2KRUA

Solution nmr structure of the pcp_red domain of light-independent protochlorophyllide reductase subunit b from chlorobium tepidum. northeast structural genomics consortium target ctr69a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
MGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the PCP_red domain of light-independent protochlorophyllide reductase subunit B from Chlorobium tepidum. Northeast Structural Genomics Consortium Target CtR69A
rcsb
source organism Chlorobaculum tepidum
molecule tags Oxidoreductase
molecule keywords Light-independent protochlorophyllide reductase subunit B
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kruA01
2KRUA 2L09A 2YNMD
chains in the Genus database with same CATH superfamily
4FWHA 4NXNM 1IY2A 3AL0C 1R5LA 2DKLA 2DNAA 4F2LA 1IN7A 2VIIA 1NHWC 1C1KA 2VDBB 3BBZA 2LH0A 5EP2A 5JI3E 4DV4M 5C1BA 2CUZA 3HU2A 3KOZE 4MM3B 1I4WA 3HHWA 2JZ1A 2HKJA 2OQ4A 5FTLA 2UUBM 2XEPA 1XWIA 2QENA 4LJ5A 3C3EA 2R4EA 4RNAA 4B3SM 1WXQA 3W67A 2JY7A 2HWJA 5E26A 2DVWB 4LZZA 4IBDA 3SARA 3L28A 2R44A 5DFLA 4LF9M 4GC5A 2MR9A 3KP1E 2DAMA 2JY6B 4GIPA 3ILKA 3GPYA 3U61A 2HHHM 3U6PA 5DYIA 4FW9A 2L4EA 3U6QA 2UU9M 2YR0A 4AG5A 5ITXA 4X65M 3C58A 3U6LA 1MU5A 1Q02A 4LF7M 3V76A 1OAOC 1T6OA 3KSJA 2YQZA 2KNVA 3T6PA 4AZFA 2VF8A 2QSFX 4LJAA 1XMOM 2FS1A 4AQYM 1L2CA 1V92A 2JZ0A 2QQ8A 3H4MA 1X37A 3LMMA 4JXJA 1IN4A 4GH9A 5IZ7D 1SXJB 3T38A 4B7FA 1D2NA 4JI0M 4DUYM 2DAKA 4GKJM 1HQYE 1G4AE 2K9DA 2O5RA 1L8QA 2CHGA 1YE9A 3AOGA 4WP2A 1ZQ9A 3SFZA 2M5ZA 1J5EM 3K8ZA 1NO1A 1OFIA 3THGA 3KOYE 3TL4X 3C9PA 4LGMA 1G41A 1V33A 4JI1M 3IHPA 2I7PA 2QHOB 4UN2B 2LBCA 2XGNA 1Q3BA 2CV0A 3SHFA 4JI4M 4OW0A 1TDHA 2LVAA 2DZLA 3NBXX 3GRRA 4PD2A 2N35A 4RF0A 5IT9S 1IBLM 4FCVA 2J5YA 3U61B 2LVQD 3VFDA 4YHHM 3A98B 1R7RA 3CF2A 3B7NA 3B7ZA 2ZTDA 2XSZD 3FD9A 4GEWA 1HNWM 2DHRA 4LF6M 3GLGB 1XXHA 1MN3A 3CF6E 4LGYA 5EQTA 5KPRA 1AUAA 2HL7A 1IXSB 1PM5A 1ZAEA 4DV5M 5F3WA 3A46A 1G8PA 1XHBA 1R4GA 2BJWA 1WJ7A 2KZUA 4AG6A 1TDZA 4JI7M 1NY5A 4RKUF 3GQ4A 2L7HA 3TWMA 1Y8GA 1OJLA 1PJQA 4IBKA 1IN8A 5ITTA 2R18A 4NC6A 3U6CA 4LZJA 4A3VB 3GQ5A 4DR3M 1K82A 4OU7A 4D82A 4X62M 4JI6M 3GLIE 2Z4RA 1VQ1A 3W68A 4IBGA 3A42A 3MJ5A 1UFZA 2KXEA 1QUTA 3SATA 1OFHA 3GLHB 3M7GA 2DWNA 2EA0A 4I5SA 1PJSA 2CP8A 1G59A 4DR1M 1KFVA 3GQ3A 2CRUA 1NSFA 2EKKA 1VDLA 4QHTA 3I4VA 2LVNC 5KO3A 2KW0A 2VQFM 1HNXM 3KS8A 1NY6A 1VEGA 1NNUC 3I01M 4G4NA 1GO5A 4OVZB 3KXEC 2JWSA 2CHQA 3FUWA 3E9SA 4WURA 3LQRA 3PFIA 1OIPA 3GLIA 4PCZA 3PNYA 2M60A 4AW4A 3K92A 2JXNA 3VDPA 3QWLA 3FUTA 4QNRA 3OTOM 4ITQA 3CTWB 4JYAM 3FTEA 1TTEA 3SYLA 2O01F 4K0KM 4LJ6A 2Z8YM 3GPXA 3U6EA 3CF0A 2MH8A 4LY6A 3H4JA 3HHXA 4B7GA 2BWBA 4JN6A 1BVSA 3Q8XA 1YSYA 1G71A 4L15A 3FUUA 2KA6B 3DOAA 5DYGA 5ITRA 3J81S 3DA1A 3AOEC 4FWGA 1XXHE 3SAVA 1DO0A 2V1CA 1I94M 2XF3A 1IXZA 2G8LA 4BLCA 2KEBA 3B74A 3GLGA 2DWZB 3J2PB 4KT0F 2OPFA 3U5ZB 3GP1A 2XFTA 1YLAA 1ZMWA 2ZTCA 4DR2M 2HAKA 1XXHB 3MMPA 3ZH9B 1QANA 2J7OA 1KSFX 2C98A 2WSFF 1IFYA 3HGIA 4NRVA 4R71A 1LTMA 1IXRC 2CE7A 1K3WA 2Y0QA 3QYEA 4LF8M 4QOZC 1SXJD 3JAMS 2JP7A 2FH0A 4L8RC 4Q7JA 1XNQM 2LVPC 4G6ZA 4L16A 1HT1E 4QOSA 2Y20A 3J7BA 1H6UA 4DR5M 3KSXA 3ZCBB 3B7QA 4DV2M 2QNJA 3HJSA 5ITQA 4Z8XA 5EXSA 3SYKA 2YFQA 4IJEA 3ZC7B 3U60A 2C99A 3VKGA 1QAOA 2G5GX 2ZBKB 1JR3A 1PRBA 4FCTA 2F5OA 1IBMM 1D0KA 3GLFE 2DI0A 2UXBM 3FYDA 1NNJA 3JR5A 4B3MM 5FSWA 5FTNA 4LFAM 3FE3A 4M9XA 2XH9A 1XNRM 4GHLA 2R4JA 3GO8A 2CFOA 1QZMA 4DV7M 3M0EA 4OVZA 3KP0E 4JI8M 3K2LA 4KHPM 4RF1A 3VLFB 2FFJA 4HLQA 1PJTA 3FTDA 4MGYE 2F5PA 2K47A 4KODA 2C96A 2X4AA 4B3TM 3GLFA 4AI6A 2JY8A 1JR3E 3L25A 1E32A 2OO9A 1DGHA 4IBJA 1R2ZA 1TR8A 2WSCF 2JNHA 1R6BX 1IN5A 4GKKM 1Z5AA 4G4RA 3VK7A 4NOOB 5JI2E 2H1RA 4LJ7A 1OKSA 3RFWA 1L1ZA 2VQEM 2JY5A 3TWLA 3DFZA 2D7HA 3IG5A 3BXWA 3GPUA 4IJFA 1GL6A 1FNNA 5KPZA 2MGWA 2I7NA 4NSRA 4PT5A 3UJNA 4GC9A 3LVWA 1W5TA 3WHLA 2ZM6M 3F92A 3QAUA 5E6JA 3U6OA 2L2DA 5FTJA 1J09A 3E46A 1NJFA 3U5ZA 1Q3CA 1Z5BA 2R62A 1V34A 5BR8M 3MHVC 1QDRA 2W82A 5EXXA 3GRYA 3J80S 3KOWE 4FWDA 3SASA 3GLGE 2Y0TA 1L2DA 5A2QS 1EFUB 1QDTA 2XSZA 4II7A 4B7HA 4CJ6A 2CV2A 4DR6M 2QZ4A 4PDGA 1GL7A 2R45A 3KDSE 3C3DA 1E9RA 1XB2B 2EKFA 1PGYA 1DO2A 1VG5A 4I81A 3JR4A 4JI2M 1N32M 3LCVB 1GLNA 1N33M 2VF7A 4HL4A 3D8BA 4YY3M 1WGLA 3HX3A 4B08A 5GKNA 1IQPA 3KW6A 4JI5M 3NWLA 4MGIE 3I4YA 4MGZE 2RGOA 1N77A 3TE6A 1K3XA 1GJSA 3LVVA 4LRSA 4WW0A 1WR1B 3GLIB 5KPTA 3HHYA 4DR4M 2L4FA 3GLFB 4F1IA 1G3IA 4DUZM 3AV0A 1RU3A 3B9PA 3KS4A 4M9SA 3TWKA 2UXDM 2RKOA 3GLHE 4BBAA 1GKIA 4ANRA 1C7YA 3UGJA 1HT2E 4IBBA 4FCWA 2XZFA 5DNYA 3KVWA 4I8OA 1OAIA 1P3QQ 4AKIA 1TH3A 4XBOA 4G3OA 1PJJA 4LFCM 1S3SA 2DAGA 3KFUG 3GRVA 3FRHA 2FE8A 1OTRA 1N34M 4D80A 1A5TA 2X49A 4DV3M 2RRUA 2DAEA 3K1JA 4R3DA 4AKGA 1SXJC 2Y21A 1YUBA 2L09A 1LV7A 1J7KA 4KLNA 3LCUA 4X66M 1WHCA 2C9CA 2O25A 3D8LA 4DR7M 1N78A 1VEKA 3SBJA 3BOSA 3HJ8A 3W0FA 1W5SA 4JV5M 4S12A 2Q2EB 1SG9A 2A5YB 1DV0A 2BNKA 1HQCA 2ERCA 3SAUA 2R6FA 2P5TA 4GRIA 4Y28F 1OIZA 2K6BA 3DZDA 5IREB 5KQ8A 2UXCM 2ZAOA 3TQSA 2V1UA 4OX9M 3PNVA 2MROB 5FTKA 3U60B 3PXGA 2NQ8C 1AIPC 1N75A 1ZMVA 3WHKA 2KRUA 4XK8F 4REZA 3HJQA 1XMQM 5EXPA 1TF0B 2DZOB 1VEJA 4DV6M 4L4UA 4PDIA 1NHGC 2BJVA 3VKHA 4IBFA 3I04M 2DZNB 4LJ4A 3T15A 4CIZA 1QQWA 4G4OA 4NRWA 2R65A 3E21A 2FOIC 4GHAA 1L1TA 1QZEA 4CHTB 4DV0M 2CWBA 2L6OA 3RGPA 3U6MA 2C5RA 1JQJC 5ITUA 1L2BA 2L7IA 1Z59A 2FNAA 5H37D 2QCUA 4P16A 1WIVA 1IY0A 4EIWA 2DAIA 4MH0E 2AHMA 3HU1A 4AKHA 3SHGB 1NV9A 2DENA 2KHHA 1QVRA 1PJIA 2KNZA 2G3QA 2X8AA 3L2AA 4IBIA 3TPZA 4L78A 5IWAM 3AKZA 1QAMA 1MX0A 4LJ9A 5FTMA 3UMMA 4TUWA 3HY5A 4M0WA 4LCBA 3RGSA 2MJ5B 2LHGA 2JA2A 5EXTA 5BPVA 3K9PA 2V6ZM 3U6DA 3SMPA 4L6V6 1N36M 4LFBM 2H5XA 2JUJA 2OOAA 3FTCA 4I4LA 1QYRA 5ITXE 1Z5CA 2RGHA 4LF4M 5LMNM 1E9SA 2LWXA 2YNMD 3PVSA 1ZV1A 4NL4H 3HKPA 3FYCA 2OOBA 3RE8A 5ITYA 5EP3A 1EIJA 1ZMUA 2LHCA 1GABA 1DGHB 2DXIA 4LF5M 3A45A 2R46A 5LMUM 3R9XB 4HEOA 3E4RA 4P17A 4IIWA 3VK8A 2DWMA 2XFSA 1JB0F 2UUCM 2CV1A 2BWEA 3GPPA 3SC3A 1T3TA 3W0LB 4W5WA 1VDDA 4GMQA 3AOEA 2UUAM 2QPAA 3VDUA 4IBCA 4ZPXA 1IM2A 2HCBA 3AFHA 4FD2A 2R0IA 2Z3XA 3IECA 2LXEA 3K9OA 2APLA 2J7NA 1WGNA 4CISA 1NVMA 1IXSA 2DHYA 3FKEA 1IBKM 3UK6A 1IY1A 3FRIA 4MGKE 1NV8A 3FUVA 4CGYB 3FUXA 3J27B 3EIHA 5EP4A 2ZAMA 4QHSA 1R2YA 1EE8A 3T1HM 1QUSA 3LQQA 1DGFA 3B89A 2Z4SA 4R7GA 1HJPA 4Z6YA 3AJIB 4LJ8A 3KOXE 3NBIA 5C18A 2C9OA 1XC8A 3EIEA 4X64M 1Z6TA 2B3TA 3GLHA 4MGHA 3IG8A 4LG2A 1SXJE 1DGGA 4JI3M 4DBGB 2QBYA 1KYIA 3SMSA 8CATA 3R8FA 4IBEA 3LW5F 3HU3A 3CGWA 3HZJA 4KO8A 4BB9A 1HR0M 2QP9X 1NJGA 2F4VM 4MB7A 1OQYA 2WZJA 2Z7JA 1T43A 4FVMA 2F5QA 1CUKA 3L27A 4D81A 5EJCA 2D7GA 3GRUA 1E94E 3FTFA 1HNZM 2EO2A 2K0BX 1JR3D 1QAQA 1TH4A 3HWSA 3ZQJA 2KZSA 2KNAA 4XGIA 1DGBA 1TGUA 4M0DA 3MK6A 1F4IA 5FLXS 2DWLA 4NXMM 4B3RM 2KDLA 3U6SA 2EUCA 2XZUA 5L8RF 2EJSA 2KRKA 1GJTA 4QNMA 4GITA 2F5NA 1GVNA 1Q39A 2QBYB 3L26A 2GQFA 3L29A 1ORYB 4M9ZA 2WSEF 4G4QA 3SAWA 3UZUA 2E5LM 2F5SA 2GNOA 2CHVA 3T1YM 1SXJA 4NSOB 3M6AA 2LNHC 2LTUA 3HHZA 1UM8A 1MJGM 3I51A 4LRTA 1TH2A 1FJGM 3QYBA 5KQDA 7CATA 2XLJA 3Q8GA 3J7AS 4DV1M 1D0LA 2ZANA 1D0MA 5EP1A 2LVOC 1IN6A 2D7EA 2CEAA
chains in the Genus database with same CATH topology
4FWHA 4NXNM 1IY2A 3AL0C 1IN7A 2VIIA 1NHWC 1C1KA 2LH0A 5EP2A 5JI3E 4DV4M 5C1BA 2CUZA 3HU2A 3KOZE 4MM3B 1I4WA 3HHWA 2HKJA 2OQ4A 5FTLA 2UUBM 2XEPA 1XWIA 2QENA 4LJ5A 2R4EA 4RNAA 4B3SM 1WXQA 5E26A 2DVWB 4LZZA 4IBDA 3SARA 3L28A 4LF9M 4GC5A 3KP1E 4GIPA 3GPYA 2HHHM 3ILKA 3U61A 3U6PA 5DYIA 4FW9A 3U6QA 2UU9M 2YR0A 4AG5A 5ITXA 4X65M 3C58A 3U6LA 1MU5A 4LF7M 3KSJA 2YQZA 4AZFA 1XMOM 4LJAA 4AQYM 1L2CA 3H4MA 1X37A 3LMMA 4JXJA 1IN4A 4GH9A 5IZ7D 1SXJB 3T38A 4B7FA 1D2NA 4JI0M 4DUYM 4GKJM 1HQYE 1G4AE 2O5RA 1L8QA 2CHGA 1YE9A 3AOGA 3SFZA 1ZQ9A 1J5EM 2M5ZA 3K8ZA 1OFIA 3THGA 3KOYE 3TL4X 4LGMA 1G41A 4JI1M 2I7PA 2XGNA 1Q3BA 2CV0A 3SHFA 4JI4M 4OW0A 1TDHA 3GRRA 4PD2A 4RF0A 5IT9S 1IBLM 4FCVA 3U61B 3VFDA 4YHHM 3A98B 1R7RA 3CF2A 2XSZD 3FD9A 1HNWM 2DHRA 4LF6M 3GLGB 1XXHA 3CF6E 4LGYA 5EQTA 5KPRA 2HL7A 1PM5A 1IXSB 1ZAEA 4DV5M 5F3WA 3A46A 1G8PA 1XHBA 2BJWA 4AG6A 2KZUA 1TDZA 4JI7M 1NY5A 3GQ4A 2L7HA 3TWMA 1OJLA 4IBKA 1IN8A 5ITTA 2R18A 3U6CA 4LZJA 4A3VB 3GQ5A 4DR3M 1K82A 4OU7A 4D82A 4X62M 4JI6M 2Z4RA 4IBGA 3A42A 3MJ5A 2KXEA 3SATA 1OFHA 3GLHB 3M7GA 2DWNA 2EA0A 4I5SA 1G59A 4DR1M 1KFVA 3GQ3A 4QHTA 1NSFA 3I4VA 3KS8A 5KO3A 2KW0A 2VQFM 1HNXM 1NY6A 1NNUC 4G4NA 4OVZB 3KXEC 2CHQA 3FUWA 3E9SA 4WURA 3LQRA 3PFIA 3GLIA 4PCZA 3PNYA 2M60A 4AW4A 3K92A 3VDPA 3QWLA 3FUTA 4QNRA 3OTOM 4ITQA 3CTWB 4JYAM 3FTEA 3SYLA 4K0KM 4LJ6A 3GPXA 3U6EA 3CF0A 4LY6A 3HHXA 4B7GA 4JN6A 3Q8XA 1YSYA 4L15A 3FUUA 2KA6B 3DOAA 5DYGA 5ITRA 3J81S 3DA1A 3AOEC 4FWGA 3SAVA 1DO0A 2V1CA 1I94M 2XF3A 1IXZA 2G8LA 4BLCA 2KEBA 2OPFA 3GLGA 2DWZB 3J2PB 3U5ZB 3GP1A 2XFTA 4DR2M 1XXHB 3ZH9B 1QANA 2J7OA 1KSFX 2C98A 3HGIA 4NRVA 1IXRC 2CE7A 1K3WA 2Y0QA 4LF8M 4QOZC 1SXJD 3JAMS 4L8RC 1XNQM 4G6ZA 4L16A 1HT1E 4QOSA 2Y20A 3J7BA 1H6UA 4DR5M 3KSXA 3ZCBB 4DV2M 3HJSA 5ITQA 4Z8XA 5EXSA 3SYKA 2YFQA 4IJEA 3ZC7B 3U60A 2C99A 3VKGA 1QAOA 2G5GX 2ZBKB 1JR3A 4FCTA 2F5OA 1IBMM 2UXBM 3FYDA 1NNJA 3JR5A 4B3MM 5FSWA 5FTNA 4LFAM 4M9XA 2XH9A 1XNRM 4GHLA 2R4JA 3GO8A 2CFOA 1QZMA 4DV7M 3M0EA 4OVZA 3KP0E 4JI8M 3K2LA 4KHPM 4RF1A 3VLFB 2FFJA 4HLQA 3FTDA 4MGYE 2F5PA 2K47A 4KODA 2C96A 2X4AA 4B3TM 3GLFA 4AI6A 3L25A 1E32A 1DGHA 4IBJA 1R2ZA 1R6BX 1IN5A 4GKKM 1Z5AA 4G4RA 3VK7A 4NOOB 5JI2E 2H1RA 4LJ7A 3RFWA 1L1ZA 2VQEM 3TWLA 3DFZA 2D7HA 3IG5A 3GPUA 4IJFA 1GL6A 1FNNA 5KPZA 2I7NA 4NSRA 4PT5A 3UJNA 4GC9A 3LVWA 1W5TA 3WHLA 2ZM6M 3QAUA 5E6JA 3U6OA 5FTJA 1J09A 1NJFA 3U5ZA 1Q3CA 1Z5BA 2R62A 5BR8M 3MHVC 2W82A 5EXXA 3GRYA 3J80S 3KOWE 4FWDA 3SASA 2Y0TA 1L2DA 5A2QS 2XSZA 4II7A 4B7HA 2CV2A 4DR6M 2QZ4A 4PDGA 1GL7A 2R45A 3KDSE 1E9RA 4I81A 1DO2A 3JR4A 4JI2M 1N32M 1N33M 1GLNA 4HL4A 3D8BA 4YY3M 4B08A 5GKNA 1IQPA 3KW6A 4JI5M 3NWLA 4MGIE 3I4YA 4MGZE 2RGOA 1N77A 3TE6A 1K3XA 3LVVA 4LRSA 4WW0A 3GLIB 5KPTA 3HHYA 4DR4M 3GLFB 4DUZM 1G3IA 3AV0A 3B9PA 3KS4A 4M9SA 3TWKA 2UXDM 2RKOA 4BBAA 1GKIA 3UGJA 1HT2E 4IBBA 4FCWA 2XZFA 5DNYA 3KVWA 4I8OA 4AKIA 1TH3A 4XBOA 1PJJA 4LFCM 1S3SA 3KFUG 3GRVA 2FE8A 1N34M 4D80A 2X49A 4DV3M 3K1JA 4R3DA 4AKGA 1SXJC 2Y21A 1YUBA 2L09A 1LV7A 1J7KA 4KLNA 4X66M 4DR7M 2C9CA 3D8LA 1N78A 3SBJA 3BOSA 3HJ8A 3W0FA 1W5SA 4JV5M 4S12A 2Q2EB 2A5YB 2BNKA 1HQCA 2ERCA 3SAUA 2P5TA 4GRIA 5IREB 5KQ8A 3DZDA 2UXCM 2ZAOA 3TQSA 2V1UA 4OX9M 3PNVA 5FTKA 3U60B 3PXGA 2NQ8C 1N75A 3WHKA 2KRUA 4REZA 3HJQA 1XMQM 5EXPA 2DZOB 4DV6M 4L4UA 4PDIA 1NHGC 2BJVA 3VKHA 4IBFA 2DZNB 4LJ4A 3T15A 1QQWA 4G4OA 4NRWA 2R65A 4GHAA 2FOIC 1L1TA 4CHTB 4DV0M 2L6OA 3RGPA 3U6MA 2C5RA 1JQJC 5ITUA 1L2BA 2L7IA 1Z59A 2FNAA 5H37D 2QCUA 4P16A 1IY0A 4EIWA 4MH0E 2AHMA 3HU1A 4AKHA 3SHGB 1QVRA 1PJIA 2X8AA 3L2AA 4IBIA 3TPZA 4L78A 5IWAM 3AKZA 1QAMA 1MX0A 4LJ9A 5FTMA 3UMMA 4TUWA 4M0WA 4LCBA 3RGSA 2JA2A 5EXTA 5BPVA 2V6ZM 3U6DA 3SMPA 1N36M 4LFBM 3FTCA 4I4LA 5ITXE 1QYRA 1Z5CA 2RGHA 5LMNM 1E9SA 2LWXA 2YNMD 3PVSA 4NL4H 3RE8A 3HKPA 3FYCA 5ITYA 5EP3A 1DGHB 2DXIA 4LF5M 3A45A 2R46A 5LMUM 3R9XB 3E4RA 4IIWA 3VK8A 2DWMA 2XFSA 2UUCM 2CV1A 3GPPA 3SC3A 1T3TA 3W0LB 4W5WA 1VDDA 4GMQA 3AOEA 2UUAM 2QPAA 3VDUA 4IBCA 4ZPXA 1IM2A 2HCBA 3AFHA 4FD2A 2Z3XA 2LXEA 2J7NA 4CISA 1NVMA 3FKEA 1IBKM 3UK6A 1IY1A 4MGKE 4CGYB 3FUVA 3FUXA 3J27B 3EIHA 5EP4A 2ZAMA 4QHSA 1R2YA 1EE8A 3T1HM 3LQQA 1DGFA 4Z6YA 2Z4SA 4R7GA 5C18A 4LF4M 3AJIB 4LJ8A 3KOXE 3NBIA 1XC8A 2C9OA 3EIEA 4X64M 1Z6TA 3GLHA 4MGHA 3IG8A 4LG2A 1SXJE 1DGGA 4JI3M 2QBYA 1KYIA 3SMSA 8CATA 3R8FA 4IBEA 3HU3A 4KO8A 4BB9A 1HR0M 2QP9X 1NJGA 2F4VM 4MB7A 4FVMA 2Z7JA 2F5QA 3L27A 4D81A 5EJCA 2D7GA 3GRUA 1E94E 3FTFA 1HNZM 2EO2A 1JR3D 1QAQA 1TH4A 3HWSA 2KZSA 4XGIA 1DGBA 1TGUA 4M0DA 3MK6A 5FLXS 2DWLA 4NXMM 4B3RM 3U6SA 2EUCA 2XZUA 2KRKA 4QNMA 4GITA 2F5NA 1GVNA 1Q39A 2QBYB 3L26A 3L29A 4M9ZA 1ORYB 4G4QA 3SAWA 3UZUA 2E5LM 2F5SA 2CHVA 3T1YM 1SXJA 4NSOB 3M6AA 2LNHC 3HHZA 1UM8A 3I51A 4LRTA 1TH2A 1FJGM 5KQDA 7CATA 2XLJA 3J7AS 4DV1M 2ZANA 5EP1A 1IN6A 2D7EA 2CEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRU A;  2L09 A;  2YNM D; 
#chains in the Genus database with same CATH topology
 4FWH A;  4NXN M;  1IY2 A;  3AL0 C;  1R5L A;  2DKL A;  2DNA A;  4F2L A;  1IN7 A;  2VII A;  1NHW C;  1C1K A;  2VDB B;  3BBZ A;  2LH0 A;  5EP2 A;  5JI3 E;  4DV4 M;  5C1B A;  2CUZ A;  3HU2 A;  3KOZ E;  4MM3 B;  1I4W A;  3HHW A;  2JZ1 A;  2HKJ A;  2OQ4 A;  5FTL A;  2UUB M;  2XEP A;  1XWI A;  2QEN A;  4LJ5 A;  3C3E A;  2R4E A;  4RNA A;  4B3S M;  1WXQ A;  3W67 A;  2JY7 A;  2HWJ A;  5E26 A;  2DVW B;  4LZZ A;  4IBD A;  3SAR A;  3L28 A;  2R44 A;  5DFL A;  4LF9 M;  4GC5 A;  2MR9 A;  3KP1 E;  2DAM A;  2JY6 B;  4GIP A;  3ILK A;  3GPY A;  3U61 A;  2HHH M;  3U6P A;  5DYI A;  4FW9 A;  2L4E A;  3U6Q A;  2UU9 M;  2YR0 A;  4AG5 A;  5ITX A;  4X65 M;  3C58 A;  3U6L A;  1MU5 A;  1Q02 A;  4LF7 M;  3V76 A;  1OAO C;  1T6O A;  3KSJ A;  2YQZ A;  2KNV A;  3T6P A;  4AZF A;  2VF8 A;  2QSF X;  4LJA A;  1XMO M;  2FS1 A;  4AQY M;  1L2C A;  1V92 A;  2JZ0 A;  2QQ8 A;  3H4M A;  1X37 A;  3LMM A;  4JXJ A;  1IN4 A;  4GH9 A;  5IZ7 D;  1SXJ B;  3T38 A;  4B7F A;  1D2N A;  4JI0 M;  4DUY M;  2DAK A;  4GKJ M;  1HQY E;  1G4A E;  2K9D A;  2O5R A;  1L8Q A;  2CHG A;  1YE9 A;  3AOG A;  4WP2 A;  1ZQ9 A;  3SFZ A;  2M5Z A;  1J5E M;  3K8Z A;  1NO1 A;  1OFI A;  3THG A;  3KOY E;  3TL4 X;  3C9P A;  4LGM A;  1G41 A;  1V33 A;  4JI1 M;  3IHP A;  2I7P A;  2QHO B;  4UN2 B;  2LBC A;  2XGN A;  1Q3B A;  2CV0 A;  3SHF A;  4JI4 M;  4OW0 A;  1TDH A;  2LVA A;  2DZL A;  3NBX X;  3GRR A;  4PD2 A;  2N35 A;  4RF0 A;  5IT9 S;  1IBL M;  4FCV A;  2J5Y A;  3U61 B;  2LVQ D;  3VFD A;  4YHH M;  3A98 B;  1R7R A;  3CF2 A;  3B7N A;  3B7Z A;  2ZTD A;  2XSZ D;  3FD9 A;  4GEW A;  1HNW M;  2DHR A;  4LF6 M;  3GLG B;  1XXH A;  1MN3 A;  3CF6 E;  4LGY A;  5EQT A;  5KPR A;  1AUA A;  2HL7 A;  1IXS B;  1PM5 A;  1ZAE A;  4DV5 M;  5F3W A;  3A46 A;  1G8P A;  1XHB A;  1R4G A;  2BJW A;  1WJ7 A;  2KZU A;  4AG6 A;  1TDZ A;  4JI7 M;  1NY5 A;  4RKU F;  3GQ4 A;  2L7H A;  3TWM A;  1Y8G A;  1OJL A;  1PJQ A;  4IBK A;  1IN8 A;  5ITT A;  2R18 A;  4NC6 A;  3U6C A;  4LZJ A;  4A3V B;  3GQ5 A;  4DR3 M;  1K82 A;  4OU7 A;  4D82 A;  4X62 M;  4JI6 M;  3GLI E;  2Z4R A;  1VQ1 A;  3W68 A;  4IBG A;  3A42 A;  3MJ5 A;  1UFZ A;  2KXE A;  1QUT A;  3SAT A;  1OFH A;  3GLH B;  3M7G A;  2DWN A;  2EA0 A;  4I5S A;  1PJS A;  2CP8 A;  1G59 A;  4DR1 M;  1KFV A;  3GQ3 A;  2CRU A;  1NSF A;  2EKK A;  1VDL A;  4QHT A;  3I4V A;  2LVN C;  5KO3 A;  2KW0 A;  2VQF M;  1HNX M;  3KS8 A;  1NY6 A;  1VEG A;  1NNU C;  3I01 M;  4G4N A;  1GO5 A;  4OVZ B;  3KXE C;  2JWS A;  2CHQ A;  3FUW A;  3E9S A;  4WUR A;  3LQR A;  3PFI A;  1OIP A;  3GLI A;  4PCZ A;  3PNY A;  2M60 A;  4AW4 A;  3K92 A;  2JXN A;  3VDP A;  3QWL A;  3FUT A;  4QNR A;  3OTO M;  4ITQ A;  3CTW B;  4JYA M;  3FTE A;  1TTE A;  3SYL A;  2O01 F;  4K0K M;  4LJ6 A;  2Z8Y M;  3GPX A;  3U6E A;  3CF0 A;  2MH8 A;  4LY6 A;  3H4J A;  3HHX A;  4B7G A;  2BWB A;  4JN6 A;  1BVS A;  3Q8X A;  1YSY A;  1G71 A;  4L15 A;  3FUU A;  2KA6 B;  3DOA A;  5DYG A;  5ITR A;  3J81 S;  3DA1 A;  3AOE C;  4FWG A;  1XXH E;  3SAV A;  1DO0 A;  2V1C A;  1I94 M;  2XF3 A;  1IXZ A;  2G8L A;  4BLC A;  2KEB A;  3B74 A;  3GLG A;  2DWZ B;  3J2P B;  4KT0 F;  2OPF A;  3U5Z B;  3GP1 A;  2XFT A;  1YLA A;  1ZMW A;  2ZTC A;  4DR2 M;  2HAK A;  1XXH B;  3MMP A;  3ZH9 B;  1QAN A;  2J7O A;  1KSF X;  2C98 A;  2WSF F;  1IFY A;  3HGI A;  4NRV A;  4R71 A;  1LTM A;  1IXR C;  2CE7 A;  1K3W A;  2Y0Q A;  3QYE A;  4LF8 M;  4QOZ C;  1SXJ D;  3JAM S;  2JP7 A;  2FH0 A;  4L8R C;  4Q7J A;  1XNQ M;  2LVP C;  4G6Z A;  4L16 A;  1HT1 E;  4QOS A;  2Y20 A;  3J7B A;  1H6U A;  4DR5 M;  3KSX A;  3ZCB B;  3B7Q A;  4DV2 M;  2QNJ A;  3HJS A;  5ITQ A;  4Z8X A;  5EXS A;  3SYK A;  2YFQ A;  4IJE A;  3ZC7 B;  3U60 A;  2C99 A;  3VKG A;  1QAO A;  2G5G X;  2ZBK B;  1JR3 A;  1PRB A;  4FCT A;  2F5O A;  1IBM M;  1D0K A;  3GLF E;  2DI0 A;  2UXB M;  3FYD A;  1NNJ A;  3JR5 A;  4B3M M;  5FSW A;  5FTN A;  4LFA M;  3FE3 A;  4M9X A;  2XH9 A;  1XNR M;  4GHL A;  2R4J A;  3GO8 A;  2CFO A;  1QZM A;  4DV7 M;  3M0E A;  4OVZ A;  3KP0 E;  4JI8 M;  3K2L A;  4KHP M;  4RF1 A;  3VLF B;  2FFJ A;  4HLQ A;  1PJT A;  3FTD A;  4MGY E;  2F5P A;  2K47 A;  4KOD A;  2C96 A;  2X4A A;  4B3T M;  3GLF A;  4AI6 A;  2JY8 A;  1JR3 E;  3L25 A;  1E32 A;  2OO9 A;  1DGH A;  4IBJ A;  1R2Z A;  1TR8 A;  2WSC F;  2JNH A;  1R6B X;  1IN5 A;  4GKK M;  1Z5A A;  4G4R A;  3VK7 A;  4NOO B;  5JI2 E;  2H1R A;  4LJ7 A;  1OKS A;  3RFW A;  1L1Z A;  2VQE M;  2JY5 A;  3TWL A;  3DFZ A;  2D7H A;  3IG5 A;  3BXW A;  3GPU A;  4IJF A;  1GL6 A;  1FNN A;  5KPZ A;  2MGW A;  2I7N A;  4NSR A;  4PT5 A;  3UJN A;  4GC9 A;  3LVW A;  1W5T A;  3WHL A;  2ZM6 M;  3F92 A;  3QAU A;  5E6J A;  3U6O A;  2L2D A;  5FTJ A;  1J09 A;  3E46 A;  1NJF A;  3U5Z A;  1Q3C A;  1Z5B A;  2R62 A;  1V34 A;  5BR8 M;  3MHV C;  1QDR A;  2W82 A;  5EXX A;  3GRY A;  3J80 S;  3KOW E;  4FWD A;  3SAS A;  3GLG E;  2Y0T A;  1L2D A;  5A2Q S;  1EFU B;  1QDT A;  2XSZ A;  4II7 A;  4B7H A;  4CJ6 A;  2CV2 A;  4DR6 M;  2QZ4 A;  4PDG A;  1GL7 A;  2R45 A;  3KDS E;  3C3D A;  1E9R A;  1XB2 B;  2EKF A;  1PGY A;  1DO2 A;  1VG5 A;  4I81 A;  3JR4 A;  4JI2 M;  1N32 M;  3LCV B;  1GLN A;  1N33 M;  2VF7 A;  4HL4 A;  3D8B A;  4YY3 M;  1WGL A;  3HX3 A;  4B08 A;  5GKN A;  1IQP A;  3KW6 A;  4JI5 M;  3NWL A;  4MGI E;  3I4Y A;  4MGZ E;  2RGO A;  1N77 A;  3TE6 A;  1K3X A;  1GJS A;  3LVV A;  4LRS A;  4WW0 A;  1WR1 B;  3GLI B;  5KPT A;  3HHY A;  4DR4 M;  2L4F A;  3GLF B;  4F1I A;  1G3I A;  4DUZ M;  3AV0 A;  1RU3 A;  3B9P A;  3KS4 A;  4M9S A;  3TWK A;  2UXD M;  2RKO A;  3GLH E;  4BBA A;  1GKI A;  4ANR A;  1C7Y A;  3UGJ A;  1HT2 E;  4IBB A;  4FCW A;  2XZF A;  5DNY A;  3KVW A;  4I8O A;  1OAI A;  1P3Q Q;  4AKI A;  1TH3 A;  4XBO A;  4G3O A;  1PJJ A;  4LFC M;  1S3S A;  2DAG A;  3KFU G;  3GRV A;  3FRH A;  2FE8 A;  1OTR A;  1N34 M;  4D80 A;  1A5T A;  2X49 A;  4DV3 M;  2RRU A;  2DAE A;  3K1J A;  4R3D A;  4AKG A;  1SXJ C;  2Y21 A;  1YUB A;  2L09 A;  1LV7 A;  1J7K A;  4KLN A;  3LCU A;  4X66 M;  1WHC A;  2C9C A;  2O25 A;  3D8L A;  4DR7 M;  1N78 A;  1VEK A;  3SBJ A;  3BOS A;  3HJ8 A;  3W0F A;  1W5S A;  4JV5 M;  4S12 A;  2Q2E B;  1SG9 A;  2A5Y B;  1DV0 A;  2BNK A;  1HQC A;  2ERC A;  3SAU A;  2R6F A;  2P5T A;  4GRI A;  4Y28 F;  1OIZ A;  2K6B A;  3DZD A;  5IRE B;  5KQ8 A;  2UXC M;  2ZAO A;  3TQS A;  2V1U A;  4OX9 M;  3PNV A;  2MRO B;  5FTK A;  3U60 B;  3PXG A;  2NQ8 C;  1AIP C;  1N75 A;  1ZMV A;  3WHK A;  2KRU A;  4XK8 F;  4REZ A;  3HJQ A;  1XMQ M;  5EXP A;  1TF0 B;  2DZO B;  1VEJ A;  4DV6 M;  4L4U A;  4PDI A;  1NHG C;  2BJV A;  3VKH A;  4IBF A;  3I04 M;  2DZN B;  4LJ4 A;  3T15 A;  4CIZ A;  1QQW A;  4G4O A;  4NRW A;  2R65 A;  3E21 A;  2FOI C;  4GHA A;  1L1T A;  1QZE A;  4CHT B;  4DV0 M;  2CWB A;  2L6O A;  3RGP A;  3U6M A;  2C5R A;  1JQJ C;  5ITU A;  1L2B A;  2L7I A;  1Z59 A;  2FNA A;  5H37 D;  2QCU A;  4P16 A;  1WIV A;  1IY0 A;  4EIW A;  2DAI A;  4MH0 E;  2AHM A;  3HU1 A;  4AKH A;  3SHG B;  1NV9 A;  2DEN A;  2KHH A;  1QVR A;  1PJI A;  2KNZ A;  2G3Q A;  2X8A A;  3L2A A;  4IBI A;  3TPZ A;  4L78 A;  5IWA M;  3AKZ A;  1QAM A;  1MX0 A;  4LJ9 A;  5FTM A;  3UMM A;  4TUW A;  3HY5 A;  4M0W A;  4LCB A;  3RGS A;  2MJ5 B;  2LHG A;  2JA2 A;  5EXT A;  5BPV A;  3K9P A;  2V6Z M;  3U6D A;  3SMP A;  4L6V 6;  1N36 M;  4LFB M;  2H5X A;  2JUJ A;  2OOA A;  3FTC A;  4I4L A;  1QYR A;  5ITX E;  1Z5C A;  2RGH A;  4LF4 M;  5LMN M;  1E9S A;  2LWX A;  2YNM D;  3PVS A;  1ZV1 A;  4NL4 H;  3HKP A;  3FYC A;  2OOB A;  3RE8 A;  5ITY A;  5EP3 A;  1EIJ A;  1ZMU A;  2LHC A;  1GAB A;  1DGH B;  2DXI A;  4LF5 M;  3A45 A;  2R46 A;  5LMU M;  3R9X B;  4HEO A;  3E4R A;  4P17 A;  4IIW A;  3VK8 A;  2DWM A;  2XFS A;  1JB0 F;  2UUC M;  2CV1 A;  2BWE A;  3GPP A;  3SC3 A;  1T3T A;  3W0L B;  4W5W A;  1VDD A;  4GMQ A;  3AOE A;  2UUA M;  2QPA A;  3VDU A;  4IBC A;  4ZPX A;  1IM2 A;  2HCB A;  3AFH A;  4FD2 A;  2R0I A;  2Z3X A;  3IEC A;  2LXE A;  3K9O A;  2APL A;  2J7N A;  1WGN A;  4CIS A;  1NVM A;  1IXS A;  2DHY A;  3FKE A;  1IBK M;  3UK6 A;  1IY1 A;  3FRI A;  4MGK E;  1NV8 A;  3FUV A;  4CGY B;  3FUX A;  3J27 B;  3EIH A;  5EP4 A;  2ZAM A;  4QHS A;  1R2Y A;  1EE8 A;  3T1H M;  1QUS A;  3LQQ A;  1DGF A;  3B89 A;  2Z4S A;  4R7G A;  1HJP A;  4Z6Y A;  3AJI B;  4LJ8 A;  3KOX E;  3NBI A;  5C18 A;  2C9O A;  1XC8 A;  3EIE A;  4X64 M;  1Z6T A;  2B3T A;  3GLH A;  4MGH A;  3IG8 A;  4LG2 A;  1SXJ E;  1DGG A;  4JI3 M;  4DBG B;  2QBY A;  1KYI A;  3SMS A;  8CAT A;  3R8F A;  4IBE A;  3LW5 F;  3HU3 A;  3CGW A;  3HZJ A;  4KO8 A;  4BB9 A;  1HR0 M;  2QP9 X;  1NJG A;  2F4V M;  4MB7 A;  1OQY A;  2WZJ A;  2Z7J A;  1T43 A;  4FVM A;  2F5Q A;  1CUK A;  3L27 A;  4D81 A;  5EJC A;  2D7G A;  3GRU A;  1E94 E;  3FTF A;  1HNZ M;  2EO2 A;  2K0B X;  1JR3 D;  1QAQ A;  1TH4 A;  3HWS A;  3ZQJ A;  2KZS A;  2KNA A;  4XGI A;  1DGB A;  1TGU A;  4M0D A;  3MK6 A;  1F4I A;  5FLX S;  2DWL A;  4NXM M;  4B3R M;  2KDL A;  3U6S A;  2EUC A;  2XZU A;  5L8R F;  2EJS A;  2KRK A;  1GJT A;  4QNM A;  4GIT A;  2F5N A;  1GVN A;  1Q39 A;  2QBY B;  3L26 A;  2GQF A;  3L29 A;  1ORY B;  4M9Z A;  2WSE F;  4G4Q A;  3SAW A;  3UZU A;  2E5L M;  2F5S A;  2GNO A;  2CHV A;  3T1Y M;  1SXJ A;  4NSO B;  3M6A A;  2LNH C;  2LTU A;  3HHZ A;  1UM8 A;  1MJG M;  3I51 A;  4LRT A;  1TH2 A;  1FJG M;  3QYB A;  5KQD A;  7CAT A;  2XLJ A;  3Q8G A;  3J7A S;  4DV1 M;  1D0L A;  2ZAN A;  1D0M A;  5EP1 A;  2LVO C;  1IN6 A;  2D7E A;  2CEA A; 
#chains in the Genus database with same CATH homology
 4FWH A;  4NXN M;  1IY2 A;  3AL0 C;  1IN7 A;  2VII A;  1NHW C;  1C1K A;  2LH0 A;  5EP2 A;  5JI3 E;  4DV4 M;  5C1B A;  2CUZ A;  3HU2 A;  3KOZ E;  4MM3 B;  1I4W A;  3HHW A;  2HKJ A;  2OQ4 A;  5FTL A;  2UUB M;  2XEP A;  1XWI A;  2QEN A;  4LJ5 A;  2R4E A;  4RNA A;  4B3S M;  1WXQ A;  5E26 A;  2DVW B;  4LZZ A;  4IBD A;  3SAR A;  3L28 A;  4LF9 M;  4GC5 A;  3KP1 E;  4GIP A;  3GPY A;  2HHH M;  3ILK A;  3U61 A;  3U6P A;  5DYI A;  4FW9 A;  3U6Q A;  2UU9 M;  2YR0 A;  4AG5 A;  5ITX A;  4X65 M;  3C58 A;  3U6L A;  1MU5 A;  4LF7 M;  3KSJ A;  2YQZ A;  4AZF A;  1XMO M;  4LJA A;  4AQY M;  1L2C A;  3H4M A;  1X37 A;  3LMM A;  4JXJ A;  1IN4 A;  4GH9 A;  5IZ7 D;  1SXJ B;  3T38 A;  4B7F A;  1D2N A;  4JI0 M;  4DUY M;  4GKJ M;  1HQY E;  1G4A E;  2O5R A;  1L8Q A;  2CHG A;  1YE9 A;  3AOG A;  3SFZ A;  1ZQ9 A;  1J5E M;  2M5Z A;  3K8Z A;  1OFI A;  3THG A;  3KOY E;  3TL4 X;  4LGM A;  1G41 A;  4JI1 M;  2I7P A;  2XGN A;  1Q3B A;  2CV0 A;  3SHF A;  4JI4 M;  4OW0 A;  1TDH A;  3GRR A;  4PD2 A;  4RF0 A;  5IT9 S;  1IBL M;  4FCV A;  3U61 B;  3VFD A;  4YHH M;  3A98 B;  1R7R A;  3CF2 A;  2XSZ D;  3FD9 A;  1HNW M;  2DHR A;  4LF6 M;  3GLG B;  1XXH A;  3CF6 E;  4LGY A;  5EQT A;  5KPR A;  2HL7 A;  1PM5 A;  1IXS B;  1ZAE A;  4DV5 M;  5F3W A;  3A46 A;  1G8P A;  1XHB A;  2BJW A;  4AG6 A;  2KZU A;  1TDZ A;  4JI7 M;  1NY5 A;  3GQ4 A;  2L7H A;  3TWM A;  1OJL A;  4IBK A;  1IN8 A;  5ITT A;  2R18 A;  3U6C A;  4LZJ A;  4A3V B;  3GQ5 A;  4DR3 M;  1K82 A;  4OU7 A;  4D82 A;  4X62 M;  4JI6 M;  2Z4R A;  4IBG A;  3A42 A;  3MJ5 A;  2KXE A;  3SAT A;  1OFH A;  3GLH B;  3M7G A;  2DWN A;  2EA0 A;  4I5S A;  1G59 A;  4DR1 M;  1KFV A;  3GQ3 A;  4QHT A;  1NSF A;  3I4V A;  3KS8 A;  5KO3 A;  2KW0 A;  2VQF M;  1HNX M;  1NY6 A;  1NNU C;  4G4N A;  4OVZ B;  3KXE C;  2CHQ A;  3FUW A;  3E9S A;  4WUR A;  3LQR A;  3PFI A;  3GLI A;  4PCZ A;  3PNY A;  2M60 A;  4AW4 A;  3K92 A;  3VDP A;  3QWL A;  3FUT A;  4QNR A;  3OTO M;  4ITQ A;  3CTW B;  4JYA M;  3FTE A;  3SYL A;  4K0K M;  4LJ6 A;  3GPX A;  3U6E A;  3CF0 A;  4LY6 A;  3HHX A;  4B7G A;  4JN6 A;  3Q8X A;  1YSY A;  4L15 A;  3FUU A;  2KA6 B;  3DOA A;  5DYG A;  5ITR A;  3J81 S;  3DA1 A;  3AOE C;  4FWG A;  3SAV A;  1DO0 A;  2V1C A;  1I94 M;  2XF3 A;  1IXZ A;  2G8L A;  4BLC A;  2KEB A;  2OPF A;  3GLG A;  2DWZ B;  3J2P B;  3U5Z B;  3GP1 A;  2XFT A;  4DR2 M;  1XXH B;  3ZH9 B;  1QAN A;  2J7O A;  1KSF X;  2C98 A;  3HGI A;  4NRV A;  1IXR C;  2CE7 A;  1K3W A;  2Y0Q A;  4LF8 M;  4QOZ C;  1SXJ D;  3JAM S;  4L8R C;  1XNQ M;  4G6Z A;  4L16 A;  1HT1 E;  4QOS A;  2Y20 A;  3J7B A;  1H6U A;  4DR5 M;  3KSX A;  3ZCB B;  4DV2 M;  3HJS A;  5ITQ A;  4Z8X A;  5EXS A;  3SYK A;  2YFQ A;  4IJE A;  3ZC7 B;  3U60 A;  2C99 A;  3VKG A;  1QAO A;  2G5G X;  2ZBK B;  1JR3 A;  4FCT A;  2F5O A;  1IBM M;  2UXB M;  3FYD A;  1NNJ A;  3JR5 A;  4B3M M;  5FSW A;  5FTN A;  4LFA M;  4M9X A;  2XH9 A;  1XNR M;  4GHL A;  2R4J A;  3GO8 A;  2CFO A;  1QZM A;  4DV7 M;  3M0E A;  4OVZ A;  3KP0 E;  4JI8 M;  3K2L A;  4KHP M;  4RF1 A;  3VLF B;  2FFJ A;  4HLQ A;  3FTD A;  4MGY E;  2F5P A;  2K47 A;  4KOD A;  2C96 A;  2X4A A;  4B3T M;  3GLF A;  4AI6 A;  3L25 A;  1E32 A;  1DGH A;  4IBJ A;  1R2Z A;  1R6B X;  1IN5 A;  4GKK M;  1Z5A A;  4G4R A;  3VK7 A;  4NOO B;  5JI2 E;  2H1R A;  4LJ7 A;  3RFW A;  1L1Z A;  2VQE M;  3TWL A;  3DFZ A;  2D7H A;  3IG5 A;  3GPU A;  4IJF A;  1GL6 A;  1FNN A;  5KPZ A;  2I7N A;  4NSR A;  4PT5 A;  3UJN A;  4GC9 A;  3LVW A;  1W5T A;  3WHL A;  2ZM6 M;  3QAU A;  5E6J A;  3U6O A;  5FTJ A;  1J09 A;  1NJF A;  3U5Z A;  1Q3C A;  1Z5B A;  2R62 A;  5BR8 M;  3MHV C;  2W82 A;  5EXX A;  3GRY A;  3J80 S;  3KOW E;  4FWD A;  3SAS A;  2Y0T A;  1L2D A;  5A2Q S;  2XSZ A;  4II7 A;  4B7H A;  2CV2 A;  4DR6 M;  2QZ4 A;  4PDG A;  1GL7 A;  2R45 A;  3KDS E;  1E9R A;  4I81 A;  1DO2 A;  3JR4 A;  4JI2 M;  1N32 M;  1N33 M;  1GLN A;  4HL4 A;  3D8B A;  4YY3 M;  4B08 A;  5GKN A;  1IQP A;  3KW6 A;  4JI5 M;  3NWL A;  4MGI E;  3I4Y A;  4MGZ E;  2RGO A;  1N77 A;  3TE6 A;  1K3X A;  3LVV A;  4LRS A;  4WW0 A;  3GLI B;  5KPT A;  3HHY A;  4DR4 M;  3GLF B;  4DUZ M;  1G3I A;  3AV0 A;  3B9P A;  3KS4 A;  4M9S A;  3TWK A;  2UXD M;  2RKO A;  4BBA A;  1GKI A;  3UGJ A;  1HT2 E;  4IBB A;  4FCW A;  2XZF A;  5DNY A;  3KVW A;  4I8O A;  4AKI A;  1TH3 A;  4XBO A;  1PJJ A;  4LFC M;  1S3S A;  3KFU G;  3GRV A;  2FE8 A;  1N34 M;  4D80 A;  2X49 A;  4DV3 M;  3K1J A;  4R3D A;  4AKG A;  1SXJ C;  2Y21 A;  1YUB A;  2L09 A;  1LV7 A;  1J7K A;  4KLN A;  4X66 M;  4DR7 M;  2C9C A;  3D8L A;  1N78 A;  3SBJ A;  3BOS A;  3HJ8 A;  3W0F A;  1W5S A;  4JV5 M;  4S12 A;  2Q2E B;  2A5Y B;  2BNK A;  1HQC A;  2ERC A;  3SAU A;  2P5T A;  4GRI A;  5IRE B;  5KQ8 A;  3DZD A;  2UXC M;  2ZAO A;  3TQS A;  2V1U A;  4OX9 M;  3PNV A;  5FTK A;  3U60 B;  3PXG A;  2NQ8 C;  1N75 A;  3WHK A;  2KRU A;  4REZ A;  3HJQ A;  1XMQ M;  5EXP A;  2DZO B;  4DV6 M;  4L4U A;  4PDI A;  1NHG C;  2BJV A;  3VKH A;  4IBF A;  2DZN B;  4LJ4 A;  3T15 A;  1QQW A;  4G4O A;  4NRW A;  2R65 A;  4GHA A;  2FOI C;  1L1T A;  4CHT B;  4DV0 M;  2L6O A;  3RGP A;  3U6M A;  2C5R A;  1JQJ C;  5ITU A;  1L2B A;  2L7I A;  1Z59 A;  2FNA A;  5H37 D;  2QCU A;  4P16 A;  1IY0 A;  4EIW A;  4MH0 E;  2AHM A;  3HU1 A;  4AKH A;  3SHG B;  1QVR A;  1PJI A;  2X8A A;  3L2A A;  4IBI A;  3TPZ A;  4L78 A;  5IWA M;  3AKZ A;  1QAM A;  1MX0 A;  4LJ9 A;  5FTM A;  3UMM A;  4TUW A;  4M0W A;  4LCB A;  3RGS A;  2JA2 A;  5EXT A;  5BPV A;  2V6Z M;  3U6D A;  3SMP A;  1N36 M;  4LFB M;  3FTC A;  4I4L A;  5ITX E;  1QYR A;  1Z5C A;  2RGH A;  5LMN M;  1E9S A;  2LWX A;  2YNM D;  3PVS A;  4NL4 H;  3RE8 A;  3HKP A;  3FYC A;  5ITY A;  5EP3 A;  1DGH B;  2DXI A;  4LF5 M;  3A45 A;  2R46 A;  5LMU M;  3R9X B;  3E4R A;  4IIW A;  3VK8 A;  2DWM A;  2XFS A;  2UUC M;  2CV1 A;  3GPP A;  3SC3 A;  1T3T A;  3W0L B;  4W5W A;  1VDD A;  4GMQ A;  3AOE A;  2UUA M;  2QPA A;  3VDU A;  4IBC A;  4ZPX A;  1IM2 A;  2HCB A;  3AFH A;  4FD2 A;  2Z3X A;  2LXE A;  2J7N A;  4CIS A;  1NVM A;  3FKE A;  1IBK M;  3UK6 A;  1IY1 A;  4MGK E;  4CGY B;  3FUV A;  3FUX A;  3J27 B;  3EIH A;  5EP4 A;  2ZAM A;  4QHS A;  1R2Y A;  1EE8 A;  3T1H M;  3LQQ A;  1DGF A;  4Z6Y A;  2Z4S A;  4R7G A;  5C18 A;  4LF4 M;  3AJI B;  4LJ8 A;  3KOX E;  3NBI A;  1XC8 A;  2C9O A;  3EIE A;  4X64 M;  1Z6T A;  3GLH A;  4MGH A;  3IG8 A;  4LG2 A;  1SXJ E;  1DGG A;  4JI3 M;  2QBY A;  1KYI A;  3SMS A;  8CAT A;  3R8F A;  4IBE A;  3HU3 A;  4KO8 A;  4BB9 A;  1HR0 M;  2QP9 X;  1NJG A;  2F4V M;  4MB7 A;  4FVM A;  2Z7J A;  2F5Q A;  3L27 A;  4D81 A;  5EJC A;  2D7G A;  3GRU A;  1E94 E;  3FTF A;  1HNZ M;  2EO2 A;  1JR3 D;  1QAQ A;  1TH4 A;  3HWS A;  2KZS A;  4XGI A;  1DGB A;  1TGU A;  4M0D A;  3MK6 A;  5FLX S;  2DWL A;  4NXM M;  4B3R M;  3U6S A;  2EUC A;  2XZU A;  2KRK A;  4QNM A;  4GIT A;  2F5N A;  1GVN A;  1Q39 A;  2QBY B;  3L26 A;  3L29 A;  4M9Z A;  1ORY B;  4G4Q A;  3SAW A;  3UZU A;  2E5L M;  2F5S A;  2CHV A;  3T1Y M;  1SXJ A;  4NSO B;  3M6A A;  2LNH C;  3HHZ A;  1UM8 A;  3I51 A;  4LRT A;  1TH2 A;  1FJG M;  5KQD A;  7CAT A;  2XLJ A;  3J7A S;  4DV1 M;  2ZAN A;  5EP1 A;  1IN6 A;  2D7E A;  2CEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...