2KROA

Rdc refined high resolution structure of the third sh3 domain of cd2ap
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
b'GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
molecule tags Signaling protein
source organism Mus musculus
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kroA00
1IO6A 3EG1A 5EC7A 2YT6A 2GNCA 2RQWA 4CC7A 3VS0A 1GFDA 2DF6A 1K1ZA 4ESRA 2GQIA 3UA6A 2ESWA 2FEIA 4A63B 3VS6A 4KRTA 1W70A 3VRZA 4LUEA 2K6DA 4Z8AA 2CDTA 2M0YA 4CC2A 2A28A 3ZL7C 5GJVB 1PHTA 2LP5A 1SRMA 1PRLC 3KFVA 2KEAA 2YUPA 3UA7A 1I0CA 2C0TA 2E5KA 1X2QA 2RMOA 2KYMA 2FPFA 1M8MA 1NG2A 2L3SA 4J9BA 1M27C 4OMMA 2D1XA 3R6NA 2RQRA 1GFCA 2M51A 3UF4A 1E6GA 1YCSB 2W10A 2BZYA 1BBZA 1NEGA 2RN8A 2JS2A 2A08A 4X1VA 4J9IA 2SRCA 4LUDA 4AFUC 2AKKA 4JPBW 1Z9QA 2RQVA 1UHCA 1UJYA 1JU5C 1FMKA 2A36A 2EBPA 1PWTA 2KT8A 4JJBA 1JQQA 4J9CA 5FW9A 2LJ3A 3THKA 4FSSA 2EYZA 4J9DA 2ED0A 3ULRB 1SHFA 1Y0MA 5FWCA 2J06A 1BK2A 1VA7A 1YP5A 2DBMA 2KR3A 1S1NA 3CQTA 1QLYA 1JEGA 2DX1A 4JJDA 2PTKA 1ZUYA 1AWXA 1UTIA 2KXCA 2BTTA 3TVTA 2XMFA 2CUBA 1GBQA 2RPNA 3M0TA 1RLQC 3GBQA 2DILA 3EG3A 1MUZA 2HCKA 1FYNA 1X2KA 1V1CA 4JZ4A 1UECA 2A37A 2AK5A 1OV3A 1GCQA 2EKHA 1AZEA 5IXFA 2O2OA 2DM1A 1X6GA 1NLOC 2LQNA 2LNHB 3I9QA 4ORZA 2JXBA 2CUDA 2X3XD 1LCKA 1AD5A 4LNPA 1X27A 3H0HA 3QWXX 1UFFA 1GCPA 1J3TA 2F2XA 4OMQA 2FRYA 2JM9A 4AG1C 2YUOA 1QKXA 1WIEA 3UATA 2EPDA 2YUNA 2L3QA 1AWJA 4OMNA 2F2VA 3NPFA 2DYBA 2KGTA 4AG2C 1H8KA 1UGVA 1CKBA 2LMJA 2NWMA 1E6HA 1NYGA 4IIOA 2PNIA 2FO0A 4HVUA 2VVKA 1B3QA 1ZUUA 1HJDA 3PVLA 2AZVA 3TSWA 1M3BA 4Y92A 1WDXA 1AEYA 1Y57A 1GL5A 5IXBA 4CC4B 3M0PA 5GJWB 5ECAA 1AWWA 1RI9A 1ZSGA 3REAB 4QT7A 1Z9ZA 4RTWA 5IHKA 3C0CA 2MIOA 4RTUA 4OMPA 1JXOA 2FG0A 2JW4A 3VS4A 2JS0A 1WI7A 2EGCA 2VWFA 2QDLA 1NM7A 2J6FA 1A0NB 2BZXA 3I5SA 1GRIA 1GCQC 1YWPA 2DL5A 3M0SA 2J05A 1I1JA 5FWBA 1SRLA 2DL8A 3M0UA 4IIMA 1SPKA 4WCIA 2RF0A 1BB9A 4E6RA 1WXUA 2VKNA 5L23A 4J9GA 5IHNA 1W6XA 2CREA 1UHFA 2C0IA 2EGEA 2BZ8A 2G6FX 4RTXA 2K7AA 1K0SA 1AWOA 4J9HA 2CH4A 1TUDA 1VYVA 1KFZA 2HDAA 2L0AA 2HBWA 2JT4A 2DL4A 2YDLA 3PE0A 2O88A 3O5ZA 2RQTA 2J7IA 2ECZA 1WYXA 1M3AA 1X69A 1T0HA 1UJ0A 3VS3A 3NGPA 1YWOA 3H0IA 2HSPA 1NEBA 2YSQA 4CC3A 3NHNA 4F17A 2CSIA 2W0ZA 2F2WA 4ZNXA 1H92A 1UUEA 2ENMA 2AZSA 2KRSA 2D0NA 3SHWA 2DMOA 2J6KA 2FRWA 2I0NA 1SSHA 2DVJA 1WLPB 1WA7A 1ABOA 2DL3A 3EG2A 5I22A 4Z88A 2KROA 2KBTA 3H0FA 2IIMA 4RTZA 3RBBB 2K2MA 2KYBA 3FJ5A 4K11A 4JJCA 1K0XA 1PKSA 2FPEA 2V1QA 4R0KA 2DRKA 1JO8A 1NYFA 3I35A 4EIKA 4HCKA 2DL7A 1OOTA 1U06A 4LN2A 2EYXA 2KE9A 1RUWA 1AZGB 3H41A 2DJQA 1MV3A 1YNZA 3VRYA 2CT3A 1AVZC 3A98A 1MV0B 2ED1A 2NUZA 2EYYA 4OMOA 1YN8A 1OPKA 2KRMA 4HVWA 1B07A 2YUQA 4J9FA 2LZ6B 2LQWA 1HSQA 2DBKA 3EHQA 1TG0A 1U3OA 1X6BA 1QKWA 2OAWA 1H3HA 2GTJA 1ZX6A 1ZLMA 1CKAA 4M4ZA 3NMZC 2P4RA 2D8JA 2DNUA 2GBQA 1WXTA 4JZ3A 1ZBJA 3U23A 1PKTA 3EGUA 2GTOA 1U5SA 4D8KA 3VS7A 1WFWA 3EHRA 4DEYA 3I5RA 1K9AA 3RNJA 1PNJA 2ROTA 2GGRA 1QCFA 4AFSC 2CSQA 3REBB 1G2BA 1HD3A 1M30A 4F14A 1ZUKA 3TSZA 1AOJA 2B86A 3SEMA 4LE9A 1XOVA 4RTYA 1NLPC 3VS5A 1VYUA 2X3WD 2OI3A 2CT4A 2K9GA 4HVVA 1ABQA 2ROLA 1K4US 1E7OA 1T3SA 1SEMA 3JV3A 5HCKA 4GLMA 1UE9A 2RNAA 2EW3A 1K76A 4AFZC 2K3BA 1BU1A 3IQLA 2DA9A 4GBQA 5IHIA 2HEQA 3VS1A 2OJ2A 4F16A 1QWFA 4AFQC 2L3PA 2EQIA 3M0QA 1VYTA 2EYWA 4HXJA 2MOXA 1KSWA 1X43A 2C0OA 4Z89A 1T3LA 2JMCA 3LH5A 2KT1A 2O9VA 4OMLA 1CSKA 1RLPC 2KXDA 1EFNA 2D8HA 2O9SA 2PZ1A 2J6OA 2LX7A 5I11A 1N5ZA 2FPDA 1T0JA 1OPLA 5IH2A 1G83A 1I07A 2DE0X 2K79A 2DRMA 1KIKA 4RTVA 3PVQA 1OEBA 2H8HA 2KNBB 2V1RA 2DLPA 3EG0A 2O31A 1ARKA 2RQUA 4DEXA 1KJWA 2LCSA 2L2PA 1UG1A 2EVRA 2JM8A 4J9EA 1W1FA 1WX6A 2CH4W 2JMAA 2KRNA 2AKLA 2MCNA 1PRMC 1UDLA 1WXBA 3M0RA 1QWEA 3VS2A 4RUGA 1TUCA 4D8DA 4RTTA 2EGAA 1M3CA 2LJ0A 2SEMA 1JXMA 2ABLA 3QWYA 1GBRA 2JTEA 2LJ1A 1SHGA
chains in the Genus database with same CATH superfamily
1IO6A 3EG1A 1K9MU 2OAUA 3VU3C 4YTLA 2RH2A 4CC7A 3NTIA 4JRQA 4HCZA 4RG8A 3SB2A 3DLMA 1SKUB 2FEIA 5DLOA 3OW2S 1TOVA 1KQSA 1FXXA 1TXQA 2M0YA 4CC2A 4FSXA 2DXBA 3OYFA 4EMKA 3KFVA 1S72A 1MMDA 3UA7A 1I0CA 2E5KA 1X2QA 2XU8A 2DTOA 3MEWA 1NG2A 2RD1A 1XJWB 2AT1B 1QCNA 2PVDB 2DK3A 2BIVA 1AHJB 1YFNA 4M7DD 3EAEA 1E6GA 3CXCS 2RN8A 2A08A 4J9IA 1UGQB 1KQ1A 3SFMA 4AFUC 2E3HA 2DERA 4KH1B 1VQ4Q 2RQVA 1Y96B 4JJBA 5LJ5h 2CZ6B 3GNGA 2LJ3A 4J6WA 4HT9A 4FSSA 1XNIA 4J9DA 2ED0A 4KGZB 3ULRB 1SHFA 4C5IA 2QDYB 1Q7YC 2KR3A 2V8KA 3ME9A 2H3EB 2PTKA 3CMAT 1AWXA 3CCEQ 3TVTA 2Y4XA 2OTJA 2XMFA 2K3YA 3M0TA 4OGEA 3CXCA 3I56Q 1MUZA 1VQ9T 4M7AG 4JZ4A 2AK5A 2MPXC 2KDSA 4C92G 2E4HA 1VQMQ 1DJ7B 3A1PA 1X6GA 2RI5A 3OYKA 3PTAA 4ORZA 3X28B 2CUDA 1LCKA 3L2UA 4XU3A 3CCLQ 4XU0A 1Y71A 2P0QA 2LT1A 1R0BG 3H0HA 1UFFA 3T9NA 4R55A 1IB8A 1XQHA 4LD6A 4Y28E 4A4GA 1NE8A 1VQPA 3JCMQ 1Q81C 3UATA 2KY9A 2X4XA 4NL2A 4XAXB 5CO7A 3CCLA 2E65A 3FEOA 5GAOm 1W2BA 4BB7A 2L3QA 1AWJA 4OMNA 1YJWQ 2F2VA 3NPFA 1WJRA 1RAEB 2R5MA 2DYBA 1JB0E 2WSFE 2HQXA 2QEXQ 4FW1A 2ZPHB 3PFSA 3G1JA 5GAMg 1VQ6Q 1E6HA 2FO0A 2E3IA 4C0DC 1EX4A 4C8QD 2VVKA 2DXTA 3CCMQ 2QA4A 4Y92A 1BCMA 2COWA 1WDXA 1D0XA 3CPWS 1Y57A 2K5FA 2NUTB 5GJWB 2RK2A 4CRIA 2MMPA 4QT7A 2NUPA 4A4EA 5IHKA 3C0CA 1VQNT 2CP5A 4OMPA 2VWFA 1NM7A 1A0NB 3EFOB 2E41A 2A3LA 1YWPA 3QPHA 1K73C 1I1JA 3PMTA 2DO3A 5A0GA 2CP3A 4M78C 1KHIA 2RF0A 4E6RA 1BYMA 5KCOA 4JRIA 4C0FA 1W6XA 1UHFA 3PT9A 3QYGB 4O5VA 3C94A 2YHTA 1TUDA 1U1SA 4QQGA 2JT4A 2DL4A 3TQ7P 3O5ZA 1WHJA 2DYIA 3TREA 2EFIA 2J7IA 1WYXA 1UJ0A 3A5ZB 1YWOA 1ZQ1A 1NEBA 2XKOC 4KT0E 4CC3A 2VXFA 4ZNXA 2DJZA 1K73R 3MEVA 5C6SA 3M5AA 2AZSA 1C1AA 2YXYA 8AT1B 5A0LA 2HNIA 1SSHA 1N6AA 2DVJA 1P92A 3KBGA 4ZGDB 1WA7A 2XI9A 3EG2A 2QG9B 4Z88A 2KBTA 1Q82R 4C8QE 3CCVA 4RTZA 3CCEA 3FJ5A 1VQMT 3RR6A 5L8RE 3CC7T 2FPEA 3M9QA 4OP0A 1JO8A 5GANg 3OYAA 4D6WA 1D3BB 4ATOA 2DL7A 1N9RA 1F1BB 1U06A 1V76A 2CZ0B 2NUPB 3OYDA 3DB3A 3JCMc 3P8HA 4M77E 5LJ3e 1VQ6A 5DM7R 1X01A 5I2SA 2L3RA 1BI2A 4DBFA 1VQLQ 2M16A 2C06A 2KI7A 3CCJT 2P84A 4PJOA 4HVWA 4XTXA 3I55T 1JRIA 3CPWP 2DBKA 1X6BA 2QEXT 2K57A 3TCJA 2OAWA 4C92F 1ZLMA 1U8RA 3NMZC 4ZGEB 3CMEQ 1LOJA 1KC8U 2GBQA 3MP6A 1Q7YU 4KUDK 3EGUA 5LJ5f 2COYA 2O01E 3CCVQ 3VS7A 1WFWA 4PJOD 5GANf 1VQMA 1K9AA 4N4HA 2EQKA 3RNJA 1PNJA 1VQNQ 2CZ7B 7AT1B 1TS9A 4AFSC 4M78A 4XTYA 2CSQA 4V2SA 4BI4A 4NL3A 3OS0A 1M30A 4GY5A 4F14A 4M75D 2RI2A 3TSZA 3JCMe 1VQ6T 3CD6A 1V29B 1AOJA 3SEMA 4LE9A 3L2VA 1LNXA 9ATCB 3CCMA 1VYUA 2L89A 5KYYB 2X3WD 3I56T 3I55A 4FU6A 3WVDB 2CP7A 3CD6Q 5HK0A 1E7OA 1SEMA 3JV3A 5HCKA 1W2BP 4AFZC 4WTOB 2DA9A 4GBQA 1Y7XA 4XTWA 4QVCA 3QBYA 2HEQA 5GAN7 3MEAA 2OJ2A 3C12A 4M77G 1B34A 3VS1A 4F16A 1QWFA 3HRUA 4EPCA 3M0QA 4HCCA 2LNVA 2VB6A 2EYWA 4HXJA 1BIBA 1KSWA 2C0OA 4XK8E 3M55A 1SF9A 2OTLQ 4OMLA 2D8HA 2QQAA 2JOYA 2CGHA 1OPLA 2D0QB 4C92B 4BY6B 2RHXA 1YJ9A 4C8QG 1YJWT 3CEYA 3HHTB 2CKKA 4RTVA 1OEBA 2H8HA 1LVKA 4MZPA 3G6ET 3NTHA 3RKYA 1ARKA 1VQKA 2HAXA 4M78F 3CCMT 1Q95G 2E6ZA 4E47A 3MCAB 3L2WA 1R0CB 3ER0A 2MWPA 3A8OB 2DTIA 4LDWA 2JMAA 5EG2A 1BCOA 2MCNA 1PRMC 2COZA 2PUOB 4M7DF 3L2RA 5A2QE 1NJIR 5CKEA 4X34A 1YBYA 4D8DA 1M3CA 4DBHA 1ZSZB 3RIRA 3VKIA 4F7UE 3QWYA 4IUUA 3CC7Q 1GBRA 2DEQA 2LJ1A 3M4GA 3OMGA 5A0DA 2PUKB 2RQWA 4RCCA 2EYQA 1GFDA 5KYXB 2RK1A 5GAN5 3CCVT 4ESRA 2HKNA 2P4TA 4EDUA 1YHQQ 4A63B 3JB9H 3VRZA 2K6DA 2MAMA 1K8AU 5GANe 3CCJQ 2RJDA 3OBWA 3OQ5A 4PLLA 1G3YA 2BUDA 2C0TA 3OMCA 4M75C 2RMOA 2KYMA 2FPFA 1M8MA 1KC8R 2L3SA 4XU1A 4J9BA 5KYYA 1Q7YR 3CMET 1VQ7A 4XTVA 5GMKj 1G3SA 2ZPGB 2QQRA 4NOYA 1MMNA 1PM3A 2BE7D 4N4IA 3OB9A 3J80E 2QEXA 4PJOC 4KULA 2SRCA 3VJPA 4M7DG 5GAOp 4M77B 1WGSA 3MO8A 1UHCA 1S72T 1JU5C 2EBPA 4O6JA 2KT8A 4J9CA 5FW9A 4Q5WA 3QSUA 3M4YA 2DEUA 5GAN3 4E7ZA 4IUTA 2LC4A 2IG0A 1BK2A 1WHMA 3OYNA 2XIDA 2HBPA 2DX1A 2JTFA 4JJDA 1ZUYA 1UTIA 2KXCA 2BTTA 2RPNA 4JRKA 1RLQC 3GBQA 1FX7A 2MF2A 3OS5A 1RI0A 5GAOl 1B7TA 2A0FB 4X9DA 4ELYC 1RL2A 1UECA 3CD6T 4FW2A 4C92E 1GCQA 1OZ2A 1AZEA 2EJFA 3CMEA 2DM1A 4R56A 1IGUA 2R57A 3I9QA 1M9SA 4J7IA 2JXBA 1M1FA 1MGQA 4ME7A 4EMKB 1I5OB 3C4SA 4MDWA 1GCPA 3QZ9B 1J3TA 4J83A 2OTLT 3UPUA 4AG1C 2YUOA 1WIEA 3QHSA 3DKMA 2EPDA 2CP6A 3D7SB 2H3JA 2WSCE 4E7IA 4ZN3A 4KGXB 3OYBA 2CP2A 4XU2A 2LMJA 3G6EQ 1M90U 2DZCA 5GAMj 3OYHA 1C6VX 4M78E 2JZ2A 1B3QA 1ZUUA 1D1CA 2HSEB 4B6MA 1X6OA 2AZVA 1M3BA 3VUZA 3NFCA 4DQ2A 4CC4B 5DLQE 3E9FA 2HQHA 5ECAA 1NJIU 1AWWA 1RI9A 4M75F 3G71T 1BI3A 3GOXA 4NS5A 4RTWA 1YCYA 2MIOA 4RTUA 5D6XA 2GCXA 3J7AF 2JW4A 1UGSB 3CCSA 3M56A 2DKGA 1FWZA 1BKBA 1WI7A 1SSFA 2MWOA 1VIFA 2EGCA 2QDLA 2DIGA 3EFRA 1GCQC 1K9MR 2J05A 4WCIA 1SPKA 2ZPBB 2OTLA 4ZTJA 1YITT 2X9HA 2KQWA 1X75C 5GMKh 1Q86U 2C0IA 5FU7B 5GAMf 3LYIA 4C92A 4J9HA 2CH4A 4J5YA 2ZPEB 2LCCA 2FB7A 1VYVA 2RO0A 1UGPB 4ZN1A 2FVUA 2YDLA 4E7KA 2RQTA 4XTUA 4FYWB 2ECZA 4OB3B 1T0HA 4N0AC 3BY7A 3FIFA 4F17A 2CSIA 2W0ZA 5IN1A 3E19A 3JCMV 4L6V5 2D0NA 3SHWA 2DMOA 4OVAA 3CMAQ 2J6KA 2FRWA 3HRSA 4C8QB 1QP2A 4M7DA 5CKHA 2RM4A 3V7CA 5I22A 4GLKA 4C0DB 1VQ8T 1IRXA 4M78D 3H0FA 4JLIA 2IIMA 2KYBA 3GPLA 2E70A 1VUBA 4K11A 4RKUE 4M7AB 5CIUA 1S72Q 4M75B 1K0XA 2EAYA 3V7RA 1RAFB 3LGLA 1Y96A 2HMAA 3M57A 4JS4A 4PFPA 2EYXA 3X25B 1RUWA 2HKQB 1NZ9A 2QK0A 4OF1A 3VRYA 2CT3A 3A98A 2RHZA 2ED1A 5FLXE 2PU9B 1Y07A 4BDYA 2QQSA 1QVPA 4J9FA 1YIJA 1TWBA 2LZ6B 4BDZA 3HP9A 1HSQA 1U3OA 5GMKm 3G7ZA 1UB4A 3EFOA 5GAOq 1H3HA 2KAFA 1ZX6A 3EFSA 1BIAA 3JSCA 3PGGA 3QJ6A 1QVFS 4F04B 3CC4Q 2D8JA 4UC4A 2DTHA 1WXTA 1YJNQ 1PKTA 2GTOA 4D8KA 4M75E 4QQDA 3G71Q 3G4SA 2EQUA 2IVWA 4M7DC 2VYTA 2VGNA 2ROTA 3RERA 2GGRA 2RJCA 1QCFA 4FM4B 1H641 3JCMh 3JB9F 3REBB 2GQVA 3OSSC 1D1AA 1W2BS 3QYHB 2VV5A 2B86A 3PIPA 4LDUA 1YITQ 4RCBA 3S3MA 1NLPC 3VS5A 4B9XA 2KK4A 5GAOr 1Q81U 2CT4A 2K9GA 3CBPA 2FZGB 3RUXA 4HKEA 1ABQA 5LJ5j 4PKCC 1UE9A 2EW3A 2Y90A 4QW2A 2LQKA 3JCMX 3EGXA 4BI8B 2R5AA 2LDMA 2L3PA 2LRQA 1VQ7Q 3GNFB 3G4SQ 4Z89A 4C5GA 1T3LA 2O9VA 4OB1B 1RLPC 2PZ1A 2LX7A 5I11A 3V7SA 5CQYA 1N5ZA 1OI1A 1T0JA 1NJIC 4IUPA 1G83A 4BD3A 2DE0X 1QP3A 2OTJT 2F1LA 3CCRQ 3SD4A 1KIKA 2XD0A 5CQXA 5HKCA 1AT1B 5HY6A 4J6YA 2KNBB 3MJXA 2O31A 2F5KA 1ZA1B 4DEXA 5GAN6 1IGQA 1KJWA 3CC4A 1UG1A 3BDLA 1NBEB 2EVRA 1O75A 2JM8A 3BDUA 3EGXB 3RDVA 1W1FA 2QASA 2KRNA 5GMKe 3BFMA 2AKLA 1UDLA 3M0RA 3RKWA 3I55Q 1VQ8Q 1YJWA 3QG1A 3MHXA 3MKDA 2BE9B 4RTTA 2DXUA 4L59A 2ABLA 3META 3JCMd 5LL6S 1S1NA 1VQKT 2I2LA 4LDXA 2YT6A 2GNCA 2F5TX 3X26B 3VS0A 1K1ZA 3JB9G 3JCMJ 2KSSA 2XK0A 1JJ2A 3H6ZA 4LUEA 1KD1C 2CDTA 5J26A 2A28A 2ATCB 4PFZA 1M4ZA 5GJVB 1SRMA 1PRLC 2YUPA 1H3ZA 4EMHA 3CBMA 1M2VA 3LWHA 4F7UB 2E1HA 1RADB 3JRZA 5KH6A 1N27A 4OMMA 4F7UF 4XQ3A 1QVGP 2D1XA 5HK3A 3UF4A 2RQRA 2M51A 2KVQG 2W10A 5KE2A 2RA2A 2BZYA 1NEGA 2JS2A 4X1VA 1PSFA 1KD1R 1OQKA 1M1KR 4JPBW 3OSVA 2QQ9A 3THKA 1IHWA 2EYZA 1TUGB 3WXMB 1XTDA 4M77C 2MK5A 1WQ7A 1KC8C 1VQ7T 2J06A 3OY9A 3G4ST 1YP5A 2DBMA 1IREB 4M78G 3CQTA 1QLYA 1JEGA 3WVEB 3X20B 2CUBA 4QVZA 3BE3A 1FYNA 1X2KA 1M90C 3R6OA 2JVVA 2A37A 4PJNA 1JBMA 2YRVA 1HYOA 4PL6A 5CKFA 3QJYA 3SWNB 2QA4Q 3V8JA 5GAN8 2LQNA 1QW1A 1C0MA 2LNHB 1QMCA 1OU8A 1UEBA 1VQ5T 2X3XD 3L42A 2DVEA 2RHIA 2QAZA 3CC7A 4LNPA 1YJNT 3ASKA 3QWXX 3JCMf 3JCMg 2FRYA 2GFAA 4ELZC 2JM9A 1K73U 4F7UA 1QVFA 1YIJQ 2DD4A 1PG5B 2K4YA 2JNGA 4Y91A 5D6WA 1H8KA 3CCJA 1UGVA 4KH0B 1CKBA 2E5QA 1OU9A 1VQKQ 3N5BB 1WHKA 4A4FA 1TH7A 5KYUB 3MP1A 3PVLA 3A8GB 3E2UA 3QO3A 4C5HA 1RABB 4E7LA 5IXBA 1KQSS 1D3BA 1I81A 3OYLA 1ZSGA 4A53A 2K5LA 4BY6C 1JXOA 2FG0A 2XDPA 4C5EA 2JS0A 2GF7A 2CS7A 3SDZA 2M0OA 2G3RA 1YJNA 3I5SA 1WJSA 2M1HA 2K2VA 4DOWA 2QGFB 3L2ZA 2O4XA 2DL8A 3M0UA 4IIMA 1MHNA 3JCMP 1BB9A 2ZGWA 1WXUA 3OA6A 2VKNA 5L23A 4J9GA 2LT4A 3JAME 3OYIA 5LJ3j 1EIFA 4TVRA 2EGEA 1G3WA 8ATCB 2YLBA 2X4WA 4CI0C 1K0SA 5C0MA 1AWOA 3LLRA 1D09B 1KFZA 2HDAA 4E7JA 2L0AA 1SG5A 3PE0A 2O88A 3O8VA 5FU6C 5FROA 2DXCA 1YJ9Q 3VS3A 3NGPA 3OYCA 2HSPA 1PD0A 1RACB 2VASA 3RMSA 1H92A 1UUEA 2ENMA 5LJ5g 1WHGA 1YITA 1U1TA 3OYMA 1VQ9A 1OX9A 4F7UG 3GP8A 3LX7A 2K5IA 3S6WA 3JB9I 1YI2T 1M1KU 2DL3A 1KG1A 3UT1A 3MEUA 3EG9B 4M7DE 2K2MA 4PJOF 1WPYA 2RHYA 3LW5E 1ZSZC 1R77A 2XDBA 3OYEA 4DBQA 3TU4K 4JJCA 2V1QA 5FRNA 1KK7A 1Q81R 4HT8A 3I35A 3GIBA 5LJ3g 1RAAB 2JUFA 1MMGA 5GANj 1JJ2S 4LN2A 3OS1A 2KE9A 5CVIA 2X4JA 2RJFA 4LDVA 4A4HA 1AZGB 3H41A 3V8KA 2EIFA 5KYXA 3G6EA 1YNZA 1AVZC 1WQWA 1MV0B 1MNEA 2EYYA 1YN8A 1OPKA 2KRMA 2QYZA 2E64A 1VQ8A 4JRPA 3C95A 2YUQA 2QI2A 1M5Q1 4PNOA 3LGFA 4RMOA 2LQWA 1ZA2B 1TG0A 2GTJA 3HL8A 2M02A 2QA4T 4IUVA 1R8OB 4JDSA 1WNLA 4M77F 1CKAA 2CZ1B 3CCUA 2P4RA 4MZMA 2L8DA 1M2OA 2DNUA 1QCOA 4FYVB 1ZBXA 4ANJA 4JZ3A 1VQNA 1U5SA 1KHCA 4WF2A 2IPOB 3Q1JA 4J8OA 4DEYA 3EHRA 3I5RA 2X4YA 2QGGA 4PJJA 1I4K1 1YIJT 3DB4A 2Y4YA 1BI0A 1M90R 3URGA 3CCQQ 2RHUA 2L5QA 1K9MC 1ZUKA 4BI3A 1PCXA 1XOVA 3LH0A 4RTYA 1GXIE 4PFOA 1TU0B 2QQBA 4Z02A 2DETA 3S3OA 2P0PA 5LJ3h 2OI3A 2X51A 1RAGB 2RI3A 3FB9A 2AHJB 5LJ5e 3ZEHA 5GAMe 1TTHB 4PK4A 3H8ZA 4MMLA 4GLMA 2RNAA 2VGMA 3CCUT 1K76A 2K3BA 3FC3A 1VQLA 2D6FA 1VQ5Q 4AFQC 2O4XB 4M7DB 1D1BA 5M9OA 1VYTA 4C92C 1Q86R 1X43A 2XG8D 2JMCA 3LH5A 2KMTA 1CSKA 2KXDA 5IAYA 3RMQA 1EFNA 3LWIA 3CCET 2J6OA 5AT1B 1PD1A 2FPDA 2LTOA 3OYYA 4N4GA 3EGDA 3JCMb 3A8HB 2FZCB 3PIOA 1G3TA 4E7SA 4M77D 2CP0A 2V1RA 3EG0A 4QQ6A 3X24B 4FYYB 2E10A 2XDDA 2QXFA 4BE2A 4PJOB 3HRTA 5GANh 4BACA 2CYZB 4II1A 4KUIA 3QZ5B 4QKUA 1QWEA 2PQWA 5I21A 4FL6A 1TUCA 1I5LA 3CPFA 3HFNA 3OYJA 2PVOB 4KBMB 2JTEA 1VQOA 2DD5A 3HPWA 3KXTA 3MP8A 1OULA 3CC4T 5EC7A 1YI2A 4FYXB 2DF6A 3J81E 4X9CA 4C8QC 2GQIA 3UA6A 1OX8A 2ESWA 3OS2A 1JJ2P 4PJOG 1M1GA 3VS6A 4KRTA 1W70A 2LX9A 3EH1A 3E9GA 4Z8AA 3GLXA 1M1KC 5D7UA 1O9SA 3ZL7C 4VUBA 2Z0WA 4ZTFA 1PHTA 2LP5A 4BE1A 3VV0A 2QTVA 2KEAA 2JJ9A 2A7YA 3G71A 3CCQT 3M53A 4M75A 4FT4A 1PC0A 2M9UA 6AT1B 3CCST 3HTRA 2F69A 1M27C 3JB9J 1QVGA 2V8JA 4MMKA 2R58A 3R6NA 1GFCA 2B8AA 1YCSB 2JTMA 1BBZA 4XTZA 2EWNA 4LUDA 2HL3A 2AKKA 5FU6B 1Z9QA 4M7AF 1UJYA 2A36A 1FMKA 1Q82U 1PWTA 1WHHA 2JN0A 1JQQA 3F70A 3A8MB 3L1AA 1IZ6A 3KUFA 1EZZB 2PVGB 2RJEA 2EKOA 2NLUA 3ZFJA 1Y0MA 5FWCA 3QIIA 1VA7A 4IUQA 2NYSA 1NPRA 4BUGA 4N0AA 2VC8A 2EJGA 5GANd 3M58A 1GBQA 2QTXA 3ZBDA 2DILA 4JJNK 3EG3A 4M7AC 2HCKA 3QUIA 2AIRB 2DFUA 5KYWB 1V1CA 1VQPT 2OTJQ 3CCRT 2YRDA 4L5GA 1LPLA 3UDCA 1WZOA 2FHDA 1OV3A 2EKHA 1I8FA 3CCUQ 5IXFA 1D0YA 2O2OA 4JS5A 1NLOC 5DY9A 2ZCFB 1N8RU 2NUTA 4AT1B 1ZHIA 5LJ5d 1AD5A 5FU7C 1X27A 4MZTA 2VUBA 1G5VA 3CBOA 2EQMA 3OW2P 2FYKA 1BI1A 2MI6A 4FCYA 4A4KA 4FIBA 2F2XA 4OMQA 1KQSP 2D9TA 1VQLT 1QKXA 5GAN2 2LCLA 2YUNA 4C0GA 1KQ2A 2HQEA 3UWNA 2XHCA 1QVGS 2KGTA 4AG2C 4AMCA 5GAOn 5LJ3f 2NWMA 1LJOA 3VYGA 1NYGA 4IIOA 2PNIA 4HVUA 3DLLA 2K3XA 3FJPA 5GMKi 1HJDA 1W4SA 3TSWA 2BKDN 4M75G 1AEYA 3CCRA 1GL5A 1WHLA 3M0PA 5IT9E 3E1SA 4P5NA 1VIEA 1M2VB 3REAB 1Z9ZA 2ZPIB 4HA8A 2EQJA 3QDFA 3RKXA 3VS4A 4QVDA 5CKDA 2J6FA 2BZXA 3QDRB 1GRIA 2DL5A 3M0SA 4BE0A 1VQ4A 5FWBA 1SRLA 5IHNA 4PJLA 3HKSA 2CREA 2YWWA 4EMKC 2BZ8A 2G6FX 4RTXA 1IHVA 2K7AA 1VQOT 1MNDA 3FDRA 3INZA 1ACMB 2FL7A 2HBWA 2HZYA 3BW1A 1M3AA 1X69A 3VUBA 3H0IA 2WACA 2YSQA 2ZZDA 2ZAEA 3NHNA 3P8DA 2F2WA 2DPPB 3PNWC 2KRSA 3CPWA 4M7AD 3P8BB 4PJMA 4DOVA 3QXEB 2I0NA 1WLPB 2MYSA 1KD1U 1ABOA 3M59A 3CCQA 3PMIA 1HK9A 1OYXA 3CC2Q 2KROA 1K8AC 5GMKl 3RBBB 1YHQA 4M7AE 4IKFA 1VQ4T 4PLIA 1PKSA 4R0KA 2DRKA 1Q86C 2LVMA 4OB0B 3MPUB 1NYFA 4EIKA 4HCKA 3GF5A 1OOTA 3JB9D 3FRNA 5AYFA 4RG2A 2OX7A 2DJQA 1MV3A 1RAIB 3L2QA 2NUZA 4OMOA 1OZ3A 2LQ8A 1B07A 3SWNA 4FT2A 1VQPQ 2DAQA 1K8AR 3OW2A 3EHQA 1QKWA 4EMGA 4LDYA 1N8RR 1ZSZA 1QVFP 3CCSQ 3TEEA 4M4ZA 5FRMA 3NTKA 2FZKB 1UGRB 1FMVA 3HFOA 5GAMh 5LJ3d 2E12A 2X35A 1ZBJA 3U23A 2HL5C 4M7AA 3CXCP 5CCAA 3V8LA 4HCBA 4JLGA 3I56A 1YHQT 1M8VA 4KGVB 1TSFA 1FMWA 3CMAA 4E7HA 3M54A 3H9NA 5KE3A 1D0ZA 1G8XA 1NPPA 1MMAA 5KYWA 1G2BA 4ZGJB 1HD3A 2V8IA 1HXDA 5KYNA 4OGCA 2DIQA 4J7FA 5CR2A 3EH2A 2HD0A 3VYHB 3RESA 4MDXA 4M78B 2WSEE 2EJ9A 4HVVA 2ROLA 1K4US 1YJ9T 1T3SA 2V26A 4E2FB 3SWNC 3FLGA 1BU1A 3IQLA 2XICA 4LXCA 2ZPFB 4J6XA 5IHIA 3CC2A 1PSEA 4B9WA 5I2MA 2YRCA 2RB6A 3CCLT 2EQIA 1WJQA 5J3BA 2GFUA 2MOXA 4IURA 5KYUA 2KT1A 2VXEA 2O9SA 1YI2Q 4OMFB 4JUVA 1B34B 1VQOQ 4C92D 5IH2A 1I07A 3S3NA 2K79A 1VQ9Q 2DRMA 1Q82C 5CKBA 3HSBA 1N9SA 3PVQA 5J39A 1IXDA 2DLPA 5CK9A 5D6YA 3AHUA 4OB2B 2RQUA 3JCMW 3AT1B 2LCSA 5KCHA 4C8QA 2L2PA 3QKJA 1RAHB 4J9EA 4DBRA 3EGDB 5GAMd 1VOMA 1WX6A 2CH4W 1VQ5A 3A8LB 2P0KA 1QQJA 4A54A 4PJOE 1WXBA 5CAIA 4LD9K 4C8QF 2YLCA 3VS2A 4RUGA 2E6NA 3CC2T 3OYGA 2EGAA 4C0ZA 5GAN4 2LJ0A 3EG9A 2SEMA 1JXMA 4M77A 2DZ9A 3OBYA 4DA4A 1N8RC 1SHGA
chains in the Genus database with same CATH topology
1IO6A 3EG1A 5EC7A 2YT6A 2GNCA 2RQWA 4CC7A 3VS0A 1GFDA 2DF6A 1K1ZA 4ESRA 2GQIA 3UA6A 2ESWA 2FEIA 4A63B 3VS6A 4KRTA 1W70A 3VRZA 4LUEA 2K6DA 4Z8AA 2CDTA 2M0YA 4CC2A 2A28A 3ZL7C 5GJVB 1PHTA 2LP5A 1SRMA 1PRLC 3KFVA 2KEAA 2YUPA 3UA7A 1I0CA 2C0TA 2E5KA 1X2QA 2RMOA 2KYMA 2FPFA 1M8MA 1NG2A 2L3SA 4J9BA 1M27C 4OMMA 2D1XA 3R6NA 2RQRA 1GFCA 2M51A 3UF4A 1E6GA 1YCSB 2W10A 2BZYA 1BBZA 1NEGA 2RN8A 2JS2A 2A08A 4X1VA 4J9IA 2SRCA 4LUDA 4AFUC 2AKKA 4JPBW 1Z9QA 2RQVA 1UHCA 1UJYA 1JU5C 1FMKA 2A36A 2EBPA 1PWTA 2KT8A 4JJBA 1JQQA 4J9CA 5FW9A 2LJ3A 3THKA 4FSSA 2EYZA 4J9DA 2ED0A 3ULRB 1SHFA 1Y0MA 5FWCA 2J06A 1BK2A 1VA7A 1YP5A 2DBMA 2KR3A 1S1NA 3CQTA 1QLYA 1JEGA 2DX1A 4JJDA 2PTKA 1ZUYA 1AWXA 1UTIA 2KXCA 2BTTA 3TVTA 2XMFA 2CUBA 1GBQA 2RPNA 3M0TA 1RLQC 3GBQA 2DILA 3EG3A 1MUZA 2HCKA 1FYNA 1X2KA 1V1CA 4JZ4A 1UECA 2A37A 2AK5A 1OV3A 1GCQA 2EKHA 1AZEA 5IXFA 2O2OA 2DM1A 1X6GA 1NLOC 2LQNA 2LNHB 3I9QA 4ORZA 2JXBA 2CUDA 2X3XD 1LCKA 1AD5A 4LNPA 1X27A 3H0HA 3QWXX 1UFFA 1GCPA 1J3TA 2F2XA 4OMQA 2FRYA 2JM9A 4AG1C 2YUOA 1QKXA 1WIEA 3UATA 2EPDA 2YUNA 2L3QA 1AWJA 4OMNA 2F2VA 3NPFA 2DYBA 2KGTA 4AG2C 1H8KA 1UGVA 1CKBA 2LMJA 2NWMA 1E6HA 1NYGA 4IIOA 2PNIA 2FO0A 4HVUA 2VVKA 1B3QA 1ZUUA 1HJDA 3PVLA 2AZVA 3TSWA 1M3BA 4Y92A 1WDXA 1AEYA 1Y57A 1GL5A 5IXBA 4CC4B 3M0PA 5GJWB 5ECAA 1AWWA 1RI9A 1ZSGA 3REAB 4QT7A 1Z9ZA 4RTWA 5IHKA 3C0CA 2MIOA 4RTUA 4OMPA 1JXOA 2FG0A 2JW4A 3VS4A 2JS0A 1WI7A 2EGCA 2VWFA 2QDLA 1NM7A 2J6FA 1A0NB 2BZXA 3I5SA 1GRIA 1GCQC 1YWPA 2DL5A 3M0SA 2J05A 1I1JA 5FWBA 1SRLA 2DL8A 3M0UA 4IIMA 1SPKA 4WCIA 2RF0A 1BB9A 4E6RA 1WXUA 2VKNA 5L23A 4J9GA 5IHNA 1W6XA 2CREA 1UHFA 2C0IA 2EGEA 2BZ8A 2G6FX 4RTXA 2K7AA 1K0SA 1AWOA 4J9HA 2CH4A 1TUDA 1VYVA 1KFZA 2HDAA 2L0AA 2HBWA 2JT4A 2DL4A 2YDLA 3PE0A 2O88A 3O5ZA 2RQTA 2J7IA 2ECZA 1WYXA 1M3AA 1X69A 1T0HA 1UJ0A 3VS3A 3NGPA 1YWOA 3H0IA 2HSPA 1NEBA 2YSQA 4CC3A 3NHNA 4F17A 2CSIA 2W0ZA 2F2WA 4ZNXA 1H92A 1UUEA 2ENMA 2AZSA 2KRSA 2D0NA 3SHWA 2DMOA 2J6KA 2FRWA 2I0NA 1SSHA 2DVJA 1WLPB 1WA7A 1ABOA 2DL3A 3EG2A 5I22A 4Z88A 2KROA 2KBTA 3H0FA 2IIMA 4RTZA 3RBBB 2K2MA 2KYBA 3FJ5A 4K11A 4JJCA 1K0XA 1PKSA 2FPEA 2V1QA 4R0KA 2DRKA 1JO8A 1NYFA 3I35A 4EIKA 4HCKA 2DL7A 1OOTA 1U06A 4LN2A 2EYXA 2KE9A 1RUWA 1AZGB 3H41A 2DJQA 1MV3A 1YNZA 3VRYA 2CT3A 1AVZC 3A98A 1MV0B 2ED1A 2NUZA 2EYYA 4OMOA 1YN8A 1OPKA 2KRMA 4HVWA 1B07A 2YUQA 4J9FA 2LZ6B 2LQWA 1HSQA 2DBKA 3EHQA 1TG0A 1U3OA 1X6BA 1QKWA 2OAWA 1H3HA 2GTJA 1ZX6A 1ZLMA 1CKAA 4M4ZA 3NMZC 2P4RA 2D8JA 2DNUA 2GBQA 1WXTA 4JZ3A 1ZBJA 3U23A 1PKTA 3EGUA 2GTOA 1U5SA 4D8KA 3VS7A 1WFWA 3EHRA 4DEYA 3I5RA 1K9AA 3RNJA 1PNJA 2ROTA 2GGRA 1QCFA 4AFSC 2CSQA 3REBB 1G2BA 1HD3A 1M30A 4F14A 1ZUKA 3TSZA 1AOJA 2B86A 3SEMA 4LE9A 1XOVA 4RTYA 1NLPC 3VS5A 1VYUA 2X3WD 2OI3A 2CT4A 2K9GA 4HVVA 1ABQA 2ROLA 1K4US 1E7OA 1T3SA 1SEMA 3JV3A 5HCKA 4GLMA 1UE9A 2RNAA 2EW3A 1K76A 4AFZC 2K3BA 1BU1A 3IQLA 2DA9A 4GBQA 5IHIA 2HEQA 3VS1A 2OJ2A 4F16A 1QWFA 4AFQC 2L3PA 2EQIA 3M0QA 1VYTA 2EYWA 4HXJA 2MOXA 1KSWA 1X43A 2C0OA 4Z89A 1T3LA 2JMCA 3LH5A 2KT1A 2O9VA 4OMLA 1CSKA 1RLPC 2KXDA 1EFNA 2D8HA 2O9SA 2PZ1A 2J6OA 2LX7A 5I11A 1N5ZA 2FPDA 1T0JA 1OPLA 5IH2A 1G83A 1I07A 2DE0X 2K79A 2DRMA 1KIKA 4RTVA 3PVQA 1OEBA 2H8HA 2KNBB 2V1RA 2DLPA 3EG0A 2O31A 1ARKA 2RQUA 4DEXA 1KJWA 2LCSA 2L2PA 1UG1A 2EVRA 2JM8A 4J9EA 1W1FA 1WX6A 2CH4W 2JMAA 2KRNA 2AKLA 2MCNA 1PRMC 1UDLA 1WXBA 3M0RA 1QWEA 3VS2A 4RUGA 1TUCA 4D8DA 4RTTA 2EGAA 1M3CA 2LJ0A 2SEMA 1JXMA 2ABLA 3QWYA 1GBRA 2JTEA 2LJ1A 1SHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IO6 A;  3EG1 A;  5EC7 A;  2YT6 A;  2GNC A;  2RQW A;  4CC7 A;  3VS0 A;  1GFD A;  2DF6 A;  1K1Z A;  4ESR A;  2GQI A;  3UA6 A;  2ESW A;  2FEI A;  4A63 B;  3VS6 A;  4KRT A;  1W70 A;  3VRZ A;  4LUE A;  2K6D A;  4Z8A A;  2CDT A;  2M0Y A;  4CC2 A;  2A28 A;  3ZL7 C;  5GJV B;  1PHT A;  2LP5 A;  1SRM A;  1PRL C;  3KFV A;  2KEA A;  2YUP A;  3UA7 A;  1I0C A;  2C0T A;  2E5K A;  1X2Q A;  2RMO A;  2KYM A;  2FPF A;  1M8M A;  1NG2 A;  2L3S A;  4J9B A;  1M27 C;  4OMM A;  2D1X A;  3R6N A;  2RQR A;  1GFC A;  2M51 A;  3UF4 A;  1E6G A;  1YCS B;  2W10 A;  2BZY A;  1BBZ A;  1NEG A;  2RN8 A;  2JS2 A;  2A08 A;  4X1V A;  4J9I A;  2SRC A;  4LUD A;  4AFU C;  2AKK A;  4JPB W;  1Z9Q A;  2RQV A;  1UHC A;  1UJY A;  1JU5 C;  1FMK A;  2A36 A;  2EBP A;  1PWT A;  2KT8 A;  4JJB A;  1JQQ A;  4J9C A;  5FW9 A;  2LJ3 A;  3THK A;  4FSS A;  2EYZ A;  4J9D A;  2ED0 A;  3ULR B;  1SHF A;  1Y0M A;  5FWC A;  2J06 A;  1BK2 A;  1VA7 A;  1YP5 A;  2DBM A;  2KR3 A;  1S1N A;  3CQT A;  1QLY A;  1JEG A;  2DX1 A;  4JJD A;  2PTK A;  1ZUY A;  1AWX A;  1UTI A;  2KXC A;  2BTT A;  3TVT A;  2XMF A;  2CUB A;  1GBQ A;  2RPN A;  3M0T A;  1RLQ C;  3GBQ A;  2DIL A;  3EG3 A;  1MUZ A;  2HCK A;  1FYN A;  1X2K A;  1V1C A;  4JZ4 A;  1UEC A;  2A37 A;  2AK5 A;  1OV3 A;  1GCQ A;  2EKH A;  1AZE A;  5IXF A;  2O2O A;  2DM1 A;  1X6G A;  1NLO C;  2LQN A;  2LNH B;  3I9Q A;  4ORZ A;  2JXB A;  2CUD A;  2X3X D;  1LCK A;  1AD5 A;  4LNP A;  1X27 A;  3H0H A;  3QWX X;  1UFF A;  1GCP A;  1J3T A;  2F2X A;  4OMQ A;  2FRY A;  2JM9 A;  4AG1 C;  2YUO A;  1QKX A;  1WIE A;  3UAT A;  2EPD A;  2YUN A;  2L3Q A;  1AWJ A;  4OMN A;  2F2V A;  3NPF A;  2DYB A;  2KGT A;  4AG2 C;  1H8K A;  1UGV A;  1CKB A;  2LMJ A;  2NWM A;  1E6H A;  1NYG A;  4IIO A;  2PNI A;  2FO0 A;  4HVU A;  2VVK A;  1B3Q A;  1ZUU A;  1HJD A;  3PVL A;  2AZV A;  3TSW A;  1M3B A;  4Y92 A;  1WDX A;  1AEY A;  1Y57 A;  1GL5 A;  5IXB A;  4CC4 B;  3M0P A;  5GJW B;  5ECA A;  1AWW A;  1RI9 A;  1ZSG A;  3REA B;  4QT7 A;  1Z9Z A;  4RTW A;  5IHK A;  3C0C A;  2MIO A;  4RTU A;  4OMP A;  1JXO A;  2FG0 A;  2JW4 A;  3VS4 A;  2JS0 A;  1WI7 A;  2EGC A;  2VWF A;  2QDL A;  1NM7 A;  2J6F A;  1A0N B;  2BZX A;  3I5S A;  1GRI A;  1GCQ C;  1YWP A;  2DL5 A;  3M0S A;  2J05 A;  1I1J A;  5FWB A;  1SRL A;  2DL8 A;  3M0U A;  4IIM A;  1SPK A;  4WCI A;  2RF0 A;  1BB9 A;  4E6R A;  1WXU A;  2VKN A;  5L23 A;  4J9G A;  5IHN A;  1W6X A;  2CRE A;  1UHF A;  2C0I A;  2EGE A;  2BZ8 A;  2G6F X;  4RTX A;  2K7A A;  1K0S A;  1AWO A;  4J9H A;  2CH4 A;  1TUD A;  1VYV A;  1KFZ A;  2HDA A;  2L0A A;  2HBW A;  2JT4 A;  2DL4 A;  2YDL A;  3PE0 A;  2O88 A;  3O5Z A;  2RQT A;  2J7I A;  2ECZ A;  1WYX A;  1M3A A;  1X69 A;  1T0H A;  1UJ0 A;  3VS3 A;  3NGP A;  1YWO A;  3H0I A;  2HSP A;  1NEB A;  2YSQ A;  4CC3 A;  3NHN A;  4F17 A;  2CSI A;  2W0Z A;  2F2W A;  4ZNX A;  1H92 A;  1UUE A;  2ENM A;  2AZS A;  2KRS A;  2D0N A;  3SHW A;  2DMO A;  2J6K A;  2FRW A;  2I0N A;  1SSH A;  2DVJ A;  1WLP B;  1WA7 A;  1ABO A;  2DL3 A;  3EG2 A;  5I22 A;  4Z88 A;  2KRO A;  2KBT A;  3H0F A;  2IIM A;  4RTZ A;  3RBB B;  2K2M A;  2KYB A;  3FJ5 A;  4K11 A;  4JJC A;  1K0X A;  1PKS A;  2FPE A;  2V1Q A;  4R0K A;  2DRK A;  1JO8 A;  1NYF A;  3I35 A;  4EIK A;  4HCK A;  2DL7 A;  1OOT A;  1U06 A;  4LN2 A;  2EYX A;  2KE9 A;  1RUW A;  1AZG B;  3H41 A;  2DJQ A;  1MV3 A;  1YNZ A;  3VRY A;  2CT3 A;  1AVZ C;  3A98 A;  1MV0 B;  2ED1 A;  2NUZ A;  2EYY A;  4OMO A;  1YN8 A;  1OPK A;  2KRM A;  4HVW A;  1B07 A;  2YUQ A;  4J9F A;  2LZ6 B;  2LQW A;  1HSQ A;  2DBK A;  3EHQ A;  1TG0 A;  1U3O A;  1X6B A;  1QKW A;  2OAW A;  1H3H A;  2GTJ A;  1ZX6 A;  1ZLM A;  1CKA A;  4M4Z A;  3NMZ C;  2P4R A;  2D8J A;  2DNU A;  2GBQ A;  1WXT A;  4JZ3 A;  1ZBJ A;  3U23 A;  1PKT A;  3EGU A;  2GTO A;  1U5S A;  4D8K A;  3VS7 A;  1WFW A;  3EHR A;  4DEY A;  3I5R A;  1K9A A;  3RNJ A;  1PNJ A;  2ROT A;  2GGR A;  1QCF A;  4AFS C;  2CSQ A;  3REB B;  1G2B A;  1HD3 A;  1M30 A;  4F14 A;  1ZUK A;  3TSZ A;  1AOJ A;  2B86 A;  3SEM A;  4LE9 A;  1XOV A;  4RTY A;  1NLP C;  3VS5 A;  1VYU A;  2X3W D;  2OI3 A;  2CT4 A;  2K9G A;  4HVV A;  1ABQ A;  2ROL A;  1K4U S;  1E7O A;  1T3S A;  1SEM A;  3JV3 A;  5HCK A;  4GLM A;  1UE9 A;  2RNA A;  2EW3 A;  1K76 A;  4AFZ C;  2K3B A;  1BU1 A;  3IQL A;  2DA9 A;  4GBQ A;  5IHI A;  2HEQ A;  3VS1 A;  2OJ2 A;  4F16 A;  1QWF A;  4AFQ C;  2L3P A;  2EQI A;  3M0Q A;  1VYT A;  2EYW A;  4HXJ A;  2MOX A;  1KSW A;  1X43 A;  2C0O A;  4Z89 A;  1T3L A;  2JMC A;  3LH5 A;  2KT1 A;  2O9V A;  4OML A;  1CSK A;  1RLP C;  2KXD A;  1EFN A;  2D8H A;  2O9S A;  2PZ1 A;  2J6O A;  2LX7 A;  5I11 A;  1N5Z A;  2FPD A;  1T0J A;  1OPL A;  5IH2 A;  1G83 A;  1I07 A;  2DE0 X;  2K79 A;  2DRM A;  1KIK A;  4RTV A;  3PVQ A;  1OEB A;  2H8H A;  2KNB B;  2V1R A;  2DLP A;  3EG0 A;  2O31 A;  1ARK A;  2RQU A;  4DEX A;  1KJW A;  2LCS A;  2L2P A;  1UG1 A;  2EVR A;  2JM8 A;  4J9E A;  1W1F A;  1WX6 A;  2CH4 W;  2JMA A;  2KRN A;  2AKL A;  2MCN A;  1PRM C;  1UDL A;  1WXB A;  3M0R A;  1QWE A;  3VS2 A;  4RUG A;  1TUC A;  4D8D A;  4RTT A;  2EGA A;  1M3C A;  2LJ0 A;  2SEM A;  1JXM A;  2ABL A;  3QWY A;  1GBR A;  2JTE A;  2LJ1 A;  1SHG A; 
#chains in the Genus database with same CATH topology
 1IO6 A;  3EG1 A;  1K9M U;  2OAU A;  3VU3 C;  4YTL A;  2RH2 A;  4CC7 A;  3NTI A;  4JRQ A;  4HCZ A;  4RG8 A;  3SB2 A;  3DLM A;  1SKU B;  2FEI A;  5DLO A;  3OW2 S;  1TOV A;  1KQS A;  1FXX A;  1TXQ A;  2M0Y A;  4CC2 A;  4FSX A;  2DXB A;  3OYF A;  4EMK A;  3KFV A;  1S72 A;  1MMD A;  3UA7 A;  1I0C A;  2E5K A;  1X2Q A;  2XU8 A;  2DTO A;  3MEW A;  1NG2 A;  2RD1 A;  1XJW B;  2AT1 B;  1QCN A;  2PVD B;  2DK3 A;  2BIV A;  1AHJ B;  1YFN A;  4M7D D;  3EAE A;  1E6G A;  3CXC S;  2RN8 A;  2A08 A;  4J9I A;  1UGQ B;  1KQ1 A;  3SFM A;  4AFU C;  2E3H A;  2DER A;  4KH1 B;  1VQ4 Q;  2RQV A;  1Y96 B;  4JJB A;  5LJ5 h;  2CZ6 B;  3GNG A;  2LJ3 A;  4J6W A;  4HT9 A;  4FSS A;  1XNI A;  4J9D A;  2ED0 A;  4KGZ B;  3ULR B;  1SHF A;  4C5I A;  2QDY B;  1Q7Y C;  2KR3 A;  2V8K A;  3ME9 A;  2H3E B;  2PTK A;  3CMA T;  1AWX A;  3CCE Q;  3TVT A;  2Y4X A;  2OTJ A;  2XMF A;  2K3Y A;  3M0T A;  4OGE A;  3CXC A;  3I56 Q;  1MUZ A;  1VQ9 T;  4M7A G;  4JZ4 A;  2AK5 A;  2MPX C;  2KDS A;  4C92 G;  2E4H A;  1VQM Q;  1DJ7 B;  3A1P A;  1X6G A;  2RI5 A;  3OYK A;  3PTA A;  4ORZ A;  3X28 B;  2CUD A;  1LCK A;  3L2U A;  4XU3 A;  3CCL Q;  4XU0 A;  1Y71 A;  2P0Q A;  2LT1 A;  1R0B G;  3H0H A;  1UFF A;  3T9N A;  4R55 A;  1IB8 A;  1XQH A;  4LD6 A;  4Y28 E;  4A4G A;  1NE8 A;  1VQP A;  3JCM Q;  1Q81 C;  3UAT A;  2KY9 A;  2X4X A;  4NL2 A;  4XAX B;  5CO7 A;  3CCL A;  2E65 A;  3FEO A;  5GAO m;  1W2B A;  4BB7 A;  2L3Q A;  1AWJ A;  4OMN A;  1YJW Q;  2F2V A;  3NPF A;  1WJR A;  1RAE B;  2R5M A;  2DYB A;  1JB0 E;  2WSF E;  2HQX A;  2QEX Q;  4FW1 A;  2ZPH B;  3PFS A;  3G1J A;  5GAM g;  1VQ6 Q;  1E6H A;  2FO0 A;  2E3I A;  4C0D C;  1EX4 A;  4C8Q D;  2VVK A;  2DXT A;  3CCM Q;  2QA4 A;  4Y92 A;  1BCM A;  2COW A;  1WDX A;  1D0X A;  3CPW S;  1Y57 A;  2K5F A;  2NUT B;  5GJW B;  2RK2 A;  4CRI A;  2MMP A;  4QT7 A;  2NUP A;  4A4E A;  5IHK A;  3C0C A;  1VQN T;  2CP5 A;  4OMP A;  2VWF A;  1NM7 A;  1A0N B;  3EFO B;  2E41 A;  2A3L A;  1YWP A;  3QPH A;  1K73 C;  1I1J A;  3PMT A;  2DO3 A;  5A0G A;  2CP3 A;  4M78 C;  1KHI A;  2RF0 A;  4E6R A;  1BYM A;  5KCO A;  4JRI A;  4C0F A;  1W6X A;  1UHF A;  3PT9 A;  3QYG B;  4O5V A;  3C94 A;  2YHT A;  1TUD A;  1U1S A;  4QQG A;  2JT4 A;  2DL4 A;  3TQ7 P;  3O5Z A;  1WHJ A;  2DYI A;  3TRE A;  2EFI A;  2J7I A;  1WYX A;  1UJ0 A;  3A5Z B;  1YWO A;  1ZQ1 A;  1NEB A;  2XKO C;  4KT0 E;  4CC3 A;  2VXF A;  4ZNX A;  2DJZ A;  1K73 R;  3MEV A;  5C6S A;  3M5A A;  2AZS A;  1C1A A;  2YXY A;  8AT1 B;  5A0L A;  2HNI A;  1SSH A;  1N6A A;  2DVJ A;  1P92 A;  3KBG A;  4ZGD B;  1WA7 A;  2XI9 A;  3EG2 A;  2QG9 B;  4Z88 A;  2KBT A;  1Q82 R;  4C8Q E;  3CCV A;  4RTZ A;  3CCE A;  3FJ5 A;  1VQM T;  3RR6 A;  5L8R E;  3CC7 T;  2FPE A;  3M9Q A;  4OP0 A;  1JO8 A;  5GAN g;  3OYA A;  4D6W A;  1D3B B;  4ATO A;  2DL7 A;  1N9R A;  1F1B B;  1U06 A;  1V76 A;  2CZ0 B;  2NUP B;  3OYD A;  3DB3 A;  3JCM c;  3P8H A;  4M77 E;  5LJ3 e;  1VQ6 A;  5DM7 R;  1X01 A;  5I2S A;  2L3R A;  1BI2 A;  4DBF A;  1VQL Q;  2M16 A;  2C06 A;  2KI7 A;  3CCJ T;  2P84 A;  4PJO A;  4HVW A;  4XTX A;  3I55 T;  1JRI A;  3CPW P;  2DBK A;  1X6B A;  2QEX T;  2K57 A;  3TCJ A;  2OAW A;  4C92 F;  1ZLM A;  1U8R A;  3NMZ C;  4ZGE B;  3CME Q;  1LOJ A;  1KC8 U;  2GBQ A;  3MP6 A;  1Q7Y U;  4KUD K;  3EGU A;  5LJ5 f;  2COY A;  2O01 E;  3CCV Q;  3VS7 A;  1WFW A;  4PJO D;  5GAN f;  1VQM A;  1K9A A;  4N4H A;  2EQK A;  3RNJ A;  1PNJ A;  1VQN Q;  2CZ7 B;  7AT1 B;  1TS9 A;  4AFS C;  4M78 A;  4XTY A;  2CSQ A;  4V2S A;  4BI4 A;  4NL3 A;  3OS0 A;  1M30 A;  4GY5 A;  4F14 A;  4M75 D;  2RI2 A;  3TSZ A;  3JCM e;  1VQ6 T;  3CD6 A;  1V29 B;  1AOJ A;  3SEM A;  4LE9 A;  3L2V A;  1LNX A;  9ATC B;  3CCM A;  1VYU A;  2L89 A;  5KYY B;  2X3W D;  3I56 T;  3I55 A;  4FU6 A;  3WVD B;  2CP7 A;  3CD6 Q;  5HK0 A;  1E7O A;  1SEM A;  3JV3 A;  5HCK A;  1W2B P;  4AFZ C;  4WTO B;  2DA9 A;  4GBQ A;  1Y7X A;  4XTW A;  4QVC A;  3QBY A;  2HEQ A;  5GAN 7;  3MEA A;  2OJ2 A;  3C12 A;  4M77 G;  1B34 A;  3VS1 A;  4F16 A;  1QWF A;  3HRU A;  4EPC A;  3M0Q A;  4HCC A;  2LNV A;  2VB6 A;  2EYW A;  4HXJ A;  1BIB A;  1KSW A;  2C0O A;  4XK8 E;  3M55 A;  1SF9 A;  2OTL Q;  4OML A;  2D8H A;  2QQA A;  2JOY A;  2CGH A;  1OPL A;  2D0Q B;  4C92 B;  4BY6 B;  2RHX A;  1YJ9 A;  4C8Q G;  1YJW T;  3CEY A;  3HHT B;  2CKK A;  4RTV A;  1OEB A;  2H8H A;  1LVK A;  4MZP A;  3G6E T;  3NTH A;  3RKY A;  1ARK A;  1VQK A;  2HAX A;  4M78 F;  3CCM T;  1Q95 G;  2E6Z A;  4E47 A;  3MCA B;  3L2W A;  1R0C B;  3ER0 A;  2MWP A;  3A8O B;  2DTI A;  4LDW A;  2JMA A;  5EG2 A;  1BCO A;  2MCN A;  1PRM C;  2COZ A;  2PUO B;  4M7D F;  3L2R A;  5A2Q E;  1NJI R;  5CKE A;  4X34 A;  1YBY A;  4D8D A;  1M3C A;  4DBH A;  1ZSZ B;  3RIR A;  3VKI A;  4F7U E;  3QWY A;  4IUU A;  3CC7 Q;  1GBR A;  2DEQ A;  2LJ1 A;  3M4G A;  3OMG A;  5A0D A;  2PUK B;  2RQW A;  4RCC A;  2EYQ A;  1GFD A;  5KYX B;  2RK1 A;  5GAN 5;  3CCV T;  4ESR A;  2HKN A;  2P4T A;  4EDU A;  1YHQ Q;  4A63 B;  3JB9 H;  3VRZ A;  2K6D A;  2MAM A;  1K8A U;  5GAN e;  3CCJ Q;  2RJD A;  3OBW A;  3OQ5 A;  4PLL A;  1G3Y A;  2BUD A;  2C0T A;  3OMC A;  4M75 C;  2RMO A;  2KYM A;  2FPF A;  1M8M A;  1KC8 R;  2L3S A;  4XU1 A;  4J9B A;  5KYY A;  1Q7Y R;  3CME T;  1VQ7 A;  4XTV A;  5GMK j;  1G3S A;  2ZPG B;  2QQR A;  4NOY A;  1MMN A;  1PM3 A;  2BE7 D;  4N4I A;  3OB9 A;  3J80 E;  2QEX A;  4PJO C;  4KUL A;  2SRC A;  3VJP A;  4M7D G;  5GAO p;  4M77 B;  1WGS A;  3MO8 A;  1UHC A;  1S72 T;  1JU5 C;  2EBP A;  4O6J A;  2KT8 A;  4J9C A;  5FW9 A;  4Q5W A;  3QSU A;  3M4Y A;  2DEU A;  5GAN 3;  4E7Z A;  4IUT A;  2LC4 A;  2IG0 A;  1BK2 A;  1WHM A;  3OYN A;  2XID A;  2HBP A;  2DX1 A;  2JTF A;  4JJD A;  1ZUY A;  1UTI A;  2KXC A;  2BTT A;  2RPN A;  4JRK A;  1RLQ C;  3GBQ A;  1FX7 A;  2MF2 A;  3OS5 A;  1RI0 A;  5GAO l;  1B7T A;  2A0F B;  4X9D A;  4ELY C;  1RL2 A;  1UEC A;  3CD6 T;  4FW2 A;  4C92 E;  1GCQ A;  1OZ2 A;  1AZE A;  2EJF A;  3CME A;  2DM1 A;  4R56 A;  1IGU A;  2R57 A;  3I9Q A;  1M9S A;  4J7I A;  2JXB A;  1M1F A;  1MGQ A;  4ME7 A;  4EMK B;  1I5O B;  3C4S A;  4MDW A;  1GCP A;  3QZ9 B;  1J3T A;  4J83 A;  2OTL T;  3UPU A;  4AG1 C;  2YUO A;  1WIE A;  3QHS A;  3DKM A;  2EPD A;  2CP6 A;  3D7S B;  2H3J A;  2WSC E;  4E7I A;  4ZN3 A;  4KGX B;  3OYB A;  2CP2 A;  4XU2 A;  2LMJ A;  3G6E Q;  1M90 U;  2DZC A;  5GAM j;  3OYH A;  1C6V X;  4M78 E;  2JZ2 A;  1B3Q A;  1ZUU A;  1D1C A;  2HSE B;  4B6M A;  1X6O A;  2AZV A;  1M3B A;  3VUZ A;  3NFC A;  4DQ2 A;  4CC4 B;  5DLQ E;  3E9F A;  2HQH A;  5ECA A;  1NJI U;  1AWW A;  1RI9 A;  4M75 F;  3G71 T;  1BI3 A;  3GOX A;  4NS5 A;  4RTW A;  1YCY A;  2MIO A;  4RTU A;  5D6X A;  2GCX A;  3J7A F;  2JW4 A;  1UGS B;  3CCS A;  3M56 A;  2DKG A;  1FWZ A;  1BKB A;  1WI7 A;  1SSF A;  2MWO A;  1VIF A;  2EGC A;  2QDL A;  2DIG A;  3EFR A;  1GCQ C;  1K9M R;  2J05 A;  4WCI A;  1SPK A;  2ZPB B;  2OTL A;  4ZTJ A;  1YIT T;  2X9H A;  2KQW A;  1X75 C;  5GMK h;  1Q86 U;  2C0I A;  5FU7 B;  5GAM f;  3LYI A;  4C92 A;  4J9H A;  2CH4 A;  4J5Y A;  2ZPE B;  2LCC A;  2FB7 A;  1VYV A;  2RO0 A;  1UGP B;  4ZN1 A;  2FVU A;  2YDL A;  4E7K A;  2RQT A;  4XTU A;  4FYW B;  2ECZ A;  4OB3 B;  1T0H A;  4N0A C;  3BY7 A;  3FIF A;  4F17 A;  2CSI A;  2W0Z A;  5IN1 A;  3E19 A;  3JCM V;  4L6V 5;  2D0N A;  3SHW A;  2DMO A;  4OVA A;  3CMA Q;  2J6K A;  2FRW A;  3HRS A;  4C8Q B;  1QP2 A;  4M7D A;  5CKH A;  2RM4 A;  3V7C A;  5I22 A;  4GLK A;  4C0D B;  1VQ8 T;  1IRX A;  4M78 D;  3H0F A;  4JLI A;  2IIM A;  2KYB A;  3GPL A;  2E70 A;  1VUB A;  4K11 A;  4RKU E;  4M7A B;  5CIU A;  1S72 Q;  4M75 B;  1K0X A;  2EAY A;  3V7R A;  1RAF B;  3LGL A;  1Y96 A;  2HMA A;  3M57 A;  4JS4 A;  4PFP A;  2EYX A;  3X25 B;  1RUW A;  2HKQ B;  1NZ9 A;  2QK0 A;  4OF1 A;  3VRY A;  2CT3 A;  3A98 A;  2RHZ A;  2ED1 A;  5FLX E;  2PU9 B;  1Y07 A;  4BDY A;  2QQS A;  1QVP A;  4J9F A;  1YIJ A;  1TWB A;  2LZ6 B;  4BDZ A;  3HP9 A;  1HSQ A;  1U3O A;  5GMK m;  3G7Z A;  1UB4 A;  3EFO A;  5GAO q;  1H3H A;  2KAF A;  1ZX6 A;  3EFS A;  1BIA A;  3JSC A;  3PGG A;  3QJ6 A;  1QVF S;  4F04 B;  3CC4 Q;  2D8J A;  4UC4 A;  2DTH A;  1WXT A;  1YJN Q;  1PKT A;  2GTO A;  4D8K A;  4M75 E;  4QQD A;  3G71 Q;  3G4S A;  2EQU A;  2IVW A;  4M7D C;  2VYT A;  2VGN A;  2ROT A;  3RER A;  2GGR A;  2RJC A;  1QCF A;  4FM4 B;  1H64 1;  3JCM h;  3JB9 F;  3REB B;  2GQV A;  3OSS C;  1D1A A;  1W2B S;  3QYH B;  2VV5 A;  2B86 A;  3PIP A;  4LDU A;  1YIT Q;  4RCB A;  3S3M A;  1NLP C;  3VS5 A;  4B9X A;  2KK4 A;  5GAO r;  1Q81 U;  2CT4 A;  2K9G A;  3CBP A;  2FZG B;  3RUX A;  4HKE A;  1ABQ A;  5LJ5 j;  4PKC C;  1UE9 A;  2EW3 A;  2Y90 A;  4QW2 A;  2LQK A;  3JCM X;  3EGX A;  4BI8 B;  2R5A A;  2LDM A;  2L3P A;  2LRQ A;  1VQ7 Q;  3GNF B;  3G4S Q;  4Z89 A;  4C5G A;  1T3L A;  2O9V A;  4OB1 B;  1RLP C;  2PZ1 A;  2LX7 A;  5I11 A;  3V7S A;  5CQY A;  1N5Z A;  1OI1 A;  1T0J A;  1NJI C;  4IUP A;  1G83 A;  4BD3 A;  2DE0 X;  1QP3 A;  2OTJ T;  2F1L A;  3CCR Q;  3SD4 A;  1KIK A;  2XD0 A;  5CQX A;  5HKC A;  1AT1 B;  5HY6 A;  4J6Y A;  2KNB B;  3MJX A;  2O31 A;  2F5K A;  1ZA1 B;  4DEX A;  5GAN 6;  1IGQ A;  1KJW A;  3CC4 A;  1UG1 A;  3BDL A;  1NBE B;  2EVR A;  1O75 A;  2JM8 A;  3BDU A;  3EGX B;  3RDV A;  1W1F A;  2QAS A;  2KRN A;  5GMK e;  3BFM A;  2AKL A;  1UDL A;  3M0R A;  3RKW A;  3I55 Q;  1VQ8 Q;  1YJW A;  3QG1 A;  3MHX A;  3MKD A;  2BE9 B;  4RTT A;  2DXU A;  4L59 A;  2ABL A;  3MET A;  3JCM d;  5LL6 S;  1S1N A;  1VQK T;  2I2L A;  4LDX A;  2YT6 A;  2GNC A;  2F5T X;  3X26 B;  3VS0 A;  1K1Z A;  3JB9 G;  3JCM J;  2KSS A;  2XK0 A;  1JJ2 A;  3H6Z A;  4LUE A;  1KD1 C;  2CDT A;  5J26 A;  2A28 A;  2ATC B;  4PFZ A;  1M4Z A;  5GJV B;  1SRM A;  1PRL C;  2YUP A;  1H3Z A;  4EMH A;  3CBM A;  1M2V A;  3LWH A;  4F7U B;  2E1H A;  1RAD B;  3JRZ A;  5KH6 A;  1N27 A;  4OMM A;  4F7U F;  4XQ3 A;  1QVG P;  2D1X A;  5HK3 A;  3UF4 A;  2RQR A;  2M51 A;  2KVQ G;  2W10 A;  5KE2 A;  2RA2 A;  2BZY A;  1NEG A;  2JS2 A;  4X1V A;  1PSF A;  1KD1 R;  1OQK A;  1M1K R;  4JPB W;  3OSV A;  2QQ9 A;  3THK A;  1IHW A;  2EYZ A;  1TUG B;  3WXM B;  1XTD A;  4M77 C;  2MK5 A;  1WQ7 A;  1KC8 C;  1VQ7 T;  2J06 A;  3OY9 A;  3G4S T;  1YP5 A;  2DBM A;  1IRE B;  4M78 G;  3CQT A;  1QLY A;  1JEG A;  3WVE B;  3X20 B;  2CUB A;  4QVZ A;  3BE3 A;  1FYN A;  1X2K A;  1M90 C;  3R6O A;  2JVV A;  2A37 A;  4PJN A;  1JBM A;  2YRV A;  1HYO A;  4PL6 A;  5CKF A;  3QJY A;  3SWN B;  2QA4 Q;  3V8J A;  5GAN 8;  2LQN A;  1QW1 A;  1C0M A;  2LNH B;  1QMC A;  1OU8 A;  1UEB A;  1VQ5 T;  2X3X D;  3L42 A;  2DVE A;  2RHI A;  2QAZ A;  3CC7 A;  4LNP A;  1YJN T;  3ASK A;  3QWX X;  3JCM f;  3JCM g;  2FRY A;  2GFA A;  4ELZ C;  2JM9 A;  1K73 U;  4F7U A;  1QVF A;  1YIJ Q;  2DD4 A;  1PG5 B;  2K4Y A;  2JNG A;  4Y91 A;  5D6W A;  1H8K A;  3CCJ A;  1UGV A;  4KH0 B;  1CKB A;  2E5Q A;  1OU9 A;  1VQK Q;  3N5B B;  1WHK A;  4A4F A;  1TH7 A;  5KYU B;  3MP1 A;  3PVL A;  3A8G B;  3E2U A;  3QO3 A;  4C5H A;  1RAB B;  4E7L A;  5IXB A;  1KQS S;  1D3B A;  1I81 A;  3OYL A;  1ZSG A;  4A53 A;  2K5L A;  4BY6 C;  1JXO A;  2FG0 A;  2XDP A;  4C5E A;  2JS0 A;  2GF7 A;  2CS7 A;  3SDZ A;  2M0O A;  2G3R A;  1YJN A;  3I5S A;  1WJS A;  2M1H A;  2K2V A;  4DOW A;  2QGF B;  3L2Z A;  2O4X A;  2DL8 A;  3M0U A;  4IIM A;  1MHN A;  3JCM P;  1BB9 A;  2ZGW A;  1WXU A;  3OA6 A;  2VKN A;  5L23 A;  4J9G A;  2LT4 A;  3JAM E;  3OYI A;  5LJ3 j;  1EIF A;  4TVR A;  2EGE A;  1G3W A;  8ATC B;  2YLB A;  2X4W A;  4CI0 C;  1K0S A;  5C0M A;  1AWO A;  3LLR A;  1D09 B;  1KFZ A;  2HDA A;  4E7J A;  2L0A A;  1SG5 A;  3PE0 A;  2O88 A;  3O8V A;  5FU6 C;  5FRO A;  2DXC A;  1YJ9 Q;  3VS3 A;  3NGP A;  3OYC A;  2HSP A;  1PD0 A;  1RAC B;  2VAS A;  3RMS A;  1H92 A;  1UUE A;  2ENM A;  5LJ5 g;  1WHG A;  1YIT A;  1U1T A;  3OYM A;  1VQ9 A;  1OX9 A;  4F7U G;  3GP8 A;  3LX7 A;  2K5I A;  3S6W A;  3JB9 I;  1YI2 T;  1M1K U;  2DL3 A;  1KG1 A;  3UT1 A;  3MEU A;  3EG9 B;  4M7D E;  2K2M A;  4PJO F;  1WPY A;  2RHY A;  3LW5 E;  1ZSZ C;  1R77 A;  2XDB A;  3OYE A;  4DBQ A;  3TU4 K;  4JJC A;  2V1Q A;  5FRN A;  1KK7 A;  1Q81 R;  4HT8 A;  3I35 A;  3GIB A;  5LJ3 g;  1RAA B;  2JUF A;  1MMG A;  5GAN j;  1JJ2 S;  4LN2 A;  3OS1 A;  2KE9 A;  5CVI A;  2X4J A;  2RJF A;  4LDV A;  4A4H A;  1AZG B;  3H41 A;  3V8K A;  2EIF A;  5KYX A;  3G6E A;  1YNZ A;  1AVZ C;  1WQW A;  1MV0 B;  1MNE A;  2EYY A;  1YN8 A;  1OPK A;  2KRM A;  2QYZ A;  2E64 A;  1VQ8 A;  4JRP A;  3C95 A;  2YUQ A;  2QI2 A;  1M5Q 1;  4PNO A;  3LGF A;  4RMO A;  2LQW A;  1ZA2 B;  1TG0 A;  2GTJ A;  3HL8 A;  2M02 A;  2QA4 T;  4IUV A;  1R8O B;  4JDS A;  1WNL A;  4M77 F;  1CKA A;  2CZ1 B;  3CCU A;  2P4R A;  4MZM A;  2L8D A;  1M2O A;  2DNU A;  1QCO A;  4FYV B;  1ZBX A;  4ANJ A;  4JZ3 A;  1VQN A;  1U5S A;  1KHC A;  4WF2 A;  2IPO B;  3Q1J A;  4J8O A;  4DEY A;  3EHR A;  3I5R A;  2X4Y A;  2QGG A;  4PJJ A;  1I4K 1;  1YIJ T;  3DB4 A;  2Y4Y A;  1BI0 A;  1M90 R;  3URG A;  3CCQ Q;  2RHU A;  2L5Q A;  1K9M C;  1ZUK A;  4BI3 A;  1PCX A;  1XOV A;  3LH0 A;  4RTY A;  1GXI E;  4PFO A;  1TU0 B;  2QQB A;  4Z02 A;  2DET A;  3S3O A;  2P0P A;  5LJ3 h;  2OI3 A;  2X51 A;  1RAG B;  2RI3 A;  3FB9 A;  2AHJ B;  5LJ5 e;  3ZEH A;  5GAM e;  1TTH B;  4PK4 A;  3H8Z A;  4MML A;  4GLM A;  2RNA A;  2VGM A;  3CCU T;  1K76 A;  2K3B A;  3FC3 A;  1VQL A;  2D6F A;  1VQ5 Q;  4AFQ C;  2O4X B;  4M7D B;  1D1B A;  5M9O A;  1VYT A;  4C92 C;  1Q86 R;  1X43 A;  2XG8 D;  2JMC A;  3LH5 A;  2KMT A;  1CSK A;  2KXD A;  5IAY A;  3RMQ A;  1EFN A;  3LWI A;  3CCE T;  2J6O A;  5AT1 B;  1PD1 A;  2FPD A;  2LTO A;  3OYY A;  4N4G A;  3EGD A;  3JCM b;  3A8H B;  2FZC B;  3PIO A;  1G3T A;  4E7S A;  4M77 D;  2CP0 A;  2V1R A;  3EG0 A;  4QQ6 A;  3X24 B;  4FYY B;  2E10 A;  2XDD A;  2QXF A;  4BE2 A;  4PJO B;  3HRT A;  5GAN h;  4BAC A;  2CYZ B;  4II1 A;  4KUI A;  3QZ5 B;  4QKU A;  1QWE A;  2PQW A;  5I21 A;  4FL6 A;  1TUC A;  1I5L A;  3CPF A;  3HFN A;  3OYJ A;  2PVO B;  4KBM B;  2JTE A;  1VQO A;  2DD5 A;  3HPW A;  3KXT A;  3MP8 A;  1OUL A;  3CC4 T;  5EC7 A;  1YI2 A;  4FYX B;  2DF6 A;  3J81 E;  4X9C A;  4C8Q C;  2GQI A;  3UA6 A;  1OX8 A;  2ESW A;  3OS2 A;  1JJ2 P;  4PJO G;  1M1G A;  3VS6 A;  4KRT A;  1W70 A;  2LX9 A;  3EH1 A;  3E9G A;  4Z8A A;  3GLX A;  1M1K C;  5D7U A;  1O9S A;  3ZL7 C;  4VUB A;  2Z0W A;  4ZTF A;  1PHT A;  2LP5 A;  4BE1 A;  3VV0 A;  2QTV A;  2KEA A;  2JJ9 A;  2A7Y A;  3G71 A;  3CCQ T;  3M53 A;  4M75 A;  4FT4 A;  1PC0 A;  2M9U A;  6AT1 B;  3CCS T;  3HTR A;  2F69 A;  1M27 C;  3JB9 J;  1QVG A;  2V8J A;  4MMK A;  2R58 A;  3R6N A;  1GFC A;  2B8A A;  1YCS B;  2JTM A;  1BBZ A;  4XTZ A;  2EWN A;  4LUD A;  2HL3 A;  2AKK A;  5FU6 B;  1Z9Q A;  4M7A F;  1UJY A;  2A36 A;  1FMK A;  1Q82 U;  1PWT A;  1WHH A;  2JN0 A;  1JQQ A;  3F70 A;  3A8M B;  3L1A A;  1IZ6 A;  3KUF A;  1EZZ B;  2PVG B;  2RJE A;  2EKO A;  2NLU A;  3ZFJ A;  1Y0M A;  5FWC A;  3QII A;  1VA7 A;  4IUQ A;  2NYS A;  1NPR A;  4BUG A;  4N0A A;  2VC8 A;  2EJG A;  5GAN d;  3M58 A;  1GBQ A;  2QTX A;  3ZBD A;  2DIL A;  4JJN K;  3EG3 A;  4M7A C;  2HCK A;  3QUI A;  2AIR B;  2DFU A;  5KYW B;  1V1C A;  1VQP T;  2OTJ Q;  3CCR T;  2YRD A;  4L5G A;  1LPL A;  3UDC A;  1WZO A;  2FHD A;  1OV3 A;  2EKH A;  1I8F A;  3CCU Q;  5IXF A;  1D0Y A;  2O2O A;  4JS5 A;  1NLO C;  5DY9 A;  2ZCF B;  1N8R U;  2NUT A;  4AT1 B;  1ZHI A;  5LJ5 d;  1AD5 A;  5FU7 C;  1X27 A;  4MZT A;  2VUB A;  1G5V A;  3CBO A;  2EQM A;  3OW2 P;  2FYK A;  1BI1 A;  2MI6 A;  4FCY A;  4A4K A;  4FIB A;  2F2X A;  4OMQ A;  1KQS P;  2D9T A;  1VQL T;  1QKX A;  5GAN 2;  2LCL A;  2YUN A;  4C0G A;  1KQ2 A;  2HQE A;  3UWN A;  2XHC A;  1QVG S;  2KGT A;  4AG2 C;  4AMC A;  5GAO n;  5LJ3 f;  2NWM A;  1LJO A;  3VYG A;  1NYG A;  4IIO A;  2PNI A;  4HVU A;  3DLL A;  2K3X A;  3FJP A;  5GMK i;  1HJD A;  1W4S A;  3TSW A;  2BKD N;  4M75 G;  1AEY A;  3CCR A;  1GL5 A;  1WHL A;  3M0P A;  5IT9 E;  3E1S A;  4P5N A;  1VIE A;  1M2V B;  3REA B;  1Z9Z A;  2ZPI B;  4HA8 A;  2EQJ A;  3QDF A;  3RKX A;  3VS4 A;  4QVD A;  5CKD A;  2J6F A;  2BZX A;  3QDR B;  1GRI A;  2DL5 A;  3M0S A;  4BE0 A;  1VQ4 A;  5FWB A;  1SRL A;  5IHN A;  4PJL A;  3HKS A;  2CRE A;  2YWW A;  4EMK C;  2BZ8 A;  2G6F X;  4RTX A;  1IHV A;  2K7A A;  1VQO T;  1MND A;  3FDR A;  3INZ A;  1ACM B;  2FL7 A;  2HBW A;  2HZY A;  3BW1 A;  1M3A A;  1X69 A;  3VUB A;  3H0I A;  2WAC A;  2YSQ A;  2ZZD A;  2ZAE A;  3NHN A;  3P8D A;  2F2W A;  2DPP B;  3PNW C;  2KRS A;  3CPW A;  4M7A D;  3P8B B;  4PJM A;  4DOV A;  3QXE B;  2I0N A;  1WLP B;  2MYS A;  1KD1 U;  1ABO A;  3M59 A;  3CCQ A;  3PMI A;  1HK9 A;  1OYX A;  3CC2 Q;  2KRO A;  1K8A C;  5GMK l;  3RBB B;  1YHQ A;  4M7A E;  4IKF A;  1VQ4 T;  4PLI A;  1PKS A;  4R0K A;  2DRK A;  1Q86 C;  2LVM A;  4OB0 B;  3MPU B;  1NYF A;  4EIK A;  4HCK A;  3GF5 A;  1OOT A;  3JB9 D;  3FRN A;  5AYF A;  4RG2 A;  2OX7 A;  2DJQ A;  1MV3 A;  1RAI B;  3L2Q A;  2NUZ A;  4OMO A;  1OZ3 A;  2LQ8 A;  1B07 A;  3SWN A;  4FT2 A;  1VQP Q;  2DAQ A;  1K8A R;  3OW2 A;  3EHQ A;  1QKW A;  4EMG A;  4LDY A;  1N8R R;  1ZSZ A;  1QVF P;  3CCS Q;  3TEE A;  4M4Z A;  5FRM A;  3NTK A;  2FZK B;  1UGR B;  1FMV A;  3HFO A;  5GAM h;  5LJ3 d;  2E12 A;  2X35 A;  1ZBJ A;  3U23 A;  2HL5 C;  4M7A A;  3CXC P;  5CCA A;  3V8L A;  4HCB A;  4JLG A;  3I56 A;  1YHQ T;  1M8V A;  4KGV B;  1TSF A;  1FMW A;  3CMA A;  4E7H A;  3M54 A;  3H9N A;  5KE3 A;  1D0Z A;  1G8X A;  1NPP A;  1MMA A;  5KYW A;  1G2B A;  4ZGJ B;  1HD3 A;  2V8I A;  1HXD A;  5KYN A;  4OGC A;  2DIQ A;  4J7F A;  5CR2 A;  3EH2 A;  2HD0 A;  3VYH B;  3RES A;  4MDX A;  4M78 B;  2WSE E;  2EJ9 A;  4HVV A;  2ROL A;  1K4U S;  1YJ9 T;  1T3S A;  2V26 A;  4E2F B;  3SWN C;  3FLG A;  1BU1 A;  3IQL A;  2XIC A;  4LXC A;  2ZPF B;  4J6X A;  5IHI A;  3CC2 A;  1PSE A;  4B9W A;  5I2M A;  2YRC A;  2RB6 A;  3CCL T;  2EQI A;  1WJQ A;  5J3B A;  2GFU A;  2MOX A;  4IUR A;  5KYU A;  2KT1 A;  2VXE A;  2O9S A;  1YI2 Q;  4OMF B;  4JUV A;  1B34 B;  1VQO Q;  4C92 D;  5IH2 A;  1I07 A;  3S3N A;  2K79 A;  1VQ9 Q;  2DRM A;  1Q82 C;  5CKB A;  3HSB A;  1N9S A;  3PVQ A;  5J39 A;  1IXD A;  2DLP A;  5CK9 A;  5D6Y A;  3AHU A;  4OB2 B;  2RQU A;  3JCM W;  3AT1 B;  2LCS A;  5KCH A;  4C8Q A;  2L2P A;  3QKJ A;  1RAH B;  4J9E A;  4DBR A;  3EGD B;  5GAM d;  1VOM A;  1WX6 A;  2CH4 W;  1VQ5 A;  3A8L B;  2P0K A;  1QQJ A;  4A54 A;  4PJO E;  1WXB A;  5CAI A;  4LD9 K;  4C8Q F;  2YLC A;  3VS2 A;  4RUG A;  2E6N A;  3CC2 T;  3OYG A;  2EGA A;  4C0Z A;  5GAN 4;  2LJ0 A;  3EG9 A;  2SEM A;  1JXM A;  4M77 A;  2DZ9 A;  3OBY A;  4DA4 A;  1N8R C;  1SHG A; 
#chains in the Genus database with same CATH homology
 1IO6 A;  3EG1 A;  5EC7 A;  2YT6 A;  2GNC A;  2RQW A;  4CC7 A;  3VS0 A;  1GFD A;  2DF6 A;  1K1Z A;  4ESR A;  2GQI A;  3UA6 A;  2ESW A;  2FEI A;  4A63 B;  3VS6 A;  4KRT A;  1W70 A;  3VRZ A;  4LUE A;  2K6D A;  4Z8A A;  2CDT A;  2M0Y A;  4CC2 A;  2A28 A;  3ZL7 C;  5GJV B;  1PHT A;  2LP5 A;  1SRM A;  1PRL C;  3KFV A;  2KEA A;  2YUP A;  3UA7 A;  1I0C A;  2C0T A;  2E5K A;  1X2Q A;  2RMO A;  2KYM A;  2FPF A;  1M8M A;  1NG2 A;  2L3S A;  4J9B A;  1M27 C;  4OMM A;  2D1X A;  3R6N A;  2RQR A;  1GFC A;  2M51 A;  3UF4 A;  1E6G A;  1YCS B;  2W10 A;  2BZY A;  1BBZ A;  1NEG A;  2RN8 A;  2JS2 A;  2A08 A;  4X1V A;  4J9I A;  2SRC A;  4LUD A;  4AFU C;  2AKK A;  4JPB W;  1Z9Q A;  2RQV A;  1UHC A;  1UJY A;  1JU5 C;  1FMK A;  2A36 A;  2EBP A;  1PWT A;  2KT8 A;  4JJB A;  1JQQ A;  4J9C A;  5FW9 A;  2LJ3 A;  3THK A;  4FSS A;  2EYZ A;  4J9D A;  2ED0 A;  3ULR B;  1SHF A;  1Y0M A;  5FWC A;  2J06 A;  1BK2 A;  1VA7 A;  1YP5 A;  2DBM A;  2KR3 A;  1S1N A;  3CQT A;  1QLY A;  1JEG A;  2DX1 A;  4JJD A;  2PTK A;  1ZUY A;  1AWX A;  1UTI A;  2KXC A;  2BTT A;  3TVT A;  2XMF A;  2CUB A;  1GBQ A;  2RPN A;  3M0T A;  1RLQ C;  3GBQ A;  2DIL A;  3EG3 A;  1MUZ A;  2HCK A;  1FYN A;  1X2K A;  1V1C A;  4JZ4 A;  1UEC A;  2A37 A;  2AK5 A;  1OV3 A;  1GCQ A;  2EKH A;  1AZE A;  5IXF A;  2O2O A;  2DM1 A;  1X6G A;  1NLO C;  2LQN A;  2LNH B;  3I9Q A;  4ORZ A;  2JXB A;  2CUD A;  2X3X D;  1LCK A;  1AD5 A;  4LNP A;  1X27 A;  3H0H A;  3QWX X;  1UFF A;  1GCP A;  1J3T A;  2F2X A;  4OMQ A;  2FRY A;  2JM9 A;  4AG1 C;  2YUO A;  1QKX A;  1WIE A;  3UAT A;  2EPD A;  2YUN A;  2L3Q A;  1AWJ A;  4OMN A;  2F2V A;  3NPF A;  2DYB A;  2KGT A;  4AG2 C;  1H8K A;  1UGV A;  1CKB A;  2LMJ A;  2NWM A;  1E6H A;  1NYG A;  4IIO A;  2PNI A;  2FO0 A;  4HVU A;  2VVK A;  1B3Q A;  1ZUU A;  1HJD A;  3PVL A;  2AZV A;  3TSW A;  1M3B A;  4Y92 A;  1WDX A;  1AEY A;  1Y57 A;  1GL5 A;  5IXB A;  4CC4 B;  3M0P A;  5GJW B;  5ECA A;  1AWW A;  1RI9 A;  1ZSG A;  3REA B;  4QT7 A;  1Z9Z A;  4RTW A;  5IHK A;  3C0C A;  2MIO A;  4RTU A;  4OMP A;  1JXO A;  2FG0 A;  2JW4 A;  3VS4 A;  2JS0 A;  1WI7 A;  2EGC A;  2VWF A;  2QDL A;  1NM7 A;  2J6F A;  1A0N B;  2BZX A;  3I5S A;  1GRI A;  1GCQ C;  1YWP A;  2DL5 A;  3M0S A;  2J05 A;  1I1J A;  5FWB A;  1SRL A;  2DL8 A;  3M0U A;  4IIM A;  1SPK A;  4WCI A;  2RF0 A;  1BB9 A;  4E6R A;  1WXU A;  2VKN A;  5L23 A;  4J9G A;  5IHN A;  1W6X A;  2CRE A;  1UHF A;  2C0I A;  2EGE A;  2BZ8 A;  2G6F X;  4RTX A;  2K7A A;  1K0S A;  1AWO A;  4J9H A;  2CH4 A;  1TUD A;  1VYV A;  1KFZ A;  2HDA A;  2L0A A;  2HBW A;  2JT4 A;  2DL4 A;  2YDL A;  3PE0 A;  2O88 A;  3O5Z A;  2RQT A;  2J7I A;  2ECZ A;  1WYX A;  1M3A A;  1X69 A;  1T0H A;  1UJ0 A;  3VS3 A;  3NGP A;  1YWO A;  3H0I A;  2HSP A;  1NEB A;  2YSQ A;  4CC3 A;  3NHN A;  4F17 A;  2CSI A;  2W0Z A;  2F2W A;  4ZNX A;  1H92 A;  1UUE A;  2ENM A;  2AZS A;  2KRS A;  2D0N A;  3SHW A;  2DMO A;  2J6K A;  2FRW A;  2I0N A;  1SSH A;  2DVJ A;  1WLP B;  1WA7 A;  1ABO A;  2DL3 A;  3EG2 A;  5I22 A;  4Z88 A;  2KRO A;  2KBT A;  3H0F A;  2IIM A;  4RTZ A;  3RBB B;  2K2M A;  2KYB A;  3FJ5 A;  4K11 A;  4JJC A;  1K0X A;  1PKS A;  2FPE A;  2V1Q A;  4R0K A;  2DRK A;  1JO8 A;  1NYF A;  3I35 A;  4EIK A;  4HCK A;  2DL7 A;  1OOT A;  1U06 A;  4LN2 A;  2EYX A;  2KE9 A;  1RUW A;  1AZG B;  3H41 A;  2DJQ A;  1MV3 A;  1YNZ A;  3VRY A;  2CT3 A;  1AVZ C;  3A98 A;  1MV0 B;  2ED1 A;  2NUZ A;  2EYY A;  4OMO A;  1YN8 A;  1OPK A;  2KRM A;  4HVW A;  1B07 A;  2YUQ A;  4J9F A;  2LZ6 B;  2LQW A;  1HSQ A;  2DBK A;  3EHQ A;  1TG0 A;  1U3O A;  1X6B A;  1QKW A;  2OAW A;  1H3H A;  2GTJ A;  1ZX6 A;  1ZLM A;  1CKA A;  4M4Z A;  3NMZ C;  2P4R A;  2D8J A;  2DNU A;  2GBQ A;  1WXT A;  4JZ3 A;  1ZBJ A;  3U23 A;  1PKT A;  3EGU A;  2GTO A;  1U5S A;  4D8K A;  3VS7 A;  1WFW A;  3EHR A;  4DEY A;  3I5R A;  1K9A A;  3RNJ A;  1PNJ A;  2ROT A;  2GGR A;  1QCF A;  4AFS C;  2CSQ A;  3REB B;  1G2B A;  1HD3 A;  1M30 A;  4F14 A;  1ZUK A;  3TSZ A;  1AOJ A;  2B86 A;  3SEM A;  4LE9 A;  1XOV A;  4RTY A;  1NLP C;  3VS5 A;  1VYU A;  2X3W D;  2OI3 A;  2CT4 A;  2K9G A;  4HVV A;  1ABQ A;  2ROL A;  1K4U S;  1E7O A;  1T3S A;  1SEM A;  3JV3 A;  5HCK A;  4GLM A;  1UE9 A;  2RNA A;  2EW3 A;  1K76 A;  4AFZ C;  2K3B A;  1BU1 A;  3IQL A;  2DA9 A;  4GBQ A;  5IHI A;  2HEQ A;  3VS1 A;  2OJ2 A;  4F16 A;  1QWF A;  4AFQ C;  2L3P A;  2EQI A;  3M0Q A;  1VYT A;  2EYW A;  4HXJ A;  2MOX A;  1KSW A;  1X43 A;  2C0O A;  4Z89 A;  1T3L A;  2JMC A;  3LH5 A;  2KT1 A;  2O9V A;  4OML A;  1CSK A;  1RLP C;  2KXD A;  1EFN A;  2D8H A;  2O9S A;  2PZ1 A;  2J6O A;  2LX7 A;  5I11 A;  1N5Z A;  2FPD A;  1T0J A;  1OPL A;  5IH2 A;  1G83 A;  1I07 A;  2DE0 X;  2K79 A;  2DRM A;  1KIK A;  4RTV A;  3PVQ A;  1OEB A;  2H8H A;  2KNB B;  2V1R A;  2DLP A;  3EG0 A;  2O31 A;  1ARK A;  2RQU A;  4DEX A;  1KJW A;  2LCS A;  2L2P A;  1UG1 A;  2EVR A;  2JM8 A;  4J9E A;  1W1F A;  1WX6 A;  2CH4 W;  2JMA A;  2KRN A;  2AKL A;  2MCN A;  1PRM C;  1UDL A;  1WXB A;  3M0R A;  1QWE A;  3VS2 A;  4RUG A;  1TUC A;  4D8D A;  4RTT A;  2EGA A;  1M3C A;  2LJ0 A;  2SEM A;  1JXM A;  2ABL A;  3QWY A;  1GBR A;  2JTE A;  2LJ1 A;  1SHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...