOr 2FZCB 4X9CA 1NEGA 1M1KC 2EFIA 4A4HA 2F69A 2HDAA 2DF6A 3KUFA 3VKIA 3H6ZA 8AT1B 1O75A 1WJSA 3MEWA 1UHCA 1M4ZA 1U1SA 1H3HA 4JDSA 3J81E 4F17A 1M1GA 3VU3C 4Z89A 3RESA 2MCNA 4NL3A 2GQVA 1YITQ 1E6HA 3JCMJ 2RK2A 3CCLQ 1G2BA 3EG9A 4RG2A 1M1FA 2O01E 1K9MR 2JW4A 4PJOF 2AKKA 1PSFA 1M1KR 1IRXA 2LJ1A 2HBPA 1VQ6A 3I56Q 1G3SA 2RI3A 2DD4A 1PKTA 2NUPB 2CH4W 3QBYA 2VB6A 3JAME 1MV0B 3M9QA 4DA4A 1QW1A 4OB0B 4LDYA 3MEVA 3C12A 1RAAB 2OAUA 2RH2A 1QCFA 5D6WA 1LNXA 3NHNA 1LCKA 1W6XA 4ORZA 2BKDN 1TU0B 3N5BB 5HY6A 5LJ5h 2EVRA 2DPPB 1OI1A 3HRTA 2O4XB 3LYIA 3QSUA 3H0IA 3V7CA 1VA7A 3QPHA 3EFSA 4KUIA 1UECA 3QJYA 2ATCB 2GTOA 4C8QG 4OMLA 1SEMA 3CMET 3G4ST 2QQ9A 2B86A 1VQOT 2YRVA 1XQHA 2KRMA 4BDYA 4JJDA 3JB9H 4E7JA 2H8HA 1BB9A 4M7DF 3E2UA 3VRZA 3CMEA 1AZGB 1AD5A 3I5SA 3V7RA 3G4SA 1VQKQ 2E3IA 2XKOC 1SF9A 2F5KA 4RCCA 1VQLQ 1UJYA 3MEAA 4M75A 4OMFB 4PJOC 5KYNA 1X2QA 3FLGA 2DJQA 2ZPBB 3NTIA 3QWXX 2C06A 2DBMA 2OI3A 5D6YA 1NBEB 3R6NA 2KRSA 4IURA 3THKA 5AYFA 2OTLT 2ED0A 4DBQA 2L2PA 1WQ7A 4FU6A 1ZUKA 2CH4A 2RQVA 3DLLA 1UGSB 1YHQQ 2L8DA 5KYXA 4XQ3A 3ZEHA 3OS2A 1BI3A 4IKFA 3OBWA 5IT9E 1HJDA 1M9SA 5LJ3d 2P0KA 2DTOA 1XTDA 2OTLA 1S72A 2OX7A 1QVGA 2FL7A 1ZSZC 1BKBA 2YLCA 4N4HA 1RABB 3LW5E 9ATCB 3M4GA 1NYGA 1PC0A 5GAOp 4OVAA 3HTRA 2DTIA 4C5IA 4M75D 1CSKA 2PVGB 5GANh 4J7IA 2CP6A 2DIQA 1Y71A 2AK5A 2PVOB 1JXOA 3NTKA 1SSFA 1YJWT 5GAMg 3OYBA 2QA4T 1SG5A 1K9MU 2CSIA 4EPCA 3M0RA 1N5ZA 3OY9A 1FYNA 1YP5A 2JT4A 3JCMb 4ZGJB 4M7DC 4DOWA 2DXBA 2FHDA 4Y92A 1YJWA 1FMWA 2ZAEA 2EPDA 4Q5WA 2DMOA 1VUBA 4QT7A 1UEBA 2KDSA 3FIFA 3C94A 4A4EA 2XMFA 2E5KA 2NUTB 4B9WA 3CCRQ 3JSCA 4XTVA 1V29B 3I5RA 1EX4A 2RD1A 4XTWA 2HL5C 2KY9A 2CP2A 1MHNA 3CCST 4M75G 4M7AF 5CIUA 4RCBA 3EFOA 4C92F 1RUWA 1BCOA 1MGQA 4LN2A 4PLIA 3JCMW 1OU8A 1JQQA 1SHGA 2CGHA 3CCSA 1Q82C 2E12A 4II1A 1FWZA 1D1CA 1TUCA 4PFZA 1QVPA 1QLYA 2LP5A 2M9UA 3HHTB 1VQ4A 2KNBB 3L1AA 2VUBA 1RADB 1TUDA 2LRQA 4XTZA 2J05A 4C0DB 3JB9D 5IXBA 2KEAA 3IQLA 3ER0A 3M0SA 1VQ8Q 2L5QA 1ZUYA 3UDCA 2X4JA 5KYUA 4EMKB 2DTHA 3MP8A 1ZSGA 1Q82R 3URGA 1B34A 1VIEA 1M27C 1JB0E 2DFUA 2EYXA 2VC8A 4M78A 3L2ZA 3LGFA 3GF5A 3O5ZA 1KSWA 5I2MA 1RACB 2HQHA 4D8DA 1FXXA 4HT8A 2DO3A 2WSCE 3VS4A 1W2BP 2E6NA 3A8MB 1UUEA 1YIJA 2LQWA 1AHJB 2LQKA 4QVZA 3FB9A 4OGCA 4M7AC 1Q7YU 4O5VA 4C92C 1AWOA 4ZTFA 1WGSA 1ZLMA 4BB7A 2Y90A 2KYMA 4WF2A 2X4XA 3U23A 2RHIA 3JCMe 1SKUB 4R0KA 3DB4A 2M51A 2VV5A 3OS1A 3L42A 1QKXA 3QJ6A 3CC4Q 3VYGA 2YSQA 4PJOA 2VGMA 3GNGA 3OS5A 1BU1A 4M78D 2HNIA 1ABQA 1UGVA 1AEYA 4WCIA 2HKQB 3G6ET 5LJ3h 1N27A 3VS7A 1KQSP 3CXCP 2HBWA 2JTMA 3SWNB 1RLQC 2IIMA 3SDZA 1IXDA 4FSSA 1K0SA 2X3XD 3PE0A 2ED1A 3LLRA 2K2VA 2MOXA 3HRUA 3HFOA 3JCMX 3S3OA 4OP0A 1D1BA 2D1XA 2K5LA 1ZSZA 4BY6C 1YI2A 1WPYA 2RK1A 2DL8A 3V8KA 1M3BA 1CKBA 4E47A 2MWOA 4ZGEB 4RTYA 4QQDA 1I8FA 4A4FA 2RN8A 1VQPQ 4PJOD 4JUVA 4M78G 1B7TA 1E7OA 2V26A 3OYNA 1D3BB 3GIBA 4OB3B 4E7SA 1WHLA 2MF2A 4IUQA 4LXCA 1LVKA 2CDTA 2HKNA 1YN8A 1ZQ1A 3OYGA 3A98A 1BK2A 1Q86C 3VJPA 4M7DA 1WDXA 1QWEA 1HSQA 2BZ8A 4PJOE 2RB6A 2G6FX 3PVQA 1SSHA 2KR3A 3X26B 2D8HA 1YCSB 3OSVA 2XIDA 3SB2A 2XDPA 2EKHA 1VYTA 2M02A 3QZ5B 1B3QA 1NM7A 2LC4A 1WX6A 4FIBA 2WSEE 3A8OB 3DLMA 1UGPB 1BI0A 1W1FA 2V1QA 4E6RA 5HK0A 3CPFA 5C6SA 1IHVA 2NWMA 2RJEA 4MMLA 1DJ7B 2K4YA 3O8VA 2DD5A 1Q86R 2HD0A 2J6OA 2X35A 2QDLA 1FMKA 2ABLA 1BI1A 3OB9A 2CREA 3EFOB 2DX1A 2FPEA 4PL6A 2ROLA 4M7DD 2LTOA 3ZFJA 1VQMQ 4FCYA 3R6OA 5HK3A 3WVDB 1YITT 2CKKA 2E5QA 1BIBA 3CCLT 4BI8B 1N9RA 2RJFA 3JCMh 4OMNA 2VXFA 2CS7A 4XAXB 2FZKB 4QVDA 3EAEA 5CO7A 2M0OA 4M7DE 5D7UA 2MIOA 3I56T 4R56A 5GAOm 3AHUA 2GFUA 1XNIA 2LZ6B 1KC8U 1QVFA 4ZNXA 1VQNQ 3BDLA 2CZ0B 5LJ5g 1Y0MA 4LUDA 2LQNA 1JJ2S 1FMVA 4MZTA 2X3WD 3QDRB 3CPWA 1WXUA 3I56A 2IVWA 5DY9A 1TH7A 1I1JA 5GMKe 3PFSA 2LX7A 1K8AU 4A4GA 1QVFS 3G71Q 2LQ8A 3RNJA 1UDLA 1RAEB 1OPKA 2K5IA 1VQ7Q 3EGXA 2A7YA 5FU7C 3VYHB 2D9TA 4M7AA 3CPWS 4C92A 2FRYA 3X25B 2VXEA 2QTXA 2CP0A 1AOJA 2NUTA 3MEUA 5KH6A 1PD1A 1Q81R 1WNLA 4C0FA 3X24B 1WXTA 2CZ7B 4M77G 1WJQA 4AMCA 2DNUA 5J39A 4EIKA 2YT6A 2EGEA 2QQBA 3I55A 4Z02A 4AG2C 2QQSA 1TS9A 4PNOA 1ARKA 2FB7A 1KD1R 3VS2A 1ABOA 1G3TA 4JJBA 2KGTA 2BZXA 1M5Q1 1VQKT 3KFVA 3SFMA 2DLPA 4WTOB 1VQLT 5IHKA 4F14A 4PJOB 3CD6Q 5GANe 5GMKi 4FT2A 4HA8A 1UFFA 3FJPA 2KRNA 3QUIA 5IN1A 5GJVB 2FG0A 4BI3A 5GAN4 1X75C 1VQLA 4FYWB 1M3CA 3CBMA 2EAYA 2DEQA 3RBBB 2L0AA 2Y4YA 3H0FA 4BD3A 4EMKA 3CMAQ 1UGQB 1KK7A 2DILA 1Q86U 2JN0A 2F1LA 4ZGDB 4JRPA 3RERA 3OMGA 3P8HA 1TSFA 4M7AE 2X4YA 1ZSZB 4C92E 2EGAA 1JBMA 2KYBA 5FWBA 3M54A 3JB9I 1UGRB 1RAHB 3M0TA 5J3BA 1GCQA 2PUOB 2R57A 2R58A 2RQUA 3DB3A 4BUGA 4KRTA 2RA2A 3M0QA 1VQ9Q 3VS1A 4A63B 3CC7T 1O9SA 2OTJT 3VS6A 2CP7A 4JS4A 2ROTA 3TCJA 4C8QE 2ZCFB 3HPWA 2RI2A 3OA6A 3RKXA 4BACA 4M7DB 3FDRA 4DBHA 2GGRA 4QQ6A 4FW1A 3QIIA 4LDWA 1X43A 3M55A 3CC7A 2OTJA 1YWOA 2JM9A 1BCMA 1W70A 3VS0A 2EGCA 1NLOC 1BIAA 2KMTA 4CRIA 1ZHIA 2AZVA 1K76A 1U3OA 1VQOA 3GPLA 3M5AA 3I35A 5GAN7 5DLOA 4J9FA 3X20B 5GMKh 4FT4A 3P8DA 2CSQA 4KBMB 1Y57A 1OQKA 1Q7YC 2EQUA 4C5HA 3UPUA 4MMKA 4MZMA 1QQJA 3SWNA 1HYOA 3RUXA 4HT9A 2AT1B 2SEMA 1KHCA 5GAMd 3TU4K 4HCCA 2COWA 4R55A 5LL6S 3M4YA 4B6MA 5KYYB 4F7UF 2MWPA 3BW1A 1Q81U 2KXCA 1VQ6Q 4J9DA 2A28A 2E64A 4N4IA 3CC2Q 5IH2A 2K5FA 1Q7YR 3J7AF 3EHQA 1PKSA 4KGXB 1KD1U 4LDXA 2QEXQ 1WHGA 2JNGA 4XTYA 1KG1A 2P84A 1D3BA 2YUOA 1YNZA 1RLPC 1VQ8T 3T9NA 4PKCC 4AFQC 3OYKA 1NPPA 4PJJA 3LH5A 4F04B 5CR2A 2F5TX 2RQWA 3LH0A 3ULRB 3RMSA 1QVGS 1RAFB 2O88A 3VS5A 4RG8A 1VQ8A 1G5VA 2LX9A 3PIOA 2O31A 1M30A 4NS5A 5LJ3e 4A4KA 1GFCA 3CQTA 4HKEA 4XU0A 5M9OA 1M8VA 3H8ZA 3HRSA 2MI6A 2HL3A 3OW2A 5J26A 2QA4A 3EG2A 2JMAA 3EGDB 2DRMA 2L3RA 5HKCA 3EGXB 5DM7R 3REAB 4M7AB 2ESWA 3ASKA 4E2FB 4C92B 1YJNQ 2LCSA 1AVZC 1OYXA 1T3SA 2A3LA 4IUTA 1PM3A 5LJ5j 3OW2S 2DEUA 1YWPA 3CCMQ 2Z0WA 3V8JA 2RHZA 4HXJA 4JLIA 4N0AC 5KE2A 1IGQA 6AT1B 4DBRA 2JS2A 3CC4T 1ZA1B 3BY7A 1OZ2A 5KE3A 4AG1C 4J9GA 4C8QB 1R8OB 1EZZB 1LJOA 2LDMA 4OMOA 3RMQA 1UTIA 3FRNA 1X69A 5A0LA 2RPNA 3A1PA 1WIEA 4PFPA 3CEYA 2RM4A 2AIRB 2YUQA 1X27A 2CP3A 4UC4A 2V8IA 3CC4A 4C8QF 2PQWA 2E70A 1UJ0A 2FO0A 2A37A 2MMPA 2GBQA 1K4US 1N6AA 4TVRA 2HMAA 1S72Q 2DA9A 3MCAB 3NMZC 2O9VA 3E9GA 5GMKj 2OJ2A 1U5SA 1Y96B 1SRLA 1OX9A 3QO3A 2QQRA 4BY6B 3KXTA 4ELYC 5GAOn 4E7KA 3L2RA 4J6XA 3JCMV 1AT1B 4BE0A 2JUFA 1UB4A 1VQPT 1H8KA 2XDBA 2XU8A 2D8JA 4JRQA 4E7HA 2YUNA 2E3HA 2QYZA 1C6VX 5I11A 2LJ3A 1R0CB 4GY5A 1ZX6A 1M90R 1HXDA 1TWBA 1YJWQ 2XD0A 3NPFA 3V8LA 1QP3A 2GTJA 2W10A 1KC8C 4BDZA 2G3RA 3L2QA 1IO6A 1OEBA 2DL4A 3CCET 2EYQA 3JB9G 2DM1A 2JTFA 4L59A 2EQMA 5GANj 2M16A 3GBQA 4FYXB 4E7ZA 2NUZA 5GAMf 1K8AC 5FRMA 5CCAA 2MAMA 4LDVA 3A5ZB 3PTAA 3OYJA 3EH2A 3CCEA 2AKLA 3GLXA 3VRYA 5GAN2 4C8QC 1RL2A 1KC8R 3CCSQ 1X01A 1RI0A 5EC7A 4HCKA 1WQWA 2C0TA 4JZ4A 1TG0A 1WHMA 1IREB 1Z9ZA 2CYZB 3FEOA 1GBRA 3OYAA 3MP6A 4GLMA 1VQ4Q 2PU9B 3KBGA 1I4K1 2BIVA 1K8AR 3G6EA 5ECAA 2WACA 5CKDA 1VQMT 5I21A 1XOVA 5AT1B 2KBTA 2D6FA 2XK0A 2JM8A 3RR6A 1KQ2A 5FROA 1MV3A 5A0DA 4KT0E 5A2QE 1CKAA 2EYYA 3OYLA 2OTJQ 2I0NA 1VQMA 3MPUB 1VIFA 4M75F 3EFRA 2EQKA 1G83A 5I2SA 4QKUA 4F16A 3INZA 2MYSA 4J9BA 4YTLA 2MK5A 1VQNT 3A8GB 2KK4A 4EMGA 1I5OB 2LVMA 1YIJQ 3E19A 2L89A 1VOMA 2P4RA 2CZ1B 4J83A 2DK3A 2EW3A 1N8RU 4HCZA 3QXEB 1B07A 4FSXA 2K3YA 2K7AA 1KJWA 3CCQQ 4XTXA 1AZEA 3UA7A 1VQNA 5CQYA 2K6DA 4ZN3A 3G71T 2YLBA 5FU7B 1KHIA 3M53A 2DKGA 1VQ7T 1QKWA 2PZ1A 4KGZB 3EG1A 1WFWA 1KIKA 3JCMP 1EIFA 4ME7A 2NYSA 3JCMQ 2CUDA 1G3WA 4N4GA 4D8KA 2M1HA 2KI7A 3SD4A 3G71A 5D6XA 4PJOG 1JRIA 4X1VA 4N0AA 4KUDK 4CC4B 1D1AA 1C0MA 3RIRA 2K3XA 4LDUA 1PD0A 3G1JA 5LJ5d 2VYTA 2YDLA 2QGGA 1M90U 1TTHB 2EQIA 5KYWB 5KYYA 2DVEA 3MHXA 1GXIE 4J8OA 1I81A 3CD6T 5A0GA 4IIOA 1D0XA 1Y7XA 5HCKA 3H41A 4M75C 4OMQA 4C5EA 1ZBXA 2EKOA 2EJ9A 3P8BB 1YI2Q 2QG9B 1NPRA 3Q1JA 4XU1A 2NLUA 3JRZA 5CKBA 2RJDA 1WHJA 2KT8A 3CCUQ 1YITA 2VGNA 1MMAA 3CCLA 4LE9A 4JPBW 1HK9A 1GBQA 5LJ3j 1SPKA 3OS0A 3HL8A 1NZ9A 1TXQA 5IXFA 3OYEA 5L8RE 5GAN3 1Q81C 2GQIA 4FL6A 4JLGA 2YUPA 3NTHA 1K73R 2KXDA 3MKDA 2HSEB 4PFOA 3L2UA 4ATOA 4M7DG 3GP8A 2OAWA 4C0ZA 2CT3A 2DZ9A 1KD1C 2B8AA 4F7UE 3EGDA 4CC3A 2EQJA 2J06A 4DOVA 4CC7A 3CCJQ 4IUPA 1S1NA 2HQEA 2YWWA 3UT1A 2JTEA 2R5AA 1QMCA 2RHXA 4KGVB 4M77E 1F1BB 3EGUA 1WJRA 3NFCA 8ATCB 1GRIA 3X28B 4AFZC 2F2XA 3OQ5A 2XI9A 4BE1A 2JMCA 3VUBA 1BYMA 1NEBA 4C8QA 3AT1B 5L23A 4C5GA 4M78F 2J7IA 1SHFA 5FU6B 3S3NA 2LCCA 3SEMA 1Y07A 4DBFA 3TVTA 1MNEA 1TUGB 1E6GA 4AT1B 4BE2A 4OB2B 3RDVA 2QASA 4P5NA 4ZTJA 3PNWC 1IHWA 2ZPFB 2FEIA 2HCKA 2J6FA 1VQKA 3M56A 3PMTA 4M7AD 4XU3A 4RTXA 4C92D 1JJ2P 1Y96A 3SHWA 3PIPA 1VQ5Q 2K3BA 1JEGA 2LT1A 1OV3A 1YHQT 1VQ6T 1UE9A 3M0UA 2X4WA 1QVFP 3H0HA 4HVWA 3C4SA 3OYMA 2GF7A 2SRCA 5GANg 3ME9A 4OB1B 3CC2T 1T0JA 2QQAA 4C8QD 2QAZA 3CPWP 2KVQG 4PJNA 4PLLA 2QEXT 2JOYA 1YHQA 3QYGB 3VV0A 2FPFA 2QGFB 3GNFB 4OGEA 5CQXA 2ZGWA 2DETA 4E7IA 1MUZA 4AFUC 3GOXA 4OF1A 1QWFA 3CC2A 3PGGA 2QEXA 1YJ9Q 2DJZA 3C95A 4IUUA 4M7AG 2QI2A 3MP1A 4C92G 3BE3A 3CCVQ 1PHTA 2PVDB 4M78C 4KH1B 3F70A 5FLXE 5LJ5f 5EG2A 3REBB 3I55Q 4EMHA 2EJGA 1U1TA 4Z8AA 2BE9B 3QZ9B 2VWFA 2EIFA 4JJNK 2H3JA 5FU6C 1OPLA 2R5MA 5GAOl 1X6BA 2ZPEB 1YJNT 3CCRT 1GCPA 1WA7A 3OYDA 1K73U 4JRIA 2JVVA 3CBOA 1G3YA 4HVVA 4X9DA 3QKJA 4L5GA 1Q95G 3CCMT 1AWJA 4F7UB 3BFMA 4ELZC 3META 1X6GA 5C0MA 2ZZDA 1YJNA 3CCRA 1H92A 2XICA 2HAXA 4M77B 2DE0X 3BDUA 1P92A 4ANJA 3CCMA 2KQWA 1PNJA 2FVUA 1R77A 2K2MA 3LWHA 2RQRA 3LX7A 4M77F 2L3SA 1NLPC 2EYWA 1S72T 2V8JA 4J9CA 2P4TA 3EHRA 5CKEA 1PG5B 3RKWA 1ZBJA 4D6WA 2A36A 5GAMe 2K9GA 1M2VB 1MMNA 5FW9A 4J6WA 4M4ZA 2BTTA 2KT1A 4QVCA 3HFNA 2AHJB 3DKMA 4OMMA 3RKYA 2X9HA 1RAGB 4MZPA 3OYCA 2LCLA 5GMKm 2JZ2A 1OU9A 4MDWA 5GANf 4FW2A 2X51A 3CC7Q 2KROA
chains in the Genus database with same CATH topology
2CH4W 2AKLA 1MV0B 3VRYA 4OMNA 4ESRA 1QCFA 5EC7A 4HCKA 1T3LA 3NHNA 2C0TA 1LCKA 4JZ4A 5IHIA 1TG0A 2RF0A 1Z9ZA 1W6XA 4ORZA 1GBRA 2D0NA 4GLMA 2MIOA 2JS0A 1JU5C 2EVRA 4J9IA 5ECAA 2LZ6B 4GBQA 3H0IA 4ZNXA 1VA7A 1XOVA 2KBTA 1UECA 1Y0MA 4LUDA 2LQNA 2GTOA 2K79A 1SEMA 2JM8A 4OMLA 2X3WD 1MV3A 1WXUA 4K11A 2B86A 1CKAA 2EYYA 2DL5A 1I1JA 4RTVA 2CUBA 2I0NA 2KRMA 2LX7A 2JXBA 4J9HA 1T0HA 4JJDA 3UATA 1I07A 2H8HA 3RNJA 1BB9A 1G83A 1UDLA 1OPKA 3VRZA 1AZGB 1AD5A 2M0YA 3I5SA 5FWCA 4F16A 1K0XA 4J9BA 2FRYA 1UJYA 1AOJA 2DBKA 4IIMA 2P4RA 1X2QA 2C0OA 2DJQA 1WXTA 2EW3A 3QWXX 2DNUA 2DBMA 4EIKA 2YT6A 2EYZA 2OI3A 1B07A 2EGEA 1RI9A 2K7AA 1KJWA 3R6NA 1GFDA 2KRSA 1AZEA 4AG2C 3UA7A 2K6DA 1ARKA 1EFNA 1AWWA 3THKA 2ED0A 3VS2A 1ABOA 2L2PA 1QKWA 2PZ1A 4JJBA 2KGTA 2BZXA 1ZUKA 3KFVA 2CH4A 2RQVA 4RTWA 1WXBA 1WFWA 2DLPA 3EG1A 1KIKA 2EBPA 5IHKA 4F14A 3EG3A 2CUDA 1HJDA 4D8KA 2LMJA 4X1VA 1UFFA 1I0CA 2KRNA 1PWTA 4CC4B 5GJVB 2FG0A 1NG2A 2FRWA 1A0NB 1NYGA 1M3CA 2YDLA 2ENMA 3PVLA 1CSKA 2EQIA 3RBBB 2L0AA 3H0FA 2AK5A 1JXOA 2W0ZA 2DILA 2CSIA 3UA6A 1PRMC 4IIOA 3M0RA 5HCKA 1N5ZA 3H41A 4OMQA 1FYNA 1YP5A 2JT4A 3QWYA 1J3TA 2EGAA 1HD3A 2KYBA 5FWBA 4Y92A 1AWXA 3M0TA 1GCQA 2KT8A 2EPDA 1Z9QA 2DMOA 4QT7A 2RQUA 4LE9A 4JPBW 2F2VA 3FJ5A 1GBQA 4KRTA 1BBZA 3TSZA 3M0QA 2J6KA 1SPKA 3VS1A 4A63B 1JXMA 3VS6A 5IXFA 2XMFA 2L3PA 2E5KA 2RNAA 2ROTA 3I5RA 2GQIA 2GNCA 2YUPA 1PRLC 2GGRA 1V1CA 3I9QA 2KXDA 2PTKA 1SRMA 2ECZA 3VS3A 1X43A 1YWOA 2JM9A 3NGPA 5IHNA 1RUWA 3EG0A 2OAWA 2CT3A 1K9AA 1W70A 2LJ0A 4LN2A 2EGCA 3VS0A 1NLOC 4CC3A 2J06A 1JQQA 1SHGA 3M0PA 2AZSA 2AZVA 1K76A 4CC7A 1U3OA 1S1NA 2DVJA 1TUCA 2JTEA 3I35A 4J9FA 3EGUA 1QLYA 2LP5A 1WYXA 2CSQA 1Y57A 1GRIA 2KNBB 5I22A 1TUDA 2VKNA 4AFZC 2F2XA 2J05A 2FPDA 5IXBA 2DL7A 2JMCA 2SEMA 2KEAA 3IQLA 1X2KA 3M0SA 1NEBA 5L23A 3C0CA 1M3AA 1GCQC 2J7IA 1ZUYA 1SHFA 2C0IA 3JV3A 2KXCA 3SEMA 2DYBA 4JZ3A 4J9DA 3TVTA 1ZSGA 4DEYA 2A28A 1E6GA 1M27C 3UF4A 2EYXA 5IH2A 3O5ZA 2FEIA 1KSWA 2HCKA 2J6FA 3EHQA 1PKSA 2VVKA 4D8DA 4Z88A 3VS4A 2YUOA 4RTXA 1YNZA 2HEQA 1RLPC 3SHWA 1UUEA 4AFQC 2LQWA 4AFSC 3LH5A 2K3BA 2RQWA 1JEGA 1OV3A 3ULRB 1GL5A 1UE9A 3M0UA 3H0HA 4HVWA 1OOTA 2LNHB 2O88A 2V1RA 1ZUUA 1AWOA 3VS5A 2SRCA 1ZLMA 2KYMA 2A08A 1T0JA 2O31A 3U23A 1M30A 4R0KA 1KFZA 1GFCA 3CQTA 2M51A 1QKXA 2L3QA 2FPFA 3TSWA 2PNIA 2YSQA 1MUZA 3EG2A 2JMAA 4AFUC 2DRMA 1NYFA 1QWFA 4CC2A 4HVUA 3REAB 1BU1A 4RTZA 1ABQA 1UGVA 2ESWA 2CT4A 4WCIA 1AEYA 1M8MA 1UG1A 4RUGA 2LCSA 3VS7A 1AVZC 1U06A 1T3SA 1VYUA 2HBWA 2DL3A 1YWPA 4DEXA 2BZYA 1PHTA 2O9SA 2RMOA 4HXJA 1RLQC 2HSPA 2IIMA 2KE9A 3REBB 2JS2A 4FSSA 1K0SA 4AG1C 2X3XD 3PE0A 4J9GA 2ED1A 4OMOA 2MOXA 1UTIA 4Z8AA 1X69A 2VWFA 2RPNA 1VYVA 1WIEA 2D1XA 1OPLA 1K1ZA 4J9EA 3ZL7C 2DL8A 1X6BA 2YUQA 4RTTA 2DRKA 1M3BA 1CKBA 1X27A 4LUEA 1GCPA 1WA7A 4HVVA 4RTYA 1UJ0A 2FO0A 2A37A 1K4US 2GBQA 2RN8A 1AWJA 2O2OA 1WLPB 2DA9A 1X6GA 1E7OA 3NMZC 4JJCA 2O9VA 2OJ2A 1U5SA 1H92A 2RQTA 1JO8A 1SRLA 4OMPA 5GJWB 1WI7A 2DE0X 2CDTA 1YN8A 4LNPA 3A98A 1BK2A 1WDXA 1PNJA 1QWEA 2F2WA 1HSQA 2BZ8A 1UHFA 4RTUA 2K2MA 2G6FX 3PVQA 1SSHA 2RQRA 2KR3A 2L3SA 1H8KA 1NEGA 1NLPC 2D8JA 2EYWA 2HDAA 2DF6A 2YUNA 2D8HA 1YCSB 1UHCA 1H3HA 4J9CA 2EKHA 1VYTA 5I11A 1B3QA 1NM7A 3EHRA 2LJ3A 1WX6A 4F17A 1ZX6A 1ZBJA 1W1FA 2V1QA 4Z89A 4E6RA 2MCNA 2A36A 3NPFA 1E6HA 2K9GA 2GTJA 2NWMA 2W10A 1G2BA 5FW9A 4M4ZA 2BTTA 2KT1A 1IO6A 2J6OA 1OEBA 2DL4A 4OMMA 2DM1A 2QDLA 2JW4A 1FMKA 2ABLA 2AKKA 2CREA 3GBQA 2NUZA 2LJ1A 2DX1A 2FPEA 2ROLA 1PKTA 2KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH4 W;  2AKL A;  1MV0 B;  3VRY A;  4OMN A;  4ESR A;  1QCF A;  5EC7 A;  4HCK A;  1T3L A;  3NHN A;  2C0T A;  1LCK A;  4JZ4 A;  5IHI A;  1TG0 A;  2RF0 A;  1Z9Z A;  1W6X A;  4ORZ A;  1GBR A;  2D0N A;  4GLM A;  2MIO A;  2JS0 A;  1JU5 C;  2EVR A;  4J9I A;  5ECA A;  2LZ6 B;  4GBQ A;  3H0I A;  4ZNX A;  1VA7 A;  1XOV A;  2KBT A;  1UEC A;  1Y0M A;  4LUD A;  2LQN A;  2GTO A;  2K79 A;  1SEM A;  2JM8 A;  4OML A;  2X3W D;  1MV3 A;  1WXU A;  4K11 A;  2B86 A;  1CKA A;  2EYY A;  2DL5 A;  1I1J A;  4RTV A;  2CUB A;  2I0N A;  2KRM A;  2LX7 A;  2JXB A;  4J9H A;  1T0H A;  4JJD A;  3UAT A;  1I07 A;  2H8H A;  3RNJ A;  1BB9 A;  1G83 A;  1UDL A;  1OPK A;  3VRZ A;  1AZG B;  1AD5 A;  2M0Y A;  3I5S A;  5FWC A;  4F16 A;  1K0X A;  4J9B A;  2FRY A;  1UJY A;  1AOJ A;  2DBK A;  4IIM A;  2P4R A;  1X2Q A;  2C0O A;  2DJQ A;  1WXT A;  2EW3 A;  3QWX X;  2DNU A;  2DBM A;  4EIK A;  2YT6 A;  2EYZ A;  2OI3 A;  1B07 A;  2EGE A;  1RI9 A;  2K7A A;  1KJW A;  3R6N A;  1GFD A;  2KRS A;  1AZE A;  4AG2 C;  3UA7 A;  2K6D A;  1ARK A;  1EFN A;  1AWW A;  3THK A;  2ED0 A;  3VS2 A;  1ABO A;  2L2P A;  1QKW A;  2PZ1 A;  4JJB A;  2KGT A;  2BZX A;  1ZUK A;  3KFV A;  2CH4 A;  2RQV A;  4RTW A;  1WXB A;  1WFW A;  2DLP A;  3EG1 A;  1KIK A;  2EBP A;  5IHK A;  4F14 A;  3EG3 A;  2CUD A;  1HJD A;  4D8K A;  2LMJ A;  4X1V A;  1UFF A;  1I0C A;  2KRN A;  1PWT A;  4CC4 B;  5GJV B;  2FG0 A;  1NG2 A;  2FRW A;  1A0N B;  1NYG A;  1M3C A;  2YDL A;  2ENM A;  3PVL A;  1CSK A;  2EQI A;  3RBB B;  2L0A A;  3H0F A;  2AK5 A;  1JXO A;  2W0Z A;  2DIL A;  2CSI A;  3UA6 A;  1PRM C;  4IIO A;  3M0R A;  5HCK A;  1N5Z A;  3H41 A;  4OMQ A;  1FYN A;  1YP5 A;  2JT4 A;  3QWY A;  1J3T A;  2EGA A;  1HD3 A;  2KYB A;  5FWB A;  4Y92 A;  1AWX A;  3M0T A;  1GCQ A;  2KT8 A;  2EPD A;  1Z9Q A;  2DMO A;  4QT7 A;  2RQU A;  4LE9 A;  4JPB W;  2F2V A;  3FJ5 A;  1GBQ A;  4KRT A;  1BBZ A;  3TSZ A;  3M0Q A;  2J6K A;  1SPK A;  3VS1 A;  4A63 B;  1JXM A;  3VS6 A;  5IXF A;  2XMF A;  2L3P A;  2E5K A;  2RNA A;  2ROT A;  3I5R A;  2GQI A;  2GNC A;  2YUP A;  1PRL C;  2GGR A;  1V1C A;  3I9Q A;  2KXD A;  2PTK A;  1SRM A;  2ECZ A;  3VS3 A;  1X43 A;  1YWO A;  2JM9 A;  3NGP A;  5IHN A;  1RUW A;  3EG0 A;  2OAW A;  2CT3 A;  1K9A A;  1W70 A;  2LJ0 A;  4LN2 A;  2EGC A;  3VS0 A;  1NLO C;  4CC3 A;  2J06 A;  1JQQ A;  1SHG A;  3M0P A;  2AZS A;  2AZV A;  1K76 A;  4CC7 A;  1U3O A;  1S1N A;  2DVJ A;  1TUC A;  2JTE A;  3I35 A;  4J9F A;  3EGU A;  1QLY A;  2LP5 A;  1WYX A;  2CSQ A;  1Y57 A;  1GRI A;  2KNB B;  5I22 A;  1TUD A;  2VKN A;  4AFZ C;  2F2X A;  2J05 A;  2FPD A;  5IXB A;  2DL7 A;  2JMC A;  2SEM A;  2KEA A;  3IQL A;  1X2K A;  3M0S A;  1NEB A;  5L23 A;  3C0C A;  1M3A A;  1GCQ C;  2J7I A;  1ZUY A;  1SHF A;  2C0I A;  3JV3 A;  2KXC A;  3SEM A;  2DYB A;  4JZ3 A;  4J9D A;  3TVT A;  1ZSG A;  4DEY A;  2A28 A;  1E6G A;  1M27 C;  3UF4 A;  2EYX A;  5IH2 A;  3O5Z A;  2FEI A;  1KSW A;  2HCK A;  2J6F A;  3EHQ A;  1PKS A;  2VVK A;  4D8D A;  4Z88 A;  3VS4 A;  2YUO A;  4RTX A;  1YNZ A;  2HEQ A;  1RLP C;  3SHW A;  1UUE A;  4AFQ C;  2LQW A;  4AFS C;  3LH5 A;  2K3B A;  2RQW A;  1JEG A;  1OV3 A;  3ULR B;  1GL5 A;  1UE9 A;  3M0U A;  3H0H A;  4HVW A;  1OOT A;  2LNH B;  2O88 A;  2V1R A;  1ZUU A;  1AWO A;  3VS5 A;  2SRC A;  1ZLM A;  2KYM A;  2A08 A;  1T0J A;  2O31 A;  3U23 A;  1M30 A;  4R0K A;  1KFZ A;  1GFC A;  3CQT A;  2M51 A;  1QKX A;  2L3Q A;  2FPF A;  3TSW A;  2PNI A;  2YSQ A;  1MUZ A;  3EG2 A;  2JMA A;  4AFU C;  2DRM A;  1NYF A;  1QWF A;  4CC2 A;  4HVU A;  3REA B;  1BU1 A;  4RTZ A;  1ABQ A;  1UGV A;  2ESW A;  2CT4 A;  4WCI A;  1AEY A;  1M8M A;  1UG1 A;  4RUG A;  2LCS A;  3VS7 A;  1AVZ C;  1U06 A;  1T3S A;  1VYU A;  2HBW A;  2DL3 A;  1YWP A;  4DEX A;  2BZY A;  1PHT A;  2O9S A;  2RMO A;  4HXJ A;  1RLQ C;  2HSP A;  2IIM A;  2KE9 A;  3REB B;  2JS2 A;  4FSS A;  1K0S A;  4AG1 C;  2X3X D;  3PE0 A;  4J9G A;  2ED1 A;  4OMO A;  2MOX A;  1UTI A;  4Z8A A;  1X69 A;  2VWF A;  2RPN A;  1VYV A;  1WIE A;  2D1X A;  1OPL A;  1K1Z A;  4J9E A;  3ZL7 C;  2DL8 A;  1X6B A;  2YUQ A;  4RTT A;  2DRK A;  1M3B A;  1CKB A;  1X27 A;  4LUE A;  1GCP A;  1WA7 A;  4HVV A;  4RTY A;  1UJ0 A;  2FO0 A;  2A37 A;  1K4U S;  2GBQ A;  2RN8 A;  1AWJ A;  2O2O A;  1WLP B;  2DA9 A;  1X6G A;  1E7O A;  3NMZ C;  4JJC A;  2O9V A;  2OJ2 A;  1U5S A;  1H92 A;  2RQT A;  1JO8 A;  1SRL A;  4OMP A;  5GJW B;  1WI7 A;  2DE0 X;  2CDT A;  1YN8 A;  4LNP A;  3A98 A;  1BK2 A;  1WDX A;  1PNJ A;  1QWE A;  2F2W A;  1HSQ A;  2BZ8 A;  1UHF A;  4RTU A;  2K2M A;  2G6F X;  3PVQ A;  1SSH A;  2RQR A;  2KR3 A;  2L3S A;  1H8K A;  1NEG A;  1NLP C;  2D8J A;  2EYW A;  2HDA A;  2DF6 A;  2YUN A;  2D8H A;  1YCS B;  1UHC A;  1H3H A;  4J9C A;  2EKH A;  1VYT A;  5I11 A;  1B3Q A;  1NM7 A;  3EHR A;  2LJ3 A;  1WX6 A;  4F17 A;  1ZX6 A;  1ZBJ A;  1W1F A;  2V1Q A;  4Z89 A;  4E6R A;  2MCN A;  2A36 A;  3NPF A;  1E6H A;  2K9G A;  2GTJ A;  2NWM A;  2W10 A;  1G2B A;  5FW9 A;  4M4Z A;  2BTT A;  2KT1 A;  1IO6 A;  2J6O A;  1OEB A;  2DL4 A;  4OMM A;  2DM1 A;  2QDL A;  2JW4 A;  1FMK A;  2ABL A;  2AKK A;  2CRE A;  3GBQ A;  2NUZ A;  2LJ1 A;  2DX1 A;  2FPE A;  2ROL A;  1PKT A;  2KRO A; 
#chains in the Genus database with same CATH topology
 1M2O A;  2DXC A;  1XJW B;  3E9F A;  3CME Q;  1IZ6 A;  2QDY B;  3G4S Q;  4ESR A;  3HKS A;  1M1K U;  1VQO Q;  2DXU A;  1T3L A;  4M75 E;  1N8R C;  5IHI A;  1W2B A;  2RF0 A;  2DER A;  2D0N A;  5LJ3 g;  1FX7 A;  2JS0 A;  1JU5 C;  5KYW A;  4J9I A;  2E1H A;  4GBQ A;  5KCO A;  2YRD A;  2DIG A;  4JS5 A;  2MPX C;  2LNV A;  4M77 C;  1W2B S;  3A8H B;  2K79 A;  2QK0 A;  2H3E B;  2CP5 A;  4K11 A;  4Y91 A;  1WHH A;  2DL5 A;  5GAN 5;  4RTV A;  3J80 E;  2WSF E;  1LPL A;  2CUB A;  1N8R R;  2JXB A;  3S3M A;  4J9H A;  1T0H A;  1MND A;  3UAT A;  1I07 A;  1VQ4 T;  4J7F A;  1QVG P;  2OTL Q;  1NJI C;  2M0Y A;  5FWC A;  1K0X A;  2QTV A;  1M90 C;  1R0B G;  2DBK A;  1U8R A;  1D0Y A;  4IIM A;  1KQS A;  3CXC A;  1X6O A;  2C0O A;  3EG9 B;  3WXM B;  1OZ3 A;  4MDX A;  1YFN A;  2EYZ A;  2XHC A;  1RI9 A;  2HQX A;  1GFD A;  3M59 A;  3PMI A;  1EFN A;  1AWW A;  2IPO B;  3HP9 A;  1KQS S;  1NJI R;  4PJM A;  1PCX A;  3CXC S;  2RI5 A;  3OYF A;  4RTW A;  1WXB A;  3OW2 P;  2EBP A;  3EG3 A;  2QA4 Q;  1YIJ T;  4DQ2 A;  3JCM d;  1VQP A;  3PT9 A;  3OYH A;  2LMJ A;  1I0C A;  1PWT A;  3FC3 A;  2K57 A;  3CCQ T;  1NG2 A;  2FRW A;  1A0N B;  1D0Z A;  1W4S A;  2KAF A;  5GAM h;  2ENM A;  3PVL A;  4B9X A;  4EDU A;  3QG1 A;  4PK4 A;  2W0Z A;  5GAN 8;  4BI4 A;  3V7S A;  3UWN A;  3CCQ A;  4PJL A;  5GAO q;  1H64 1;  1MMG A;  2E6Z A;  4XTU A;  3UA6 A;  1PRM C;  2DYI A;  3QWY A;  1J3T A;  1HD3 A;  1AWX A;  4FYY B;  2GCX A;  3JCM g;  5KCH A;  2E10 A;  3WVE B;  1Z9Q A;  2ZPG B;  2F2V A;  3FJ5 A;  3VUZ A;  2PUK B;  1BBZ A;  3TSZ A;  2J6K A;  5GMK l;  1JXM A;  2L3P A;  2XG8 D;  5LJ3 f;  2RNA A;  4HCB A;  3OSS C;  2ZPH B;  4M75 B;  2YHT A;  2GNC A;  3QHS A;  3L2V A;  1PRL C;  3LGL A;  1V1C A;  3I9Q A;  1YI2 T;  2PTK A;  1SRM A;  2YXY A;  2ECZ A;  3VS3 A;  2HZY A;  1ZA2 B;  3NGP A;  5IHN A;  3JCM c;  2DXT A;  1WZO A;  3EG0 A;  2NUP A;  4M78 E;  3CCU T;  4C0D C;  3S6W A;  1K9A A;  2LJ0 A;  3OYI A;  4JRK A;  2D0Q B;  4FM4 B;  3M0P A;  2AZS A;  3CBP A;  4J6Y A;  4X34 A;  5KYX B;  2DVJ A;  2RHY A;  4EMK C;  4ZN1 A;  3OBY A;  3TEE A;  1I5L A;  1WYX A;  3CCU A;  2FZG B;  5I22 A;  2JJ9 A;  3HSB A;  2A0F B;  2VKN A;  4O6J A;  3OYY A;  2FPD A;  4L6V 5;  4LD9 K;  2RO0 A;  2DL7 A;  2O4X A;  4QQG A;  1BI2 A;  1X2K A;  3QDF A;  3C0C A;  1M3A A;  4RKU E;  1GCQ C;  1WHK A;  2BE7 D;  2E65 A;  3A8L B;  4GLK A;  2C0I A;  3JV3 A;  3CCJ T;  4CI0 C;  3QYH B;  2DYB A;  4JZ3 A;  2Y4X A;  3D7S B;  4DEY A;  4FYV B;  3CCE Q;  3UF4 A;  1TOV A;  2ZPI B;  1VQ7 A;  4F7U A;  2VVK A;  1PSE A;  4Z88 A;  3CCJ A;  2P0Q A;  4J5Y A;  1NJI U;  4IUV A;  3LWI A;  2P0P A;  2HEQ A;  1YCY A;  3EH1 A;  4M77 A;  1Q82 U;  4AFS C;  2E41 A;  1GL5 A;  4VUB A;  3G7Z A;  2DAQ A;  3G6E Q;  2QXF A;  5DLQ E;  3JB9 J;  2V8K A;  1OOT A;  1MMD A;  2LNH B;  2V1R A;  1ZUU A;  7AT1 B;  4NOY A;  4A54 A;  5GAM j;  1NE8 A;  2KSS A;  2A08 A;  2VAS A;  2EJF A;  1QCO A;  3MO8 A;  1ACM B;  1KFZ A;  1K73 C;  3MJX A;  3JB9 F;  1N9S A;  1OUL A;  3SWN C;  1D09 B;  2L3Q A;  1RAI B;  2BUD A;  3M58 A;  3TSW A;  2PNI A;  3CD6 A;  1IB8 A;  1VQ5 T;  1NYF A;  4CC2 A;  5LJ5 e;  4A53 A;  4HVU A;  1C1A A;  1M2V A;  4RTZ A;  5IAY A;  2CT4 A;  2GFA A;  4C0G A;  3CMA T;  1M8M A;  2YRC A;  3JCM f;  2DZC A;  4XU2 A;  1UG1 A;  4RUG A;  4XK8 E;  3TQ7 P;  4Y28 E;  2LT4 A;  1H3Z A;  1V76 A;  1U06 A;  1VYU A;  2DL3 A;  1JJ2 A;  2E4H A;  4DEX A;  2BZY A;  2EWN A;  4M77 D;  1VQ5 A;  2O9S A;  2RMO A;  3E1S A;  1QCN A;  2HSP A;  3CMA A;  2I2L A;  2KE9 A;  1G8X A;  5FRN A;  5CKF A;  2FYK A;  5CAI A;  1VQ9 T;  1YBY A;  5KYU B;  3ZBD A;  1VYV A;  3OMC A;  4J9E A;  1K1Z A;  2RHU A;  3ZL7 C;  4KH0 B;  4RTT A;  3M57 A;  2DRK A;  1YJ9 T;  4LUE A;  4V2S A;  1B34 B;  3H9N A;  2XDD A;  4KUL A;  4M78 B;  4QW2 A;  1KQ1 A;  4LD6 A;  5CK9 A;  3CCV T;  1IGU A;  2O2O A;  1VQ9 A;  2IG0 A;  1WLP B;  2RJC A;  5GAN 6;  4JJC A;  3I55 T;  1QP2 A;  4F7U G;  1LOJ A;  1YJ9 A;  2COZ A;  1JO8 A;  2RQT A;  3TRE A;  4OMP A;  5GJW B;  1WI7 A;  5GAN d;  2COY A;  2CZ6 B;  5CVI A;  1OX8 A;  3CCV A;  4LNP A;  4E7L A;  2F2W A;  5CKH A;  1K9M C;  1UHF A;  4NL2 A;  4RTU A;  3L2W A;  4RMO A;  5GAO r;  2FZC B;  4X9C A;  1NEG A;  1M1K C;  2EFI A;  4A4H A;  2F69 A;  2HDA A;  2DF6 A;  3KUF A;  3VKI A;  3H6Z A;  8AT1 B;  1O75 A;  1WJS A;  3MEW A;  1UHC A;  1M4Z A;  1U1S A;  1H3H A;  4JDS A;  3J81 E;  4F17 A;  1M1G A;  3VU3 C;  4Z89 A;  3RES A;  2MCN A;  4NL3 A;  2GQV A;  1YIT Q;  1E6H A;  3JCM J;  2RK2 A;  3CCL Q;  1G2B A;  3EG9 A;  4RG2 A;  1M1F A;  2O01 E;  1K9M R;  2JW4 A;  4PJO F;  2AKK A;  1PSF A;  1M1K R;  1IRX A;  2LJ1 A;  2HBP A;  1VQ6 A;  3I56 Q;  1G3S A;  2RI3 A;  2DD4 A;  1PKT A;  2NUP B;  2CH4 W;  3QBY A;  2VB6 A;  3JAM E;  1MV0 B;  3M9Q A;  4DA4 A;  1QW1 A;  4OB0 B;  4LDY A;  3MEV A;  3C12 A;  1RAA B;  2OAU A;  2RH2 A;  1QCF A;  5D6W A;  1LNX A;  3NHN A;  1LCK A;  1W6X A;  4ORZ A;  2BKD N;  1TU0 B;  3N5B B;  5HY6 A;  5LJ5 h;  2EVR A;  2DPP B;  1OI1 A;  3HRT A;  2O4X B;  3LYI A;  3QSU A;  3H0I A;  3V7C A;  1VA7 A;  3QPH A;  3EFS A;  4KUI A;  1UEC A;  3QJY A;  2ATC B;  2GTO A;  4C8Q G;  4OML A;  1SEM A;  3CME T;  3G4S T;  2QQ9 A;  2B86 A;  1VQO T;  2YRV A;  1XQH A;  2KRM A;  4BDY A;  4JJD A;  3JB9 H;  4E7J A;  2H8H A;  1BB9 A;  4M7D F;  3E2U A;  3VRZ A;  3CME A;  1AZG B;  1AD5 A;  3I5S A;  3V7R A;  3G4S A;  1VQK Q;  2E3I A;  2XKO C;  1SF9 A;  2F5K A;  4RCC A;  1VQL Q;  1UJY A;  3MEA A;  4M75 A;  4OMF B;  4PJO C;  5KYN A;  1X2Q A;  3FLG A;  2DJQ A;  2ZPB B;  3NTI A;  3QWX X;  2C06 A;  2DBM A;  2OI3 A;  5D6Y A;  1NBE B;  3R6N A;  2KRS A;  4IUR A;  3THK A;  5AYF A;  2OTL T;  2ED0 A;  4DBQ A;  2L2P A;  1WQ7 A;  4FU6 A;  1ZUK A;  2CH4 A;  2RQV A;  3DLL A;  1UGS B;  1YHQ Q;  2L8D A;  5KYX A;  4XQ3 A;  3ZEH A;  3OS2 A;  1BI3 A;  4IKF A;  3OBW A;  5IT9 E;  1HJD A;  1M9S A;  5LJ3 d;  2P0K A;  2DTO A;  1XTD A;  2OTL A;  1S72 A;  2OX7 A;  1QVG A;  2FL7 A;  1ZSZ C;  1BKB A;  2YLC A;  4N4H A;  1RAB B;  3LW5 E;  9ATC B;  3M4G A;  1NYG A;  1PC0 A;  5GAO p;  4OVA A;  3HTR A;  2DTI A;  4C5I A;  4M75 D;  1CSK A;  2PVG B;  5GAN h;  4J7I A;  2CP6 A;  2DIQ A;  1Y71 A;  2AK5 A;  2PVO B;  1JXO A;  3NTK A;  1SSF A;  1YJW T;  5GAM g;  3OYB A;  2QA4 T;  1SG5 A;  1K9M U;  2CSI A;  4EPC A;  3M0R A;  1N5Z A;  3OY9 A;  1FYN A;  1YP5 A;  2JT4 A;  3JCM b;  4ZGJ B;  4M7D C;  4DOW A;  2DXB A;  2FHD A;  4Y92 A;  1YJW A;  1FMW A;  2ZAE A;  2EPD A;  4Q5W A;  2DMO A;  1VUB A;  4QT7 A;  1UEB A;  2KDS A;  3FIF A;  3C94 A;  4A4E A;  2XMF A;  2E5K A;  2NUT B;  4B9W A;  3CCR Q;  3JSC A;  4XTV A;  1V29 B;  3I5R A;  1EX4 A;  2RD1 A;  4XTW A;  2HL5 C;  2KY9 A;  2CP2 A;  1MHN A;  3CCS T;  4M75 G;  4M7A F;  5CIU A;  4RCB A;  3EFO A;  4C92 F;  1RUW A;  1BCO A;  1MGQ A;  4LN2 A;  4PLI A;  3JCM W;  1OU8 A;  1JQQ A;  1SHG A;  2CGH A;  3CCS A;  1Q82 C;  2E12 A;  4II1 A;  1FWZ A;  1D1C A;  1TUC A;  4PFZ A;  1QVP A;  1QLY A;  2LP5 A;  2M9U A;  3HHT B;  1VQ4 A;  2KNB B;  3L1A A;  2VUB A;  1RAD B;  1TUD A;  2LRQ A;  4XTZ A;  2J05 A;  4C0D B;  3JB9 D;  5IXB A;  2KEA A;  3IQL A;  3ER0 A;  3M0S A;  1VQ8 Q;  2L5Q A;  1ZUY A;  3UDC A;  2X4J A;  5KYU A;  4EMK B;  2DTH A;  3MP8 A;  1ZSG A;  1Q82 R;  3URG A;  1B34 A;  1VIE A;  1M27 C;  1JB0 E;  2DFU A;  2EYX A;  2VC8 A;  4M78 A;  3L2Z A;  3LGF A;  3GF5 A;  3O5Z A;  1KSW A;  5I2M A;  1RAC B;  2HQH A;  4D8D A;  1FXX A;  4HT8 A;  2DO3 A;  2WSC E;  3VS4 A;  1W2B P;  2E6N A;  3A8M B;  1UUE A;  1YIJ A;  2LQW A;  1AHJ B;  2LQK A;  4QVZ A;  3FB9 A;  4OGC A;  4M7A C;  1Q7Y U;  4O5V A;  4C92 C;  1AWO A;  4ZTF A;  1WGS A;  1ZLM A;  4BB7 A;  2Y90 A;  2KYM A;  4WF2 A;  2X4X A;  3U23 A;  2RHI A;  3JCM e;  1SKU B;  4R0K A;  3DB4 A;  2M51 A;  2VV5 A;  3OS1 A;  3L42 A;  1QKX A;  3QJ6 A;  3CC4 Q;  3VYG A;  2YSQ A;  4PJO A;  2VGM A;  3GNG A;  3OS5 A;  1BU1 A;  4M78 D;  2HNI A;  1ABQ A;  1UGV A;  1AEY A;  4WCI A;  2HKQ B;  3G6E T;  5LJ3 h;  1N27 A;  3VS7 A;  1KQS P;  3CXC P;  2HBW A;  2JTM A;  3SWN B;  1RLQ C;  2IIM A;  3SDZ A;  1IXD A;  4FSS A;  1K0S A;  2X3X D;  3PE0 A;  2ED1 A;  3LLR A;  2K2V A;  2MOX A;  3HRU A;  3HFO A;  3JCM X;  3S3O A;  4OP0 A;  1D1B A;  2D1X A;  2K5L A;  1ZSZ A;  4BY6 C;  1YI2 A;  1WPY A;  2RK1 A;  2DL8 A;  3V8K A;  1M3B A;  1CKB A;  4E47 A;  2MWO A;  4ZGE B;  4RTY A;  4QQD A;  1I8F A;  4A4F A;  2RN8 A;  1VQP Q;  4PJO D;  4JUV A;  4M78 G;  1B7T A;  1E7O A;  2V26 A;  3OYN A;  1D3B B;  3GIB A;  4OB3 B;  4E7S A;  1WHL A;  2MF2 A;  4IUQ A;  4LXC A;  1LVK A;  2CDT A;  2HKN A;  1YN8 A;  1ZQ1 A;  3OYG A;  3A98 A;  1BK2 A;  1Q86 C;  3VJP A;  4M7D A;  1WDX A;  1QWE A;  1HSQ A;  2BZ8 A;  4PJO E;  2RB6 A;  2G6F X;  3PVQ A;  1SSH A;  2KR3 A;  3X26 B;  2D8H A;  1YCS B;  3OSV A;  2XID A;  3SB2 A;  2XDP A;  2EKH A;  1VYT A;  2M02 A;  3QZ5 B;  1B3Q A;  1NM7 A;  2LC4 A;  1WX6 A;  4FIB A;  2WSE E;  3A8O B;  3DLM A;  1UGP B;  1BI0 A;  1W1F A;  2V1Q A;  4E6R A;  5HK0 A;  3CPF A;  5C6S A;  1IHV A;  2NWM A;  2RJE A;  4MML A;  1DJ7 B;  2K4Y A;  3O8V A;  2DD5 A;  1Q86 R;  2HD0 A;  2J6O A;  2X35 A;  2QDL A;  1FMK A;  2ABL A;  1BI1 A;  3OB9 A;  2CRE A;  3EFO B;  2DX1 A;  2FPE A;  4PL6 A;  2ROL A;  4M7D D;  2LTO A;  3ZFJ A;  1VQM Q;  4FCY A;  3R6O A;  5HK3 A;  3WVD B;  1YIT T;  2CKK A;  2E5Q A;  1BIB A;  3CCL T;  4BI8 B;  1N9R A;  2RJF A;  3JCM h;  4OMN A;  2VXF A;  2CS7 A;  4XAX B;  2FZK B;  4QVD A;  3EAE A;  5CO7 A;  2M0O A;  4M7D E;  5D7U A;  2MIO A;  3I56 T;  4R56 A;  5GAO m;  3AHU A;  2GFU A;  1XNI A;  2LZ6 B;  1KC8 U;  1QVF A;  4ZNX A;  1VQN Q;  3BDL A;  2CZ0 B;  5LJ5 g;  1Y0M A;  4LUD A;  2LQN A;  1JJ2 S;  1FMV A;  4MZT A;  2X3W D;  3QDR B;  3CPW A;  1WXU A;  3I56 A;  2IVW A;  5DY9 A;  1TH7 A;  1I1J A;  5GMK e;  3PFS A;  2LX7 A;  1K8A U;  4A4G A;  1QVF S;  3G71 Q;  2LQ8 A;  3RNJ A;  1UDL A;  1RAE B;  1OPK A;  2K5I A;  1VQ7 Q;  3EGX A;  2A7Y A;  5FU7 C;  3VYH B;  2D9T A;  4M7A A;  3CPW S;  4C92 A;  2FRY A;  3X25 B;  2VXE A;  2QTX A;  2CP0 A;  1AOJ A;  2NUT A;  3MEU A;  5KH6 A;  1PD1 A;  1Q81 R;  1WNL A;  4C0F A;  3X24 B;  1WXT A;  2CZ7 B;  4M77 G;  1WJQ A;  4AMC A;  2DNU A;  5J39 A;  4EIK A;  2YT6 A;  2EGE A;  2QQB A;  3I55 A;  4Z02 A;  4AG2 C;  2QQS A;  1TS9 A;  4PNO A;  1ARK A;  2FB7 A;  1KD1 R;  3VS2 A;  1ABO A;  1G3T A;  4JJB A;  2KGT A;  2BZX A;  1M5Q 1;  1VQK T;  3KFV A;  3SFM A;  2DLP A;  4WTO B;  1VQL T;  5IHK A;  4F14 A;  4PJO B;  3CD6 Q;  5GAN e;  5GMK i;  4FT2 A;  4HA8 A;  1UFF A;  3FJP A;  2KRN A;  3QUI A;  5IN1 A;  5GJV B;  2FG0 A;  4BI3 A;  5GAN 4;  1X75 C;  1VQL A;  4FYW B;  1M3C A;  3CBM A;  2EAY A;  2DEQ A;  3RBB B;  2L0A A;  2Y4Y A;  3H0F A;  4BD3 A;  4EMK A;  3CMA Q;  1UGQ B;  1KK7 A;  2DIL A;  1Q86 U;  2JN0 A;  2F1L A;  4ZGD B;  4JRP A;  3RER A;  3OMG A;  3P8H A;  1TSF A;  4M7A E;  2X4Y A;  1ZSZ B;  4C92 E;  2EGA A;  1JBM A;  2KYB A;  5FWB A;  3M54 A;  3JB9 I;  1UGR B;  1RAH B;  3M0T A;  5J3B A;  1GCQ A;  2PUO B;  2R57 A;  2R58 A;  2RQU A;  3DB3 A;  4BUG A;  4KRT A;  2RA2 A;  3M0Q A;  1VQ9 Q;  3VS1 A;  4A63 B;  3CC7 T;  1O9S A;  2OTJ T;  3VS6 A;  2CP7 A;  4JS4 A;  2ROT A;  3TCJ A;  4C8Q E;  2ZCF B;  3HPW A;  2RI2 A;  3OA6 A;  3RKX A;  4BAC A;  4M7D B;  3FDR A;  4DBH A;  2GGR A;  4QQ6 A;  4FW1 A;  3QII A;  4LDW A;  1X43 A;  3M55 A;  3CC7 A;  2OTJ A;  1YWO A;  2JM9 A;  1BCM A;  1W70 A;  3VS0 A;  2EGC A;  1NLO C;  1BIA A;  2KMT A;  4CRI A;  1ZHI A;  2AZV A;  1K76 A;  1U3O A;  1VQO A;  3GPL A;  3M5A A;  3I35 A;  5GAN 7;  5DLO A;  4J9F A;  3X20 B;  5GMK h;  4FT4 A;  3P8D A;  2CSQ A;  4KBM B;  1Y57 A;  1OQK A;  1Q7Y C;  2EQU A;  4C5H A;  3UPU A;  4MMK A;  4MZM A;  1QQJ A;  3SWN A;  1HYO A;  3RUX A;  4HT9 A;  2AT1 B;  2SEM A;  1KHC A;  5GAM d;  3TU4 K;  4HCC A;  2COW A;  4R55 A;  5LL6 S;  3M4Y A;  4B6M A;  5KYY B;  4F7U F;  2MWP A;  3BW1 A;  1Q81 U;  2KXC A;  1VQ6 Q;  4J9D A;  2A28 A;  2E64 A;  4N4I A;  3CC2 Q;  5IH2 A;  2K5F A;  1Q7Y R;  3J7A F;  3EHQ A;  1PKS A;  4KGX B;  1KD1 U;  4LDX A;  2QEX Q;  1WHG A;  2JNG A;  4XTY A;  1KG1 A;  2P84 A;  1D3B A;  2YUO A;  1YNZ A;  1RLP C;  1VQ8 T;  3T9N A;  4PKC C;  4AFQ C;  3OYK A;  1NPP A;  4PJJ A;  3LH5 A;  4F04 B;  5CR2 A;  2F5T X;  2RQW A;  3LH0 A;  3ULR B;  3RMS A;  1QVG S;  1RAF B;  2O88 A;  3VS5 A;  4RG8 A;  1VQ8 A;  1G5V A;  2LX9 A;  3PIO A;  2O31 A;  1M30 A;  4NS5 A;  5LJ3 e;  4A4K A;  1GFC A;  3CQT A;  4HKE A;  4XU0 A;  5M9O A;  1M8V A;  3H8Z A;  3HRS A;  2MI6 A;  2HL3 A;  3OW2 A;  5J26 A;  2QA4 A;  3EG2 A;  2JMA A;  3EGD B;  2DRM A;  2L3R A;  5HKC A;  3EGX B;  5DM7 R;  3REA B;  4M7A B;  2ESW A;  3ASK A;  4E2F B;  4C92 B;  1YJN Q;  2LCS A;  1AVZ C;  1OYX A;  1T3S A;  2A3L A;  4IUT A;  1PM3 A;  5LJ5 j;  3OW2 S;  2DEU A;  1YWP A;  3CCM Q;  2Z0W A;  3V8J A;  2RHZ A;  4HXJ A;  4JLI A;  4N0A C;  5KE2 A;  1IGQ A;  6AT1 B;  4DBR A;  2JS2 A;  3CC4 T;  1ZA1 B;  3BY7 A;  1OZ2 A;  5KE3 A;  4AG1 C;  4J9G A;  4C8Q B;  1R8O B;  1EZZ B;  1LJO A;  2LDM A;  4OMO A;  3RMQ A;  1UTI A;  3FRN A;  1X69 A;  5A0L A;  2RPN A;  3A1P A;  1WIE A;  4PFP A;  3CEY A;  2RM4 A;  2AIR B;  2YUQ A;  1X27 A;  2CP3 A;  4UC4 A;  2V8I A;  3CC4 A;  4C8Q F;  2PQW A;  2E70 A;  1UJ0 A;  2FO0 A;  2A37 A;  2MMP A;  2GBQ A;  1K4U S;  1N6A A;  4TVR A;  2HMA A;  1S72 Q;  2DA9 A;  3MCA B;  3NMZ C;  2O9V A;  3E9G A;  5GMK j;  2OJ2 A;  1U5S A;  1Y96 B;  1SRL A;  1OX9 A;  3QO3 A;  2QQR A;  4BY6 B;  3KXT A;  4ELY C;  5GAO n;  4E7K A;  3L2R A;  4J6X A;  3JCM V;  1AT1 B;  4BE0 A;  2JUF A;  1UB4 A;  1VQP T;  1H8K A;  2XDB A;  2XU8 A;  2D8J A;  4JRQ A;  4E7H A;  2YUN A;  2E3H A;  2QYZ A;  1C6V X;  5I11 A;  2LJ3 A;  1R0C B;  4GY5 A;  1ZX6 A;  1M90 R;  1HXD A;  1TWB A;  1YJW Q;  2XD0 A;  3NPF A;  3V8L A;  1QP3 A;  2GTJ A;  2W10 A;  1KC8 C;  4BDZ A;  2G3R A;  3L2Q A;  1IO6 A;  1OEB A;  2DL4 A;  3CCE T;  2EYQ A;  3JB9 G;  2DM1 A;  2JTF A;  4L59 A;  2EQM A;  5GAN j;  2M16 A;  3GBQ A;  4FYX B;  4E7Z A;  2NUZ A;  5GAM f;  1K8A C;  5FRM A;  5CCA A;  2MAM A;  4LDV A;  3A5Z B;  3PTA A;  3OYJ A;  3EH2 A;  3CCE A;  2AKL A;  3GLX A;  3VRY A;  5GAN 2;  4C8Q C;  1RL2 A;  1KC8 R;  3CCS Q;  1X01 A;  1RI0 A;  5EC7 A;  4HCK A;  1WQW A;  2C0T A;  4JZ4 A;  1TG0 A;  1WHM A;  1IRE B;  1Z9Z A;  2CYZ B;  3FEO A;  1GBR A;  3OYA A;  3MP6 A;  4GLM A;  1VQ4 Q;  2PU9 B;  3KBG A;  1I4K 1;  2BIV A;  1K8A R;  3G6E A;  5ECA A;  2WAC A;  5CKD A;  1VQM T;  5I21 A;  1XOV A;  5AT1 B;  2KBT A;  2D6F A;  2XK0 A;  2JM8 A;  3RR6 A;  1KQ2 A;  5FRO A;  1MV3 A;  5A0D A;  4KT0 E;  5A2Q E;  1CKA A;  2EYY A;  3OYL A;  2OTJ Q;  2I0N A;  1VQM A;  3MPU B;  1VIF A;  4M75 F;  3EFR A;  2EQK A;  1G83 A;  5I2S A;  4QKU A;  4F16 A;  3INZ A;  2MYS A;  4J9B A;  4YTL A;  2MK5 A;  1VQN T;  3A8G B;  2KK4 A;  4EMG A;  1I5O B;  2LVM A;  1YIJ Q;  3E19 A;  2L89 A;  1VOM A;  2P4R A;  2CZ1 B;  4J83 A;  2DK3 A;  2EW3 A;  1N8R U;  4HCZ A;  3QXE B;  1B07 A;  4FSX A;  2K3Y A;  2K7A A;  1KJW A;  3CCQ Q;  4XTX A;  1AZE A;  3UA7 A;  1VQN A;  5CQY A;  2K6D A;  4ZN3 A;  3G71 T;  2YLB A;  5FU7 B;  1KHI A;  3M53 A;  2DKG A;  1VQ7 T;  1QKW A;  2PZ1 A;  4KGZ B;  3EG1 A;  1WFW A;  1KIK A;  3JCM P;  1EIF A;  4ME7 A;  2NYS A;  3JCM Q;  2CUD A;  1G3W A;  4N4G A;  4D8K A;  2M1H A;  2KI7 A;  3SD4 A;  3G71 A;  5D6X A;  4PJO G;  1JRI A;  4X1V A;  4N0A A;  4KUD K;  4CC4 B;  1D1A A;  1C0M A;  3RIR A;  2K3X A;  4LDU A;  1PD0 A;  3G1J A;  5LJ5 d;  2VYT A;  2YDL A;  2QGG A;  1M90 U;  1TTH B;  2EQI A;  5KYW B;  5KYY A;  2DVE A;  3MHX A;  1GXI E;  4J8O A;  1I81 A;  3CD6 T;  5A0G A;  4IIO A;  1D0X A;  1Y7X A;  5HCK A;  3H41 A;  4M75 C;  4OMQ A;  4C5E A;  1ZBX A;  2EKO A;  2EJ9 A;  3P8B B;  1YI2 Q;  2QG9 B;  1NPR A;  3Q1J A;  4XU1 A;  2NLU A;  3JRZ A;  5CKB A;  2RJD A;  1WHJ A;  2KT8 A;  3CCU Q;  1YIT A;  2VGN A;  1MMA A;  3CCL A;  4LE9 A;  4JPB W;  1HK9 A;  1GBQ A;  5LJ3 j;  1SPK A;  3OS0 A;  3HL8 A;  1NZ9 A;  1TXQ A;  5IXF A;  3OYE A;  5L8R E;  5GAN 3;  1Q81 C;  2GQI A;  4FL6 A;  4JLG A;  2YUP A;  3NTH A;  1K73 R;  2KXD A;  3MKD A;  2HSE B;  4PFO A;  3L2U A;  4ATO A;  4M7D G;  3GP8 A;  2OAW A;  4C0Z A;  2CT3 A;  2DZ9 A;  1KD1 C;  2B8A A;  4F7U E;  3EGD A;  4CC3 A;  2EQJ A;  2J06 A;  4DOV A;  4CC7 A;  3CCJ Q;  4IUP A;  1S1N A;  2HQE A;  2YWW A;  3UT1 A;  2JTE A;  2R5A A;  1QMC A;  2RHX A;  4KGV B;  4M77 E;  1F1B B;  3EGU A;  1WJR A;  3NFC A;  8ATC B;  1GRI A;  3X28 B;  4AFZ C;  2F2X A;  3OQ5 A;  2XI9 A;  4BE1 A;  2JMC A;  3VUB A;  1BYM A;  1NEB A;  4C8Q A;  3AT1 B;  5L23 A;  4C5G A;  4M78 F;  2J7I A;  1SHF A;  5FU6 B;  3S3N A;  2LCC A;  3SEM A;  1Y07 A;  4DBF A;  3TVT A;  1MNE A;  1TUG B;  1E6G A;  4AT1 B;  4BE2 A;  4OB2 B;  3RDV A;  2QAS A;  4P5N A;  4ZTJ A;  3PNW C;  1IHW A;  2ZPF B;  2FEI A;  2HCK A;  2J6F A;  1VQK A;  3M56 A;  3PMT A;  4M7A D;  4XU3 A;  4RTX A;  4C92 D;  1JJ2 P;  1Y96 A;  3SHW A;  3PIP A;  1VQ5 Q;  2K3B A;  1JEG A;  2LT1 A;  1OV3 A;  1YHQ T;  1VQ6 T;  1UE9 A;  3M0U A;  2X4W A;  1QVF P;  3H0H A;  4HVW A;  3C4S A;  3OYM A;  2GF7 A;  2SRC A;  5GAN g;  3ME9 A;  4OB1 B;  3CC2 T;  1T0J A;  2QQA A;  4C8Q D;  2QAZ A;  3CPW P;  2KVQ G;  4PJN A;  4PLL A;  2QEX T;  2JOY A;  1YHQ A;  3QYG B;  3VV0 A;  2FPF A;  2QGF B;  3GNF B;  4OGE A;  5CQX A;  2ZGW A;  2DET A;  4E7I A;  1MUZ A;  4AFU C;  3GOX A;  4OF1 A;  1QWF A;  3CC2 A;  3PGG A;  2QEX A;  1YJ9 Q;  2DJZ A;  3C95 A;  4IUU A;  4M7A G;  2QI2 A;  3MP1 A;  4C92 G;  3BE3 A;  3CCV Q;  1PHT A;  2PVD B;  4M78 C;  4KH1 B;  3F70 A;  5FLX E;  5LJ5 f;  5EG2 A;  3REB B;  3I55 Q;  4EMH A;  2EJG A;  1U1T A;  4Z8A A;  2BE9 B;  3QZ9 B;  2VWF A;  2EIF A;  4JJN K;  2H3J A;  5FU6 C;  1OPL A;  2R5M A;  5GAO l;  1X6B A;  2ZPE B;  1YJN T;  3CCR T;  1GCP A;  1WA7 A;  3OYD A;  1K73 U;  4JRI A;  2JVV A;  3CBO A;  1G3Y A;  4HVV A;  4X9D A;  3QKJ A;  4L5G A;  1Q95 G;  3CCM T;  1AWJ A;  4F7U B;  3BFM A;  4ELZ C;  3MET A;  1X6G A;  5C0M A;  2ZZD A;  1YJN A;  3CCR A;  1H92 A;  2XIC A;  2HAX A;  4M77 B;  2DE0 X;  3BDU A;  1P92 A;  4ANJ A;  3CCM A;  2KQW A;  1PNJ A;  2FVU A;  1R77 A;  2K2M A;  3LWH A;  2RQR A;  3LX7 A;  4M77 F;  2L3S A;  1NLP C;  2EYW A;  1S72 T;  2V8J A;  4J9C A;  2P4T A;  3EHR A;  5CKE A;  1PG5 B;  3RKW A;  1ZBJ A;  4D6W A;  2A36 A;  5GAM e;  2K9G A;  1M2V B;  1MMN A;  5FW9 A;  4J6W A;  4M4Z A;  2BTT A;  2KT1 A;  4QVC A;  3HFN A;  2AHJ B;  3DKM A;  4OMM A;  3RKY A;  2X9H A;  1RAG B;  4MZP A;  3OYC A;  2LCL A;  5GMK m;  2JZ2 A;  1OU9 A;  4MDW A;  5GAN f;  4FW2 A;  2X51 A;  3CC7 Q;  2KRO A; 
#chains in the Genus database with same CATH homology
 2CH4 W;  2AKL A;  1MV0 B;  3VRY A;  4OMN A;  4ESR A;  1QCF A;  5EC7 A;  4HCK A;  1T3L A;  3NHN A;  2C0T A;  1LCK A;  4JZ4 A;  5IHI A;  1TG0 A;  2RF0 A;  1Z9Z A;  1W6X A;  4ORZ A;  1GBR A;  2D0N A;  4GLM A;  2MIO A;  2JS0 A;  1JU5 C;  2EVR A;  4J9I A;  5ECA A;  2LZ6 B;  4GBQ A;  3H0I A;  4ZNX A;  1VA7 A;  1XOV A;  2KBT A;  1UEC A;  1Y0M A;  4LUD A;  2LQN A;  2GTO A;  2K79 A;  1SEM A;  2JM8 A;  4OML A;  2X3W D;  1MV3 A;  1WXU A;  4K11 A;  2B86 A;  1CKA A;  2EYY A;  2DL5 A;  1I1J A;  4RTV A;  2CUB A;  2I0N A;  2KRM A;  2LX7 A;  2JXB A;  4J9H A;  1T0H A;  4JJD A;  3UAT A;  1I07 A;  2H8H A;  3RNJ A;  1BB9 A;  1G83 A;  1UDL A;  1OPK A;  3VRZ A;  1AZG B;  1AD5 A;  2M0Y A;  3I5S A;  5FWC A;  4F16 A;  1K0X A;  4J9B A;  2FRY A;  1UJY A;  1AOJ A;  2DBK A;  4IIM A;  2P4R A;  1X2Q A;  2C0O A;  2DJQ A;  1WXT A;  2EW3 A;  3QWX X;  2DNU A;  2DBM A;  4EIK A;  2YT6 A;  2EYZ A;  2OI3 A;  1B07 A;  2EGE A;  1RI9 A;  2K7A A;  1KJW A;  3R6N A;  1GFD A;  2KRS A;  1AZE A;  4AG2 C;  3UA7 A;  2K6D A;  1ARK A;  1EFN A;  1AWW A;  3THK A;  2ED0 A;  3VS2 A;  1ABO A;  2L2P A;  1QKW A;  2PZ1 A;  4JJB A;  2KGT A;  2BZX A;  1ZUK A;  3KFV A;  2CH4 A;  2RQV A;  4RTW A;  1WXB A;  1WFW A;  2DLP A;  3EG1 A;  1KIK A;  2EBP A;  5IHK A;  4F14 A;  3EG3 A;  2CUD A;  1HJD A;  4D8K A;  2LMJ A;  4X1V A;  1UFF A;  1I0C A;  2KRN A;  1PWT A;  4CC4 B;  5GJV B;  2FG0 A;  1NG2 A;  2FRW A;  1A0N B;  1NYG A;  1M3C A;  2YDL A;  2ENM A;  3PVL A;  1CSK A;  2EQI A;  3RBB B;  2L0A A;  3H0F A;  2AK5 A;  1JXO A;  2W0Z A;  2DIL A;  2CSI A;  3UA6 A;  1PRM C;  4IIO A;  3M0R A;  5HCK A;  1N5Z A;  3H41 A;  4OMQ A;  1FYN A;  1YP5 A;  2JT4 A;  3QWY A;  1J3T A;  2EGA A;  1HD3 A;  2KYB A;  5FWB A;  4Y92 A;  1AWX A;  3M0T A;  1GCQ A;  2KT8 A;  2EPD A;  1Z9Q A;  2DMO A;  4QT7 A;  2RQU A;  4LE9 A;  4JPB W;  2F2V A;  3FJ5 A;  1GBQ A;  4KRT A;  1BBZ A;  3TSZ A;  3M0Q A;  2J6K A;  1SPK A;  3VS1 A;  4A63 B;  1JXM A;  3VS6 A;  5IXF A;  2XMF A;  2L3P A;  2E5K A;  2RNA A;  2ROT A;  3I5R A;  2GQI A;  2GNC A;  2YUP A;  1PRL C;  2GGR A;  1V1C A;  3I9Q A;  2KXD A;  2PTK A;  1SRM A;  2ECZ A;  3VS3 A;  1X43 A;  1YWO A;  2JM9 A;  3NGP A;  5IHN A;  1RUW A;  3EG0 A;  2OAW A;  2CT3 A;  1K9A A;  1W70 A;  2LJ0 A;  4LN2 A;  2EGC A;  3VS0 A;  1NLO C;  4CC3 A;  2J06 A;  1JQQ A;  1SHG A;  3M0P A;  2AZS A;  2AZV A;  1K76 A;  4CC7 A;  1U3O A;  1S1N A;  2DVJ A;  1TUC A;  2JTE A;  3I35 A;  4J9F A;  3EGU A;  1QLY A;  2LP5 A;  1WYX A;  2CSQ A;  1Y57 A;  1GRI A;  2KNB B;  5I22 A;  1TUD A;  2VKN A;  4AFZ C;  2F2X A;  2J05 A;  2FPD A;  5IXB A;  2DL7 A;  2JMC A;  2SEM A;  2KEA A;  3IQL A;  1X2K A;  3M0S A;  1NEB A;  5L23 A;  3C0C A;  1M3A A;  1GCQ C;  2J7I A;  1ZUY A;  1SHF A;  2C0I A;  3JV3 A;  2KXC A;  3SEM A;  2DYB A;  4JZ3 A;  4J9D A;  3TVT A;  1ZSG A;  4DEY A;  2A28 A;  1E6G A;  1M27 C;  3UF4 A;  2EYX A;  5IH2 A;  3O5Z A;  2FEI A;  1KSW A;  2HCK A;  2J6F A;  3EHQ A;  1PKS A;  2VVK A;  4D8D A;  4Z88 A;  3VS4 A;  2YUO A;  4RTX A;  1YNZ A;  2HEQ A;  1RLP C;  3SHW A;  1UUE A;  4AFQ C;  2LQW A;  4AFS C;  3LH5 A;  2K3B A;  2RQW A;  1JEG A;  1OV3 A;  3ULR B;  1GL5 A;  1UE9 A;  3M0U A;  3H0H A;  4HVW A;  1OOT A;  2LNH B;  2O88 A;  2V1R A;  1ZUU A;  1AWO A;  3VS5 A;  2SRC A;  1ZLM A;  2KYM A;  2A08 A;  1T0J A;  2O31 A;  3U23 A;  1M30 A;  4R0K A;  1KFZ A;  1GFC A;  3CQT A;  2M51 A;  1QKX A;  2L3Q A;  2FPF A;  3TSW A;  2PNI A;  2YSQ A;  1MUZ A;  3EG2 A;  2JMA A;  4AFU C;  2DRM A;  1NYF A;  1QWF A;  4CC2 A;  4HVU A;  3REA B;  1BU1 A;  4RTZ A;  1ABQ A;  1UGV A;  2ESW A;  2CT4 A;  4WCI A;  1AEY A;  1M8M A;  1UG1 A;  4RUG A;  2LCS A;  3VS7 A;  1AVZ C;  1U06 A;  1T3S A;  1VYU A;  2HBW A;  2DL3 A;  1YWP A;  4DEX A;  2BZY A;  1PHT A;  2O9S A;  2RMO A;  4HXJ A;  1RLQ C;  2HSP A;  2IIM A;  2KE9 A;  3REB B;  2JS2 A;  4FSS A;  1K0S A;  4AG1 C;  2X3X D;  3PE0 A;  4J9G A;  2ED1 A;  4OMO A;  2MOX A;  1UTI A;  4Z8A A;  1X69 A;  2VWF A;  2RPN A;  1VYV A;  1WIE A;  2D1X A;  1OPL A;  1K1Z A;  4J9E A;  3ZL7 C;  2DL8 A;  1X6B A;  2YUQ A;  4RTT A;  2DRK A;  1M3B A;  1CKB A;  1X27 A;  4LUE A;  1GCP A;  1WA7 A;  4HVV A;  4RTY A;  1UJ0 A;  2FO0 A;  2A37 A;  1K4U S;  2GBQ A;  2RN8 A;  1AWJ A;  2O2O A;  1WLP B;  2DA9 A;  1X6G A;  1E7O A;  3NMZ C;  4JJC A;  2O9V A;  2OJ2 A;  1U5S A;  1H92 A;  2RQT A;  1JO8 A;  1SRL A;  4OMP A;  5GJW B;  1WI7 A;  2DE0 X;  2CDT A;  1YN8 A;  4LNP A;  3A98 A;  1BK2 A;  1WDX A;  1PNJ A;  1QWE A;  2F2W A;  1HSQ A;  2BZ8 A;  1UHF A;  4RTU A;  2K2M A;  2G6F X;  3PVQ A;  1SSH A;  2RQR A;  2KR3 A;  2L3S A;  1H8K A;  1NEG A;  1NLP C;  2D8J A;  2EYW A;  2HDA A;  2DF6 A;  2YUN A;  2D8H A;  1YCS B;  1UHC A;  1H3H A;  4J9C A;  2EKH A;  1VYT A;  5I11 A;  1B3Q A;  1NM7 A;  3EHR A;  2LJ3 A;  1WX6 A;  4F17 A;  1ZX6 A;  1ZBJ A;  1W1F A;  2V1Q A;  4Z89 A;  4E6R A;  2MCN A;  2A36 A;  3NPF A;  1E6H A;  2K9G A;  2GTJ A;  2NWM A;  2W10 A;  1G2B A;  5FW9 A;  4M4Z A;  2BTT A;  2KT1 A;  1IO6 A;  2J6O A;  1OEB A;  2DL4 A;  4OMM A;  2DM1 A;  2QDL A;  2JW4 A;  1FMK A;  2ABL A;  2AKK A;  2CRE A;  3GBQ A;  2NUZ A;  2LJ1 A;  2DX1 A;  2FPE A;  2ROL A;  1PKT A;  2KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...