2KROA

Rdc refined high resolution structure of the third sh3 domain of cd2ap
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
GAMGAKEYCRTLFPYTGTNEDELTFREGEIIHLISKETGEAGWWKGELNGKEGVFPDNFAVQIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure, Dynamics and Thermodynamics of the three SH3 domains of CD2AP
rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords CD2-associated protein
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kroA00
3NPFA 3I5SA 1X2KA 4JZ3A 2X3XD 1PNJA 2O2OA 3EG0A 5IHIA 1M30A 2K2MA 2YUNA 2GQIA 4OMPA 2DILA 3H0IA 2OAWA 3EHRA 1E6HA 3VS7A 4KRTA 4OMMA 3U23A 3M0TA 4RTUA 1SHGA 2AKLA 1YWOA 2G6FX 1KJWA 4ZNXA 1ZUKA 2CREA 1IO6A 2DL8A 1AWWA 3VS2A 2KEAA 2L2PA 2K7AA 2LZ6B 1NYFA 1X27A 4J9FA 2IIMA 2D8JA 4RTXA 3M0UA 4EIKA 2KYBA 2RF0A 3VS6A 1N5ZA 1UTIA 4ESRA 1KIKA 2V1RA 4J9IA 1PWTA 1U3OA 4LE9A 1OPLA 4IIMA 3M0PA 2EYZA 2KXCA 1PHTA 5IH2A 1BK2A 4J9CA 3RBBB 4F14A 1K76A 2JS0A 1JXOA 1X43A 4LN2A 1WIEA 3EG3A 2EYXA 2FRYA 2ROLA 2EBPA 1QCFA 1W6XA 2DRKA 1SRMA 2D1XA 1I1JA 2JMCA 2CUDA 3H41A 2E5KA 1BB9A 4J9EA 3IQLA 4CC7A 1AWJA 1EFNA 2JT4A 3M0RA 2YUQA 2HBWA 1VYUA 4E6RA 2LNHB 2CDTA 2EW3A 2A28A 5IHNA 4AFUC 5L23A 1WDXA 1JXMA 2KRMA 3UA7A 1G83A 2MCNA 1ABOA 2ABLA 1UG1A 2L3PA 2O31A 3PE0A 4JJDA 3PVQA 2VWFA 2VVKA 2BTTA 1J3TA 3M0QA 1A0NB 3I9QA 2SEMA 2BZXA 1YWPA 2MOXA 2FPEA 3THKA 4X1VA 2OJ2A 1JO8A 5IXBA 5IXFA 1NLOC 2C0TA 2PTKA 2M51A 2RQVA 2LMJA 3TVTA 1QKWA 2GGRA 4RTZA 2JM9A 3LH5A 2JXBA 2A36A 2CH4W 4GBQA 4AFSC 1GFDA 3UATA 1WXUA 1I0CA 1X6GA 1BU1A 2H8HA 3R6NA 2C0OA 2RQRA 2EGEA 5GJVB 3REAB 2ROTA 5FW9A 2FEIA 4JJCA 1CKAA 1U06A 2LCSA 1AZGB 1YN8A 1YNZA 1ZUYA 1UJYA 5FWCA 2EKHA 2O9SA 2V1QA 4LUDA 2CSQA 2ED1A 4AFZC 2CUBA 2DLPA 2X3WD 3RNJA 4HXJA 1ABQA 4M4ZA 2EVRA 1PRLC 2F2WA 2A08A 2LJ3A 1UHCA 3SEMA 2K6DA 2P4RA 2O88A 1UJ0A 2KRNA 3VRYA 1WYXA 1K9AA 3SHWA 3TSWA 1NYGA 1RI9A 4Y92A 3EG2A 1GCPA 3A98A 2L3QA 2LJ1A 2EYYA 2C0IA 1PRMC 2DMOA 1M8MA 2XMFA 2DYBA 4RUGA 2EGAA 1MUZA 2LJ0A 1OV3A 4CC2A 4J9BA 1YP5A 1W70A 1AD5A 4Z89A 1BBZA 3JV3A 2CSIA 1KSWA 2I0NA 1PKSA 4OMNA 1HD3A 4DEXA 1HJDA 1OOTA 1K4US 2ECZA 1K1ZA 2DVJA 1NM7A 2RQUA 2A37A 1K0SA 2DL4A 4QT7A 5IHKA 1AWXA 4IIOA 3NHNA 2FPDA 2RN8A 4RTVA 1UUEA 1UHFA 2DBKA 2AK5A 2ENMA 3M0SA 2KGTA 1LCKA 2CT3A 1WLPB 2JW4A 1H8KA 1SEMA 1ZX6A 1UE9A 4OMLA 1TUDA 2HDAA 2VKNA 1QWFA 1WXBA 4J9DA 4LUEA 1W1FA 2AZVA 1WI7A 2RQTA 2JM8A 2YSQA 1GBRA 1AZEA 1UDLA 2DJQA 1M3BA 1ZBJA 2L3SA 2YT6A 3VRZA 1K0XA 2KROA 2DL3A 3I5RA 4CC4B 2DF6A 2EGCA 3CQTA 2K9GA 3H0HA 3VS0A 2RMOA 2LX7A 1MV3A 2F2VA 2KT1A 5HCKA 1SRLA 2HSPA 1GCQC 2GNCA 2RQWA 3VS1A 4CC3A 1CKBA 1NEBA 2NWMA 1JEGA 1Y0MA 2DA9A 3EG1A 2DE0X 2ED0A 3VS4A 1RLQC 2DX1A 1AOJA 5EC7A 1NEGA 2NUZA 1T0JA 3C0CA 4WCIA 1QKXA 2JTEA 2DM1A 1PKTA 4R0KA 1Y57A 4JJBA 3H0FA 2AKKA 2K79A 3ZL7C 2BZ8A 4DEYA 5I11A 2LQNA 2PNIA 1YCSB 1H3HA 3EGUA 5GJWB 2CH4A 2YUPA 2EQIA 2MIOA 4HVVA 1HSQA 1AEYA 1WX6A 1ZLMA 2O9VA 1ARKA 2LQWA 5I22A 4GLMA 1WA7A 2W0ZA 4RTYA 3QWYA 2KE9A 4Z88A 4F16A 1UECA 1ZSGA 2FRWA 3QWXX 4AG1C 2K3BA 1AVZC 1E7OA 4HCKA 1T0HA 2KYMA 2LP5A 2DL7A 2JMAA 2D8HA 1SHFA 1M3CA 2KR3A 2J6OA 3UF4A 2YDLA 1NG2A 3GBQA 2DBMA 1SSHA 3TSZA 2JS2A 2KXDA 5ECAA 1QLYA 4FSSA 1GL5A 3KFVA 4RTWA 2CT4A 3O5ZA 1JU5C 2QDLA 3NGPA 1GFCA 4RTTA 1B3QA 1UGVA 4HVWA 3REBB 2F2XA 1FYNA 1T3LA 2KRSA 1WFWA 2HCKA 2W10A 2DNUA 2GBQA 1E6GA 1QWEA 4OMOA 2FO0A 2FPFA 2YUOA 3UA6A 2FG0A 1OPKA 5FWBA 2EYWA 3VS3A 1X2QA 1VYTA 1RUWA 2ESWA 2HEQA 1ZUUA 3I35A 4A63B 1B07A 4HVUA 2L0AA 2PZ1A 1KFZA 1WXTA 1AWOA 1M3AA 1JQQA 2KBTA 1NLPC 2B86A 1H92A 1S1NA 3PVLA 4D8KA 1GRIA 1SPKA 2OI3A 2GTJA 2J6FA 2AZSA 1XOVA 1Z9ZA 2GTOA 4D8DA 1T3SA 1M27C 1CSKA 1X69A 1GBQA 4J9GA 1TUCA 4Z8AA 1VA7A 4JPBW 2EPDA 2J6KA 1I07A 1RLPC 4ORZA 3ULRB 2DL5A 1Z9QA 2RNAA 4JZ4A 4LNPA 1V1CA 2SRCA 2KT8A 1GCQA 2RPNA 3FJ5A 1TG0A 4AFQC 2J06A 1U5SA 2J7IA 4F17A 2M0YA 2BZYA 2DRMA 1X6BA 3VS5A 4AG2C 2D0NA 1G2BA 4K11A 3EHQA 1VYVA 1OEBA 2J05A 4OMQA 1UFFA 4J9HA 1FMKA 3NMZC 1MV0B 2KNBB
chains in the Genus database with same CATH superfamily
1TWBA 2FZKB 3I5SA 2P4TA 3CCSA 4JZ3A 2X3XD 3OYHA 3JCMJ 2O2OA 4PNOA 1QQJA 3OA6A 3BW1A 3H0IA 3OYBA 2HMAA 3EHRA 1E6HA 4KRTA 4OMMA 3HTRA 3U23A 2XU8A 3TQ7P 1KG1A 1D0YA 4M7DD 3SFMA 3OYJA 1KJWA 2CREA 1IO6A 3CCUT 2KEAA 3CC4T 2K7AA 2PVGB 4M78D 4PJNA 4C8QF 5HK0A 3CMAT 2QASA 4C92B 2A7YA 2EQUA 4NL2A 2DKGA 2QA4A 4EIKA 3CCET 2A3LA 3VS6A 1N5ZA 3RDVA 4ESRA 1KC8C 1N8RR 1Y7XA 4BI8B 1IHVA 4LE9A 1VQ7T 2P0PA 1WGSA 1IZ6A 3VYHB 2DXTA 4PJOD 2RH2A 4P5NA 1FXXA 2DEQA 4J9CA 2K57A 2RI5A 3L2ZA 1JXOA 1X43A 1WIEA 3OQ5A 3E19A 3CD6A 4M7DA 3EG3A 2RD1A 1PC0A 5CR2A 1Q81U 2CGHA 1VQ6A 3H41A 1BB9A 3MPUB 1KQ1A 2QXFA 1AWJA 2NUPB 3RMSA 4JJNK 3M0RA 2E65A 5A0GA 1TU0B 3OYFA 5DLOA 1QVFA 5GANe 2HBWA 1VYUA 5CKFA 3PIOA 5FLXE 3CPWA 2KRMA 4HA8A 3G6ET 4J7IA 5GAMe 1SKUB 2VVKA 2OTJQ 1J3TA 3M0QA 1OULA 3I9QA 1RAAB 1X01A 2SEMA 2BZXA 2FL7A 2FPEA 3JB9G 4PJLA 4X1VA 2OJ2A 2F5KA 2PTKA 4C5EA 3TVTA 2WACA 2RHYA 1HYOA 5KYUA 2CP5A 4FYYB 4GBQA 3CCJA 2KMTA 3Q1JA 1RABB 1OYXA 3MEWA 5GMKl 2H8HA 1IXDA 3HRTA 3QDRB 2DD4A 1K73C 2C0OA 4M7DF 2DYIA 1GXIE 1KQ2A 5KE3A 3REAB 4M78C 2FEIA 4FW2A 1CKAA 4FU6A 1FX7A 2CP2A 1U06A 3MO8A 4M75E 1UJYA 2EKHA 3BDUA 4LUDA 5L8RE 4OB2B 4C0DB 2DD5A 5GAOn 2ED1A 3LLRA 2CUBA 4C92A 1TSFA 3OS2A 4N4GA 4C92E 2ZPFB 1VQ9A 2A08A 3TREA 3CCQQ 1YJ9A 3CCST 1VQNA 2P84A 4N0AC 4M77B 1KQSA 2D6FA 3VRYA 1K9AA 4QW2A 1M1KR 4YTLA 3TSWA 2QI2A 3A98A 2L3QA 2LJ1A 1ZA1B 3HFNA 3BFMA 1B34B 4LDVA 4IUQA 4M77G 4E7SA 2CZ0B 4RUGA 4ZN3A 3M4GA 5LJ3g 1OV3A 2D9TA 4J9BA 2VXEA 2COWA 2YRDA 3FIFA 3HHTB 2M02A 2BUDA 3QIIA 2RK2A 2RA2A 4M78B 1KSWA 3OBYA 2I0NA 3GIBA 8ATCB 1JRIA 3UT1A 1Q81C 4WF2A 1Q7YC 3HP9A 4DEXA 1HJDA 1VQKA 2DTHA 3EFRA 4PLIA 4RCBA 3RKYA 4AT1B 2MWPA 3C12A 3I56T 1NPRA 3QHSA 1KC8U 1K0SA 2RO0A 4C0GA 3RERA 3ZFJA 4RTVA 1RACB 1ACMB 1UUEA 1VQOA 2DBKA 2DO3A 1VQ5T 4FT4A 5GAN3 2K5IA 4R55A 5EG2A 1WLPB 1H8KA 1SEMA 2VYTA 1UE9A 2MAMA 4FT2A 4XTXA 2HDAA 1YJNT 1K8AR 2VGNA 1M1KU 2DJQA 1YIJT 4F7UE 1M9SA 4OMFB 3ZBDA 1C6VX 3OY9A 2FZGB 3HFOA 2MMPA 3H0HA 2RMOA 5GAN5 1Q82C 1VQMT 3M56A 1MV3A 3PMTA 3KBGA 2LT4A 1VQ7A 2HSPA 1Y07A 2RQWA 4CC3A 1NEBA 1QP3A 2I2LA 2NWMA 1Y0MA 5KCOA 3SDZA 1U1TA 4E7HA 4M7DC 4M7AB 5CVIA 3VS4A 2MWOA 2X9HA 3E1SA 3CD6T 3KUFA 2NUZA 1T0JA 3QSUA 2QK0A 1PKTA 4CRIA 4BI4A 1W2BS 3H0FA 5GAOq 3RR6A 2BE9B 4DEYA 2LQNA 3LX7A 4JRIA 1FMVA 4TVRA 5GJWB 1YJNQ 2L89A 2YUPA 2EQIA 2MIOA 4HVVA 4C5HA 5FU7B 2RJCA 3EG9B 1ZLMA 1YITA 2H3EB 1BIAA 2LQWA 2L3RA 3A8OB 5GAOl 1WA7A 1WZOA 4Z88A 2E64A 3VV0A 1IB8A 4JRQA 5GAMj 3QWXX 2K3BA 5GMKm 1T0HA 2LP5A 2DL7A 1M3CA 1UGRB 2RI2A 3INZA 4BACA 5M9OA 2WSEE 2EKOA 5KYYB 3OYNA 3LYIA 2L5QA 2QDLA 3DB4A 5LJ5h 3JCMQ 4J83A 3RMQA 6AT1B 5GAOm 4HVWA 2PQWA 3GPLA 5KYWB 2KRSA 4XU0A 1PSFA 4LXCA 2RJFA 1SG5A 3PIPA 5GAN7 1OPKA 2EYWA 1WHKA 3OBWA 5FROA 1YJ9Q 5GAN2 2L0AA 1Q7YR 1AWOA 2DIGA 1WHGA 2YWWA 1M3AA 3MP8A 2KBTA 3AHUA 2B86A 4V2SA 1S1NA 2R5MA 4Q5WA 1KD1C 1KHCA 5GANg 1SF9A 4BY6B 2GTJA 3O8VA 4KGXB 3FB9A 4MMLA 3OYDA 2YHTA 2IPOB 3PNWC 4DBRA 2C06A 2EIFA 2V8IA 1VQ9T 4JLGA 4XTYA 1N6AA 1X69A 4Z8AA 3CCSQ 2KAFA 3CCJQ 1VQ5Q 2EPDA 2J6KA 3JB9H 3ULRB 3H8ZA 2DL5A 2IVWA 5GAMf 3I55T 3H6ZA 2RI3A 3FJ5A 4AFQC 2HNIA 2M0YA 2DRMA 1K8AU 4LD6A 3QZ5B 3VS5A 3G4SQ 5FRMA 3JB9I 1G2BA 4K11A 1VQ4T 1PCXA 4KH0B 5IXBA 3NPFA 1X2KA 2K3XA 1YJNA 1NJIU 2OTJT 5IHIA 1M30A 2BE7D 1YFNA 1ZHIA 2ZCFB 3LGFA 5GANh 2OAWA 2CKKA 3CBPA 5KYNA 1O75A 2AKLA 2IG0A 3ZEHA 1ZUKA 4N4HA 5GANd 4ZGEB 2NUPA 3BE3A 3VS2A 2L2PA 1VQPA 4BE1A 1PD1A 4ZGJB 2DVEA 3PT9A 1KC8R 4OB1B 4RTXA 3M0UA 3JCMg 5LJ3h 3CXCS 2DPPB 1OZ3A 1U8RA 2OAUA 4FL6A 4J9IA 5CKEA 1G8XA 2X4WA 3LWIA 3M0PA 3QYHB 2EYZA 4PJOE 1BK2A 2DXBA 1VQMQ 4F14A 3CBMA 3QPHA 4FYWB 4BI3A 3I56A 4M77F 3GOXA 4M75A 1VQOQ 3LGLA 4NS5A 2D1XA 1I1JA 2CUDA 3OMCA 1VQOT 1W2BA 4LD9K 2OTLT 2K2VA 3X24B 3VUZA 4N4IA 3CC7Q 3EGDB 2LX9A 1G5VA 3OW2S 1YI2Q 2JJ9A 2A28A 2ZPIB 1WDXA 1JXMA 2VV5A 2ZPEB 2MCNA 1ABOA 1VQ6T 3L2VA 2O31A 1VQLA 4JJDA 2ZPBB 2HKNA 1VQ6Q 1G3WA 1KD1R 3J7AF 1BCMA 5I21A 3X28B 3S3OA 1S72A 1YWPA 1WJRA 1R0CB 3THKA 4M78F 1Q81R 2RHIA 4C8QD 1D3BB 1NLOC 2C0TA 3JCMP 2ZPHB 4DQ2A 1G3TA 1QKWA 2GGRA 1SSFA 3OMGA 2FHDA 2JZ2A 1U1SA 5FU6C 1JJ2P 5DM7R 2E70A 1PM3A 4AFSC 2OTJA 1BI0A 5CAIA 1W2BP 3V8LA 3M53A 4JLIA 1I0CA 4FYXB 4IUVA 4OGEA 2VGMA 3R6NA 1MMDA 1TOVA 5GJVB 2GF7A 2ROTA 4OP0A 2GQVA 2DFUA 2NYSA 2ZPGB 4XU2A 3I55A 1UEBA 1YNZA 4IKFA 5FWCA 9ATCB 3HRSA 5LJ5f 1JBMA 4WTOB 3J80E 3OB9A 3RNJA 3OYIA 3MEAA 2RJDA 1VIEA 1UHCA 3EGXB 3M55A 2K6DA 3FC3A 5CIUA 2V8JA 3CCMQ 1WYXA 1TH7A 5A0DA 2VXFA 2ZGWA 1GCPA 3EAEA 2O4XA 5GAN8 3FJPA 3R6OA 4M77D 2C0IA 3UDCA 5FRNA 1M8MA 3OS0A 3OYLA 3OYYA 1MUZA 1VQ8T 4J8OA 5CKHA 4Z89A 4M7AF 1VQNQ 2BIVA 1PKSA 5GAN6 1HD3A 3JCMd 2DTOA 3OYKA 1K4US 1VQPT 4DA4A 2QQRA 2E1HA 3OYMA 4QQDA 2QAZA 2RQUA 1VQPQ 4C0DC 4QT7A 5IHKA 3HRUA 4IIOA 3V8JA 1QCNA 4A54A 3L2QA 1KQSS 1PSEA 1TS9A 5GAMh 1UHFA 2PVOB 2ENMA 4LDUA 1LCKA 2CT3A 3E9GA 4OMLA 4R56A 2LRQA 3HPWA 2VKNA 1RAIB 2CP6A 3A5ZB 2Y4YA 1QWFA 4LUEA 5KYUB 1W1FA 2XDPA 5DLQE 3TEEA 2RQTA 1HXDA 3QBYA 1GBRA 3WVDB 2F5TX 2M0OA 4KBMB 3JAME 1K0XA 5D7UA 3X20B 4GY5A 4C8QC 4J6YA 4MMKA 1YI2T 3NTHA 2K9GA 4MZMA 1K73R 1WJQA 4FCYA 3I56Q 1Q86R 2YXYA 5KYYA 1GCQC 2CYZB 2GNCA 3EH1A 1M5Q1 3VS1A 4RMOA 5LL6S 1VQ9Q 1RLQC 2E4HA 4E7JA 3EH2A 5EC7A 1Y96A 3M58A 2XKOC 2MPXC 2FB7A 4WCIA 3PTAA 1Y57A 4JJBA 2AKKA 1EX4A 2BZ8A 4X9DA 1YCSB 3UWNA 1WHHA 1LJOA 3EGDA 1MNDA 3G1JA 4OGCA 4C92C 1N9SA 2LQKA 3S3NA 1AEYA 4XTUA 2VB6A 4M7AE 2O9VA 1OX8A 3JB9F 4ZTFA 4FM4B 4ELYC 2JUFA 1VIFA 1F1BB 2FRWA 5LJ5e 1ZBXA 4AG1C 4HCKA 2DAQA 2KYMA 2D8HA 2EQKA 3FLGA 3GLXA 2J6OA 1Y71A 1NG2A 2YDLA 5CQXA 5GAN4 2DBMA 1SSHA 3GNGA 4M77C 2HQEA 4DOWA 1QLYA 5DY9A 1GL5A 2JTMA 4RTWA 2CT4A 1MNEA 3CCUA 5KYXB 3NGPA 4M7DG 4RTTA 1NJIR 1UGVA 3MEUA 4XK8E 2OTLA 5GMKi 5GANj 2FO0A 2FPFA 2NLUA 4XU1A 3MJXA 2E3HA 2DIQA 2Y4XA 5FWBA 1RUWA 2HEQA 4NOYA 4ELZC 4OB0B 4F7UB 1UGSB 5GAMg 3KXTA 3G4ST 1KFZA 3CCRA 2XHCA 1N9RA 2XI9A 3JCMV 4ME7A 3MCAB 5KYWA 3QKJA 3CCLQ 1M1KC 1SPKA 2OI3A 5CO7A 3CXCA 3S6WA 3EGXA 1RI0A 1T3SA 2KVQG 4E2FB 3CC4Q 4JUVA 4J9GA 1TUCA 5I2SA 4D6WA 4HCCA 4HCBA 3CMET 1NE8A 4ORZA 4JZ4A 2RNAA 1NZ9A 2E41A 2EJFA 1P92A 2RB6A 2Y90A 5J39A 5GAOr 1V29B 2LQ8A 3MKDA 4JRKA 4E7KA 3VKIA 4AG2C 3M5AA 1VQ8Q 2HQHA 2DZCA 1YHQA 2BKDN 2WSCE 3OS5A 1OEBA 2J05A 4OMQA 4LDXA 3NMZC 2KNBB 3V7RA 1PNJA 3RKXA 5LJ3f 3EG0A 4M7DB 4C5GA 2EWNA 2YUNA 2XG8D 4OMPA 1OZ2A 1HK9A 3JB9D 2G3RA 2HBPA 3VS7A 4DBQA 1BI3A 3WXMB 4C92D 1SHGA 4A4EA 1YWOA 1M90C 1X75C 2G6FX 4ZNXA 4C0FA 1XNIA 2LTOA 1NPPA 3SWNC 1D1BA 2LZ6B 1RAHB 2QTXA 4J5YA 1G3SA 1G3YA 2IIMA 2D8JA 4XAXB 3HKSA 2KYBA 4A4GA 2RF0A 3CC7T 3NFCA 5CCAA 3QG1A 1KK7A 1KIKA 3UPUA 2D0QB 3LWHA 4FYVB 1U3OA 1YJWT 3AT1B 4IIMA 1WHJA 4M75F 4EPCA 1H641 2LCCA 1PHTA 1VQ8A 3RBBB 3URGA 4LN2A 2KQWA 4XTVA 4BB7A 4DBFA 2FRYA 2EBPA 2XD0A 2DRKA 1SRMA 4RKUE 4J9EA 1JJ2A 2GFUA 2MYSA 2EJGA 3WVEB 1Q82U 1EFNA 2R5AA 3P8DA 3M57A 3META 1MGQA 2CDTA 5IHNA 4AFUC 3UA7A 1G83A 2M16A 1TTHB 2ABLA 2F1LA 1UG1A 4HT8A 3PE0A 3T9NA 3MEVA 2F69A 3GNFB 7AT1B 5IXFA 3TU4K 2COYA 2E6ZA 3SB2A 4A4KA 2M51A 2LMJA 1MMAA 4HT9A 4E7ZA 4M75B 4RTZA 3A8MB 2JM9A 3OS1A 2JXBA 2A36A 1DJ7B 2CH4W 2YLBA 1GFDA 3UATA 1JJ2S 1KD1U 5LJ5g 1I8FA 1IGQA 3H9NA 4PKCC 3A8GB 1WNLA 3CC2Q 1WXUA 3RESA 5C6SA 3G71T 3M59A 1NJIC 4C92F 2VC8A 5A2QE 5FW9A 3V7SA 4EDUA 4JJCA 3OYCA 2DK3A 2LCSA 2YRVA 1AZGB 1ZUYA 4BD3A 5LJ3d 2XDBA 4IUTA 4QQGA 2O9SA 4DOVA 1FWZA 2ATCB 4HXJA 3CCQT 1ABQA 4M4ZA 2QGGA 4XQ3A 4KULA 3NTIA 5IN1A 1PRLC 2F2WA 1KQSP 1D0XA 2LJ3A 3X26B 3VJPA 1MMNA 2E12A 3SEMA 3CC7A 2P4RA 5GANf 2CP7A 4J6WA 2O88A 3GF5A 1YHQT 4F7UG 1RI9A 1YHQQ 2KI7A 1YIJQ 2EYYA 2QDYB 2DMOA 4B9WA 2P0QA 2XMFA 2DYBA 1ZSZC 1EIFA 1LVKA 2LJ0A 1VQ4Q 4CC2A 3JSCA 1YP5A 1W70A 1AD5A 3L42A 3QUIA 1BBZA 2GFAA 3JV3A 2CSIA 2MF2A 4Z02A 4PL6A 4EMHA 3M4YA 1OU8A 4ANJA 4PJJA 1OOTA 2ECZA 3RIRA 4ATOA 3EFOB 1NM7A 2DL4A 4KT0E 1AWXA 3NHNA 2FPDA 2CZ6B 3LH0A 2R58A 4VUBA 4BE0A 2JW4A 1ZX6A 4X9CA 1TUDA 3G7ZA 1PG5B 4J9DA 1WI7A 2YSQA 2CZ7B 1OQKA 3E9FA 2WSFE 3G71A 1M3BA 3VRZA 1KHIA 2DTIA 4Y91A 3EG9A 4IUUA 2RJEA 2DL3A 2PUKB 3QZ9B 3D7SB 3I5RA 1M1GA 4CC4B 2COZA 2EGCA 3CQTA 2XICA 1M1FA 2ZZDA 2F2VA 2O4XB 5HCKA 2DEUA 2FYKA 3JCMf 1VQ7Q 1CKBA 1JEGA 1RAEB 5GAOp 2DXUA 2QQBA 2DE0X 2ED0A 1ZA2B 2MI6A 4L59A 2DX1A 1AOJA 3JB9J 4RG2A 5CKBA 2H3JA 3C0CA 5KYXA 5GMKe 3QJYA 3JRZA 4R0KA 5J26A 3DLMA 4M7AD 1M4ZA 3DB3A 3QJ6A 2B8AA 2K79A 3ZL7C 3QXEB 5I11A 2PNIA 3CC4A 1D09B 3ASKA 1R8OB 2CH4A 1Q86C 3EFOA 4PJOB 4MDWA 2JVVA 3CMEQ 4RG8A 1K9MR 1QVFS 1HSQA 1M2VA 2RHZA 5C0MA 4JS4A 1XTDA 3C4SA 4RTYA 3QWYA 3G6EQ 5J3BA 3NTKA 2JMAA 4NL3A 4C8QE 3CPFA 2RK1A 3CCEA 1VQLT 3UF4A 4KUDK 3J81E 3TSZA 1VQ4A 5ECAA 4QKUA 4FSSA 4MZPA 3OW2A 1YITT 5AT1B 1B7TA 3KFVA 3N5BB 3G4SA 1S72Q 3CCRT 1B3QA 3REBB 3CMAQ 3CCLA 1FYNA 1T3LA 1QW1A 1WFWA 2W10A 2DNUA 3CCMA 1E6GA 1QWEA 2X51A 4FIBA 1IHWA 4HCZA 3UA6A 2FG0A 3CCVA 5LJ3e 2EYQA 4O5VA 4QVDA 5LJ5j 1ZUUA 3I35A 4A63B 4CI0C 4BDZA 2PU9B 3QDFA 2PZ1A 1WXTA 5CQYA 5GMKh 1BI2A 3CMEA 4LDYA 1H92A 4UC4A 1M2OA 3PVLA 1YI2A 4D8KA 1GRIA 1N27A 4N0AA 2HL3A 1XOVA 1Z9ZA 2CP3A 1RAGB 1K73U 4E7LA 1I5LA 1CSKA 1Q7YU 4C8QA 1VA7A 2VUBA 4FSXA 2X4JA 1RLPC 1YBYA 2LT1A 2CP0A 3FEOA 2SRCA 2KT8A 1GCQA 1QVPA 2RPNA 4JRPA 1TG0A 1TUGB 2J06A 2J7IA 3C94A 3OSVA 2BZYA 1RADB 2QGFB 2CS7A 1I4K1 1R0BG 2QEXQ 2YLCA 1UB4A 2EFIA 3EHQA 1UFFA 4J9HA 1FMKA 1MV0B 1VUBA 4BE2A 1QCOA 3CCVT 5KE2A 4M7AC 2KY9A 2K2MA 3CCQA 2GQIA 3P8HA 2DILA 1X6OA 5D6YA 3L2RA 2QA4Q 4M7DE 4C8QG 1WHLA 2P0KA 3M0TA 4RTUA 1H3ZA 3CPWS 4IURA 2E3IA 3CD6Q 3JCMc 2DL8A 1AWWA 2V8KA 4ZGDB 1WJSA 1NYFA 1X27A 5A0LA 1M2VB 4J9FA 1RL2A 1N8RU 3CC2T 1QVGS 3MP6A 1UTIA 2AT1B 1VOMA 1XJWB 4ZN1A 2V1RA 2QEXA 2K3YA 2XIDA 2K5LA 1PWTA 3MP1A 1VQKQ 2EQJA 1OPLA 2EQMA 2PVDB 1VQ5A 3X25B 3S3MA 2DXCA 4B9XA 2KXCA 3CXCP 5IH2A 1VQMA 2NUTA 4J7FA 4QQ6A 1UGPB 2X35A 3DLLA 4KUIA 5I2MA 1K76A 2JS0A 2A0FB 1MHNA 1IREB 2DETA 1S72T 2EYXA 4QVCA 5KCHA 4XTWA 4PJOA 2ROLA 4BDYA 1UGQB 1QCFA 1W6XA 2DZ9A 2JMCA 2E5KA 3L1AA 3IQLA 4J6XA 4EMKA 4CC7A 3A1PA 1D3BA 3SWNA 4OF1A 2YRCA 1QVGP 1K9MU 2JT4A 3PMIA 3VYGA 1YJWA 4IUPA 2HSEB 3E2UA 2HAXA 4A4HA 2YUQA 4M78A 3JCMb 3JCMh 1C0MA 2LNHB 4E6RA 1YJWQ 2EW3A 5L23A 4KH1B 2L3PA 2JN0A 4C8QB 4PFPA 4PFOA 1BYMA 3PVQA 3F70A 2VWFA 2L8DA 2BTTA 4FW1A 2M9UA 3A8HB 1VQKT 1WHMA 2LVMA 1A0NB 3L2UA 2K4YA 2HD0A 4L6V5 4E7IA 2MOXA 3ME9A 1OI1A 1RAFB 2AHJB 1JO8A 5CK9A 2RQVA 4A4FA 4M77A 1C1AA 2DERA 2QG9B 1JB0E 1R77A 1I5OB 3LH5A 1LOJA 2LC4A 4BUGA 2E10A 2EAYA 4M7AG 3SD4A 2KDSA 3CCUQ 4M75D 2QTVA 1X6GA 1BU1A 5AYFA 3M54A 3C95A 1PD0A 2RQRA 5HKCA 1VQNT 2EGEA 3FDRA 3CCEQ 1YN8A 2E6NA 2QEXT 1YCYA 3PGGA 1Q86U 2V1QA 2CSQA 1BKBA 3OYGA 3P8BB 3CC2A 3QYGB 1K8AC 4XU3A 1TXQA 2Z0WA 4AFZC 2DLPA 2X3WD 4M77E 3OW2P 2EVRA 3CMAA 1OX9A 3HSBA 2M1HA 4PJMA 2QA4T 1NBEB 4B6MA 3SWNB 1UJ0A 2KRNA 3SHWA 2RHUA 3L2WA 1NYGA 4Y92A 3EG2A 2OX7A 1EZZB 3CCJT 4OB3B 1WQ7A 3OYAA 1PRMC 3QO3A 5HY6A 4L5GA 3GP8A 2EGAA 3FRNA 5D6WA 4EMGA 3JCMe 1D0ZA 4F04B 2JNGA 1LNXA 3BY7A 4M75G 4OMNA 2QYZA 1BI1A 4C5IA 4A53A 1AHJB 1K1ZA 1O9SA 2DVJA 2JTFA 1YITQ 1M8VA 1AT1B 5LJ5d 2KK4A 3G6EA 2A37A 4O6JA 2O01E 4M78G 1VQLQ 2X4XA 2RN8A 2JOYA 2RM4A 2HQXA 2V26A 1IRXA 2AK5A 3M0SA 2KGTA 4E47A 2RHXA 1WXBA 2AZVA 2JM8A 3V8KA 5FU7C 3DKMA 1QVFP 4LDWA 1AZEA 1UDLA 1ZBJA 2L3SA 2YT6A 3BDLA 2EJ9A 1YJ9T 4F7UF 3CEYA 1ZSZB 2KROA 3M9QA 8AT1B 3VUBA 2DF6A 3MHXA 4MZTA 2K5FA 3V7CA 3VS0A 1K9MC 2LX7A 2KT1A 3VU3C 1M90U 1Q95G 1FMWA 1SRLA 1XQHA 4PFZA 2LDMA 5IAYA 4PK4A 2DA9A 3EG1A 4KGVB 1I81A 4M75C 3JCMW 2QQAA 1V76A 4C0ZA 2QQ9A 1NEGA 5GMKj 3JCMX 1D1CA 1N8RC 1QKXA 2JTEA 2DM1A 1WQWA 3HL8A 4PLLA 2HZYA 3CCRQ 3I55Q 2LNVA 3CBOA 5LJ3j 1BCOA 1H3HA 3EGUA 3OSSC 3PFSA 1Q82R 4DBHA 2XK0A 4OVAA 1M90R 1WX6A 2FZCB 5KH6A 1ARKA 4EMKB 5I22A 1ZQ1A 4GLMA 2W0ZA 2KE9A 4II1A 2KSSA 1UECA 1ZSGA 4F16A 1AVZC 1E7OA 3LW5E 3CCLT 1SHFA 4BY6C 4MDXA 2KR3A 2X4YA 2QQSA 3GBQA 2JS2A 4XTZA 2KXDA 1IGUA 2E5QA 3O5ZA 1W4SA 4ZTJA 1JU5C 3RUXA 2CZ1B 1GFCA 1QP2A 1MMGA 1Y96B 1LPLA 4X34A 2F2XA 3OYEA 2HCKA 2AIRB 3G71Q 2GBQA 2NUTB 5GAMd 4OMOA 2HL5C 4PJOF 2XDDA 1QVGA 2YUOA 2LCLA 1D1AA 4PJOC 1QMCA 3VS3A 4KGZB 1X2QA 1VYTA 3EFSA 4AMCA 2ESWA 2R57A 1B07A 2FVUA 4HVUA 5IT9E 4EMKC 1B34A 4RCCA 4Y28E 1JQQA 1NLPC 2PUOB 2HKQB 4C92G 4PJOG 5D6XA 3RKWA 3CCVQ 2J6FA 2AZSA 4JS5A 2GTOA 3ER0A 4D8DA 4GLKA 1M27C 4JDSA 1GBQA 4HKEA 2DJZA 2MK5A 2GCXA 4JPBW 3A8LB 1OU9A 5FU6B 1I07A 4F7UA 4QVZA 3CCMT 4LNPA 1Z9QA 1V1CA 3CPWP 2OTLQ 4M7AA 1U5SA 3TCJA 4F17A 4M78E 1ZSZA 2ZAEA 1X6BA 5HK3A 1BIBA 2VASA 2D0NA 5CKDA 1YIJA 1VYVA 1WPYA
chains in the Genus database with same CATH topology
3NPFA 3I5SA 1X2KA 4JZ3A 2X3XD 1PNJA 2O2OA 3EG0A 5IHIA 1M30A 2K2MA 2YUNA 2GQIA 4OMPA 2DILA 3H0IA 2OAWA 3EHRA 1E6HA 3VS7A 4KRTA 4OMMA 3U23A 3M0TA 4RTUA 1SHGA 2AKLA 1YWOA 2G6FX 1KJWA 4ZNXA 1ZUKA 2CREA 1IO6A 2DL8A 1AWWA 3VS2A 2KEAA 2L2PA 2K7AA 2LZ6B 1NYFA 1X27A 4J9FA 2IIMA 2D8JA 4RTXA 3M0UA 4EIKA 2KYBA 2RF0A 3VS6A 1N5ZA 1UTIA 4ESRA 1KIKA 2V1RA 4J9IA 1PWTA 1U3OA 4LE9A 1OPLA 4IIMA 3M0PA 2EYZA 2KXCA 1PHTA 5IH2A 1BK2A 4J9CA 3RBBB 4F14A 1K76A 2JS0A 1JXOA 1X43A 4LN2A 1WIEA 3EG3A 2EYXA 2FRYA 2ROLA 2EBPA 1QCFA 1W6XA 2DRKA 1SRMA 2D1XA 1I1JA 2JMCA 2CUDA 3H41A 2E5KA 1BB9A 4J9EA 3IQLA 4CC7A 1AWJA 1EFNA 2JT4A 3M0RA 2YUQA 2HBWA 1VYUA 4E6RA 2LNHB 2CDTA 2EW3A 2A28A 5IHNA 4AFUC 5L23A 1WDXA 1JXMA 2KRMA 3UA7A 1G83A 2MCNA 1ABOA 2ABLA 1UG1A 2L3PA 2O31A 3PE0A 4JJDA 3PVQA 2VWFA 2VVKA 2BTTA 1J3TA 3M0QA 1A0NB 3I9QA 2SEMA 2BZXA 1YWPA 2MOXA 2FPEA 3THKA 4X1VA 2OJ2A 1JO8A 5IXBA 5IXFA 1NLOC 2C0TA 2PTKA 2M51A 2RQVA 2LMJA 3TVTA 1QKWA 2GGRA 4RTZA 2JM9A 3LH5A 2JXBA 2A36A 2CH4W 4GBQA 4AFSC 1GFDA 3UATA 1WXUA 1I0CA 1X6GA 1BU1A 2H8HA 3R6NA 2C0OA 2RQRA 2EGEA 5GJVB 3REAB 2ROTA 5FW9A 2FEIA 4JJCA 1CKAA 1U06A 2LCSA 1AZGB 1YN8A 1YNZA 1ZUYA 1UJYA 5FWCA 2EKHA 2O9SA 2V1QA 4LUDA 2CSQA 2ED1A 4AFZC 2CUBA 2DLPA 2X3WD 3RNJA 4HXJA 1ABQA 4M4ZA 2EVRA 1PRLC 2F2WA 2A08A 2LJ3A 1UHCA 3SEMA 2K6DA 2P4RA 2O88A 1UJ0A 2KRNA 3VRYA 1WYXA 1K9AA 3SHWA 3TSWA 1NYGA 1RI9A 4Y92A 3EG2A 1GCPA 3A98A 2L3QA 2LJ1A 2EYYA 2C0IA 1PRMC 2DMOA 1M8MA 2XMFA 2DYBA 4RUGA 2EGAA 1MUZA 2LJ0A 1OV3A 4CC2A 4J9BA 1YP5A 1W70A 1AD5A 4Z89A 1BBZA 3JV3A 2CSIA 1KSWA 2I0NA 1PKSA 4OMNA 1HD3A 4DEXA 1HJDA 1OOTA 1K4US 2ECZA 1K1ZA 2DVJA 1NM7A 2RQUA 2A37A 1K0SA 2DL4A 4QT7A 5IHKA 1AWXA 4IIOA 3NHNA 2FPDA 2RN8A 4RTVA 1UUEA 1UHFA 2DBKA 2AK5A 2ENMA 3M0SA 2KGTA 1LCKA 2CT3A 1WLPB 2JW4A 1H8KA 1SEMA 1ZX6A 1UE9A 4OMLA 1TUDA 2HDAA 2VKNA 1QWFA 1WXBA 4J9DA 4LUEA 1W1FA 2AZVA 1WI7A 2RQTA 2JM8A 2YSQA 1GBRA 1AZEA 1UDLA 2DJQA 1M3BA 1ZBJA 2L3SA 2YT6A 3VRZA 1K0XA 2KROA 2DL3A 3I5RA 4CC4B 2DF6A 2EGCA 3CQTA 2K9GA 3H0HA 3VS0A 2RMOA 2LX7A 1MV3A 2F2VA 2KT1A 5HCKA 1SRLA 2HSPA 1GCQC 2GNCA 2RQWA 3VS1A 4CC3A 1CKBA 1NEBA 2NWMA 1JEGA 1Y0MA 2DA9A 3EG1A 2DE0X 2ED0A 3VS4A 1RLQC 2DX1A 1AOJA 5EC7A 1NEGA 2NUZA 1T0JA 3C0CA 4WCIA 1QKXA 2JTEA 2DM1A 1PKTA 4R0KA 1Y57A 4JJBA 3H0FA 2AKKA 2K79A 3ZL7C 2BZ8A 4DEYA 5I11A 2LQNA 2PNIA 1YCSB 1H3HA 3EGUA 5GJWB 2CH4A 2YUPA 2EQIA 2MIOA 4HVVA 1HSQA 1AEYA 1WX6A 1ZLMA 2O9VA 1ARKA 2LQWA 5I22A 4GLMA 1WA7A 2W0ZA 4RTYA 3QWYA 2KE9A 4Z88A 4F16A 1UECA 1ZSGA 2FRWA 3QWXX 4AG1C 2K3BA 1AVZC 1E7OA 4HCKA 1T0HA 2KYMA 2LP5A 2DL7A 2JMAA 2D8HA 1SHFA 1M3CA 2KR3A 2J6OA 3UF4A 2YDLA 1NG2A 3GBQA 2DBMA 1SSHA 3TSZA 2JS2A 2KXDA 5ECAA 1QLYA 4FSSA 1GL5A 3KFVA 4RTWA 2CT4A 3O5ZA 1JU5C 2QDLA 3NGPA 1GFCA 4RTTA 1B3QA 1UGVA 4HVWA 3REBB 2F2XA 1FYNA 1T3LA 2KRSA 1WFWA 2HCKA 2W10A 2DNUA 2GBQA 1E6GA 1QWEA 4OMOA 2FO0A 2FPFA 2YUOA 3UA6A 2FG0A 1OPKA 5FWBA 2EYWA 3VS3A 1X2QA 1VYTA 1RUWA 2ESWA 2HEQA 1ZUUA 3I35A 4A63B 1B07A 4HVUA 2L0AA 2PZ1A 1KFZA 1WXTA 1AWOA 1M3AA 1JQQA 2KBTA 1NLPC 2B86A 1H92A 1S1NA 3PVLA 4D8KA 1GRIA 1SPKA 2OI3A 2GTJA 2J6FA 2AZSA 1XOVA 1Z9ZA 2GTOA 4D8DA 1T3SA 1M27C 1CSKA 1X69A 1GBQA 4J9GA 1TUCA 4Z8AA 1VA7A 4JPBW 2EPDA 2J6KA 1I07A 1RLPC 4ORZA 3ULRB 2DL5A 1Z9QA 2RNAA 4JZ4A 4LNPA 1V1CA 2SRCA 2KT8A 1GCQA 2RPNA 3FJ5A 1TG0A 4AFQC 2J06A 1U5SA 2J7IA 4F17A 2M0YA 2BZYA 2DRMA 1X6BA 3VS5A 4AG2C 2D0NA 1G2BA 4K11A 3EHQA 1VYVA 1OEBA 2J05A 4OMQA 1UFFA 4J9HA 1FMKA 3NMZC 1MV0B 2KNBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPF A;  3I5S A;  1X2K A;  4JZ3 A;  2X3X D;  1PNJ A;  2O2O A;  3EG0 A;  5IHI A;  1M30 A;  2K2M A;  2YUN A;  2GQI A;  4OMP A;  2DIL A;  3H0I A;  2OAW A;  3EHR A;  1E6H A;  3VS7 A;  4KRT A;  4OMM A;  3U23 A;  3M0T A;  4RTU A;  1SHG A;  2AKL A;  1YWO A;  2G6F X;  1KJW A;  4ZNX A;  1ZUK A;  2CRE A;  1IO6 A;  2DL8 A;  1AWW A;  3VS2 A;  2KEA A;  2L2P A;  2K7A A;  2LZ6 B;  1NYF A;  1X27 A;  4J9F A;  2IIM A;  2D8J A;  4RTX A;  3M0U A;  4EIK A;  2KYB A;  2RF0 A;  3VS6 A;  1N5Z A;  1UTI A;  4ESR A;  1KIK A;  2V1R A;  4J9I A;  1PWT A;  1U3O A;  4LE9 A;  1OPL A;  4IIM A;  3M0P A;  2EYZ A;  2KXC A;  1PHT A;  5IH2 A;  1BK2 A;  4J9C A;  3RBB B;  4F14 A;  1K76 A;  2JS0 A;  1JXO A;  1X43 A;  4LN2 A;  1WIE A;  3EG3 A;  2EYX A;  2FRY A;  2ROL A;  2EBP A;  1QCF A;  1W6X A;  2DRK A;  1SRM A;  2D1X A;  1I1J A;  2JMC A;  2CUD A;  3H41 A;  2E5K A;  1BB9 A;  4J9E A;  3IQL A;  4CC7 A;  1AWJ A;  1EFN A;  2JT4 A;  3M0R A;  2YUQ A;  2HBW A;  1VYU A;  4E6R A;  2LNH B;  2CDT A;  2EW3 A;  2A28 A;  5IHN A;  4AFU C;  5L23 A;  1WDX A;  1JXM A;  2KRM A;  3UA7 A;  1G83 A;  2MCN A;  1ABO A;  2ABL A;  1UG1 A;  2L3P A;  2O31 A;  3PE0 A;  4JJD A;  3PVQ A;  2VWF A;  2VVK A;  2BTT A;  1J3T A;  3M0Q A;  1A0N B;  3I9Q A;  2SEM A;  2BZX A;  1YWP A;  2MOX A;  2FPE A;  3THK A;  4X1V A;  2OJ2 A;  1JO8 A;  5IXB A;  5IXF A;  1NLO C;  2C0T A;  2PTK A;  2M51 A;  2RQV A;  2LMJ A;  3TVT A;  1QKW A;  2GGR A;  4RTZ A;  2JM9 A;  3LH5 A;  2JXB A;  2A36 A;  2CH4 W;  4GBQ A;  4AFS C;  1GFD A;  3UAT A;  1WXU A;  1I0C A;  1X6G A;  1BU1 A;  2H8H A;  3R6N A;  2C0O A;  2RQR A;  2EGE A;  5GJV B;  3REA B;  2ROT A;  5FW9 A;  2FEI A;  4JJC A;  1CKA A;  1U06 A;  2LCS A;  1AZG B;  1YN8 A;  1YNZ A;  1ZUY A;  1UJY A;  5FWC A;  2EKH A;  2O9S A;  2V1Q A;  4LUD A;  2CSQ A;  2ED1 A;  4AFZ C;  2CUB A;  2DLP A;  2X3W D;  3RNJ A;  4HXJ A;  1ABQ A;  4M4Z A;  2EVR A;  1PRL C;  2F2W A;  2A08 A;  2LJ3 A;  1UHC A;  3SEM A;  2K6D A;  2P4R A;  2O88 A;  1UJ0 A;  2KRN A;  3VRY A;  1WYX A;  1K9A A;  3SHW A;  3TSW A;  1NYG A;  1RI9 A;  4Y92 A;  3EG2 A;  1GCP A;  3A98 A;  2L3Q A;  2LJ1 A;  2EYY A;  2C0I A;  1PRM C;  2DMO A;  1M8M A;  2XMF A;  2DYB A;  4RUG A;  2EGA A;  1MUZ A;  2LJ0 A;  1OV3 A;  4CC2 A;  4J9B A;  1YP5 A;  1W70 A;  1AD5 A;  4Z89 A;  1BBZ A;  3JV3 A;  2CSI A;  1KSW A;  2I0N A;  1PKS A;  4OMN A;  1HD3 A;  4DEX A;  1HJD A;  1OOT A;  1K4U S;  2ECZ A;  1K1Z A;  2DVJ A;  1NM7 A;  2RQU A;  2A37 A;  1K0S A;  2DL4 A;  4QT7 A;  5IHK A;  1AWX A;  4IIO A;  3NHN A;  2FPD A;  2RN8 A;  4RTV A;  1UUE A;  1UHF A;  2DBK A;  2AK5 A;  2ENM A;  3M0S A;  2KGT A;  1LCK A;  2CT3 A;  1WLP B;  2JW4 A;  1H8K A;  1SEM A;  1ZX6 A;  1UE9 A;  4OML A;  1TUD A;  2HDA A;  2VKN A;  1QWF A;  1WXB A;  4J9D A;  4LUE A;  1W1F A;  2AZV A;  1WI7 A;  2RQT A;  2JM8 A;  2YSQ A;  1GBR A;  1AZE A;  1UDL A;  2DJQ A;  1M3B A;  1ZBJ A;  2L3S A;  2YT6 A;  3VRZ A;  1K0X A;  2KRO A;  2DL3 A;  3I5R A;  4CC4 B;  2DF6 A;  2EGC A;  3CQT A;  2K9G A;  3H0H A;  3VS0 A;  2RMO A;  2LX7 A;  1MV3 A;  2F2V A;  2KT1 A;  5HCK A;  1SRL A;  2HSP A;  1GCQ C;  2GNC A;  2RQW A;  3VS1 A;  4CC3 A;  1CKB A;  1NEB A;  2NWM A;  1JEG A;  1Y0M A;  2DA9 A;  3EG1 A;  2DE0 X;  2ED0 A;  3VS4 A;  1RLQ C;  2DX1 A;  1AOJ A;  5EC7 A;  1NEG A;  2NUZ A;  1T0J A;  3C0C A;  4WCI A;  1QKX A;  2JTE A;  2DM1 A;  1PKT A;  4R0K A;  1Y57 A;  4JJB A;  3H0F A;  2AKK A;  2K79 A;  3ZL7 C;  2BZ8 A;  4DEY A;  5I11 A;  2LQN A;  2PNI A;  1YCS B;  1H3H A;  3EGU A;  5GJW B;  2CH4 A;  2YUP A;  2EQI A;  2MIO A;  4HVV A;  1HSQ A;  1AEY A;  1WX6 A;  1ZLM A;  2O9V A;  1ARK A;  2LQW A;  5I22 A;  4GLM A;  1WA7 A;  2W0Z A;  4RTY A;  3QWY A;  2KE9 A;  4Z88 A;  4F16 A;  1UEC A;  1ZSG A;  2FRW A;  3QWX X;  4AG1 C;  2K3B A;  1AVZ C;  1E7O A;  4HCK A;  1T0H A;  2KYM A;  2LP5 A;  2DL7 A;  2JMA A;  2D8H A;  1SHF A;  1M3C A;  2KR3 A;  2J6O A;  3UF4 A;  2YDL A;  1NG2 A;  3GBQ A;  2DBM A;  1SSH A;  3TSZ A;  2JS2 A;  2KXD A;  5ECA A;  1QLY A;  4FSS A;  1GL5 A;  3KFV A;  4RTW A;  2CT4 A;  3O5Z A;  1JU5 C;  2QDL A;  3NGP A;  1GFC A;  4RTT A;  1B3Q A;  1UGV A;  4HVW A;  3REB B;  2F2X A;  1FYN A;  1T3L A;  2KRS A;  1WFW A;  2HCK A;  2W10 A;  2DNU A;  2GBQ A;  1E6G A;  1QWE A;  4OMO A;  2FO0 A;  2FPF A;  2YUO A;  3UA6 A;  2FG0 A;  1OPK A;  5FWB A;  2EYW A;  3VS3 A;  1X2Q A;  1VYT A;  1RUW A;  2ESW A;  2HEQ A;  1ZUU A;  3I35 A;  4A63 B;  1B07 A;  4HVU A;  2L0A A;  2PZ1 A;  1KFZ A;  1WXT A;  1AWO A;  1M3A A;  1JQQ A;  2KBT A;  1NLP C;  2B86 A;  1H92 A;  1S1N A;  3PVL A;  4D8K A;  1GRI A;  1SPK A;  2OI3 A;  2GTJ A;  2J6F A;  2AZS A;  1XOV A;  1Z9Z A;  2GTO A;  4D8D A;  1T3S A;  1M27 C;  1CSK A;  1X69 A;  1GBQ A;  4J9G A;  1TUC A;  4Z8A A;  1VA7 A;  4JPB W;  2EPD A;  2J6K A;  1I07 A;  1RLP C;  4ORZ A;  3ULR B;  2DL5 A;  1Z9Q A;  2RNA A;  4JZ4 A;  4LNP A;  1V1C A;  2SRC A;  2KT8 A;  1GCQ A;  2RPN A;  3FJ5 A;  1TG0 A;  4AFQ C;  2J06 A;  1U5S A;  2J7I A;  4F17 A;  2M0Y A;  2BZY A;  2DRM A;  1X6B A;  3VS5 A;  4AG2 C;  2D0N A;  1G2B A;  4K11 A;  3EHQ A;  1VYV A;  1OEB A;  2J05 A;  4OMQ A;  1UFF A;  4J9H A;  1FMK A;  3NMZ C;  1MV0 B;  2KNB B; 
#chains in the Genus database with same CATH topology
 1TWB A;  2FZK B;  3I5S A;  2P4T A;  3CCS A;  4JZ3 A;  2X3X D;  3OYH A;  3JCM J;  2O2O A;  4PNO A;  1QQJ A;  3OA6 A;  3BW1 A;  3H0I A;  3OYB A;  2HMA A;  3EHR A;  1E6H A;  4KRT A;  4OMM A;  3HTR A;  3U23 A;  2XU8 A;  3TQ7 P;  1KG1 A;  1D0Y A;  4M7D D;  3SFM A;  3OYJ A;  1KJW A;  2CRE A;  1IO6 A;  3CCU T;  2KEA A;  3CC4 T;  2K7A A;  2PVG B;  4M78 D;  4PJN A;  4C8Q F;  5HK0 A;  3CMA T;  2QAS A;  4C92 B;  2A7Y A;  2EQU A;  4NL2 A;  2DKG A;  2QA4 A;  4EIK A;  3CCE T;  2A3L A;  3VS6 A;  1N5Z A;  3RDV A;  4ESR A;  1KC8 C;  1N8R R;  1Y7X A;  4BI8 B;  1IHV A;  4LE9 A;  1VQ7 T;  2P0P A;  1WGS A;  1IZ6 A;  3VYH B;  2DXT A;  4PJO D;  2RH2 A;  4P5N A;  1FXX A;  2DEQ A;  4J9C A;  2K57 A;  2RI5 A;  3L2Z A;  1JXO A;  1X43 A;  1WIE A;  3OQ5 A;  3E19 A;  3CD6 A;  4M7D A;  3EG3 A;  2RD1 A;  1PC0 A;  5CR2 A;  1Q81 U;  2CGH A;  1VQ6 A;  3H41 A;  1BB9 A;  3MPU B;  1KQ1 A;  2QXF A;  1AWJ A;  2NUP B;  3RMS A;  4JJN K;  3M0R A;  2E65 A;  5A0G A;  1TU0 B;  3OYF A;  5DLO A;  1QVF A;  5GAN e;  2HBW A;  1VYU A;  5CKF A;  3PIO A;  5FLX E;  3CPW A;  2KRM A;  4HA8 A;  3G6E T;  4J7I A;  5GAM e;  1SKU B;  2VVK A;  2OTJ Q;  1J3T A;  3M0Q A;  1OUL A;  3I9Q A;  1RAA B;  1X01 A;  2SEM A;  2BZX A;  2FL7 A;  2FPE A;  3JB9 G;  4PJL A;  4X1V A;  2OJ2 A;  2F5K A;  2PTK A;  4C5E A;  3TVT A;  2WAC A;  2RHY A;  1HYO A;  5KYU A;  2CP5 A;  4FYY B;  4GBQ A;  3CCJ A;  2KMT A;  3Q1J A;  1RAB B;  1OYX A;  3MEW A;  5GMK l;  2H8H A;  1IXD A;  3HRT A;  3QDR B;  2DD4 A;  1K73 C;  2C0O A;  4M7D F;  2DYI A;  1GXI E;  1KQ2 A;  5KE3 A;  3REA B;  4M78 C;  2FEI A;  4FW2 A;  1CKA A;  4FU6 A;  1FX7 A;  2CP2 A;  1U06 A;  3MO8 A;  4M75 E;  1UJY A;  2EKH A;  3BDU A;  4LUD A;  5L8R E;  4OB2 B;  4C0D B;  2DD5 A;  5GAO n;  2ED1 A;  3LLR A;  2CUB A;  4C92 A;  1TSF A;  3OS2 A;  4N4G A;  4C92 E;  2ZPF B;  1VQ9 A;  2A08 A;  3TRE A;  3CCQ Q;  1YJ9 A;  3CCS T;  1VQN A;  2P84 A;  4N0A C;  4M77 B;  1KQS A;  2D6F A;  3VRY A;  1K9A A;  4QW2 A;  1M1K R;  4YTL A;  3TSW A;  2QI2 A;  3A98 A;  2L3Q A;  2LJ1 A;  1ZA1 B;  3HFN A;  3BFM A;  1B34 B;  4LDV A;  4IUQ A;  4M77 G;  4E7S A;  2CZ0 B;  4RUG A;  4ZN3 A;  3M4G A;  5LJ3 g;  1OV3 A;  2D9T A;  4J9B A;  2VXE A;  2COW A;  2YRD A;  3FIF A;  3HHT B;  2M02 A;  2BUD A;  3QII A;  2RK2 A;  2RA2 A;  4M78 B;  1KSW A;  3OBY A;  2I0N A;  3GIB A;  8ATC B;  1JRI A;  3UT1 A;  1Q81 C;  4WF2 A;  1Q7Y C;  3HP9 A;  4DEX A;  1HJD A;  1VQK A;  2DTH A;  3EFR A;  4PLI A;  4RCB A;  3RKY A;  4AT1 B;  2MWP A;  3C12 A;  3I56 T;  1NPR A;  3QHS A;  1KC8 U;  1K0S A;  2RO0 A;  4C0G A;  3RER A;  3ZFJ A;  4RTV A;  1RAC B;  1ACM B;  1UUE A;  1VQO A;  2DBK A;  2DO3 A;  1VQ5 T;  4FT4 A;  5GAN 3;  2K5I A;  4R55 A;  5EG2 A;  1WLP B;  1H8K A;  1SEM A;  2VYT A;  1UE9 A;  2MAM A;  4FT2 A;  4XTX A;  2HDA A;  1YJN T;  1K8A R;  2VGN A;  1M1K U;  2DJQ A;  1YIJ T;  4F7U E;  1M9S A;  4OMF B;  3ZBD A;  1C6V X;  3OY9 A;  2FZG B;  3HFO A;  2MMP A;  3H0H A;  2RMO A;  5GAN 5;  1Q82 C;  1VQM T;  3M56 A;  1MV3 A;  3PMT A;  3KBG A;  2LT4 A;  1VQ7 A;  2HSP A;  1Y07 A;  2RQW A;  4CC3 A;  1NEB A;  1QP3 A;  2I2L A;  2NWM A;  1Y0M A;  5KCO A;  3SDZ A;  1U1T A;  4E7H A;  4M7D C;  4M7A B;  5CVI A;  3VS4 A;  2MWO A;  2X9H A;  3E1S A;  3CD6 T;  3KUF A;  2NUZ A;  1T0J A;  3QSU A;  2QK0 A;  1PKT A;  4CRI A;  4BI4 A;  1W2B S;  3H0F A;  5GAO q;  3RR6 A;  2BE9 B;  4DEY A;  2LQN A;  3LX7 A;  4JRI A;  1FMV A;  4TVR A;  5GJW B;  1YJN Q;  2L89 A;  2YUP A;  2EQI A;  2MIO A;  4HVV A;  4C5H A;  5FU7 B;  2RJC A;  3EG9 B;  1ZLM A;  1YIT A;  2H3E B;  1BIA A;  2LQW A;  2L3R A;  3A8O B;  5GAO l;  1WA7 A;  1WZO A;  4Z88 A;  2E64 A;  3VV0 A;  1IB8 A;  4JRQ A;  5GAM j;  3QWX X;  2K3B A;  5GMK m;  1T0H A;  2LP5 A;  2DL7 A;  1M3C A;  1UGR B;  2RI2 A;  3INZ A;  4BAC A;  5M9O A;  2WSE E;  2EKO A;  5KYY B;  3OYN A;  3LYI A;  2L5Q A;  2QDL A;  3DB4 A;  5LJ5 h;  3JCM Q;  4J83 A;  3RMQ A;  6AT1 B;  5GAO m;  4HVW A;  2PQW A;  3GPL A;  5KYW B;  2KRS A;  4XU0 A;  1PSF A;  4LXC A;  2RJF A;  1SG5 A;  3PIP A;  5GAN 7;  1OPK A;  2EYW A;  1WHK A;  3OBW A;  5FRO A;  1YJ9 Q;  5GAN 2;  2L0A A;  1Q7Y R;  1AWO A;  2DIG A;  1WHG A;  2YWW A;  1M3A A;  3MP8 A;  2KBT A;  3AHU A;  2B86 A;  4V2S A;  1S1N A;  2R5M A;  4Q5W A;  1KD1 C;  1KHC A;  5GAN g;  1SF9 A;  4BY6 B;  2GTJ A;  3O8V A;  4KGX B;  3FB9 A;  4MML A;  3OYD A;  2YHT A;  2IPO B;  3PNW C;  4DBR A;  2C06 A;  2EIF A;  2V8I A;  1VQ9 T;  4JLG A;  4XTY A;  1N6A A;  1X69 A;  4Z8A A;  3CCS Q;  2KAF A;  3CCJ Q;  1VQ5 Q;  2EPD A;  2J6K A;  3JB9 H;  3ULR B;  3H8Z A;  2DL5 A;  2IVW A;  5GAM f;  3I55 T;  3H6Z A;  2RI3 A;  3FJ5 A;  4AFQ C;  2HNI A;  2M0Y A;  2DRM A;  1K8A U;  4LD6 A;  3QZ5 B;  3VS5 A;  3G4S Q;  5FRM A;  3JB9 I;  1G2B A;  4K11 A;  1VQ4 T;  1PCX A;  4KH0 B;  5IXB A;  3NPF A;  1X2K A;  2K3X A;  1YJN A;  1NJI U;  2OTJ T;  5IHI A;  1M30 A;  2BE7 D;  1YFN A;  1ZHI A;  2ZCF B;  3LGF A;  5GAN h;  2OAW A;  2CKK A;  3CBP A;  5KYN A;  1O75 A;  2AKL A;  2IG0 A;  3ZEH A;  1ZUK A;  4N4H A;  5GAN d;  4ZGE B;  2NUP A;  3BE3 A;  3VS2 A;  2L2P A;  1VQP A;  4BE1 A;  1PD1 A;  4ZGJ B;  2DVE A;  3PT9 A;  1KC8 R;  4OB1 B;  4RTX A;  3M0U A;  3JCM g;  5LJ3 h;  3CXC S;  2DPP B;  1OZ3 A;  1U8R A;  2OAU A;  4FL6 A;  4J9I A;  5CKE A;  1G8X A;  2X4W A;  3LWI A;  3M0P A;  3QYH B;  2EYZ A;  4PJO E;  1BK2 A;  2DXB A;  1VQM Q;  4F14 A;  3CBM A;  3QPH A;  4FYW B;  4BI3 A;  3I56 A;  4M77 F;  3GOX A;  4M75 A;  1VQO Q;  3LGL A;  4NS5 A;  2D1X A;  1I1J A;  2CUD A;  3OMC A;  1VQO T;  1W2B A;  4LD9 K;  2OTL T;  2K2V A;  3X24 B;  3VUZ A;  4N4I A;  3CC7 Q;  3EGD B;  2LX9 A;  1G5V A;  3OW2 S;  1YI2 Q;  2JJ9 A;  2A28 A;  2ZPI B;  1WDX A;  1JXM A;  2VV5 A;  2ZPE B;  2MCN A;  1ABO A;  1VQ6 T;  3L2V A;  2O31 A;  1VQL A;  4JJD A;  2ZPB B;  2HKN A;  1VQ6 Q;  1G3W A;  1KD1 R;  3J7A F;  1BCM A;  5I21 A;  3X28 B;  3S3O A;  1S72 A;  1YWP A;  1WJR A;  1R0C B;  3THK A;  4M78 F;  1Q81 R;  2RHI A;  4C8Q D;  1D3B B;  1NLO C;  2C0T A;  3JCM P;  2ZPH B;  4DQ2 A;  1G3T A;  1QKW A;  2GGR A;  1SSF A;  3OMG A;  2FHD A;  2JZ2 A;  1U1S A;  5FU6 C;  1JJ2 P;  5DM7 R;  2E70 A;  1PM3 A;  4AFS C;  2OTJ A;  1BI0 A;  5CAI A;  1W2B P;  3V8L A;  3M53 A;  4JLI A;  1I0C A;  4FYX B;  4IUV A;  4OGE A;  2VGM A;  3R6N A;  1MMD A;  1TOV A;  5GJV B;  2GF7 A;  2ROT A;  4OP0 A;  2GQV A;  2DFU A;  2NYS A;  2ZPG B;  4XU2 A;  3I55 A;  1UEB A;  1YNZ A;  4IKF A;  5FWC A;  9ATC B;  3HRS A;  5LJ5 f;  1JBM A;  4WTO B;  3J80 E;  3OB9 A;  3RNJ A;  3OYI A;  3MEA A;  2RJD A;  1VIE A;  1UHC A;  3EGX B;  3M55 A;  2K6D A;  3FC3 A;  5CIU A;  2V8J A;  3CCM Q;  1WYX A;  1TH7 A;  5A0D A;  2VXF A;  2ZGW A;  1GCP A;  3EAE A;  2O4X A;  5GAN 8;  3FJP A;  3R6O A;  4M77 D;  2C0I A;  3UDC A;  5FRN A;  1M8M A;  3OS0 A;  3OYL A;  3OYY A;  1MUZ A;  1VQ8 T;  4J8O A;  5CKH A;  4Z89 A;  4M7A F;  1VQN Q;  2BIV A;  1PKS A;  5GAN 6;  1HD3 A;  3JCM d;  2DTO A;  3OYK A;  1K4U S;  1VQP T;  4DA4 A;  2QQR A;  2E1H A;  3OYM A;  4QQD A;  2QAZ A;  2RQU A;  1VQP Q;  4C0D C;  4QT7 A;  5IHK A;  3HRU A;  4IIO A;  3V8J A;  1QCN A;  4A54 A;  3L2Q A;  1KQS S;  1PSE A;  1TS9 A;  5GAM h;  1UHF A;  2PVO B;  2ENM A;  4LDU A;  1LCK A;  2CT3 A;  3E9G A;  4OML A;  4R56 A;  2LRQ A;  3HPW A;  2VKN A;  1RAI B;  2CP6 A;  3A5Z B;  2Y4Y A;  1QWF A;  4LUE A;  5KYU B;  1W1F A;  2XDP A;  5DLQ E;  3TEE A;  2RQT A;  1HXD A;  3QBY A;  1GBR A;  3WVD B;  2F5T X;  2M0O A;  4KBM B;  3JAM E;  1K0X A;  5D7U A;  3X20 B;  4GY5 A;  4C8Q C;  4J6Y A;  4MMK A;  1YI2 T;  3NTH A;  2K9G A;  4MZM A;  1K73 R;  1WJQ A;  4FCY A;  3I56 Q;  1Q86 R;  2YXY A;  5KYY A;  1GCQ C;  2CYZ B;  2GNC A;  3EH1 A;  1M5Q 1;  3VS1 A;  4RMO A;  5LL6 S;  1VQ9 Q;  1RLQ C;  2E4H A;  4E7J A;  3EH2 A;  5EC7 A;  1Y96 A;  3M58 A;  2XKO C;  2MPX C;  2FB7 A;  4WCI A;  3PTA A;  1Y57 A;  4JJB A;  2AKK A;  1EX4 A;  2BZ8 A;  4X9D A;  1YCS B;  3UWN A;  1WHH A;  1LJO A;  3EGD A;  1MND A;  3G1J A;  4OGC A;  4C92 C;  1N9S A;  2LQK A;  3S3N A;  1AEY A;  4XTU A;  2VB6 A;  4M7A E;  2O9V A;  1OX8 A;  3JB9 F;  4ZTF A;  4FM4 B;  4ELY C;  2JUF A;  1VIF A;  1F1B B;  2FRW A;  5LJ5 e;  1ZBX A;  4AG1 C;  4HCK A;  2DAQ A;  2KYM A;  2D8H A;  2EQK A;  3FLG A;  3GLX A;  2J6O A;  1Y71 A;  1NG2 A;  2YDL A;  5CQX A;  5GAN 4;  2DBM A;  1SSH A;  3GNG A;  4M77 C;  2HQE A;  4DOW A;  1QLY A;  5DY9 A;  1GL5 A;  2JTM A;  4RTW A;  2CT4 A;  1MNE A;  3CCU A;  5KYX B;  3NGP A;  4M7D G;  4RTT A;  1NJI R;  1UGV A;  3MEU A;  4XK8 E;  2OTL A;  5GMK i;  5GAN j;  2FO0 A;  2FPF A;  2NLU A;  4XU1 A;  3MJX A;  2E3H A;  2DIQ A;  2Y4X A;  5FWB A;  1RUW A;  2HEQ A;  4NOY A;  4ELZ C;  4OB0 B;  4F7U B;  1UGS B;  5GAM g;  3KXT A;  3G4S T;  1KFZ A;  3CCR A;  2XHC A;  1N9R A;  2XI9 A;  3JCM V;  4ME7 A;  3MCA B;  5KYW A;  3QKJ A;  3CCL Q;  1M1K C;  1SPK A;  2OI3 A;  5CO7 A;  3CXC A;  3S6W A;  3EGX A;  1RI0 A;  1T3S A;  2KVQ G;  4E2F B;  3CC4 Q;  4JUV A;  4J9G A;  1TUC A;  5I2S A;  4D6W A;  4HCC A;  4HCB A;  3CME T;  1NE8 A;  4ORZ A;  4JZ4 A;  2RNA A;  1NZ9 A;  2E41 A;  2EJF A;  1P92 A;  2RB6 A;  2Y90 A;  5J39 A;  5GAO r;  1V29 B;  2LQ8 A;  3MKD A;  4JRK A;  4E7K A;  3VKI A;  4AG2 C;  3M5A A;  1VQ8 Q;  2HQH A;  2DZC A;  1YHQ A;  2BKD N;  2WSC E;  3OS5 A;  1OEB A;  2J05 A;  4OMQ A;  4LDX A;  3NMZ C;  2KNB B;  3V7R A;  1PNJ A;  3RKX A;  5LJ3 f;  3EG0 A;  4M7D B;  4C5G A;  2EWN A;  2YUN A;  2XG8 D;  4OMP A;  1OZ2 A;  1HK9 A;  3JB9 D;  2G3R A;  2HBP A;  3VS7 A;  4DBQ A;  1BI3 A;  3WXM B;  4C92 D;  1SHG A;  4A4E A;  1YWO A;  1M90 C;  1X75 C;  2G6F X;  4ZNX A;  4C0F A;  1XNI A;  2LTO A;  1NPP A;  3SWN C;  1D1B A;  2LZ6 B;  1RAH B;  2QTX A;  4J5Y A;  1G3S A;  1G3Y A;  2IIM A;  2D8J A;  4XAX B;  3HKS A;  2KYB A;  4A4G A;  2RF0 A;  3CC7 T;  3NFC A;  5CCA A;  3QG1 A;  1KK7 A;  1KIK A;  3UPU A;  2D0Q B;  3LWH A;  4FYV B;  1U3O A;  1YJW T;  3AT1 B;  4IIM A;  1WHJ A;  4M75 F;  4EPC A;  1H64 1;  2LCC A;  1PHT A;  1VQ8 A;  3RBB B;  3URG A;  4LN2 A;  2KQW A;  4XTV A;  4BB7 A;  4DBF A;  2FRY A;  2EBP A;  2XD0 A;  2DRK A;  1SRM A;  4RKU E;  4J9E A;  1JJ2 A;  2GFU A;  2MYS A;  2EJG A;  3WVE B;  1Q82 U;  1EFN A;  2R5A A;  3P8D A;  3M57 A;  3MET A;  1MGQ A;  2CDT A;  5IHN A;  4AFU C;  3UA7 A;  1G83 A;  2M16 A;  1TTH B;  2ABL A;  2F1L A;  1UG1 A;  4HT8 A;  3PE0 A;  3T9N A;  3MEV A;  2F69 A;  3GNF B;  7AT1 B;  5IXF A;  3TU4 K;  2COY A;  2E6Z A;  3SB2 A;  4A4K A;  2M51 A;  2LMJ A;  1MMA A;  4HT9 A;  4E7Z A;  4M75 B;  4RTZ A;  3A8M B;  2JM9 A;  3OS1 A;  2JXB A;  2A36 A;  1DJ7 B;  2CH4 W;  2YLB A;  1GFD A;  3UAT A;  1JJ2 S;  1KD1 U;  5LJ5 g;  1I8F A;  1IGQ A;  3H9N A;  4PKC C;  3A8G B;  1WNL A;  3CC2 Q;  1WXU A;  3RES A;  5C6S A;  3G71 T;  3M59 A;  1NJI C;  4C92 F;  2VC8 A;  5A2Q E;  5FW9 A;  3V7S A;  4EDU A;  4JJC A;  3OYC A;  2DK3 A;  2LCS A;  2YRV A;  1AZG B;  1ZUY A;  4BD3 A;  5LJ3 d;  2XDB A;  4IUT A;  4QQG A;  2O9S A;  4DOV A;  1FWZ A;  2ATC B;  4HXJ A;  3CCQ T;  1ABQ A;  4M4Z A;  2QGG A;  4XQ3 A;  4KUL A;  3NTI A;  5IN1 A;  1PRL C;  2F2W A;  1KQS P;  1D0X A;  2LJ3 A;  3X26 B;  3VJP A;  1MMN A;  2E12 A;  3SEM A;  3CC7 A;  2P4R A;  5GAN f;  2CP7 A;  4J6W A;  2O88 A;  3GF5 A;  1YHQ T;  4F7U G;  1RI9 A;  1YHQ Q;  2KI7 A;  1YIJ Q;  2EYY A;  2QDY B;  2DMO A;  4B9W A;  2P0Q A;  2XMF A;  2DYB A;  1ZSZ C;  1EIF A;  1LVK A;  2LJ0 A;  1VQ4 Q;  4CC2 A;  3JSC A;  1YP5 A;  1W70 A;  1AD5 A;  3L42 A;  3QUI A;  1BBZ A;  2GFA A;  3JV3 A;  2CSI A;  2MF2 A;  4Z02 A;  4PL6 A;  4EMH A;  3M4Y A;  1OU8 A;  4ANJ A;  4PJJ A;  1OOT A;  2ECZ A;  3RIR A;  4ATO A;  3EFO B;  1NM7 A;  2DL4 A;  4KT0 E;  1AWX A;  3NHN A;  2FPD A;  2CZ6 B;  3LH0 A;  2R58 A;  4VUB A;  4BE0 A;  2JW4 A;  1ZX6 A;  4X9C A;  1TUD A;  3G7Z A;  1PG5 B;  4J9D A;  1WI7 A;  2YSQ A;  2CZ7 B;  1OQK A;  3E9F A;  2WSF E;  3G71 A;  1M3B A;  3VRZ A;  1KHI A;  2DTI A;  4Y91 A;  3EG9 A;  4IUU A;  2RJE A;  2DL3 A;  2PUK B;  3QZ9 B;  3D7S B;  3I5R A;  1M1G A;  4CC4 B;  2COZ A;  2EGC A;  3CQT A;  2XIC A;  1M1F A;  2ZZD A;  2F2V A;  2O4X B;  5HCK A;  2DEU A;  2FYK A;  3JCM f;  1VQ7 Q;  1CKB A;  1JEG A;  1RAE B;  5GAO p;  2DXU A;  2QQB A;  2DE0 X;  2ED0 A;  1ZA2 B;  2MI6 A;  4L59 A;  2DX1 A;  1AOJ A;  3JB9 J;  4RG2 A;  5CKB A;  2H3J A;  3C0C A;  5KYX A;  5GMK e;  3QJY A;  3JRZ A;  4R0K A;  5J26 A;  3DLM A;  4M7A D;  1M4Z A;  3DB3 A;  3QJ6 A;  2B8A A;  2K79 A;  3ZL7 C;  3QXE B;  5I11 A;  2PNI A;  3CC4 A;  1D09 B;  3ASK A;  1R8O B;  2CH4 A;  1Q86 C;  3EFO A;  4PJO B;  4MDW A;  2JVV A;  3CME Q;  4RG8 A;  1K9M R;  1QVF S;  1HSQ A;  1M2V A;  2RHZ A;  5C0M A;  4JS4 A;  1XTD A;  3C4S A;  4RTY A;  3QWY A;  3G6E Q;  5J3B A;  3NTK A;  2JMA A;  4NL3 A;  4C8Q E;  3CPF A;  2RK1 A;  3CCE A;  1VQL T;  3UF4 A;  4KUD K;  3J81 E;  3TSZ A;  1VQ4 A;  5ECA A;  4QKU A;  4FSS A;  4MZP A;  3OW2 A;  1YIT T;  5AT1 B;  1B7T A;  3KFV A;  3N5B B;  3G4S A;  1S72 Q;  3CCR T;  1B3Q A;  3REB B;  3CMA Q;  3CCL A;  1FYN A;  1T3L A;  1QW1 A;  1WFW A;  2W10 A;  2DNU A;  3CCM A;  1E6G A;  1QWE A;  2X51 A;  4FIB A;  1IHW A;  4HCZ A;  3UA6 A;  2FG0 A;  3CCV A;  5LJ3 e;  2EYQ A;  4O5V A;  4QVD A;  5LJ5 j;  1ZUU A;  3I35 A;  4A63 B;  4CI0 C;  4BDZ A;  2PU9 B;  3QDF A;  2PZ1 A;  1WXT A;  5CQY A;  5GMK h;  1BI2 A;  3CME A;  4LDY A;  1H92 A;  4UC4 A;  1M2O A;  3PVL A;  1YI2 A;  4D8K A;  1GRI A;  1N27 A;  4N0A A;  2HL3 A;  1XOV A;  1Z9Z A;  2CP3 A;  1RAG B;  1K73 U;  4E7L A;  1I5L A;  1CSK A;  1Q7Y U;  4C8Q A;  1VA7 A;  2VUB A;  4FSX A;  2X4J A;  1RLP C;  1YBY A;  2LT1 A;  2CP0 A;  3FEO A;  2SRC A;  2KT8 A;  1GCQ A;  1QVP A;  2RPN A;  4JRP A;  1TG0 A;  1TUG B;  2J06 A;  2J7I A;  3C94 A;  3OSV A;  2BZY A;  1RAD B;  2QGF B;  2CS7 A;  1I4K 1;  1R0B G;  2QEX Q;  2YLC A;  1UB4 A;  2EFI A;  3EHQ A;  1UFF A;  4J9H A;  1FMK A;  1MV0 B;  1VUB A;  4BE2 A;  1QCO A;  3CCV T;  5KE2 A;  4M7A C;  2KY9 A;  2K2M A;  3CCQ A;  2GQI A;  3P8H A;  2DIL A;  1X6O A;  5D6Y A;  3L2R A;  2QA4 Q;  4M7D E;  4C8Q G;  1WHL A;  2P0K A;  3M0T A;  4RTU A;  1H3Z A;  3CPW S;  4IUR A;  2E3I A;  3CD6 Q;  3JCM c;  2DL8 A;  1AWW A;  2V8K A;  4ZGD B;  1WJS A;  1NYF A;  1X27 A;  5A0L A;  1M2V B;  4J9F A;  1RL2 A;  1N8R U;  3CC2 T;  1QVG S;  3MP6 A;  1UTI A;  2AT1 B;  1VOM A;  1XJW B;  4ZN1 A;  2V1R A;  2QEX A;  2K3Y A;  2XID A;  2K5L A;  1PWT A;  3MP1 A;  1VQK Q;  2EQJ A;  1OPL A;  2EQM A;  2PVD B;  1VQ5 A;  3X25 B;  3S3M A;  2DXC A;  4B9X A;  2KXC A;  3CXC P;  5IH2 A;  1VQM A;  2NUT A;  4J7F A;  4QQ6 A;  1UGP B;  2X35 A;  3DLL A;  4KUI A;  5I2M A;  1K76 A;  2JS0 A;  2A0F B;  1MHN A;  1IRE B;  2DET A;  1S72 T;  2EYX A;  4QVC A;  5KCH A;  4XTW A;  4PJO A;  2ROL A;  4BDY A;  1UGQ B;  1QCF A;  1W6X A;  2DZ9 A;  2JMC A;  2E5K A;  3L1A A;  3IQL A;  4J6X A;  4EMK A;  4CC7 A;  3A1P A;  1D3B A;  3SWN A;  4OF1 A;  2YRC A;  1QVG P;  1K9M U;  2JT4 A;  3PMI A;  3VYG A;  1YJW A;  4IUP A;  2HSE B;  3E2U A;  2HAX A;  4A4H A;  2YUQ A;  4M78 A;  3JCM b;  3JCM h;  1C0M A;  2LNH B;  4E6R A;  1YJW Q;  2EW3 A;  5L23 A;  4KH1 B;  2L3P A;  2JN0 A;  4C8Q B;  4PFP A;  4PFO A;  1BYM A;  3PVQ A;  3F70 A;  2VWF A;  2L8D A;  2BTT A;  4FW1 A;  2M9U A;  3A8H B;  1VQK T;  1WHM A;  2LVM A;  1A0N B;  3L2U A;  2K4Y A;  2HD0 A;  4L6V 5;  4E7I A;  2MOX A;  3ME9 A;  1OI1 A;  1RAF B;  2AHJ B;  1JO8 A;  5CK9 A;  2RQV A;  4A4F A;  4M77 A;  1C1A A;  2DER A;  2QG9 B;  1JB0 E;  1R77 A;  1I5O B;  3LH5 A;  1LOJ A;  2LC4 A;  4BUG A;  2E10 A;  2EAY A;  4M7A G;  3SD4 A;  2KDS A;  3CCU Q;  4M75 D;  2QTV A;  1X6G A;  1BU1 A;  5AYF A;  3M54 A;  3C95 A;  1PD0 A;  2RQR A;  5HKC A;  1VQN T;  2EGE A;  3FDR A;  3CCE Q;  1YN8 A;  2E6N A;  2QEX T;  1YCY A;  3PGG A;  1Q86 U;  2V1Q A;  2CSQ A;  1BKB A;  3OYG A;  3P8B B;  3CC2 A;  3QYG B;  1K8A C;  4XU3 A;  1TXQ A;  2Z0W A;  4AFZ C;  2DLP A;  2X3W D;  4M77 E;  3OW2 P;  2EVR A;  3CMA A;  1OX9 A;  3HSB A;  2M1H A;  4PJM A;  2QA4 T;  1NBE B;  4B6M A;  3SWN B;  1UJ0 A;  2KRN A;  3SHW A;  2RHU A;  3L2W A;  1NYG A;  4Y92 A;  3EG2 A;  2OX7 A;  1EZZ B;  3CCJ T;  4OB3 B;  1WQ7 A;  3OYA A;  1PRM C;  3QO3 A;  5HY6 A;  4L5G A;  3GP8 A;  2EGA A;  3FRN A;  5D6W A;  4EMG A;  3JCM e;  1D0Z A;  4F04 B;  2JNG A;  1LNX A;  3BY7 A;  4M75 G;  4OMN A;  2QYZ A;  1BI1 A;  4C5I A;  4A53 A;  1AHJ B;  1K1Z A;  1O9S A;  2DVJ A;  2JTF A;  1YIT Q;  1M8V A;  1AT1 B;  5LJ5 d;  2KK4 A;  3G6E A;  2A37 A;  4O6J A;  2O01 E;  4M78 G;  1VQL Q;  2X4X A;  2RN8 A;  2JOY A;  2RM4 A;  2HQX A;  2V26 A;  1IRX A;  2AK5 A;  3M0S A;  2KGT A;  4E47 A;  2RHX A;  1WXB A;  2AZV A;  2JM8 A;  3V8K A;  5FU7 C;  3DKM A;  1QVF P;  4LDW A;  1AZE A;  1UDL A;  1ZBJ A;  2L3S A;  2YT6 A;  3BDL A;  2EJ9 A;  1YJ9 T;  4F7U F;  3CEY A;  1ZSZ B;  2KRO A;  3M9Q A;  8AT1 B;  3VUB A;  2DF6 A;  3MHX A;  4MZT A;  2K5F A;  3V7C A;  3VS0 A;  1K9M C;  2LX7 A;  2KT1 A;  3VU3 C;  1M90 U;  1Q95 G;  1FMW A;  1SRL A;  1XQH A;  4PFZ A;  2LDM A;  5IAY A;  4PK4 A;  2DA9 A;  3EG1 A;  4KGV B;  1I81 A;  4M75 C;  3JCM W;  2QQA A;  1V76 A;  4C0Z A;  2QQ9 A;  1NEG A;  5GMK j;  3JCM X;  1D1C A;  1N8R C;  1QKX A;  2JTE A;  2DM1 A;  1WQW A;  3HL8 A;  4PLL A;  2HZY A;  3CCR Q;  3I55 Q;  2LNV A;  3CBO A;  5LJ3 j;  1BCO A;  1H3H A;  3EGU A;  3OSS C;  3PFS A;  1Q82 R;  4DBH A;  2XK0 A;  4OVA A;  1M90 R;  1WX6 A;  2FZC B;  5KH6 A;  1ARK A;  4EMK B;  5I22 A;  1ZQ1 A;  4GLM A;  2W0Z A;  2KE9 A;  4II1 A;  2KSS A;  1UEC A;  1ZSG A;  4F16 A;  1AVZ C;  1E7O A;  3LW5 E;  3CCL T;  1SHF A;  4BY6 C;  4MDX A;  2KR3 A;  2X4Y A;  2QQS A;  3GBQ A;  2JS2 A;  4XTZ A;  2KXD A;  1IGU A;  2E5Q A;  3O5Z A;  1W4S A;  4ZTJ A;  1JU5 C;  3RUX A;  2CZ1 B;  1GFC A;  1QP2 A;  1MMG A;  1Y96 B;  1LPL A;  4X34 A;  2F2X A;  3OYE A;  2HCK A;  2AIR B;  3G71 Q;  2GBQ A;  2NUT B;  5GAM d;  4OMO A;  2HL5 C;  4PJO F;  2XDD A;  1QVG A;  2YUO A;  2LCL A;  1D1A A;  4PJO C;  1QMC A;  3VS3 A;  4KGZ B;  1X2Q A;  1VYT A;  3EFS A;  4AMC A;  2ESW A;  2R57 A;  1B07 A;  2FVU A;  4HVU A;  5IT9 E;  4EMK C;  1B34 A;  4RCC A;  4Y28 E;  1JQQ A;  1NLP C;  2PUO B;  2HKQ B;  4C92 G;  4PJO G;  5D6X A;  3RKW A;  3CCV Q;  2J6F A;  2AZS A;  4JS5 A;  2GTO A;  3ER0 A;  4D8D A;  4GLK A;  1M27 C;  4JDS A;  1GBQ A;  4HKE A;  2DJZ A;  2MK5 A;  2GCX A;  4JPB W;  3A8L B;  1OU9 A;  5FU6 B;  1I07 A;  4F7U A;  4QVZ A;  3CCM T;  4LNP A;  1Z9Q A;  1V1C A;  3CPW P;  2OTL Q;  4M7A A;  1U5S A;  3TCJ A;  4F17 A;  4M78 E;  1ZSZ A;  2ZAE A;  1X6B A;  5HK3 A;  1BIB A;  2VAS A;  2D0N A;  5CKD A;  1YIJ A;  1VYV A;  1WPY A; 
#chains in the Genus database with same CATH homology
 3NPF A;  3I5S A;  1X2K A;  4JZ3 A;  2X3X D;  1PNJ A;  2O2O A;  3EG0 A;  5IHI A;  1M30 A;  2K2M A;  2YUN A;  2GQI A;  4OMP A;  2DIL A;  3H0I A;  2OAW A;  3EHR A;  1E6H A;  3VS7 A;  4KRT A;  4OMM A;  3U23 A;  3M0T A;  4RTU A;  1SHG A;  2AKL A;  1YWO A;  2G6F X;  1KJW A;  4ZNX A;  1ZUK A;  2CRE A;  1IO6 A;  2DL8 A;  1AWW A;  3VS2 A;  2KEA A;  2L2P A;  2K7A A;  2LZ6 B;  1NYF A;  1X27 A;  4J9F A;  2IIM A;  2D8J A;  4RTX A;  3M0U A;  4EIK A;  2KYB A;  2RF0 A;  3VS6 A;  1N5Z A;  1UTI A;  4ESR A;  1KIK A;  2V1R A;  4J9I A;  1PWT A;  1U3O A;  4LE9 A;  1OPL A;  4IIM A;  3M0P A;  2EYZ A;  2KXC A;  1PHT A;  5IH2 A;  1BK2 A;  4J9C A;  3RBB B;  4F14 A;  1K76 A;  2JS0 A;  1JXO A;  1X43 A;  4LN2 A;  1WIE A;  3EG3 A;  2EYX A;  2FRY A;  2ROL A;  2EBP A;  1QCF A;  1W6X A;  2DRK A;  1SRM A;  2D1X A;  1I1J A;  2JMC A;  2CUD A;  3H41 A;  2E5K A;  1BB9 A;  4J9E A;  3IQL A;  4CC7 A;  1AWJ A;  1EFN A;  2JT4 A;  3M0R A;  2YUQ A;  2HBW A;  1VYU A;  4E6R A;  2LNH B;  2CDT A;  2EW3 A;  2A28 A;  5IHN A;  4AFU C;  5L23 A;  1WDX A;  1JXM A;  2KRM A;  3UA7 A;  1G83 A;  2MCN A;  1ABO A;  2ABL A;  1UG1 A;  2L3P A;  2O31 A;  3PE0 A;  4JJD A;  3PVQ A;  2VWF A;  2VVK A;  2BTT A;  1J3T A;  3M0Q A;  1A0N B;  3I9Q A;  2SEM A;  2BZX A;  1YWP A;  2MOX A;  2FPE A;  3THK A;  4X1V A;  2OJ2 A;  1JO8 A;  5IXB A;  5IXF A;  1NLO C;  2C0T A;  2PTK A;  2M51 A;  2RQV A;  2LMJ A;  3TVT A;  1QKW A;  2GGR A;  4RTZ A;  2JM9 A;  3LH5 A;  2JXB A;  2A36 A;  2CH4 W;  4GBQ A;  4AFS C;  1GFD A;  3UAT A;  1WXU A;  1I0C A;  1X6G A;  1BU1 A;  2H8H A;  3R6N A;  2C0O A;  2RQR A;  2EGE A;  5GJV B;  3REA B;  2ROT A;  5FW9 A;  2FEI A;  4JJC A;  1CKA A;  1U06 A;  2LCS A;  1AZG B;  1YN8 A;  1YNZ A;  1ZUY A;  1UJY A;  5FWC A;  2EKH A;  2O9S A;  2V1Q A;  4LUD A;  2CSQ A;  2ED1 A;  4AFZ C;  2CUB A;  2DLP A;  2X3W D;  3RNJ A;  4HXJ A;  1ABQ A;  4M4Z A;  2EVR A;  1PRL C;  2F2W A;  2A08 A;  2LJ3 A;  1UHC A;  3SEM A;  2K6D A;  2P4R A;  2O88 A;  1UJ0 A;  2KRN A;  3VRY A;  1WYX A;  1K9A A;  3SHW A;  3TSW A;  1NYG A;  1RI9 A;  4Y92 A;  3EG2 A;  1GCP A;  3A98 A;  2L3Q A;  2LJ1 A;  2EYY A;  2C0I A;  1PRM C;  2DMO A;  1M8M A;  2XMF A;  2DYB A;  4RUG A;  2EGA A;  1MUZ A;  2LJ0 A;  1OV3 A;  4CC2 A;  4J9B A;  1YP5 A;  1W70 A;  1AD5 A;  4Z89 A;  1BBZ A;  3JV3 A;  2CSI A;  1KSW A;  2I0N A;  1PKS A;  4OMN A;  1HD3 A;  4DEX A;  1HJD A;  1OOT A;  1K4U S;  2ECZ A;  1K1Z A;  2DVJ A;  1NM7 A;  2RQU A;  2A37 A;  1K0S A;  2DL4 A;  4QT7 A;  5IHK A;  1AWX A;  4IIO A;  3NHN A;  2FPD A;  2RN8 A;  4RTV A;  1UUE A;  1UHF A;  2DBK A;  2AK5 A;  2ENM A;  3M0S A;  2KGT A;  1LCK A;  2CT3 A;  1WLP B;  2JW4 A;  1H8K A;  1SEM A;  1ZX6 A;  1UE9 A;  4OML A;  1TUD A;  2HDA A;  2VKN A;  1QWF A;  1WXB A;  4J9D A;  4LUE A;  1W1F A;  2AZV A;  1WI7 A;  2RQT A;  2JM8 A;  2YSQ A;  1GBR A;  1AZE A;  1UDL A;  2DJQ A;  1M3B A;  1ZBJ A;  2L3S A;  2YT6 A;  3VRZ A;  1K0X A;  2KRO A;  2DL3 A;  3I5R A;  4CC4 B;  2DF6 A;  2EGC A;  3CQT A;  2K9G A;  3H0H A;  3VS0 A;  2RMO A;  2LX7 A;  1MV3 A;  2F2V A;  2KT1 A;  5HCK A;  1SRL A;  2HSP A;  1GCQ C;  2GNC A;  2RQW A;  3VS1 A;  4CC3 A;  1CKB A;  1NEB A;  2NWM A;  1JEG A;  1Y0M A;  2DA9 A;  3EG1 A;  2DE0 X;  2ED0 A;  3VS4 A;  1RLQ C;  2DX1 A;  1AOJ A;  5EC7 A;  1NEG A;  2NUZ A;  1T0J A;  3C0C A;  4WCI A;  1QKX A;  2JTE A;  2DM1 A;  1PKT A;  4R0K A;  1Y57 A;  4JJB A;  3H0F A;  2AKK A;  2K79 A;  3ZL7 C;  2BZ8 A;  4DEY A;  5I11 A;  2LQN A;  2PNI A;  1YCS B;  1H3H A;  3EGU A;  5GJW B;  2CH4 A;  2YUP A;  2EQI A;  2MIO A;  4HVV A;  1HSQ A;  1AEY A;  1WX6 A;  1ZLM A;  2O9V A;  1ARK A;  2LQW A;  5I22 A;  4GLM A;  1WA7 A;  2W0Z A;  4RTY A;  3QWY A;  2KE9 A;  4Z88 A;  4F16 A;  1UEC A;  1ZSG A;  2FRW A;  3QWX X;  4AG1 C;  2K3B A;  1AVZ C;  1E7O A;  4HCK A;  1T0H A;  2KYM A;  2LP5 A;  2DL7 A;  2JMA A;  2D8H A;  1SHF A;  1M3C A;  2KR3 A;  2J6O A;  3UF4 A;  2YDL A;  1NG2 A;  3GBQ A;  2DBM A;  1SSH A;  3TSZ A;  2JS2 A;  2KXD A;  5ECA A;  1QLY A;  4FSS A;  1GL5 A;  3KFV A;  4RTW A;  2CT4 A;  3O5Z A;  1JU5 C;  2QDL A;  3NGP A;  1GFC A;  4RTT A;  1B3Q A;  1UGV A;  4HVW A;  3REB B;  2F2X A;  1FYN A;  1T3L A;  2KRS A;  1WFW A;  2HCK A;  2W10 A;  2DNU A;  2GBQ A;  1E6G A;  1QWE A;  4OMO A;  2FO0 A;  2FPF A;  2YUO A;  3UA6 A;  2FG0 A;  1OPK A;  5FWB A;  2EYW A;  3VS3 A;  1X2Q A;  1VYT A;  1RUW A;  2ESW A;  2HEQ A;  1ZUU A;  3I35 A;  4A63 B;  1B07 A;  4HVU A;  2L0A A;  2PZ1 A;  1KFZ A;  1WXT A;  1AWO A;  1M3A A;  1JQQ A;  2KBT A;  1NLP C;  2B86 A;  1H92 A;  1S1N A;  3PVL A;  4D8K A;  1GRI A;  1SPK A;  2OI3 A;  2GTJ A;  2J6F A;  2AZS A;  1XOV A;  1Z9Z A;  2GTO A;  4D8D A;  1T3S A;  1M27 C;  1CSK A;  1X69 A;  1GBQ A;  4J9G A;  1TUC A;  4Z8A A;  1VA7 A;  4JPB W;  2EPD A;  2J6K A;  1I07 A;  1RLP C;  4ORZ A;  3ULR B;  2DL5 A;  1Z9Q A;  2RNA A;  4JZ4 A;  4LNP A;  1V1C A;  2SRC A;  2KT8 A;  1GCQ A;  2RPN A;  3FJ5 A;  1TG0 A;  4AFQ C;  2J06 A;  1U5S A;  2J7I A;  4F17 A;  2M0Y A;  2BZY A;  2DRM A;  1X6B A;  3VS5 A;  4AG2 C;  2D0N A;  1G2B A;  4K11 A;  3EHQ A;  1VYV A;  1OEB A;  2J05 A;  4OMQ A;  1UFF A;  4J9H A;  1FMK A;  3NMZ C;  1MV0 B;  2KNB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...