2KROA

Rdc refined high resolution structure of the third sh3 domain of cd2ap
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD2-associated protein
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kroA00
1X69A 1YWPA 1MUZA 2VKNA 2FEIA 4K11A 5I11A 2HSPA 2CH4W 2FRWA 4JJBA 1JXOA 2FG0A 2ROTA 4D8KA 1UGVA 3ULRB 2KXCA 4DEYA 1SRMA 1K4US 3O5ZA 4CC3A 2EW3A 2P4RA 1H8KA 2NWMA 2EYZA 4Y92A 1T3SA 1ZUKA 2EGCA 2EQIA 5ECAA 4LNPA 1OEBA 4HVUA 1OPKA 1PNJA 1PRLC 1UUEA 3UATA 1WXBA 1GFCA 2GBQA 2LNHB 3M0SA 2PZ1A 2CREA 3I5RA 1OV3A 1JQQA 4OMQA 3REAB 2YDLA 2DVJA 3I35A 2F2WA 2QDLA 2J7IA 2RQUA 2D8HA 4RTTA 1T0JA 1I0CA 2DLPA 1SSHA 2DL5A 3SEMA 2GNCA 2KEAA 1PKTA 1X6BA 5GJWB 1W70A 1E6GA 2A36A 2DNUA 2KBTA 2OJ2A 1NYGA 2L2PA 4AG1C 2AKLA 1K9AA 4LN2A 2M0YA 2NUZA 2EGEA 2CT4A 1UHFA 1WFWA 2HEQA 3EHQA 2DF6A 3VS3A 3IQLA 1SPKA 4AFQC 2BZYA 2ECZA 1A0NB 1K0SA 2X3XD 1IO6A 2VWFA 5IHNA 2YT6A 2EVRA 2KROA 2D0NA 1AZGB 4F16A 2ESWA 1W6XA 3VS2A 2CT3A 1NEBA 2K79A 2MCNA 1W1FA 4OMOA 2K3BA 1UE9A 3EHRA 1M27C 3CQTA 2RQRA 1MV3A 2KYMA 4LUEA 3KFVA 1N5ZA 2DMOA 2CSIA 2SRCA 2JM8A 4E6RA 1FMKA 2C0TA 4RTWA 1PHTA 2JM9A 1Z9QA 2RQVA 2XMFA 1QWEA 2C0IA 3THKA 2A08A 3VS0A 1JXMA 4HCKA 2MIOA 2BZXA 4J9CA 5IHIA 2FPDA 1X43A 2GTJA 3I9QA 2SEMA 2J6KA 4ZNXA 2CUBA 2EKHA 4OMMA 1QKXA 2K6DA 5L23A 1GRIA 2DRKA 1JEGA 1YP5A 1AOJA 2RN8A 3UF4A 1QCFA 1SRLA 1UDLA 2EYYA 1QWFA 4HVVA 1YWOA 1YN8A 1B3QA 3PE0A 4DEXA 3A98A 3NPFA 4ORZA 2MOXA 2JS2A 3REBB 2G6FX 1KSWA 4LUDA 1UFFA 4A63B 3VS4A 2V1QA 2GGRA 1WX6A 2EGAA 2RQTA 1KIKA 1HD3A 2FO0A 2DL8A 2HCKA 2HDAA 1GL5A 2AZVA 2EYXA 1WXUA 2LJ3A 2O31A 1U06A 2DL7A 1UJYA 1NYFA 1GCQC 2YUPA 1I1JA 1JO8A 2ENMA 1S1NA 2DL3A 1ARKA 2LZ6B 3H0IA 1YNZA 1TUDA 3EG3A 3I5SA 1NLPC 2RF0A 3VRYA 1QKWA 5IH2A 2DM1A 1M8MA 1K0XA 3UA6A 4HVWA 1NLOC 4WCIA 1TUCA 1WA7A 1ZUUA 2ED1A 4J9EA 2DBKA 2PTKA 1GBQA 2DL4A 3EGUA 1K1ZA 2F2XA 2HBWA 2DJQA 2KE9A 4CC4B 4RTVA 1UECA 2YUOA 2I0NA 1AZEA 1SHGA 1MV0B 1U3OA 1Y57A 1FYNA 4GBQA 1K76A 2ED0A 2J06A 2KXDA 5IHKA 1NEGA 2A28A 5IXFA 4JJCA 1J3TA 4AFUC 2PNIA 4EIKA 4RUGA 3FJ5A 2DBMA 1T0HA 2GTOA 1GFDA 4FSSA 2K2MA 2AKKA 2LJ0A 2J6FA 2LMJA 2W10A 2DX1A 2YSQA 3M0QA 4F14A 2ABLA 1AWOA 1HJDA 1B07A 4QT7A 4CC7A 1SEMA 2L0AA 4Z89A 2YUNA 1BU1A 1T3LA 1WXTA 2W0ZA 2C0OA 2J05A 2DRMA 2KRSA 1HSQA 2KGTA 1X6GA 2RPNA 5FW9A 4Z88A 1SHFA 2KYBA 2GQIA 3VS5A 2DYBA 1BBZA 2KT1A 2DA9A 1AWWA 3QWXX 1U5SA 3JV3A 4GLMA 1WDXA 2LQNA 4OMLA 1WI7A 2F2VA 1ZLMA 2FPFA 1X2KA 1V1CA 2LX7A 1KJWA 1H92A 1Z9ZA 1AD5A 2DILA 1WLPB 4J9BA 1E6HA 1QLYA 3EG1A 3PVQA 2JS0A 4JZ3A 1X2QA 2KR3A 2O9SA 4RTYA 2JXBA 3RBBB 2L3QA 1RLPC 1OPLA 1PRMC 5I22A 1NM7A 1BB9A 2D1XA 2RQWA 3QWYA 1LCKA 1M30A 2K9GA 3PVLA 2EYWA 2LJ1A 4JPBW 4HXJA 1ABQA 1KFZA 1ZBJA 1CKBA 2BTTA 1Y0MA 3H41A 3GBQA 1WYXA 1AEYA 4AFSC 1G83A 2A37A 4CC2A 2O9VA 4F17A 2J6OA 3TSWA 3M0RA 1PWTA 3M0TA 5EC7A 4KRTA 2BZ8A 3VS7A 1RUWA 4R0KA 2JT4A 3NMZC 1I07A 2X3WD 4D8DA 5IXBA 3M0PA 3U23A 1GCQA 1PKSA 2DE0X 3NGPA 1XOVA 2CDTA 1X27A 2H8HA 1G2BA 2EPDA 4J9GA 1VYUA 4LE9A 3M0UA 1AWJA 1RLQC 3UA7A 1M3BA 1H3HA 1RI9A 4Z8AA 3VS6A 1E7OA 2VVKA 1AWXA 4AG2C 1UJ0A 1ZUYA 2CSQA 4J9FA 1JU5C 2JMCA 2OI3A 2D8JA 1GCPA 2AK5A 1VYVA 2LQWA 3H0FA 1TG0A 2IIMA 2YUQA 2LP5A 2JMAA 2KNBB 1UG1A 4M4ZA 5GJVB 1CSKA 3TSZA 2M51A 2ROLA 3SHWA 1BK2A 4J9DA 2AZSA 3RNJA 2JW4A 1YCSB 2KT8A 4RTXA 3VRZA 1WIEA 3LH5A 2E5KA 4J9HA 2KRMA 3C0CA 2JTEA 1NG2A 2O2OA 3NHNA 5FWCA 1VYTA 4OMNA 5FWBA 2O88A 2LCSA 2L3SA 1ZSGA 2CH4A 1OOTA 2K7AA 3R6NA 1VA7A 2RNAA 1EFNA 5HCKA 3TVTA 1ZX6A 4IIOA 1ABOA 4JZ4A 4X1VA 1CKAA 1UTIA 2EBPA 4AFZC 1M3CA 2OAWA 4JJDA 3EG2A 1UHCA 4RTUA 4ESRA 4RTZA 3ZL7C 4IIMA 2CUDA 3H0HA 4OMPA 4J9IA 2B86A 3VS1A 2FPEA 2L3PA 3EG0A 1GBRA 1AVZC 2KRNA 2RMOA 1M3AA 2V1RA 2FRYA
chains in the Genus database with same CATH superfamily
2E6NA 1AT1B 2IPOB 2VKNA 4PJOC 1WHLA 3OA6A 3X25B 1IRXA 2HSPA 2MI6A 4FT4A 2FRWA 4JRIA 4JJBA 2K5FA 1JXOA 2ZPIB 2A7YA 2ZPGB 2DTOA 2VGNA 4AT1B 2KXCA 1TUGB 4RMOA 3NTHA 1H8KA 2NWMA 2EYZA 4M77G 4OGCA 4Y92A 3CCEA 1YFNA 2WSFE 5GMKh 5GAMd 2EGCA 5D6WA 1OEBA 1PRLC 4ZN3A 1SG5A 2PUKB 3M0SA 2PZ1A 2VUBA 4FW1A 4M75F 2E4HA 1JQQA 3GP8A 4OGEA 1B34B 2D8HA 3JB9F 2FVUA 4B6MA 1I0CA 4XTXA 1SSHA 3E2UA 3PFSA 2E64A 1PKTA 3I56Q 1W70A 4VUBA 2DTHA 4II1A 2P0KA 2RD1A 4AG1C 2AKLA 1WPYA 4M77B 2MF2A 3CCQQ 4M75C 2EAYA 1WQWA 2L3RA 1TOVA 3IQLA 3L2QA 3ZFJA 1K0SA 2X3XD 4JLGA 4J5YA 2VWFA 2LCLA 4MZMA 1I5OB 2D0NA 3M56A 1AZGB 2DYIA 1QVPA 3HSBA 2ESWA 1W6XA 3JCMV 2K5IA 3X20B 1M90U 1XTDA 1R0BG 5IT9E 3O8VA 3F70A 4OP0A 2DZ9A 3EG9B 1W1FA 2K3BA 2DJZA 2COWA 4M77E 1M27C 1VQ4Q 3CCUT 3HRUA 1GXIE 3P8HA 1TTHB 3NFCA 4XTWA 5CKDA 1VQLQ 3JCMf 4RKUE 2SRCA 1KQ1A 2C0TA 2D9TA 4CRIA 3JCMX 2VV5A 1PHTA 3KBGA 5GAN6 1UB4A 1Z9QA 2C0IA 4A4EA 2A08A 4PKCC 4KT0E 3VS0A 1JJ2A 2BZXA 2E12A 3DLMA 2FPDA 2CYZB 2XIDA 1SF9A 2P0PA 1QKXA 2K6DA 2O01E 2P0QA 3I55Q 2KMTA 1FMWA 2WSEE 3OYLA 1RAFB 1SRLA 1YIJT 1M1FA 2CKKA 9ATCB 1D0YA 3M55A 1B3QA 4C0GA 4Q5WA 5GAN4 5KYYB 3L2UA 3G4SA 2ZPFB 2MOXA 1PC0A 5DLOA 4M7AG 1VQOA 3ASKA 1VQ8A 3VS4A 2GGRA 5GMKm 1WX6A 2RQTA 4WTOB 1HD3A 4M78G 4PFPA 2OTJA 3QO3A 4R55A 4QQ6A 4EMKB 1S72A 1U06A 4O6JA 4DBHA 1GCQC 1I1JA 3BFMA 3LW5E 3S3NA 2XHCA 2BE9B 4ME7A 2JVVA 1S1NA 1PSFA 1WZOA 1YJ9T 3RKYA 1M2VA 1ACMB 1YNZA 3PNWC 3EG3A 1NLPC 3JCMb 3QZ5B 3CD6T 1QKWA 3L42A 2DM1A 2ZZDA 4J6XA 6AT1B 3UA6A 3V8KA 1KQSS 3CC7T 5HK3A 2ED1A 4J9EA 4E7KA 2L5QA 1W4SA 4XTVA 4TVRA 2PTKA 4JS5A 4M77F 1XJWB 4EPCA 1WNLA 1MV0B 3SD4A 1K73C 4HT8A 1Y57A 1BKBA 1K9MU 2E65A 3M58A 2ED0A 2J06A 1F1BB 3FJPA 1NEGA 1TSFA 1J3TA 2HL3A 4ZTFA 2CZ1B 1K73R 4C8QD 3M57A 3CC2Q 3NTIA 2XDBA 5CAIA 4EIKA 3EGDA 2M9UA 3OW2S 5GAOn 2AKKA 2LJ0A 2XD0A 2BKDN 4F14A 2YSQA 4PLLA 3OS5A 2ABLA 1AWOA 5GAOl 3QSUA 2X4XA 1HJDA 1B07A 1T3LA 5GANg 3AT1B 2C0OA 2HD0A 3CCET 2KGTA 3A8GB 5D6YA 1YHQQ 2LCCA 4C5IA 2GQIA 1VQNQ 1IZ6A 1N9SA 2KT1A 4IUQA 1AWWA 2XG8D 1U5SA 4LDYA 4X9DA 1WDXA 4C5EA 5GAOr 2F2VA 5GANe 1TH7A 3FRNA 2DIQA 1V1CA 5FU6B 1R0CB 4BE2A 3E9FA 1WLPB 3DLLA 4MMLA 4M7DG 4PJMA 5GMKj 1UEBA 1YJWQ 3HHTB 4C92G 4JZ3A 3CMEQ 1N27A 3A8HB 2KR3A 2O9SA 1XNIA 2DEQA 2L3QA 1OPLA 3LYIA 2D1XA 2RQWA 4NL3A 1M30A 3PVLA 1IXDA 3QDFA 1LNXA 1V29B 1RADB 1KFZA 1CKBA 2NYSA 3GBQA 3WVDB 3CCSQ 4AFSC 1G83A 3OYEA 4JRKA 3CCMA 2O9VA 3JB9H 4FT2A 5J26A 5IN1A 4M7DB 4KUIA 3D7SB 3URGA 4Y28E 3TSWA 3M0RA 5CIUA 4C92B 1VQ6Q 4IUPA 3CCLA 3UWNA 3TCJA 2LNVA 3V7SA 3GIBA 3EH2A 1N8RC 3HFOA 3CC4Q 3NMZC 2CP5A 1I07A 5IXBA 3U23A 2K3XA 1GCQA 4OB1B 4X34A 3VYGA 1BIBA 4OB2B 2H8HA 2OTLQ 4J7IA 2EPDA 1VYUA 3SDZA 1N8RR 4JS4A 1AWJA 1IGUA 2KSSA 3UA7A 3PGGA 1M3BA 2FZGB 4E7ZA 4R56A 3OS1A 3MEUA 4PJOG 4J6WA 4OF1A 4JUVA 5FU7B 1UG1A 3TQ7P 1TXQA 4M4ZA 5GJVB 1OX8A 2D6FA 3G4ST 1W2BP 5AYFA 4RTXA 3VRZA 1Q81R 1VQ8T 3LH5A 3SB2A 1KC8C 2CP7A 4J9HA 1OX9A 2KRMA 5GAMe 3JRZA 5FWBA 2OTJT 2L89A 3M53A 2L3SA 1S72T 4DOWA 1KC8R 1VA7A 1M1KC 2RNAA 4PFOA 1ZX6A 4PJOB 2PVGB 1CKAA 4FW2A 2OAWA 3EG2A 5KYUB 1K8AU 2NUPA 1ZSZC 3ZL7C 4IIMA 1M1KR 2CUDA 4J9IA 3CCJA 1NJIC 4LD9K 3A5ZB 2XK0A 3HKSA 1X6OA 2CP2A 3AHUA 2FPEA 4IKFA 4PL6A 3EG0A 3CXCS 1Y71A 2V1RA 2FRYA 3SWNA 1MUZA 4M75G 5FLXE 1NJIR 3VYHB 5I11A 2B8AA 4M7AD 3JB9G 2YLBA 4FYVB 2RI2A 2QK0A 2X51A 4M78D 2FZKB 4BE1A 4N0AC 4ANJA 2E5QA 3ULRB 4DEYA 1Y96B 2EW3A 3UT1A 3OYDA 3S3OA 3EFOA 1WQ7A 2F1LA 3BDUA 3CCUQ 2EQIA 5GAN5 4C92F 3EGDB 2GBQA 3M4GA 1JRIA 4DA4A 4M75B 1Q86C 3I5RA 2F2WA 3QHSA 3JAME 1YIJA 1QVGP 4RTTA 3OSSC 4KH0B 4B9XA 5CKFA 2RHUA 3PIOA 2DXBA 2DLPA 1Q86R 2DL5A 3SEMA 1OZ3A 1E6GA 2QASA 2OJ2A 1QP3A 3OBWA 2L2PA 2DZCA 4LN2A 2QG9B 2M0YA 2NUZA 3CCVA 1NBEB 2HEQA 3C94A 1HYOA 2DF6A 1H3ZA 3VS3A 2BZYA 3JCMc 2DXUA 3E1SA 5GANh 1IO6A 5IHNA 2CS7A 2YT6A 2KROA 5KE2A 4F16A 3EFSA 2FB7A 2K79A 3OYKA 4BUGA 1BI1A 1OQKA 4OMOA 1UE9A 1WHJA 1JJ2P 3CD6A 2RJCA 4QVCA 1MV3A 2KYMA 1OZ2A 4ZTJA 1W2BA 1YJ9Q 1FMKA 3CCMT 4PJOF 2XMFA 3THKA 1LJOA 5CKHA 2OX7A 1I4K1 4HCKA 5LJ3d 4A4GA 3UPUA 3OBYA 1G3TA 2NUTA 4N4IA 5IHIA 8AT1B 3CCLT 3RIRA 3OYIA 2SEMA 4ZNXA 2CGHA 3CC7Q 3L2ZA 1GRIA 4M7DD 1JEGA 1C1AA 4MMKA 4C92D 2DERA 3H9NA 1OI1A 3RR6A 1D1BA 1QWFA 4HVVA 1Q7YC 1YN8A 1OU9A 3LWIA 3T9NA 3G6EQ 3PE0A 3MO8A 1ZSZA 4HT9A 3NPFA 4PJLA 3QYHB 2JS2A 2G6FX 1Q7YR 2V1QA 1Q95G 1KD1C 3X26B 2RO0A 4WF2A 2HCKA 2HDAA 1FXXA 2AZVA 2EYXA 3ZBDA 2VASA 4L5GA 5I2SA 2O4XB 1KD1R 3DKMA 2DEUA 1TU0B 1D1AA 1VQPA 3FIFA 1M1GA 4N0AA 3CCEQ 2HQXA 2K5LA 5GAMh 1RAHB 2QGFB 2MWOA 3HTRA 2YHTA 1M5Q1 1NLOC 4WCIA 1PD1A 4PK4A 5LJ5g 2DBKA 2DL4A 3A1PA 3CCQA 2X35A 2H3EB 5GAOq 4RTVA 1QVGA 1X75C 1SHGA 3QZ9B 2BE7D 1FYNA 3CCJT 2KXDA 2XDDA 4J7FA 5CR2A 4PJOD 3L2RA 2NUPB 1M9SA 2QXFA 3HL8A 2YLCA 2WSCE 4HCBA 2PNIA 5LJ5e 3DB3A 3META 1VQMQ 1YJNA 2GTOA 3M54A 1QW1A 4HKEA 1VQ4A 1HXDA 2E10A 3WXMB 2R57A 2J6FA 2LMJA 2W10A 2DX1A 3M0QA 2M02A 1QVFS 5GMKl 4QT7A 2YWWA 5LJ3f 2YUNA 1VQ9T 1PG5B 1DJ7B 2X9HA 2CZ6B 1NE8A 2DRMA 2LRQA 3OS2A 2KRSA 1HSQA 1X6GA 5DY9A 5J39A 1N6AA 2DYBA 3EFOB 2FZCB 4FYYB 5AT1B 4GLMA 3C95A 5KCHA 2MMPA 1WI7A 4BDYA 3OYFA 3JCMP 1ZLMA 1EX4A 2RJFA 3OYBA 1Z9ZA 3TEEA 2DILA 4IUUA 2DETA 1D3BA 1E6HA 5GAOp 2DK3A 4M75D 3EG1A 2DPPB 1KHIA 2AT1B 1PM3A 3JB9D 1M4ZA 2JXBA 1PRMC 1VIFA 3CCVT 4E7JA 4RG8A 3LLRA 3QWYA 2MK5A 1LCKA 3UDCA 5CKEA 5D7UA 4C8QC 2QGGA 3QBYA 3G4SQ 2RA2A 3GPLA 1M2OA 2DXTA 1VQOQ 1AEYA 3BE3A 1QP2A 4CC2A 4F17A 2E6ZA 1O9SA 2OTJQ 3L2WA 1S72Q 1BYMA 4A53A 3HFNA 1TWBA 2X3WD 3RUXA 5L8RE 3M0PA 2DE0X 3V8JA 3NGPA 4QW2A 2QEXQ 4BB7A 1YITT 3OSVA 2RK2A 2VXFA 1VQ7A 1G2BA 4J9GA 4LE9A 4RG2A 4XU3A 3M0UA 1RLQC 1EZZB 2DVEA 1H3HA 4Z8AA 4E7IA 4XU1A 5KYWB 2AHJB 4J9FA 1KQSP 2D8JA 2AK5A 3CC2A 4UC4A 3JSCA 1VYVA 4DQ2A 3CMAQ 2LQ8A 5DM7R 2YUQA 1R8OB 3M5AA 3CCRA 4XK8E 2V26A 2YXYA 2KNBB 2HL5C 1CSKA 3TSZA 2ROLA 5LJ3j 2AZSA 1VIEA 3EFRA 1RAAB 4EMGA 3G71A 1WIEA 2E5KA 2VB6A 3C0CA 1YI2Q 2O2OA 1VYTA 2O88A 1VQ5A 3MEVA 3OW2P 4BDZA 3SWNC 2K7AA 1MMGA 1EFNA 1VQPT 5GAN3 1ABOA 4JZ4A 4X1VA 2NLUA 3QPHA 4AFZC 3MEWA 3GNFB 4RTUA 2RHYA 4LDVA 5FROA 4OMPA 2LC4A 1MGQA 2IVWA 2D0QB 2PVOB 3I56T 1OULA 3QXEB 1GBRA 3LX7A 2RMOA 4RCBA 1M3AA 4Z02A 2MWPA 3CCQT 4BE0A 1Y07A 5J3BA 4BY6C 3V7CA 3GLXA 2DD4A 2FEIA 3MP8A 2R58A 1Q82C 4JRQA 1NPRA 2KK4A 4IUVA 4KGZB 4M77D 4V2SA 1P92A 2F5KA 2QI2A 3JCMg 1SRMA 2H3JA 1Q82R 5GAOm 1BIAA 1UGQB 4FL6A 2P4RA 1T3SA 1YJNT 5ECAA 4BI8B 5LJ5h 1VQ4T 1VQ6A 2VXEA 4HVUA 5HK0A 1OPKA 1EIFA 1WXBA 3UATA 4ELYC 3JCMW 3QG1A 1VQLT 3CPWS 2LNHB 1WHHA 4C8QA 2CREA 3JCMe 1OV3A 3CCMQ 3EGXA 2KVQG 4MDXA 2JJ9A 3PMTA 2RI3A 3I35A 2RQUA 1BI3A 4BACA 2OTLA 1T0JA 3CCLQ 3OYJA 2BUDA 4MZPA 3FB9A 4HA8A 2FYKA 2RJEA 1WHKA 2GNCA 2KEAA 1X6BA 4KGXB 2A36A 2KBTA 2HQHA 5KCOA 1K9AA 3FC3A 4N4HA 4XTUA 3I55T 5GAMg 2CT4A 3RMQA 1SPKA 2OAUA 2ECZA 1Q81C 1A0NB 2K4YA 4OMFB 2EVRA 5KYNA 3LGLA 4M7AC 2BIVA 1KQSA 2E70A 1NEBA 3INZA 2FHDA 1FWZA 4M78C 1KQ2A 2PVDB 3JB9J 2RHZA 3L1AA 3QJ6A 3G7ZA 5GAN8 3QDRB 4LUEA 1RAIB 2QAZA 3KFVA 4X9CA 4BD3A 4ZN1A 2DMOA 1B34A 2MPXC 4JLIA 4PJNA 4OB0B 2JM8A 4ZGDB 1IREB 3A8MB 2JM9A 1X01A 2RQVA 1QWEA 4XTZA 1JXMA 1M90C 1YBYA 3OW2A 1M2VB 2GTJA 2QA4A 3JCMJ 2CUBA 5A0LA 5HKCA 4IURA 1M90R 1YP5A 3S6WA 2RN8A 3UF4A 1QCFA 2QQ9A 1UDLA 2EJFA 3VUBA 1VQ7T 2FL7A 1YWOA 3MHXA 3CCJQ 1WGSA 2HAXA 1ZQ1A 2LTOA 3A98A 1XQHA 2DO3A 2K3YA 3EG9A 1KSWA 4LUDA 4A63B 1VQ9A 3CEYA 3X28B 5GAN2 4QQDA 3CC2T 3CXCP 1KIKA 5CQXA 2CZ7B 3CCRT 5CKBA 3FDRA 4BI3A 2O31A 2DTIA 2DL7A 1UJYA 1NYFA 2YUPA 5FRNA 5KE3A 1JO8A 3RMSA 2RK1A 2KQWA 3G71T 1K73U 2ATCB 3CBPA 2DL3A 1ARKA 2LZ6B 4LDUA 4ZGJB 5EG2A 1TUDA 3I5SA 3OYGA 5HY6A 1VQ5T 1BCMA 5IH2A 4DBRA 1QCOA 4GLKA 1VQKA 1D0ZA 1M8MA 1N9RA 1K0XA 2HKQB 4MDWA 2ZGWA 1TUCA 1ZUUA 3VV0A 2F2XA 3MEAA 4D6WA 4CC4B 1YIJQ 2I0NA 5CO7A 1AZEA 1U3OA 4F04B 2LDMA 1G3SA 4A4HA 3OS0A 1C0MA 5IHKA 2A28A 4KGVB 2LT1A 4RUGA 4EMKA 3FJ5A 2DBMA 1T0HA 2DIGA 2JNGA 2GFUA 1GFDA 1SSFA 3OYHA 1D0XA 3VKIA 3LH0A 4CC7A 3CCST 4Z89A 1K9MC 1G8XA 1OYXA 3RERA 1WJRA 1WJQA 2W0ZA 5A0DA 4M7AA 1YITA 2GFAA 2RPNA 5FW9A 4Z88A 1SHFA 3CD6Q 3CBOA 1VQ6T 3VS5A 2R5MA 1K9MR 1ZHIA 2I2LA 2PQWA 1FX7A 1BBZA 4M78A 1UGRB 1WHMA 4QQGA 3QWXX 4C0DC 2MAMA 3JV3A 2LQNA 3M9QA 4E7HA 2FPFA 3FEOA 2V8JA 2RB6A 4OB3B 3H6ZA 1H92A 3JCMh 2GCXA 2OTLT 1AD5A 1D1CA 3EGXB 5KYXA 5GMKi 3VJPA 4QVZA 2JS0A 1X2QA 2HZYA 4RTYA 1BB9A 5LL6S 1N8RU 2LJ1A 4C8QE 3OYCA 4HCCA 2CP0A 1Y0MA 1WYXA 2RH2A 3CXCA 2JTFA 2RI5A 1RI0A 4GY5A 3JB9I 3MCAB 1RABB 2RM4A 3RDVA 2YRVA 1IHVA 5EC7A 4KRTA 2BZ8A 2COZA 3I56A 4R0KA 2JT4A 5GANf 1VQPQ 1U1SA 1Q81U 4D8DA 2VGMA 1M8VA 4LD6A 3P8DA 1MMDA 2PUOB 4LDWA 1X27A 2V8KA 2E3HA 5IAYA 4C0ZA 1TS9A 2QA4T 1KC8U 4AG2C 3PIPA 1E7OA 1AWXA 1ZUYA 4AMCA 3PT9A 4QVDA 3PMIA 4KULA 2JMCA 2OI3A 4L59A 1GCPA 2LQWA 2R5AA 1TG0A 2IIMA 5GAN7 4LDXA 1VQMA 2V8IA 1M1KU 2EQKA 4F7UA 2JMAA 3SWNB 5CQYA 2M51A 3SHWA 3RKXA 2KI7A 4O5VA 1VQLA 4M7DA 3RNJA 2JW4A 1KHCA 5M9OA 3EH1A 2KT8A 4C92A 1I5LA 3OYMA 3VUZA 3A8LB 1NJIU 1NG2A 2EQJA 1YJNQ 1AHJB 3OYNA 1I81A 4LXCA 4JDSA 1ZSGA 4FSXA 4PJJA 3BDLA 1MHNA 2CH4A 3MP1A 1OOTA 4FU6A 1JBMA 1QVFP 3TVTA 4BY6B 3I55A 1KG1A 3HP9A 1UTIA 1KK7A 3OB9A 4A54A 3C12A 1UHCA 1QCNA 4RTZA 4IUTA 4QKUA 4C8QF 3BY7A 3H0HA 2B86A 3VS1A 1VQKT 1NPPA 2L3PA 2EQUA 4NOYA 2KRNA 2E3IA 3GNGA 1X69A 1YWPA 4K11A 3L2VA 5C6SA 2CH4W 1Q86U 2Y4XA 2IG0A 4C0FA 4FYXB 2FG0A 2ROTA 4D8KA 1K8AC 1UGVA 1PD0A 3RKWA 2QTXA 3O5ZA 5GAMf 1VQ8Q 2YRCA 3GOXA 1K4US 2Y90A 3J7AF 4CC3A 3E9GA 2F5TX 3C4SA 1ZUKA 1K8AR 4LNPA 1UUEA 1PNJA 4BI4A 3X24B 4PJOA 3Q1JA 1GFCA 5GANj 2HKNA 5KYUA 4N4GA 3FLGA 2E41A 3QYGB 4OMQA 3REAB 2YDLA 2DVJA 3QJYA 4MZTA 4KH1B 2QDLA 2QEXA 2J7IA 4RCCA 2F69A 4B9WA 1V76A 1IHWA 4J6YA 1VUBA 1YCYA 4M7AB 3QUIA 3V8LA 5GJWB 2DNUA 2GF7A 1NYGA 2QTVA 2NUTB 2EIFA 4M78B 1RAEB 2G3RA 2QQRA 2EGEA 1UHFA 1WFWA 3EHQA 3CMAA 2COYA 1VQ7Q 1MMAA 4AFQC 4E7SA 2XU8A 2DD5A 4EDUA 1Y96A 4XAXB 4HCZA 2JN0A 3G6ET 2L8DA 2Y4YA 3VS2A 2CT3A 4M7AE 3S3MA 5KYXB 3OMCA 2MCNA 1R77A 1HK9A 4M77C 3MPUB 1ZSZB 1MMNA 3CCRQ 2QQBA 1YI2A 3EHRA 3HPWA 4M78E 1YHQA 4M75A 3CQTA 2RQRA 1VQNA 2ZPEB 1N5ZA 2CSIA 3G71Q 2Z0WA 1G5VA 1Q7YU 3M4YA 4E6RA 5FRMA 2LVMA 4RTWA 1ZA1B 4KBMB 2EFIA 3P8BB 3G1JA 3QKJA 2MIOA 1VQ5Q 4FYWB 4Y91A 4J9CA 1X43A 3I9QA 2J6KA 1YJWA 1KD1U 3NTKA 2EKHA 4OMMA 1QVFA 1UGPB 2DXCA 2CP3A 3CMEA 5L23A 2QYZA 3OYAA 2DRKA 1ZBXA 1AOJA 4PLIA 4F7UG 2EYYA 4DOVA 3KUFA 1Y7XA 5D6XA 3TREA 4C5HA 4DEXA 5CCAA 3HRTA 2QQSA 2RHIA 3CBMA 5GAMj 3H8ZA 4ATOA 4ORZA 3REBB 2RJDA 3JCMQ 2E1HA 3CCSA 1UFFA 1NZ9A 1BCOA 5LJ3g 5C0MA 2EGAA 2RHXA 4EMHA 1VOMA 2XKOC 2FO0A 5LJ5d 2DL8A 3LWHA 1GL5A 2CP6A 2QQAA 1VQMT 1WXUA 2XICA 2LJ3A 1WJSA 4OVAA 1PSEA 2P84A 2ENMA 4YTLA 4F7UB 3CC4A 2X4YA 5LJ3e 3H0IA 4XU0A 4FM4B 2RF0A 4ELZC 2DKGA 5I21A 3VRYA 2DFUA 1G3WA 1OU8A 5CVIA 4M7AF 4HVWA 4EMKC 4NL2A 2X4JA 3WVEB 1WA7A 3CPWP 2VYTA 1GBQA 3EGUA 2JOYA 1K1ZA 2HBWA 4M78F 2DJQA 2KE9A 1RAGB 1UECA 4F7UE 2YUOA 3SFMA 3RESA 1G3YA 4GBQA 2M16A 1K76A 4M7DE 1W2BS 4JJNK 2MYSA 4C92E 4P5NA 5IXFA 1D3BB 4JJCA 4AFUC 2EJ9A 4PNOA 5GMKe 2ZPHB 8ATCB 2O4XA 2ZCFB 4A4FA 4FSSA 2K2MA 2M0OA 4NS5A 4C0DB 1IGQA 4C5GA 4XQ3A 3HRSA 1VQOT 3VU3C 1SEMA 2L0AA 1BU1A 1WXTA 2KY9A 2J05A 3J81E 3KXTA 2LQKA 2EKOA 2VC8A 2XI9A 3J80E 2KYBA 4CI0C 1B7TA 4J83A 4M77A 2EQMA 4L6V5 2DA9A 3MP6A 3CPFA 5KH6A 4OMLA 1X2KA 2QEXT 2LX7A 1KJWA 2A0FB 4J9BA 3OYYA 2X4WA 2K2VA 2QA4Q 1QLYA 2JTMA 4FIBA 3PVQA 4J8OA 2DAQA 3N5BB 1LOJA 5CK9A 1WHGA 1IB8A 2P4TA 5LJ5f 4ZGEB 3R6OA 2K57A 3RBBB 1RLPC 5I22A 1NM7A 5A0GA 3CMAT 2K9GA 3MKDA 4PJOE 2EYWA 5FU6C 3CCUA 1UGSB 4JPBW 5I2MA 4HXJA 1ABQA 3BW1A 1ZBJA 2HBPA 2BTTA 3H41A 1RACB 3ER0A 3M59A 1VQ9Q 1D09B 2A37A 4F7UF 1QVGS 4XTYA 2QDYB 3LGFA 1ZA2B 1YI2T 4FCYA 2J6OA 4M7DF 1YHQT 1PWTA 3V7RA 2JUFA 3M0TA 1VQNT 1PCXA 3VS7A 1RUWA 2KAFA 4KUDK 1RL2A 3QIIA 2KDSA 1JB0E 1PKSA 4DBQA 2HQEA 1XOVA 2CDTA 5GANd 5KYYA 2LT4A 4M7DC 2M1HA 5A2QE 2GQVA 2A3LA 4C92C 4A4KA 1VQKQ 2CZ0B 1YJWT 1RI9A 3VS6A 2VVKA 3ZEHA 1UJ0A 1MNDA 2CSQA 2AIRB 3CPWA 3DB4A 2JZ2A 3GF5A 2HSEB 3CMET 1JU5C 3CCVQ 2C06A 1BI2A 3H0FA 1C6VX 2EYQA 4M75E 1JJ2S 2LP5A 1QQJA 3EAEA 2LX9A 4C8QG 3PTAA 2PU9B 1BK2A 4J9DA 3OQ5A 1I8FA 4E7LA 1YCSB 1YJ9A 1LPLA 1SKUB 2JTEA 5DLQE 3NHNA 5FWCA 2WACA 4OMNA 3MJXA 1H641 1U1TA 3TU4K 2LCSA 5FU7C 2EJGA 3A8OB 2YRDA 2XDPA 1LVKA 2ZAEA 3ME9A 3R6NA 4E2FB 3CC7A 5HCKA 3CC4T 4IIOA 1Q82U 3JCMd 1FMVA 2EBPA 1YITQ 3OMGA 1BI0A 1M3CA 4JJDA 1QMCA 4C8QB 4ESRA 5KYWA 2HMAA 2ZPBB 5LJ3h 4DBFA 1O75A 3G6EA 3OY9A 4E47A 2EWNA 7AT1B 5LJ5j 2HNIA 4JRPA 1U8RA 1MNEA 1AVZC 4XU2A 3E19A 4PFZA
chains in the Genus database with same CATH topology
1X69A 1YWPA 1MUZA 2VKNA 2FEIA 4K11A 5I11A 2HSPA 2CH4W 2FRWA 4JJBA 1JXOA 2FG0A 2ROTA 4D8KA 1UGVA 3ULRB 2KXCA 4DEYA 1SRMA 1K4US 3O5ZA 4CC3A 2EW3A 2P4RA 1H8KA 2NWMA 2EYZA 4Y92A 1T3SA 1ZUKA 2EGCA 2EQIA 5ECAA 4LNPA 1OEBA 4HVUA 1OPKA 1PNJA 1PRLC 1UUEA 3UATA 1WXBA 1GFCA 2GBQA 2LNHB 3M0SA 2PZ1A 2CREA 3I5RA 1OV3A 1JQQA 4OMQA 3REAB 2YDLA 2DVJA 3I35A 2F2WA 2QDLA 2J7IA 2RQUA 2D8HA 4RTTA 1T0JA 1I0CA 2DLPA 1SSHA 2DL5A 3SEMA 2GNCA 2KEAA 1PKTA 1X6BA 5GJWB 1W70A 1E6GA 2A36A 2DNUA 2KBTA 2OJ2A 1NYGA 2L2PA 4AG1C 2AKLA 1K9AA 4LN2A 2M0YA 2NUZA 2EGEA 2CT4A 1UHFA 1WFWA 2HEQA 3EHQA 2DF6A 3VS3A 3IQLA 1SPKA 4AFQC 2BZYA 2ECZA 1A0NB 1K0SA 2X3XD 1IO6A 2VWFA 5IHNA 2YT6A 2EVRA 2KROA 2D0NA 1AZGB 4F16A 2ESWA 1W6XA 3VS2A 2CT3A 1NEBA 2K79A 2MCNA 1W1FA 4OMOA 2K3BA 1UE9A 3EHRA 1M27C 3CQTA 2RQRA 1MV3A 2KYMA 4LUEA 3KFVA 1N5ZA 2DMOA 2CSIA 2SRCA 2JM8A 4E6RA 1FMKA 2C0TA 4RTWA 1PHTA 2JM9A 1Z9QA 2RQVA 2XMFA 1QWEA 2C0IA 3THKA 2A08A 3VS0A 1JXMA 4HCKA 2MIOA 2BZXA 4J9CA 5IHIA 2FPDA 1X43A 2GTJA 3I9QA 2SEMA 2J6KA 4ZNXA 2CUBA 2EKHA 4OMMA 1QKXA 2K6DA 5L23A 1GRIA 2DRKA 1JEGA 1YP5A 1AOJA 2RN8A 3UF4A 1QCFA 1SRLA 1UDLA 2EYYA 1QWFA 4HVVA 1YWOA 1YN8A 1B3QA 3PE0A 4DEXA 3A98A 3NPFA 4ORZA 2MOXA 2JS2A 3REBB 2G6FX 1KSWA 4LUDA 1UFFA 4A63B 3VS4A 2V1QA 2GGRA 1WX6A 2EGAA 2RQTA 1KIKA 1HD3A 2FO0A 2DL8A 2HCKA 2HDAA 1GL5A 2AZVA 2EYXA 1WXUA 2LJ3A 2O31A 1U06A 2DL7A 1UJYA 1NYFA 1GCQC 2YUPA 1I1JA 1JO8A 2ENMA 1S1NA 2DL3A 1ARKA 2LZ6B 3H0IA 1YNZA 1TUDA 3EG3A 3I5SA 1NLPC 2RF0A 3VRYA 1QKWA 5IH2A 2DM1A 1M8MA 1K0XA 3UA6A 4HVWA 1NLOC 4WCIA 1TUCA 1WA7A 1ZUUA 2ED1A 4J9EA 2DBKA 2PTKA 1GBQA 2DL4A 3EGUA 1K1ZA 2F2XA 2HBWA 2DJQA 2KE9A 4CC4B 4RTVA 1UECA 2YUOA 2I0NA 1AZEA 1SHGA 1MV0B 1U3OA 1Y57A 1FYNA 4GBQA 1K76A 2ED0A 2J06A 2KXDA 5IHKA 1NEGA 2A28A 5IXFA 4JJCA 1J3TA 4AFUC 2PNIA 4EIKA 4RUGA 3FJ5A 2DBMA 1T0HA 2GTOA 1GFDA 4FSSA 2K2MA 2AKKA 2LJ0A 2J6FA 2LMJA 2W10A 2DX1A 2YSQA 3M0QA 4F14A 2ABLA 1AWOA 1HJDA 1B07A 4QT7A 4CC7A 1SEMA 2L0AA 4Z89A 2YUNA 1BU1A 1T3LA 1WXTA 2W0ZA 2C0OA 2J05A 2DRMA 2KRSA 1HSQA 2KGTA 1X6GA 2RPNA 5FW9A 4Z88A 1SHFA 2KYBA 2GQIA 3VS5A 2DYBA 1BBZA 2KT1A 2DA9A 1AWWA 3QWXX 1U5SA 3JV3A 4GLMA 1WDXA 2LQNA 4OMLA 1WI7A 2F2VA 1ZLMA 2FPFA 1X2KA 1V1CA 2LX7A 1KJWA 1H92A 1Z9ZA 1AD5A 2DILA 1WLPB 4J9BA 1E6HA 1QLYA 3EG1A 3PVQA 2JS0A 4JZ3A 1X2QA 2KR3A 2O9SA 4RTYA 2JXBA 3RBBB 2L3QA 1RLPC 1OPLA 1PRMC 5I22A 1NM7A 1BB9A 2D1XA 2RQWA 3QWYA 1LCKA 1M30A 2K9GA 3PVLA 2EYWA 2LJ1A 4JPBW 4HXJA 1ABQA 1KFZA 1ZBJA 1CKBA 2BTTA 1Y0MA 3H41A 3GBQA 1WYXA 1AEYA 4AFSC 1G83A 2A37A 4CC2A 2O9VA 4F17A 2J6OA 3TSWA 3M0RA 1PWTA 3M0TA 5EC7A 4KRTA 2BZ8A 3VS7A 1RUWA 4R0KA 2JT4A 3NMZC 1I07A 2X3WD 4D8DA 5IXBA 3M0PA 3U23A 1GCQA 1PKSA 2DE0X 3NGPA 1XOVA 2CDTA 1X27A 2H8HA 1G2BA 2EPDA 4J9GA 1VYUA 4LE9A 3M0UA 1AWJA 1RLQC 3UA7A 1M3BA 1H3HA 1RI9A 4Z8AA 3VS6A 1E7OA 2VVKA 1AWXA 4AG2C 1UJ0A 1ZUYA 2CSQA 4J9FA 1JU5C 2JMCA 2OI3A 2D8JA 1GCPA 2AK5A 1VYVA 2LQWA 3H0FA 1TG0A 2IIMA 2YUQA 2LP5A 2JMAA 2KNBB 1UG1A 4M4ZA 5GJVB 1CSKA 3TSZA 2M51A 2ROLA 3SHWA 1BK2A 4J9DA 2AZSA 3RNJA 2JW4A 1YCSB 2KT8A 4RTXA 3VRZA 1WIEA 3LH5A 2E5KA 4J9HA 2KRMA 3C0CA 2JTEA 1NG2A 2O2OA 3NHNA 5FWCA 1VYTA 4OMNA 5FWBA 2O88A 2LCSA 2L3SA 1ZSGA 2CH4A 1OOTA 2K7AA 3R6NA 1VA7A 2RNAA 1EFNA 5HCKA 3TVTA 1ZX6A 4IIOA 1ABOA 4JZ4A 4X1VA 1CKAA 1UTIA 2EBPA 4AFZC 1M3CA 2OAWA 4JJDA 3EG2A 1UHCA 4RTUA 4ESRA 4RTZA 3ZL7C 4IIMA 2CUDA 3H0HA 4OMPA 4J9IA 2B86A 3VS1A 2FPEA 2L3PA 3EG0A 1GBRA 1AVZC 2KRNA 2RMOA 1M3AA 2V1RA 2FRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X69 A;  1YWP A;  1MUZ A;  2VKN A;  2FEI A;  4K11 A;  5I11 A;  2HSP A;  2CH4 W;  2FRW A;  4JJB A;  1JXO A;  2FG0 A;  2ROT A;  4D8K A;  1UGV A;  3ULR B;  2KXC A;  4DEY A;  1SRM A;  1K4U S;  3O5Z A;  4CC3 A;  2EW3 A;  2P4R A;  1H8K A;  2NWM A;  2EYZ A;  4Y92 A;  1T3S A;  1ZUK A;  2EGC A;  2EQI A;  5ECA A;  4LNP A;  1OEB A;  4HVU A;  1OPK A;  1PNJ A;  1PRL C;  1UUE A;  3UAT A;  1WXB A;  1GFC A;  2GBQ A;  2LNH B;  3M0S A;  2PZ1 A;  2CRE A;  3I5R A;  1OV3 A;  1JQQ A;  4OMQ A;  3REA B;  2YDL A;  2DVJ A;  3I35 A;  2F2W A;  2QDL A;  2J7I A;  2RQU A;  2D8H A;  4RTT A;  1T0J A;  1I0C A;  2DLP A;  1SSH A;  2DL5 A;  3SEM A;  2GNC A;  2KEA A;  1PKT A;  1X6B A;  5GJW B;  1W70 A;  1E6G A;  2A36 A;  2DNU A;  2KBT A;  2OJ2 A;  1NYG A;  2L2P A;  4AG1 C;  2AKL A;  1K9A A;  4LN2 A;  2M0Y A;  2NUZ A;  2EGE A;  2CT4 A;  1UHF A;  1WFW A;  2HEQ A;  3EHQ A;  2DF6 A;  3VS3 A;  3IQL A;  1SPK A;  4AFQ C;  2BZY A;  2ECZ A;  1A0N B;  1K0S A;  2X3X D;  1IO6 A;  2VWF A;  5IHN A;  2YT6 A;  2EVR A;  2KRO A;  2D0N A;  1AZG B;  4F16 A;  2ESW A;  1W6X A;  3VS2 A;  2CT3 A;  1NEB A;  2K79 A;  2MCN A;  1W1F A;  4OMO A;  2K3B A;  1UE9 A;  3EHR A;  1M27 C;  3CQT A;  2RQR A;  1MV3 A;  2KYM A;  4LUE A;  3KFV A;  1N5Z A;  2DMO A;  2CSI A;  2SRC A;  2JM8 A;  4E6R A;  1FMK A;  2C0T A;  4RTW A;  1PHT A;  2JM9 A;  1Z9Q A;  2RQV A;  2XMF A;  1QWE A;  2C0I A;  3THK A;  2A08 A;  3VS0 A;  1JXM A;  4HCK A;  2MIO A;  2BZX A;  4J9C A;  5IHI A;  2FPD A;  1X43 A;  2GTJ A;  3I9Q A;  2SEM A;  2J6K A;  4ZNX A;  2CUB A;  2EKH A;  4OMM A;  1QKX A;  2K6D A;  5L23 A;  1GRI A;  2DRK A;  1JEG A;  1YP5 A;  1AOJ A;  2RN8 A;  3UF4 A;  1QCF A;  1SRL A;  1UDL A;  2EYY A;  1QWF A;  4HVV A;  1YWO A;  1YN8 A;  1B3Q A;  3PE0 A;  4DEX A;  3A98 A;  3NPF A;  4ORZ A;  2MOX A;  2JS2 A;  3REB B;  2G6F X;  1KSW A;  4LUD A;  1UFF A;  4A63 B;  3VS4 A;  2V1Q A;  2GGR A;  1WX6 A;  2EGA A;  2RQT A;  1KIK A;  1HD3 A;  2FO0 A;  2DL8 A;  2HCK A;  2HDA A;  1GL5 A;  2AZV A;  2EYX A;  1WXU A;  2LJ3 A;  2O31 A;  1U06 A;  2DL7 A;  1UJY A;  1NYF A;  1GCQ C;  2YUP A;  1I1J A;  1JO8 A;  2ENM A;  1S1N A;  2DL3 A;  1ARK A;  2LZ6 B;  3H0I A;  1YNZ A;  1TUD A;  3EG3 A;  3I5S A;  1NLP C;  2RF0 A;  3VRY A;  1QKW A;  5IH2 A;  2DM1 A;  1M8M A;  1K0X A;  3UA6 A;  4HVW A;  1NLO C;  4WCI A;  1TUC A;  1WA7 A;  1ZUU A;  2ED1 A;  4J9E A;  2DBK A;  2PTK A;  1GBQ A;  2DL4 A;  3EGU A;  1K1Z A;  2F2X A;  2HBW A;  2DJQ A;  2KE9 A;  4CC4 B;  4RTV A;  1UEC A;  2YUO A;  2I0N A;  1AZE A;  1SHG A;  1MV0 B;  1U3O A;  1Y57 A;  1FYN A;  4GBQ A;  1K76 A;  2ED0 A;  2J06 A;  2KXD A;  5IHK A;  1NEG A;  2A28 A;  5IXF A;  4JJC A;  1J3T A;  4AFU C;  2PNI A;  4EIK A;  4RUG A;  3FJ5 A;  2DBM A;  1T0H A;  2GTO A;  1GFD A;  4FSS A;  2K2M A;  2AKK A;  2LJ0 A;  2J6F A;  2LMJ A;  2W10 A;  2DX1 A;  2YSQ A;  3M0Q A;  4F14 A;  2ABL A;  1AWO A;  1HJD A;  1B07 A;  4QT7 A;  4CC7 A;  1SEM A;  2L0A A;  4Z89 A;  2YUN A;  1BU1 A;  1T3L A;  1WXT A;  2W0Z A;  2C0O A;  2J05 A;  2DRM A;  2KRS A;  1HSQ A;  2KGT A;  1X6G A;  2RPN A;  5FW9 A;  4Z88 A;  1SHF A;  2KYB A;  2GQI A;  3VS5 A;  2DYB A;  1BBZ A;  2KT1 A;  2DA9 A;  1AWW A;  3QWX X;  1U5S A;  3JV3 A;  4GLM A;  1WDX A;  2LQN A;  4OML A;  1WI7 A;  2F2V A;  1ZLM A;  2FPF A;  1X2K A;  1V1C A;  2LX7 A;  1KJW A;  1H92 A;  1Z9Z A;  1AD5 A;  2DIL A;  1WLP B;  4J9B A;  1E6H A;  1QLY A;  3EG1 A;  3PVQ A;  2JS0 A;  4JZ3 A;  1X2Q A;  2KR3 A;  2O9S A;  4RTY A;  2JXB A;  3RBB B;  2L3Q A;  1RLP C;  1OPL A;  1PRM C;  5I22 A;  1NM7 A;  1BB9 A;  2D1X A;  2RQW A;  3QWY A;  1LCK A;  1M30 A;  2K9G A;  3PVL A;  2EYW A;  2LJ1 A;  4JPB W;  4HXJ A;  1ABQ A;  1KFZ A;  1ZBJ A;  1CKB A;  2BTT A;  1Y0M A;  3H41 A;  3GBQ A;  1WYX A;  1AEY A;  4AFS C;  1G83 A;  2A37 A;  4CC2 A;  2O9V A;  4F17 A;  2J6O A;  3TSW A;  3M0R A;  1PWT A;  3M0T A;  5EC7 A;  4KRT A;  2BZ8 A;  3VS7 A;  1RUW A;  4R0K A;  2JT4 A;  3NMZ C;  1I07 A;  2X3W D;  4D8D A;  5IXB A;  3M0P A;  3U23 A;  1GCQ A;  1PKS A;  2DE0 X;  3NGP A;  1XOV A;  2CDT A;  1X27 A;  2H8H A;  1G2B A;  2EPD A;  4J9G A;  1VYU A;  4LE9 A;  3M0U A;  1AWJ A;  1RLQ C;  3UA7 A;  1M3B A;  1H3H A;  1RI9 A;  4Z8A A;  3VS6 A;  1E7O A;  2VVK A;  1AWX A;  4AG2 C;  1UJ0 A;  1ZUY A;  2CSQ A;  4J9F A;  1JU5 C;  2JMC A;  2OI3 A;  2D8J A;  1GCP A;  2AK5 A;  1VYV A;  2LQW A;  3H0F A;  1TG0 A;  2IIM A;  2YUQ A;  2LP5 A;  2JMA A;  2KNB B;  1UG1 A;  4M4Z A;  5GJV B;  1CSK A;  3TSZ A;  2M51 A;  2ROL A;  3SHW A;  1BK2 A;  4J9D A;  2AZS A;  3RNJ A;  2JW4 A;  1YCS B;  2KT8 A;  4RTX A;  3VRZ A;  1WIE A;  3LH5 A;  2E5K A;  4J9H A;  2KRM A;  3C0C A;  2JTE A;  1NG2 A;  2O2O A;  3NHN A;  5FWC A;  1VYT A;  4OMN A;  5FWB A;  2O88 A;  2LCS A;  2L3S A;  1ZSG A;  2CH4 A;  1OOT A;  2K7A A;  3R6N A;  1VA7 A;  2RNA A;  1EFN A;  5HCK A;  3TVT A;  1ZX6 A;  4IIO A;  1ABO A;  4JZ4 A;  4X1V A;  1CKA A;  1UTI A;  2EBP A;  4AFZ C;  1M3C A;  2OAW A;  4JJD A;  3EG2 A;  1UHC A;  4RTU A;  4ESR A;  4RTZ A;  3ZL7 C;  4IIM A;  2CUD A;  3H0H A;  4OMP A;  4J9I A;  2B86 A;  3VS1 A;  2FPE A;  2L3P A;  3EG0 A;  1GBR A;  1AVZ C;  2KRN A;  2RMO A;  1M3A A;  2V1R A;  2FRY A; 
#chains in the Genus database with same CATH topology
 2E6N A;  1AT1 B;  2IPO B;  2VKN A;  4PJO C;  1WHL A;  3OA6 A;  3X25 B;  1IRX A;  2HSP A;  2MI6 A;  4FT4 A;  2FRW A;  4JRI A;  4JJB A;  2K5F A;  1JXO A;  2ZPI B;  2A7Y A;  2ZPG B;  2DTO A;  2VGN A;  4AT1 B;  2KXC A;  1TUG B;  4RMO A;  3NTH A;  1H8K A;  2NWM A;  2EYZ A;  4M77 G;  4OGC A;  4Y92 A;  3CCE A;  1YFN A;  2WSF E;  5GMK h;  5GAM d;  2EGC A;  5D6W A;  1OEB A;  1PRL C;  4ZN3 A;  1SG5 A;  2PUK B;  3M0S A;  2PZ1 A;  2VUB A;  4FW1 A;  4M75 F;  2E4H A;  1JQQ A;  3GP8 A;  4OGE A;  1B34 B;  2D8H A;  3JB9 F;  2FVU A;  4B6M A;  1I0C A;  4XTX A;  1SSH A;  3E2U A;  3PFS A;  2E64 A;  1PKT A;  3I56 Q;  1W70 A;  4VUB A;  2DTH A;  4II1 A;  2P0K A;  2RD1 A;  4AG1 C;  2AKL A;  1WPY A;  4M77 B;  2MF2 A;  3CCQ Q;  4M75 C;  2EAY A;  1WQW A;  2L3R A;  1TOV A;  3IQL A;  3L2Q A;  3ZFJ A;  1K0S A;  2X3X D;  4JLG A;  4J5Y A;  2VWF A;  2LCL A;  4MZM A;  1I5O B;  2D0N A;  3M56 A;  1AZG B;  2DYI A;  1QVP A;  3HSB A;  2ESW A;  1W6X A;  3JCM V;  2K5I A;  3X20 B;  1M90 U;  1XTD A;  1R0B G;  5IT9 E;  3O8V A;  3F70 A;  4OP0 A;  2DZ9 A;  3EG9 B;  1W1F A;  2K3B A;  2DJZ A;  2COW A;  4M77 E;  1M27 C;  1VQ4 Q;  3CCU T;  3HRU A;  1GXI E;  3P8H A;  1TTH B;  3NFC A;  4XTW A;  5CKD A;  1VQL Q;  3JCM f;  4RKU E;  2SRC A;  1KQ1 A;  2C0T A;  2D9T A;  4CRI A;  3JCM X;  2VV5 A;  1PHT A;  3KBG A;  5GAN 6;  1UB4 A;  1Z9Q A;  2C0I A;  4A4E A;  2A08 A;  4PKC C;  4KT0 E;  3VS0 A;  1JJ2 A;  2BZX A;  2E12 A;  3DLM A;  2FPD A;  2CYZ B;  2XID A;  1SF9 A;  2P0P A;  1QKX A;  2K6D A;  2O01 E;  2P0Q A;  3I55 Q;  2KMT A;  1FMW A;  2WSE E;  3OYL A;  1RAF B;  1SRL A;  1YIJ T;  1M1F A;  2CKK A;  9ATC B;  1D0Y A;  3M55 A;  1B3Q A;  4C0G A;  4Q5W A;  5GAN 4;  5KYY B;  3L2U A;  3G4S A;  2ZPF B;  2MOX A;  1PC0 A;  5DLO A;  4M7A G;  1VQO A;  3ASK A;  1VQ8 A;  3VS4 A;  2GGR A;  5GMK m;  1WX6 A;  2RQT A;  4WTO B;  1HD3 A;  4M78 G;  4PFP A;  2OTJ A;  3QO3 A;  4R55 A;  4QQ6 A;  4EMK B;  1S72 A;  1U06 A;  4O6J A;  4DBH A;  1GCQ C;  1I1J A;  3BFM A;  3LW5 E;  3S3N A;  2XHC A;  2BE9 B;  4ME7 A;  2JVV A;  1S1N A;  1PSF A;  1WZO A;  1YJ9 T;  3RKY A;  1M2V A;  1ACM B;  1YNZ A;  3PNW C;  3EG3 A;  1NLP C;  3JCM b;  3QZ5 B;  3CD6 T;  1QKW A;  3L42 A;  2DM1 A;  2ZZD A;  4J6X A;  6AT1 B;  3UA6 A;  3V8K A;  1KQS S;  3CC7 T;  5HK3 A;  2ED1 A;  4J9E A;  4E7K A;  2L5Q A;  1W4S A;  4XTV A;  4TVR A;  2PTK A;  4JS5 A;  4M77 F;  1XJW B;  4EPC A;  1WNL A;  1MV0 B;  3SD4 A;  1K73 C;  4HT8 A;  1Y57 A;  1BKB A;  1K9M U;  2E65 A;  3M58 A;  2ED0 A;  2J06 A;  1F1B B;  3FJP A;  1NEG A;  1TSF A;  1J3T A;  2HL3 A;  4ZTF A;  2CZ1 B;  1K73 R;  4C8Q D;  3M57 A;  3CC2 Q;  3NTI A;  2XDB A;  5CAI A;  4EIK A;  3EGD A;  2M9U A;  3OW2 S;  5GAO n;  2AKK A;  2LJ0 A;  2XD0 A;  2BKD N;  4F14 A;  2YSQ A;  4PLL A;  3OS5 A;  2ABL A;  1AWO A;  5GAO l;  3QSU A;  2X4X A;  1HJD A;  1B07 A;  1T3L A;  5GAN g;  3AT1 B;  2C0O A;  2HD0 A;  3CCE T;  2KGT A;  3A8G B;  5D6Y A;  1YHQ Q;  2LCC A;  4C5I A;  2GQI A;  1VQN Q;  1IZ6 A;  1N9S A;  2KT1 A;  4IUQ A;  1AWW A;  2XG8 D;  1U5S A;  4LDY A;  4X9D A;  1WDX A;  4C5E A;  5GAO r;  2F2V A;  5GAN e;  1TH7 A;  3FRN A;  2DIQ A;  1V1C A;  5FU6 B;  1R0C B;  4BE2 A;  3E9F A;  1WLP B;  3DLL A;  4MML A;  4M7D G;  4PJM A;  5GMK j;  1UEB A;  1YJW Q;  3HHT B;  4C92 G;  4JZ3 A;  3CME Q;  1N27 A;  3A8H B;  2KR3 A;  2O9S A;  1XNI A;  2DEQ A;  2L3Q A;  1OPL A;  3LYI A;  2D1X A;  2RQW A;  4NL3 A;  1M30 A;  3PVL A;  1IXD A;  3QDF A;  1LNX A;  1V29 B;  1RAD B;  1KFZ A;  1CKB A;  2NYS A;  3GBQ A;  3WVD B;  3CCS Q;  4AFS C;  1G83 A;  3OYE A;  4JRK A;  3CCM A;  2O9V A;  3JB9 H;  4FT2 A;  5J26 A;  5IN1 A;  4M7D B;  4KUI A;  3D7S B;  3URG A;  4Y28 E;  3TSW A;  3M0R A;  5CIU A;  4C92 B;  1VQ6 Q;  4IUP A;  3CCL A;  3UWN A;  3TCJ A;  2LNV A;  3V7S A;  3GIB A;  3EH2 A;  1N8R C;  3HFO A;  3CC4 Q;  3NMZ C;  2CP5 A;  1I07 A;  5IXB A;  3U23 A;  2K3X A;  1GCQ A;  4OB1 B;  4X34 A;  3VYG A;  1BIB A;  4OB2 B;  2H8H A;  2OTL Q;  4J7I A;  2EPD A;  1VYU A;  3SDZ A;  1N8R R;  4JS4 A;  1AWJ A;  1IGU A;  2KSS A;  3UA7 A;  3PGG A;  1M3B A;  2FZG B;  4E7Z A;  4R56 A;  3OS1 A;  3MEU A;  4PJO G;  4J6W A;  4OF1 A;  4JUV A;  5FU7 B;  1UG1 A;  3TQ7 P;  1TXQ A;  4M4Z A;  5GJV B;  1OX8 A;  2D6F A;  3G4S T;  1W2B P;  5AYF A;  4RTX A;  3VRZ A;  1Q81 R;  1VQ8 T;  3LH5 A;  3SB2 A;  1KC8 C;  2CP7 A;  4J9H A;  1OX9 A;  2KRM A;  5GAM e;  3JRZ A;  5FWB A;  2OTJ T;  2L89 A;  3M53 A;  2L3S A;  1S72 T;  4DOW A;  1KC8 R;  1VA7 A;  1M1K C;  2RNA A;  4PFO A;  1ZX6 A;  4PJO B;  2PVG B;  1CKA A;  4FW2 A;  2OAW A;  3EG2 A;  5KYU B;  1K8A U;  2NUP A;  1ZSZ C;  3ZL7 C;  4IIM A;  1M1K R;  2CUD A;  4J9I A;  3CCJ A;  1NJI C;  4LD9 K;  3A5Z B;  2XK0 A;  3HKS A;  1X6O A;  2CP2 A;  3AHU A;  2FPE A;  4IKF A;  4PL6 A;  3EG0 A;  3CXC S;  1Y71 A;  2V1R A;  2FRY A;  3SWN A;  1MUZ A;  4M75 G;  5FLX E;  1NJI R;  3VYH B;  5I11 A;  2B8A A;  4M7A D;  3JB9 G;  2YLB A;  4FYV B;  2RI2 A;  2QK0 A;  2X51 A;  4M78 D;  2FZK B;  4BE1 A;  4N0A C;  4ANJ A;  2E5Q A;  3ULR B;  4DEY A;  1Y96 B;  2EW3 A;  3UT1 A;  3OYD A;  3S3O A;  3EFO A;  1WQ7 A;  2F1L A;  3BDU A;  3CCU Q;  2EQI A;  5GAN 5;  4C92 F;  3EGD B;  2GBQ A;  3M4G A;  1JRI A;  4DA4 A;  4M75 B;  1Q86 C;  3I5R A;  2F2W A;  3QHS A;  3JAM E;  1YIJ A;  1QVG P;  4RTT A;  3OSS C;  4KH0 B;  4B9X A;  5CKF A;  2RHU A;  3PIO A;  2DXB A;  2DLP A;  1Q86 R;  2DL5 A;  3SEM A;  1OZ3 A;  1E6G A;  2QAS A;  2OJ2 A;  1QP3 A;  3OBW A;  2L2P A;  2DZC A;  4LN2 A;  2QG9 B;  2M0Y A;  2NUZ A;  3CCV A;  1NBE B;  2HEQ A;  3C94 A;  1HYO A;  2DF6 A;  1H3Z A;  3VS3 A;  2BZY A;  3JCM c;  2DXU A;  3E1S A;  5GAN h;  1IO6 A;  5IHN A;  2CS7 A;  2YT6 A;  2KRO A;  5KE2 A;  4F16 A;  3EFS A;  2FB7 A;  2K79 A;  3OYK A;  4BUG A;  1BI1 A;  1OQK A;  4OMO A;  1UE9 A;  1WHJ A;  1JJ2 P;  3CD6 A;  2RJC A;  4QVC A;  1MV3 A;  2KYM A;  1OZ2 A;  4ZTJ A;  1W2B A;  1YJ9 Q;  1FMK A;  3CCM T;  4PJO F;  2XMF A;  3THK A;  1LJO A;  5CKH A;  2OX7 A;  1I4K 1;  4HCK A;  5LJ3 d;  4A4G A;  3UPU A;  3OBY A;  1G3T A;  2NUT A;  4N4I A;  5IHI A;  8AT1 B;  3CCL T;  3RIR A;  3OYI A;  2SEM A;  4ZNX A;  2CGH A;  3CC7 Q;  3L2Z A;  1GRI A;  4M7D D;  1JEG A;  1C1A A;  4MMK A;  4C92 D;  2DER A;  3H9N A;  1OI1 A;  3RR6 A;  1D1B A;  1QWF A;  4HVV A;  1Q7Y C;  1YN8 A;  1OU9 A;  3LWI A;  3T9N A;  3G6E Q;  3PE0 A;  3MO8 A;  1ZSZ A;  4HT9 A;  3NPF A;  4PJL A;  3QYH B;  2JS2 A;  2G6F X;  1Q7Y R;  2V1Q A;  1Q95 G;  1KD1 C;  3X26 B;  2RO0 A;  4WF2 A;  2HCK A;  2HDA A;  1FXX A;  2AZV A;  2EYX A;  3ZBD A;  2VAS A;  4L5G A;  5I2S A;  2O4X B;  1KD1 R;  3DKM A;  2DEU A;  1TU0 B;  1D1A A;  1VQP A;  3FIF A;  1M1G A;  4N0A A;  3CCE Q;  2HQX A;  2K5L A;  5GAM h;  1RAH B;  2QGF B;  2MWO A;  3HTR A;  2YHT A;  1M5Q 1;  1NLO C;  4WCI A;  1PD1 A;  4PK4 A;  5LJ5 g;  2DBK A;  2DL4 A;  3A1P A;  3CCQ A;  2X35 A;  2H3E B;  5GAO q;  4RTV A;  1QVG A;  1X75 C;  1SHG A;  3QZ9 B;  2BE7 D;  1FYN A;  3CCJ T;  2KXD A;  2XDD A;  4J7F A;  5CR2 A;  4PJO D;  3L2R A;  2NUP B;  1M9S A;  2QXF A;  3HL8 A;  2YLC A;  2WSC E;  4HCB A;  2PNI A;  5LJ5 e;  3DB3 A;  3MET A;  1VQM Q;  1YJN A;  2GTO A;  3M54 A;  1QW1 A;  4HKE A;  1VQ4 A;  1HXD A;  2E10 A;  3WXM B;  2R57 A;  2J6F A;  2LMJ A;  2W10 A;  2DX1 A;  3M0Q A;  2M02 A;  1QVF S;  5GMK l;  4QT7 A;  2YWW A;  5LJ3 f;  2YUN A;  1VQ9 T;  1PG5 B;  1DJ7 B;  2X9H A;  2CZ6 B;  1NE8 A;  2DRM A;  2LRQ A;  3OS2 A;  2KRS A;  1HSQ A;  1X6G A;  5DY9 A;  5J39 A;  1N6A A;  2DYB A;  3EFO B;  2FZC B;  4FYY B;  5AT1 B;  4GLM A;  3C95 A;  5KCH A;  2MMP A;  1WI7 A;  4BDY A;  3OYF A;  3JCM P;  1ZLM A;  1EX4 A;  2RJF A;  3OYB A;  1Z9Z A;  3TEE A;  2DIL A;  4IUU A;  2DET A;  1D3B A;  1E6H A;  5GAO p;  2DK3 A;  4M75 D;  3EG1 A;  2DPP B;  1KHI A;  2AT1 B;  1PM3 A;  3JB9 D;  1M4Z A;  2JXB A;  1PRM C;  1VIF A;  3CCV T;  4E7J A;  4RG8 A;  3LLR A;  3QWY A;  2MK5 A;  1LCK A;  3UDC A;  5CKE A;  5D7U A;  4C8Q C;  2QGG A;  3QBY A;  3G4S Q;  2RA2 A;  3GPL A;  1M2O A;  2DXT A;  1VQO Q;  1AEY A;  3BE3 A;  1QP2 A;  4CC2 A;  4F17 A;  2E6Z A;  1O9S A;  2OTJ Q;  3L2W A;  1S72 Q;  1BYM A;  4A53 A;  3HFN A;  1TWB A;  2X3W D;  3RUX A;  5L8R E;  3M0P A;  2DE0 X;  3V8J A;  3NGP A;  4QW2 A;  2QEX Q;  4BB7 A;  1YIT T;  3OSV A;  2RK2 A;  2VXF A;  1VQ7 A;  1G2B A;  4J9G A;  4LE9 A;  4RG2 A;  4XU3 A;  3M0U A;  1RLQ C;  1EZZ B;  2DVE A;  1H3H A;  4Z8A A;  4E7I A;  4XU1 A;  5KYW B;  2AHJ B;  4J9F A;  1KQS P;  2D8J A;  2AK5 A;  3CC2 A;  4UC4 A;  3JSC A;  1VYV A;  4DQ2 A;  3CMA Q;  2LQ8 A;  5DM7 R;  2YUQ A;  1R8O B;  3M5A A;  3CCR A;  4XK8 E;  2V26 A;  2YXY A;  2KNB B;  2HL5 C;  1CSK A;  3TSZ A;  2ROL A;  5LJ3 j;  2AZS A;  1VIE A;  3EFR A;  1RAA B;  4EMG A;  3G71 A;  1WIE A;  2E5K A;  2VB6 A;  3C0C A;  1YI2 Q;  2O2O A;  1VYT A;  2O88 A;  1VQ5 A;  3MEV A;  3OW2 P;  4BDZ A;  3SWN C;  2K7A A;  1MMG A;  1EFN A;  1VQP T;  5GAN 3;  1ABO A;  4JZ4 A;  4X1V A;  2NLU A;  3QPH A;  4AFZ C;  3MEW A;  3GNF B;  4RTU A;  2RHY A;  4LDV A;  5FRO A;  4OMP A;  2LC4 A;  1MGQ A;  2IVW A;  2D0Q B;  2PVO B;  3I56 T;  1OUL A;  3QXE B;  1GBR A;  3LX7 A;  2RMO A;  4RCB A;  1M3A A;  4Z02 A;  2MWP A;  3CCQ T;  4BE0 A;  1Y07 A;  5J3B A;  4BY6 C;  3V7C A;  3GLX A;  2DD4 A;  2FEI A;  3MP8 A;  2R58 A;  1Q82 C;  4JRQ A;  1NPR A;  2KK4 A;  4IUV A;  4KGZ B;  4M77 D;  4V2S A;  1P92 A;  2F5K A;  2QI2 A;  3JCM g;  1SRM A;  2H3J A;  1Q82 R;  5GAO m;  1BIA A;  1UGQ B;  4FL6 A;  2P4R A;  1T3S A;  1YJN T;  5ECA A;  4BI8 B;  5LJ5 h;  1VQ4 T;  1VQ6 A;  2VXE A;  4HVU A;  5HK0 A;  1OPK A;  1EIF A;  1WXB A;  3UAT A;  4ELY C;  3JCM W;  3QG1 A;  1VQL T;  3CPW S;  2LNH B;  1WHH A;  4C8Q A;  2CRE A;  3JCM e;  1OV3 A;  3CCM Q;  3EGX A;  2KVQ G;  4MDX A;  2JJ9 A;  3PMT A;  2RI3 A;  3I35 A;  2RQU A;  1BI3 A;  4BAC A;  2OTL A;  1T0J A;  3CCL Q;  3OYJ A;  2BUD A;  4MZP A;  3FB9 A;  4HA8 A;  2FYK A;  2RJE A;  1WHK A;  2GNC A;  2KEA A;  1X6B A;  4KGX B;  2A36 A;  2KBT A;  2HQH A;  5KCO A;  1K9A A;  3FC3 A;  4N4H A;  4XTU A;  3I55 T;  5GAM g;  2CT4 A;  3RMQ A;  1SPK A;  2OAU A;  2ECZ A;  1Q81 C;  1A0N B;  2K4Y A;  4OMF B;  2EVR A;  5KYN A;  3LGL A;  4M7A C;  2BIV A;  1KQS A;  2E70 A;  1NEB A;  3INZ A;  2FHD A;  1FWZ A;  4M78 C;  1KQ2 A;  2PVD B;  3JB9 J;  2RHZ A;  3L1A A;  3QJ6 A;  3G7Z A;  5GAN 8;  3QDR B;  4LUE A;  1RAI B;  2QAZ A;  3KFV A;  4X9C A;  4BD3 A;  4ZN1 A;  2DMO A;  1B34 A;  2MPX C;  4JLI A;  4PJN A;  4OB0 B;  2JM8 A;  4ZGD B;  1IRE B;  3A8M B;  2JM9 A;  1X01 A;  2RQV A;  1QWE A;  4XTZ A;  1JXM A;  1M90 C;  1YBY A;  3OW2 A;  1M2V B;  2GTJ A;  2QA4 A;  3JCM J;  2CUB A;  5A0L A;  5HKC A;  4IUR A;  1M90 R;  1YP5 A;  3S6W A;  2RN8 A;  3UF4 A;  1QCF A;  2QQ9 A;  1UDL A;  2EJF A;  3VUB A;  1VQ7 T;  2FL7 A;  1YWO A;  3MHX A;  3CCJ Q;  1WGS A;  2HAX A;  1ZQ1 A;  2LTO A;  3A98 A;  1XQH A;  2DO3 A;  2K3Y A;  3EG9 A;  1KSW A;  4LUD A;  4A63 B;  1VQ9 A;  3CEY A;  3X28 B;  5GAN 2;  4QQD A;  3CC2 T;  3CXC P;  1KIK A;  5CQX A;  2CZ7 B;  3CCR T;  5CKB A;  3FDR A;  4BI3 A;  2O31 A;  2DTI A;  2DL7 A;  1UJY A;  1NYF A;  2YUP A;  5FRN A;  5KE3 A;  1JO8 A;  3RMS A;  2RK1 A;  2KQW A;  3G71 T;  1K73 U;  2ATC B;  3CBP A;  2DL3 A;  1ARK A;  2LZ6 B;  4LDU A;  4ZGJ B;  5EG2 A;  1TUD A;  3I5S A;  3OYG A;  5HY6 A;  1VQ5 T;  1BCM A;  5IH2 A;  4DBR A;  1QCO A;  4GLK A;  1VQK A;  1D0Z A;  1M8M A;  1N9R A;  1K0X A;  2HKQ B;  4MDW A;  2ZGW A;  1TUC A;  1ZUU A;  3VV0 A;  2F2X A;  3MEA A;  4D6W A;  4CC4 B;  1YIJ Q;  2I0N A;  5CO7 A;  1AZE A;  1U3O A;  4F04 B;  2LDM A;  1G3S A;  4A4H A;  3OS0 A;  1C0M A;  5IHK A;  2A28 A;  4KGV B;  2LT1 A;  4RUG A;  4EMK A;  3FJ5 A;  2DBM A;  1T0H A;  2DIG A;  2JNG A;  2GFU A;  1GFD A;  1SSF A;  3OYH A;  1D0X A;  3VKI A;  3LH0 A;  4CC7 A;  3CCS T;  4Z89 A;  1K9M C;  1G8X A;  1OYX A;  3RER A;  1WJR A;  1WJQ A;  2W0Z A;  5A0D A;  4M7A A;  1YIT A;  2GFA A;  2RPN A;  5FW9 A;  4Z88 A;  1SHF A;  3CD6 Q;  3CBO A;  1VQ6 T;  3VS5 A;  2R5M A;  1K9M R;  1ZHI A;  2I2L A;  2PQW A;  1FX7 A;  1BBZ A;  4M78 A;  1UGR B;  1WHM A;  4QQG A;  3QWX X;  4C0D C;  2MAM A;  3JV3 A;  2LQN A;  3M9Q A;  4E7H A;  2FPF A;  3FEO A;  2V8J A;  2RB6 A;  4OB3 B;  3H6Z A;  1H92 A;  3JCM h;  2GCX A;  2OTL T;  1AD5 A;  1D1C A;  3EGX B;  5KYX A;  5GMK i;  3VJP A;  4QVZ A;  2JS0 A;  1X2Q A;  2HZY A;  4RTY A;  1BB9 A;  5LL6 S;  1N8R U;  2LJ1 A;  4C8Q E;  3OYC A;  4HCC A;  2CP0 A;  1Y0M A;  1WYX A;  2RH2 A;  3CXC A;  2JTF A;  2RI5 A;  1RI0 A;  4GY5 A;  3JB9 I;  3MCA B;  1RAB B;  2RM4 A;  3RDV A;  2YRV A;  1IHV A;  5EC7 A;  4KRT A;  2BZ8 A;  2COZ A;  3I56 A;  4R0K A;  2JT4 A;  5GAN f;  1VQP Q;  1U1S A;  1Q81 U;  4D8D A;  2VGM A;  1M8V A;  4LD6 A;  3P8D A;  1MMD A;  2PUO B;  4LDW A;  1X27 A;  2V8K A;  2E3H A;  5IAY A;  4C0Z A;  1TS9 A;  2QA4 T;  1KC8 U;  4AG2 C;  3PIP A;  1E7O A;  1AWX A;  1ZUY A;  4AMC A;  3PT9 A;  4QVD A;  3PMI A;  4KUL A;  2JMC A;  2OI3 A;  4L59 A;  1GCP A;  2LQW A;  2R5A A;  1TG0 A;  2IIM A;  5GAN 7;  4LDX A;  1VQM A;  2V8I A;  1M1K U;  2EQK A;  4F7U A;  2JMA A;  3SWN B;  5CQY A;  2M51 A;  3SHW A;  3RKX A;  2KI7 A;  4O5V A;  1VQL A;  4M7D A;  3RNJ A;  2JW4 A;  1KHC A;  5M9O A;  3EH1 A;  2KT8 A;  4C92 A;  1I5L A;  3OYM A;  3VUZ A;  3A8L B;  1NJI U;  1NG2 A;  2EQJ A;  1YJN Q;  1AHJ B;  3OYN A;  1I81 A;  4LXC A;  4JDS A;  1ZSG A;  4FSX A;  4PJJ A;  3BDL A;  1MHN A;  2CH4 A;  3MP1 A;  1OOT A;  4FU6 A;  1JBM A;  1QVF P;  3TVT A;  4BY6 B;  3I55 A;  1KG1 A;  3HP9 A;  1UTI A;  1KK7 A;  3OB9 A;  4A54 A;  3C12 A;  1UHC A;  1QCN A;  4RTZ A;  4IUT A;  4QKU A;  4C8Q F;  3BY7 A;  3H0H A;  2B86 A;  3VS1 A;  1VQK T;  1NPP A;  2L3P A;  2EQU A;  4NOY A;  2KRN A;  2E3I A;  3GNG A;  1X69 A;  1YWP A;  4K11 A;  3L2V A;  5C6S A;  2CH4 W;  1Q86 U;  2Y4X A;  2IG0 A;  4C0F A;  4FYX B;  2FG0 A;  2ROT A;  4D8K A;  1K8A C;  1UGV A;  1PD0 A;  3RKW A;  2QTX A;  3O5Z A;  5GAM f;  1VQ8 Q;  2YRC A;  3GOX A;  1K4U S;  2Y90 A;  3J7A F;  4CC3 A;  3E9G A;  2F5T X;  3C4S A;  1ZUK A;  1K8A R;  4LNP A;  1UUE A;  1PNJ A;  4BI4 A;  3X24 B;  4PJO A;  3Q1J A;  1GFC A;  5GAN j;  2HKN A;  5KYU A;  4N4G A;  3FLG A;  2E41 A;  3QYG B;  4OMQ A;  3REA B;  2YDL A;  2DVJ A;  3QJY A;  4MZT A;  4KH1 B;  2QDL A;  2QEX A;  2J7I A;  4RCC A;  2F69 A;  4B9W A;  1V76 A;  1IHW A;  4J6Y A;  1VUB A;  1YCY A;  4M7A B;  3QUI A;  3V8L A;  5GJW B;  2DNU A;  2GF7 A;  1NYG A;  2QTV A;  2NUT B;  2EIF A;  4M78 B;  1RAE B;  2G3R A;  2QQR A;  2EGE A;  1UHF A;  1WFW A;  3EHQ A;  3CMA A;  2COY A;  1VQ7 Q;  1MMA A;  4AFQ C;  4E7S A;  2XU8 A;  2DD5 A;  4EDU A;  1Y96 A;  4XAX B;  4HCZ A;  2JN0 A;  3G6E T;  2L8D A;  2Y4Y A;  3VS2 A;  2CT3 A;  4M7A E;  3S3M A;  5KYX B;  3OMC A;  2MCN A;  1R77 A;  1HK9 A;  4M77 C;  3MPU B;  1ZSZ B;  1MMN A;  3CCR Q;  2QQB A;  1YI2 A;  3EHR A;  3HPW A;  4M78 E;  1YHQ A;  4M75 A;  3CQT A;  2RQR A;  1VQN A;  2ZPE B;  1N5Z A;  2CSI A;  3G71 Q;  2Z0W A;  1G5V A;  1Q7Y U;  3M4Y A;  4E6R A;  5FRM A;  2LVM A;  4RTW A;  1ZA1 B;  4KBM B;  2EFI A;  3P8B B;  3G1J A;  3QKJ A;  2MIO A;  1VQ5 Q;  4FYW B;  4Y91 A;  4J9C A;  1X43 A;  3I9Q A;  2J6K A;  1YJW A;  1KD1 U;  3NTK A;  2EKH A;  4OMM A;  1QVF A;  1UGP B;  2DXC A;  2CP3 A;  3CME A;  5L23 A;  2QYZ A;  3OYA A;  2DRK A;  1ZBX A;  1AOJ A;  4PLI A;  4F7U G;  2EYY A;  4DOV A;  3KUF A;  1Y7X A;  5D6X A;  3TRE A;  4C5H A;  4DEX A;  5CCA A;  3HRT A;  2QQS A;  2RHI A;  3CBM A;  5GAM j;  3H8Z A;  4ATO A;  4ORZ A;  3REB B;  2RJD A;  3JCM Q;  2E1H A;  3CCS A;  1UFF A;  1NZ9 A;  1BCO A;  5LJ3 g;  5C0M A;  2EGA A;  2RHX A;  4EMH A;  1VOM A;  2XKO C;  2FO0 A;  5LJ5 d;  2DL8 A;  3LWH A;  1GL5 A;  2CP6 A;  2QQA A;  1VQM T;  1WXU A;  2XIC A;  2LJ3 A;  1WJS A;  4OVA A;  1PSE A;  2P84 A;  2ENM A;  4YTL A;  4F7U B;  3CC4 A;  2X4Y A;  5LJ3 e;  3H0I A;  4XU0 A;  4FM4 B;  2RF0 A;  4ELZ C;  2DKG A;  5I21 A;  3VRY A;  2DFU A;  1G3W A;  1OU8 A;  5CVI A;  4M7A F;  4HVW A;  4EMK C;  4NL2 A;  2X4J A;  3WVE B;  1WA7 A;  3CPW P;  2VYT A;  1GBQ A;  3EGU A;  2JOY A;  1K1Z A;  2HBW A;  4M78 F;  2DJQ A;  2KE9 A;  1RAG B;  1UEC A;  4F7U E;  2YUO A;  3SFM A;  3RES A;  1G3Y A;  4GBQ A;  2M16 A;  1K76 A;  4M7D E;  1W2B S;  4JJN K;  2MYS A;  4C92 E;  4P5N A;  5IXF A;  1D3B B;  4JJC A;  4AFU C;  2EJ9 A;  4PNO A;  5GMK e;  2ZPH B;  8ATC B;  2O4X A;  2ZCF B;  4A4F A;  4FSS A;  2K2M A;  2M0O A;  4NS5 A;  4C0D B;  1IGQ A;  4C5G A;  4XQ3 A;  3HRS A;  1VQO T;  3VU3 C;  1SEM A;  2L0A A;  1BU1 A;  1WXT A;  2KY9 A;  2J05 A;  3J81 E;  3KXT A;  2LQK A;  2EKO A;  2VC8 A;  2XI9 A;  3J80 E;  2KYB A;  4CI0 C;  1B7T A;  4J83 A;  4M77 A;  2EQM A;  4L6V 5;  2DA9 A;  3MP6 A;  3CPF A;  5KH6 A;  4OML A;  1X2K A;  2QEX T;  2LX7 A;  1KJW A;  2A0F B;  4J9B A;  3OYY A;  2X4W A;  2K2V A;  2QA4 Q;  1QLY A;  2JTM A;  4FIB A;  3PVQ A;  4J8O A;  2DAQ A;  3N5B B;  1LOJ A;  5CK9 A;  1WHG A;  1IB8 A;  2P4T A;  5LJ5 f;  4ZGE B;  3R6O A;  2K57 A;  3RBB B;  1RLP C;  5I22 A;  1NM7 A;  5A0G A;  3CMA T;  2K9G A;  3MKD A;  4PJO E;  2EYW A;  5FU6 C;  3CCU A;  1UGS B;  4JPB W;  5I2M A;  4HXJ A;  1ABQ A;  3BW1 A;  1ZBJ A;  2HBP A;  2BTT A;  3H41 A;  1RAC B;  3ER0 A;  3M59 A;  1VQ9 Q;  1D09 B;  2A37 A;  4F7U F;  1QVG S;  4XTY A;  2QDY B;  3LGF A;  1ZA2 B;  1YI2 T;  4FCY A;  2J6O A;  4M7D F;  1YHQ T;  1PWT A;  3V7R A;  2JUF A;  3M0T A;  1VQN T;  1PCX A;  3VS7 A;  1RUW A;  2KAF A;  4KUD K;  1RL2 A;  3QII A;  2KDS A;  1JB0 E;  1PKS A;  4DBQ A;  2HQE A;  1XOV A;  2CDT A;  5GAN d;  5KYY A;  2LT4 A;  4M7D C;  2M1H A;  5A2Q E;  2GQV A;  2A3L A;  4C92 C;  4A4K A;  1VQK Q;  2CZ0 B;  1YJW T;  1RI9 A;  3VS6 A;  2VVK A;  3ZEH A;  1UJ0 A;  1MND A;  2CSQ A;  2AIR B;  3CPW A;  3DB4 A;  2JZ2 A;  3GF5 A;  2HSE B;  3CME T;  1JU5 C;  3CCV Q;  2C06 A;  1BI2 A;  3H0F A;  1C6V X;  2EYQ A;  4M75 E;  1JJ2 S;  2LP5 A;  1QQJ A;  3EAE A;  2LX9 A;  4C8Q G;  3PTA A;  2PU9 B;  1BK2 A;  4J9D A;  3OQ5 A;  1I8F A;  4E7L A;  1YCS B;  1YJ9 A;  1LPL A;  1SKU B;  2JTE A;  5DLQ E;  3NHN A;  5FWC A;  2WAC A;  4OMN A;  3MJX A;  1H64 1;  1U1T A;  3TU4 K;  2LCS A;  5FU7 C;  2EJG A;  3A8O B;  2YRD A;  2XDP A;  1LVK A;  2ZAE A;  3ME9 A;  3R6N A;  4E2F B;  3CC7 A;  5HCK A;  3CC4 T;  4IIO A;  1Q82 U;  3JCM d;  1FMV A;  2EBP A;  1YIT Q;  3OMG A;  1BI0 A;  1M3C A;  4JJD A;  1QMC A;  4C8Q B;  4ESR A;  5KYW A;  2HMA A;  2ZPB B;  5LJ3 h;  4DBF A;  1O75 A;  3G6E A;  3OY9 A;  4E47 A;  2EWN A;  7AT1 B;  5LJ5 j;  2HNI A;  4JRP A;  1U8R A;  1MNE A;  1AVZ C;  4XU2 A;  3E19 A;  4PFZ A; 
#chains in the Genus database with same CATH homology
 1X69 A;  1YWP A;  1MUZ A;  2VKN A;  2FEI A;  4K11 A;  5I11 A;  2HSP A;  2CH4 W;  2FRW A;  4JJB A;  1JXO A;  2FG0 A;  2ROT A;  4D8K A;  1UGV A;  3ULR B;  2KXC A;  4DEY A;  1SRM A;  1K4U S;  3O5Z A;  4CC3 A;  2EW3 A;  2P4R A;  1H8K A;  2NWM A;  2EYZ A;  4Y92 A;  1T3S A;  1ZUK A;  2EGC A;  2EQI A;  5ECA A;  4LNP A;  1OEB A;  4HVU A;  1OPK A;  1PNJ A;  1PRL C;  1UUE A;  3UAT A;  1WXB A;  1GFC A;  2GBQ A;  2LNH B;  3M0S A;  2PZ1 A;  2CRE A;  3I5R A;  1OV3 A;  1JQQ A;  4OMQ A;  3REA B;  2YDL A;  2DVJ A;  3I35 A;  2F2W A;  2QDL A;  2J7I A;  2RQU A;  2D8H A;  4RTT A;  1T0J A;  1I0C A;  2DLP A;  1SSH A;  2DL5 A;  3SEM A;  2GNC A;  2KEA A;  1PKT A;  1X6B A;  5GJW B;  1W70 A;  1E6G A;  2A36 A;  2DNU A;  2KBT A;  2OJ2 A;  1NYG A;  2L2P A;  4AG1 C;  2AKL A;  1K9A A;  4LN2 A;  2M0Y A;  2NUZ A;  2EGE A;  2CT4 A;  1UHF A;  1WFW A;  2HEQ A;  3EHQ A;  2DF6 A;  3VS3 A;  3IQL A;  1SPK A;  4AFQ C;  2BZY A;  2ECZ A;  1A0N B;  1K0S A;  2X3X D;  1IO6 A;  2VWF A;  5IHN A;  2YT6 A;  2EVR A;  2KRO A;  2D0N A;  1AZG B;  4F16 A;  2ESW A;  1W6X A;  3VS2 A;  2CT3 A;  1NEB A;  2K79 A;  2MCN A;  1W1F A;  4OMO A;  2K3B A;  1UE9 A;  3EHR A;  1M27 C;  3CQT A;  2RQR A;  1MV3 A;  2KYM A;  4LUE A;  3KFV A;  1N5Z A;  2DMO A;  2CSI A;  2SRC A;  2JM8 A;  4E6R A;  1FMK A;  2C0T A;  4RTW A;  1PHT A;  2JM9 A;  1Z9Q A;  2RQV A;  2XMF A;  1QWE A;  2C0I A;  3THK A;  2A08 A;  3VS0 A;  1JXM A;  4HCK A;  2MIO A;  2BZX A;  4J9C A;  5IHI A;  2FPD A;  1X43 A;  2GTJ A;  3I9Q A;  2SEM A;  2J6K A;  4ZNX A;  2CUB A;  2EKH A;  4OMM A;  1QKX A;  2K6D A;  5L23 A;  1GRI A;  2DRK A;  1JEG A;  1YP5 A;  1AOJ A;  2RN8 A;  3UF4 A;  1QCF A;  1SRL A;  1UDL A;  2EYY A;  1QWF A;  4HVV A;  1YWO A;  1YN8 A;  1B3Q A;  3PE0 A;  4DEX A;  3A98 A;  3NPF A;  4ORZ A;  2MOX A;  2JS2 A;  3REB B;  2G6F X;  1KSW A;  4LUD A;  1UFF A;  4A63 B;  3VS4 A;  2V1Q A;  2GGR A;  1WX6 A;  2EGA A;  2RQT A;  1KIK A;  1HD3 A;  2FO0 A;  2DL8 A;  2HCK A;  2HDA A;  1GL5 A;  2AZV A;  2EYX A;  1WXU A;  2LJ3 A;  2O31 A;  1U06 A;  2DL7 A;  1UJY A;  1NYF A;  1GCQ C;  2YUP A;  1I1J A;  1JO8 A;  2ENM A;  1S1N A;  2DL3 A;  1ARK A;  2LZ6 B;  3H0I A;  1YNZ A;  1TUD A;  3EG3 A;  3I5S A;  1NLP C;  2RF0 A;  3VRY A;  1QKW A;  5IH2 A;  2DM1 A;  1M8M A;  1K0X A;  3UA6 A;  4HVW A;  1NLO C;  4WCI A;  1TUC A;  1WA7 A;  1ZUU A;  2ED1 A;  4J9E A;  2DBK A;  2PTK A;  1GBQ A;  2DL4 A;  3EGU A;  1K1Z A;  2F2X A;  2HBW A;  2DJQ A;  2KE9 A;  4CC4 B;  4RTV A;  1UEC A;  2YUO A;  2I0N A;  1AZE A;  1SHG A;  1MV0 B;  1U3O A;  1Y57 A;  1FYN A;  4GBQ A;  1K76 A;  2ED0 A;  2J06 A;  2KXD A;  5IHK A;  1NEG A;  2A28 A;  5IXF A;  4JJC A;  1J3T A;  4AFU C;  2PNI A;  4EIK A;  4RUG A;  3FJ5 A;  2DBM A;  1T0H A;  2GTO A;  1GFD A;  4FSS A;  2K2M A;  2AKK A;  2LJ0 A;  2J6F A;  2LMJ A;  2W10 A;  2DX1 A;  2YSQ A;  3M0Q A;  4F14 A;  2ABL A;  1AWO A;  1HJD A;  1B07 A;  4QT7 A;  4CC7 A;  1SEM A;  2L0A A;  4Z89 A;  2YUN A;  1BU1 A;  1T3L A;  1WXT A;  2W0Z A;  2C0O A;  2J05 A;  2DRM A;  2KRS A;  1HSQ A;  2KGT A;  1X6G A;  2RPN A;  5FW9 A;  4Z88 A;  1SHF A;  2KYB A;  2GQI A;  3VS5 A;  2DYB A;  1BBZ A;  2KT1 A;  2DA9 A;  1AWW A;  3QWX X;  1U5S A;  3JV3 A;  4GLM A;  1WDX A;  2LQN A;  4OML A;  1WI7 A;  2F2V A;  1ZLM A;  2FPF A;  1X2K A;  1V1C A;  2LX7 A;  1KJW A;  1H92 A;  1Z9Z A;  1AD5 A;  2DIL A;  1WLP B;  4J9B A;  1E6H A;  1QLY A;  3EG1 A;  3PVQ A;  2JS0 A;  4JZ3 A;  1X2Q A;  2KR3 A;  2O9S A;  4RTY A;  2JXB A;  3RBB B;  2L3Q A;  1RLP C;  1OPL A;  1PRM C;  5I22 A;  1NM7 A;  1BB9 A;  2D1X A;  2RQW A;  3QWY A;  1LCK A;  1M30 A;  2K9G A;  3PVL A;  2EYW A;  2LJ1 A;  4JPB W;  4HXJ A;  1ABQ A;  1KFZ A;  1ZBJ A;  1CKB A;  2BTT A;  1Y0M A;  3H41 A;  3GBQ A;  1WYX A;  1AEY A;  4AFS C;  1G83 A;  2A37 A;  4CC2 A;  2O9V A;  4F17 A;  2J6O A;  3TSW A;  3M0R A;  1PWT A;  3M0T A;  5EC7 A;  4KRT A;  2BZ8 A;  3VS7 A;  1RUW A;  4R0K A;  2JT4 A;  3NMZ C;  1I07 A;  2X3W D;  4D8D A;  5IXB A;  3M0P A;  3U23 A;  1GCQ A;  1PKS A;  2DE0 X;  3NGP A;  1XOV A;  2CDT A;  1X27 A;  2H8H A;  1G2B A;  2EPD A;  4J9G A;  1VYU A;  4LE9 A;  3M0U A;  1AWJ A;  1RLQ C;  3UA7 A;  1M3B A;  1H3H A;  1RI9 A;  4Z8A A;  3VS6 A;  1E7O A;  2VVK A;  1AWX A;  4AG2 C;  1UJ0 A;  1ZUY A;  2CSQ A;  4J9F A;  1JU5 C;  2JMC A;  2OI3 A;  2D8J A;  1GCP A;  2AK5 A;  1VYV A;  2LQW A;  3H0F A;  1TG0 A;  2IIM A;  2YUQ A;  2LP5 A;  2JMA A;  2KNB B;  1UG1 A;  4M4Z A;  5GJV B;  1CSK A;  3TSZ A;  2M51 A;  2ROL A;  3SHW A;  1BK2 A;  4J9D A;  2AZS A;  3RNJ A;  2JW4 A;  1YCS B;  2KT8 A;  4RTX A;  3VRZ A;  1WIE A;  3LH5 A;  2E5K A;  4J9H A;  2KRM A;  3C0C A;  2JTE A;  1NG2 A;  2O2O A;  3NHN A;  5FWC A;  1VYT A;  4OMN A;  5FWB A;  2O88 A;  2LCS A;  2L3S A;  1ZSG A;  2CH4 A;  1OOT A;  2K7A A;  3R6N A;  1VA7 A;  2RNA A;  1EFN A;  5HCK A;  3TVT A;  1ZX6 A;  4IIO A;  1ABO A;  4JZ4 A;  4X1V A;  1CKA A;  1UTI A;  2EBP A;  4AFZ C;  1M3C A;  2OAW A;  4JJD A;  3EG2 A;  1UHC A;  4RTU A;  4ESR A;  4RTZ A;  3ZL7 C;  4IIM A;  2CUD A;  3H0H A;  4OMP A;  4J9I A;  2B86 A;  3VS1 A;  2FPE A;  2L3P A;  3EG0 A;  1GBR A;  1AVZ C;  2KRN A;  2RMO A;  1M3A A;  2V1R A;  2FRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...