2KRUA

Solution nmr structure of the pcp_red domain of light-independent protochlorophyllide reductase subunit b from chlorobium tepidum. northeast structural genomics consortium target ctr69a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
b'MGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light-independent protochlorophyllide reductase subunit B
molecule tags Oxidoreductase
source organism Chlorobaculum tepidum
publication title Solution NMR structure of the PCP_red domain of light-independent protochlorophyllide reductase subunit B from Chlorobium tepidum. Northeast Structural Genomics Consortium Target CtR69A
rcsb
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kruA01
2L09A 2KRUA 2YNMD
chains in the Genus database with same CATH superfamily
4DV2M 2LVPC 1NV8A 2HWJA 2I7NA 4QNRA 3GLGE 4R3DA 3D8LA 2CV1A 4JYAM 1F4IA 4LF4M 3NBXX 1ZMVA 3U6MA 2K47A 1NJFA 1IXZA 4M9XA 1L2DA 1IBKM 2FFJA 1KYIA 1G4AE 3HWSA 5EP2A 3W0LB 1R4GA 2CUZA 3GLHB 1X37A 1TH2A 2V6ZM 2WSEF 4WURA 3JR5A 1G3IA 4CISA 4DV5M 1K3XA 2F5NA 5FTJA 2BNKA 4OW0A 3B7QA 2KEBA 5EJCA 2LHGA 1TF0B 2ERCA 2Z8YM 4GIPA 4CIZA 2KNVA 4LJ9A 4GHAA 1OJLA 3U6PA 1WR1B 1FNNA 3SBJA 1V92A 2OQ4A 3U60B 4JI2M 3GPPA 4OU7A 2Y0TA 5DYGA 3LMMA 4FWGA 4KHPM 3AKZA 3L2AA 3QYEA 5IREB 3C9PA 1FJGM 1S3SA 2JY6B 3CF2A 3HHYA 2O25A 1J7KA 4S12A 5FTKA 4KO8A 2J7NA 1NJGA 3CGWA 3DZDA 3IHPA 3KSJA 2RGOA 4OVZB 2DVWB 2J5YA 3K9PA 4PT5A 1E32A 3U6EA 4I81A 1Q3BA 2QENA 1K82A 4FCWA 4JI6M 4EIWA 3QAUA 3QYBA 1QAOA 2KNZA 3D8BA 4IBGA 1D0KA 2LVNC 2R65A 4P17A 2HHHM 4MGHA 4B3TM 3E21A 2L7IA 3AV0A 4JI7M 1IFYA 2L2DA 1L8QA 2WSCF 3MK6A 2R4JA 1HT1E 4FWDA 2C96A 1IM2A 2JY7A 2YFQA 2Z7JA 1YE9A 2DNAA 3B9PA 3R9XB 4GH9A 3L27A 5ITRA 4AKIA 1DGBA 3BOSA 2Z4SA 3KOXE 2C9CA 1GLNA 2EUCA 1D2NA 1WGLA 2R45A 3E46A 1QAMA 1R2ZA 2YR0A 4LJ6A 2ZANA 2D7EA 2L09A 1N34M 5KPTA 2C9OA 4X66M 1Y8GA 4JI3M 2QQ8A 2WSFF 1UM8A 4DV3M 1RU3A 1VG5A 2YQZA 3VDPA 2C5RA 4DR7M 2EJSA 3I04M 3M7GA 3WHKA 4FWHA 1L1TA 3AFHA 3CTWB 1MJGM 4G6ZA 3GPUA 1TGUA 1HQYE 2KRKA 3LW5F 2N35A 3QWLA 5C1BA 3RGPA 4LRSA 2EKKA 2UUCM 4YHHM 3SYKA 3BXWA 2K0BX 1H6UA 4FCTA 4DR1M 1JQJC 4OX9M 2DHRA 4PDGA 3SAUA 3Q8XA 1K3WA 3I4VA 2DENA 2L4FA 3HU2A 2VF8A 3IG8A 4JI4M 4L4UA 1DV0A 2VQEM 2QHOB 5C18A 3U6DA 1ORYB 3DFZA 2M60A 3HZJA 4ZPXA 1V33A 2A5YB 3KFUG 3U6LA 3BBZA 4D81A 3U60A 1ZV1A 3GLIE 4ITQA 1MX0A 3GO8A 4Q7JA 3KSXA 4BLCA 4G4RA 3KS4A 3K8ZA 1QZEA 2MH8A 1OIPA 3FRIA 2F5QA 1Z59A 4LFCM 4GHLA 1GJTA 3K92A 3J2PB 3JR4A 8CATA 4FVMA 1XB2B 2DHYA 3SAVA 5H37D 1EE8A 2DZOB 4HL4A 2CV2A 1HQCA 1G41A 4NXMM 1WXQA 2C98A 2ZAOA 1KSFX 3GLHA 3H4MA 4ANRA 3KOWE 5DNYA 3GLFE 2DAIA 3B7ZA 1GL7A 2JWSA 1GO5A 2VQFM 1NSFA 4MGYE 3DOAA 1IXSB 3EIHA 3B89A 1N75A 2FOIC 4LJAA 1PJSA 3L28A 1IY1A 4KODA 5DFLA 4LF8M 4BB9A 1HT2E 2AHMA 3FD9A 2HCBA 3U61B 3T1YM 1ZMUA 2KZSA 3GRUA 1PGYA 1XXHA 2OOBA 1D0LA 4CJ6A 3ZCBB 3J27B 2B3TA 4F2LA 5E6JA 5KO3A 1NHGC 3SASA 2GQFA 3FUTA 2O5RA 5E26A 4AW4A 4M9ZA 2LXEA 1JR3A 4G4QA 1IY2A 5F3WA 2RKOA 4LCBA 3KP1E 3PNVA 1HR0M 4IJEA 2FNAA 3PVSA 2EKFA 4IIWA 3UK6A 3C3EA 1YUBA 2VF7A 4M0WA 2CRUA 1R6BX 2R6FA 2F4VM 3UZUA 3J80S 1C7YA 5FTNA 3GQ3A 2E5LM 2Z4RA 4NOOB 3FTFA 3HKPA 4LG2A 1CUKA 3DA1A 2XLJA 3OTOM 4OVZA 1UFZA 5ITUA 4CHTB 3RGSA 1WHCA 1GABA 1HJPA 4JI5M 2CFOA 1XMQM 4W5WA 3U6OA 1NO1A 1IN8A 2DZNB 4IBBA 4D82A 4K0KM 4L78A 4AKHA 2JA2A 1PJTA 3GQ5A 4GMQA 3FUVA 1Z5BA 1P3QQ 2LVQD 1VDDA 2LTUA 2YNMD 2APLA 3HGIA 1N36M 2DWMA 2KDLA 3F92A 1W5TA 2P5TA 4LFAM 3VK8A 2QBYB 2D7HA 4L15A 1PJIA 3SATA 3ZC7B 1GVNA 2W82A 3HX3A 3FTDA 2OPFA 2QP9X 1IQPA 3FKEA 3KS8A 3CF6E 4JN6A 1VEKA 4QHTA 3T38A 1G8PA 2HKJA 2Y0QA 4RF0A 4BBAA 3L29A 4LZZA 2UXBM 3M0EA 2XFTA 3KDSE 2J7OA 3U5ZB 5GKNA 3GLGB 3PXGA 1WIVA 2GNOA 3HHWA 4DR3M 3PFIA 1Q39A 4B3MM 3KW6A 5EXPA 2JY5A 4P16A 4G4OA 1HNXM 4M9SA 4XGIA 2LHCA 1A5TA 1I94M 4L6V6 4B7HA 3U6QA 2XEPA 5ITTA 2UUAM 1QYRA 1IXSA 2R46A 2C99A 4QOSA 4RNAA 5EQTA 4AI6A 3TWLA 1NHWC 5JI2E 3AOEA 4Z8XA 4GKKM 3EIEA 1YSYA 2HL7A 1IN5A 3I01M 2BJVA 1TTEA 2JP7A 1E94E 3T15A 2V1CA 3NBIA 3CF0A 4KLNA 1JR3D 2BWEA 4R71A 5LMNM 3ZQJA 2BWBA 3TE6A 2JXNA 4F1IA 3GPXA 1E9RA 3GLHE 1TDZA 1L1ZA 3LQRA 1NV9A 2L4EA 1MU5A 4UN2B 2ZAMA 4HEOA 5EXTA 4YY3M 2MGWA 1N33M 1QDRA 1NNUC 3L25A 1N32M 1PRBA 4DV4M 4GC5A 4I4LA 2Y20A 3GPYA 2CHGA 3W67A 2Z3XA 4REZA 2VIIA 5KPZA 1LV7A 1BVSA 3FTCA 2QCUA 2LVOC 3HJSA 4A3VB 1QQWA 1Z5AA 4NL4H 4IJFA 1NY5A 3RE8A 1XHBA 1SXJD 1Q3CA 2FE8A 1QVRA 1DGHA 2Q2EB 5FLXS 1L2CA 4IBIA 3SAWA 4LF7M 5EXSA 4MGKE 1ZAEA 2XGNA 1DO0A 4B3SM 1QAQA 2LNHC 3FTEA 1Z6TA 2UUBM 3HJ8A 4DUZM 4LJ4A 4LJ8A 5ITXA 1G71A 2DAEA 1VEJA 4NRWA 1NNJA 2O01F 3LCVB 3LQQA 4Y28F 5EP1A 2FS1A 3IECA 4XBOA 2CEAA 1PM5A 2DWLA 2CV0A 2UXCM 2FH0A 3L26A 4MGZE 3TWKA 2UU9M 2NQ8C 4RKUF 3K9OA 4IBEA 4X62M 3U61A 1DGHB 3AOGA 4FW9A 5DYIA 2DZLA 3HU1A 4GEWA 3SC3A 1HNWM 4AZFA 1VEGA 2G5GX 2L7HA 4LY6A 4DR2M 1OKSA 1GL6A 2DAMA 3J81S 1T43A 3VDUA 4NC6A 5EP4A 5ITQA 5L8RF 2QPAA 2F5PA 2K6BA 1IBLM 4LJ5A 1DGFA 3GLFA 1OFIA 4M0DA 2H1RA 4LF5M 4B7GA 1SXJC 2OO9A 2JZ1A 2BJWA 3T6PA 3HJQA 3J7AS 3FE3A 4JI8M 3VKHA 2QSFX 4LF9M 3IG5A 4LFBM 2JY8A 3HU3A 4FCVA 2R4EA 1LTMA 2DAGA 2WZJA 3GP1A 1XNRM 1SXJB 2ZTDA 2F5OA 2XZFA 2ZBKB 4I5SA 1QDTA 4QNMA 4LGYA 3I4YA 2R0IA 4CGYB 2X4AA 1OQYA 3GLIA 2I7PA 3NWLA 4JXJA 2DWZB 5KPRA 3VLFB 3GLIB 1OAIA 2JNHA 4JI0M 2DWNA 4IBFA 2VDBB 3FYDA 2KA6B 2QZ4A 2XSZD 3B74A 1L2BA 4AG6A 2G8LA 4X65M 4GITA 2LVAA 5IWAM 1JR3E 1ZQ9A 2JUJA 5ITXE 1DGGA 3A46A 2CHQA 1XMOM 2X49A 2XFSA 1IN6A 3R8FA 5JI3E 1NVMA 2LBCA 3J7BA 4WW0A 5KQDA 3KVWA 3GRYA 5EXXA 4IBCA 3ZH9B 1GJSA 3Q8GA 4GKJM 4I8OA 3THGA 4NSRA 1IN7A 1GKIA 3V76A 4B7FA 1IY0A 1QANA 1EFUB 2MJ5B 2DI0A 2V1UA 3VKGA 1WGNA 3LVWA 3MJ5A 3HHZA 3MMPA 3E9SA 1WJ7A 3GRRA 3LVVA 3PNYA 5FTMA 1R2YA 2UXDM 3B7NA 3W68A 3RFWA 2X8AA 3FUWA 3U6CA 1TR8A 1SXJE 2DKLA 3HY5A 3FRHA 2XSZA 3I51A 3JAMS 2MR9A 3U6SA 2Y21A 4NSOB 1J5EM 1XNQM 1IBMM 1NY6A 1R7RA 1SG9A 1KFVA 3GRVA 3K2LA 3TPZA 1QUSA 4MH0E 2CHVA 1T3TA 1W5SA 4IBKA 5IZ7D 4X64M 3AL0C 3A45A 1OTRA 2L6OA 5ITYA 1Q02A 1VQ1A 3SFZA 3SARA 1AIPC 3SMPA 3A42A 4LGMA 4NXNM 3TQSA 2EA0A 2EO2A 1AUAA 2RGHA 4MGIE 2XF3A 3KXEC 1J09A 4QOZC 3H4JA 1D0MA 1MN3A 2DAKA 2RRUA 1Z5CA 1TH4A 1TH3A 4MM3B 4DR4M 4DV0M 1EIJA 1OAOC 1VDLA 1QZMA 2R18A 1PJQA 4DUYM 2DXIA 4MB7A 1OFHA 2MROB 3UJNA 2XZUA 1E9SA 2JZ0A 4WP2A 1XXHB 2R62A 4LF6M 5FSWA 3FUXA 4IBDA 5A2QS 2CE7A 1TDHA 1QUTA 2D7GA 4R7GA 2H5XA 4DV7M 2KHHA 2KW0A 4DR5M 1HNZM 3LCUA 2F5SA 3T1HM 1XC8A 1T6OA 1XWIA 1C1KA 2QNJA 4GC9A 2QBYA 3GQ4A 1SXJA 3FUUA 4LRTA 4GRIA 4JI1M 2LH0A 1N78A 4RF1A 5BR8M 1G59A 3TL4X 3WHLA 4II7A 5IT9S 4LJ7A 3GLFB 4AQYM 4DV1M 2OOAA 3MHVC 1ZMWA 3VFDA 1IN4A 4IBJA 3C58A 5EP3A 1V34A 4AKGA 1I4WA 3W0FA 1XXHE 2KZUA 2G3QA 2ZM6M 2CP8A 3M6AA 4Z6YA 4PCZA 1OIZA 1JB0F 2ZTCA 7CATA 4B3RM 4XK8F 4JV5M 4PDIA 4DBGB 2CWBA 3TWMA 4L8RC 1YLAA 3K1JA 4KT0F 3FYCA 1DO2A 3ILKA 3AJIB 3AOEC 4HLQA 3UMMA 3SYLA 3SHGB 1IXRC 3HHXA 4DR6M 3VK7A 1R5LA 2R44A 4PD2A 2XH9A 4G3OA 4D80A 4AG5A 3SMSA 2HAKA 4B08A 3UGJA 3U5ZA 2LWXA 4L16A 5FTLA 5KQ8A 2M5ZA 3KOYE 2KRUA 4G4NA 4DV6M 4TUWA 2KXEA 3C3DA 2K9DA 3KOZE 4FD2A 5LMUM 4QHSA 5BPVA 2KNAA 3E4RA 4LZJA 3GLGA 1PJJA 3SHFA 1N77A 4NRVA 3A98B 3KP0E
chains in the Genus database with same CATH topology
4DV2M 2I7NA 4QNRA 2CV1A 4R3DA 3D8LA 4JYAM 4LF4M 3U6MA 2K47A 1NJFA 1IXZA 4M9XA 1L2DA 1IBKM 2FFJA 1KYIA 1G4AE 3HWSA 5EP2A 3W0LB 2CUZA 3GLHB 1X37A 1TH2A 2V6ZM 3JR5A 4WURA 1G3IA 4CISA 4DV5M 1K3XA 2F5NA 5FTJA 2BNKA 4OW0A 5EJCA 2KEBA 2ERCA 4GIPA 4LJ9A 4GHAA 1OJLA 3U6PA 1FNNA 3SBJA 2OQ4A 3U60B 4JI2M 3GPPA 4OU7A 2Y0TA 5DYGA 3LMMA 4FWGA 4KHPM 3AKZA 3L2AA 5IREB 1FJGM 1S3SA 3CF2A 3HHYA 4S12A 1J7KA 5FTKA 4KO8A 2J7NA 1NJGA 3DZDA 3KSJA 2RGOA 4OVZB 2DVWB 4PT5A 1E32A 3U6EA 4I81A 1Q3BA 2QENA 1K82A 4FCWA 4JI6M 4EIWA 3QAUA 1QAOA 3D8BA 4IBGA 2R65A 2HHHM 4MGHA 4B3TM 2L7IA 3AV0A 4JI7M 1L8QA 3MK6A 2R4JA 1HT1E 4FWDA 2C96A 1IM2A 2YFQA 2Z7JA 1YE9A 3B9PA 3R9XB 4GH9A 3L27A 5ITRA 4AKIA 1DGBA 3BOSA 2Z4SA 3KOXE 2C9CA 1GLNA 2EUCA 1D2NA 2R45A 1R2ZA 1QAMA 2YR0A 4LJ6A 2ZANA 2D7EA 2L09A 1N34M 5KPTA 2C9OA 4X66M 4JI3M 1UM8A 4DV3M 2YQZA 3VDPA 2C5RA 4DR7M 3M7GA 1L1TA 3WHKA 4FWHA 3AFHA 3CTWB 4G6ZA 3GPUA 1TGUA 1HQYE 2KRKA 3QWLA 5C1BA 3RGPA 4LRSA 2UUCM 4YHHM 3SYKA 4FCTA 1H6UA 4DR1M 1JQJC 4OX9M 2DHRA 4PDGA 3SAUA 3Q8XA 1K3WA 3I4VA 3HU2A 4JI4M 3IG8A 4L4UA 2VQEM 5C18A 3U6DA 1ORYB 3DFZA 2M60A 4ZPXA 3KFUG 2A5YB 3U6LA 4D81A 3U60A 4ITQA 1MX0A 3GO8A 3KSXA 4BLCA 4G4RA 3KS4A 3K8ZA 2F5QA 1Z59A 4LFCM 4GHLA 3K92A 3J2PB 3JR4A 8CATA 4FVMA 3SAVA 5H37D 1EE8A 2DZOB 4HL4A 2CV2A 1HQCA 1G41A 4NXMM 1WXQA 2C98A 2ZAOA 1KSFX 3GLHA 3H4MA 3KOWE 5DNYA 1GL7A 2VQFM 1NSFA 4MGYE 3DOAA 1IXSB 3EIHA 1N75A 2FOIC 4LJAA 3L28A 1IY1A 4KODA 4LF8M 4BB9A 1HT2E 2AHMA 3FD9A 2HCBA 3U61B 3T1YM 2KZSA 3GRUA 1XXHA 3ZCBB 3J27B 5E6JA 5KO3A 1NHGC 3SASA 3FUTA 2O5RA 5E26A 4AW4A 4M9ZA 2LXEA 1JR3A 4G4QA 1IY2A 5F3WA 2RKOA 4LCBA 3KP1E 3PNVA 1HR0M 4IJEA 2FNAA 3PVSA 4IIWA 3UK6A 1YUBA 4M0WA 1R6BX 2F4VM 3UZUA 3J80S 5FTNA 3GQ3A 2E5LM 2Z4RA 4NOOB 3FTFA 3HKPA 4LG2A 3DA1A 2XLJA 3OTOM 4OVZA 5ITUA 4CHTB 3RGSA 4JI5M 2CFOA 1XMQM 4W5WA 3U6OA 1IN8A 2DZNB 4IBBA 4D82A 4K0KM 4L78A 4AKHA 2JA2A 3GQ5A 4GMQA 3FUVA 1Z5BA 2DWMA 3HGIA 1VDDA 2YNMD 1N36M 1W5TA 2P5TA 4LFAM 3VK8A 2QBYB 2D7HA 4L15A 1PJIA 3SATA 3ZC7B 1GVNA 2W82A 3FTDA 2OPFA 2QP9X 1IQPA 3FKEA 3KS8A 3CF6E 4JN6A 4QHTA 3T38A 1G8PA 2HKJA 2Y0QA 4RF0A 4BBAA 3L29A 4LZZA 2UXBM 3M0EA 2XFTA 3KDSE 2J7OA 3U5ZB 5GKNA 3GLGB 3PXGA 3HHWA 4DR3M 3PFIA 1Q39A 3KW6A 5EXPA 4P16A 4G4OA 1HNXM 4M9SA 4XGIA 1I94M 4B7HA 3U6QA 2XEPA 5ITTA 2UUAM 1QYRA 2R46A 2C99A 4QOSA 4RNAA 5EQTA 4AI6A 3TWLA 1NHWC 5JI2E 3AOEA 4Z8XA 4GKKM 3EIEA 1YSYA 2HL7A 1IN5A 3T15A 2BJVA 1E94E 2V1CA 3NBIA 3CF0A 4KLNA 1JR3D 5LMNM 3TE6A 3GPXA 1E9RA 1TDZA 1L1ZA 3LQRA 1MU5A 2ZAMA 5EXTA 4YY3M 1N33M 1NNUC 3L25A 1N32M 4DV4M 4GC5A 4I4LA 2Y20A 3GPYA 2CHGA 2Z3XA 4REZA 2VIIA 5KPZA 1LV7A 3FTCA 2QCUA 3HJSA 4A3VB 1QQWA 1Z5AA 4NL4H 4IJFA 1NY5A 3RE8A 1XHBA 1SXJD 1Q3CA 2FE8A 1QVRA 1DGHA 2Q2EB 5FLXS 1L2CA 4IBIA 3SAWA 4LF7M 5EXSA 4MGKE 1ZAEA 2XGNA 1DO0A 4B3SM 1QAQA 2LNHC 3FTEA 1Z6TA 2UUBM 3HJ8A 4DUZM 4LJ4A 4LJ8A 5ITXA 4NRWA 1NNJA 3LQQA 2DWLA 5EP1A 1PM5A 4XBOA 2CV0A 2UXCM 2CEAA 3L26A 2UU9M 4MGZE 3TWKA 2NQ8C 4IBEA 4X62M 3U61A 1DGHB 3AOGA 4FW9A 5DYIA 3HU1A 3SC3A 1HNWM 4AZFA 2G5GX 2L7HA 4LY6A 4DR2M 1GL6A 3J81S 3VDUA 5EP4A 5ITQA 2QPAA 2F5PA 1IBLM 4LJ5A 1DGFA 3GLFA 1OFIA 4M0DA 2H1RA 4LF5M 4B7GA 1SXJC 2BJWA 3HJQA 3J7AS 4JI8M 3VKHA 4LF9M 3IG5A 4LFBM 3HU3A 4FCVA 2R4EA 3GP1A 1XNRM 1SXJB 2F5OA 2XZFA 2ZBKB 4I5SA 4QNMA 4LGYA 3I4YA 4CGYB 2X4AA 3GLIA 2I7PA 3NWLA 4JXJA 2DWZB 5KPRA 3VLFB 3GLIB 2DWNA 4JI0M 4IBFA 3FYDA 2KA6B 2QZ4A 2XSZD 1L2BA 4AG6A 2G8LA 4X65M 4GITA 5IWAM 1ZQ9A 5ITXE 1DGGA 3A46A 2CHQA 1XMOM 2X49A 2XFSA 1IN6A 3R8FA 5JI3E 1NVMA 4WW0A 3J7BA 5KQDA 3KVWA 3GRYA 5EXXA 4IBCA 3ZH9B 4GKJM 4I8OA 3THGA 4NSRA 1IN7A 1GKIA 4B7FA 1IY0A 1QANA 2V1UA 3VKGA 3LVWA 3MJ5A 3HHZA 3E9SA 3GRRA 3LVVA 3PNYA 5FTMA 1R2YA 2UXDM 3RFWA 2X8AA 3FUWA 3U6CA 1SXJE 2XSZA 3I51A 3JAMS 3U6SA 2Y21A 4NSOB 1J5EM 1XNQM 1IBMM 1NY6A 1R7RA 1KFVA 3GRVA 3K2LA 3TPZA 4MH0E 2CHVA 1T3TA 1W5SA 4IBKA 5IZ7D 4X64M 3AL0C 3A45A 2L6OA 5ITYA 3SFZA 3SARA 4B3MM 3SMPA 3A42A 4LGMA 4NXNM 3TQSA 2EA0A 2EO2A 2RGHA 4MGIE 2XF3A 3KXEC 1J09A 4QOZC 1Z5CA 1TH4A 1TH3A 4MM3B 4DR4M 4DV0M 1QZMA 2R18A 2DXIA 4DUYM 4MB7A 1OFHA 3UJNA 2XZUA 1E9SA 1XXHB 2R62A 4LF6M 5FSWA 3FUXA 4IBDA 5A2QS 2CE7A 1TDHA 2D7GA 4R7GA 4DV7M 2KW0A 4DR5M 1HNZM 2F5SA 3T1HM 1XC8A 1XWIA 1C1KA 2QBYA 4GC9A 3GQ4A 1SXJA 3FUUA 4LRTA 4GRIA 4JI1M 2LH0A 1N78A 4RF1A 5BR8M 1G59A 3TL4X 3WHLA 4II7A 5IT9S 4LJ7A 3GLFB 4AQYM 4DV1M 3MHVC 3VFDA 1IN4A 4IBJA 3C58A 5EP3A 4AKGA 1I4WA 3W0FA 2KZUA 2ZM6M 3M6AA 4Z6YA 4PCZA 4B3RM 7CATA 4JV5M 4PDIA 4L8RC 3TWMA 3K1JA 3FYCA 1DO2A 3ILKA 3AJIB 3AOEC 4HLQA 3UMMA 3SYLA 3SHGB 1IXRC 3HHXA 4DR6M 3VK7A 4PD2A 2XH9A 4D80A 4AG5A 3SMSA 4B08A 3UGJA 3U5ZA 2LWXA 4L16A 5FTLA 5KQ8A 2M5ZA 3KOYE 2KRUA 4G4NA 4DV6M 4TUWA 2KXEA 3KOZE 4FD2A 5LMUM 4QHSA 5BPVA 3E4RA 4LZJA 3GLGA 1PJJA 3SHFA 1N77A 4NRVA 3A98B 3KP0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L09 A;  2KRU A;  2YNM D; 
#chains in the Genus database with same CATH topology
 4DV2 M;  2LVP C;  1NV8 A;  2HWJ A;  2I7N A;  4QNR A;  3GLG E;  4R3D A;  3D8L A;  2CV1 A;  4JYA M;  1F4I A;  4LF4 M;  3NBX X;  1ZMV A;  3U6M A;  2K47 A;  1NJF A;  1IXZ A;  4M9X A;  1L2D A;  1IBK M;  2FFJ A;  1KYI A;  1G4A E;  3HWS A;  5EP2 A;  3W0L B;  1R4G A;  2CUZ A;  3GLH B;  1X37 A;  1TH2 A;  2V6Z M;  2WSE F;  4WUR A;  3JR5 A;  1G3I A;  4CIS A;  4DV5 M;  1K3X A;  2F5N A;  5FTJ A;  2BNK A;  4OW0 A;  3B7Q A;  2KEB A;  5EJC A;  2LHG A;  1TF0 B;  2ERC A;  2Z8Y M;  4GIP A;  4CIZ A;  2KNV A;  4LJ9 A;  4GHA A;  1OJL A;  3U6P A;  1WR1 B;  1FNN A;  3SBJ A;  1V92 A;  2OQ4 A;  3U60 B;  4JI2 M;  3GPP A;  4OU7 A;  2Y0T A;  5DYG A;  3LMM A;  4FWG A;  4KHP M;  3AKZ A;  3L2A A;  3QYE A;  5IRE B;  3C9P A;  1FJG M;  1S3S A;  2JY6 B;  3CF2 A;  3HHY A;  2O25 A;  1J7K A;  4S12 A;  5FTK A;  4KO8 A;  2J7N A;  1NJG A;  3CGW A;  3DZD A;  3IHP A;  3KSJ A;  2RGO A;  4OVZ B;  2DVW B;  2J5Y A;  3K9P A;  4PT5 A;  1E32 A;  3U6E A;  4I81 A;  1Q3B A;  2QEN A;  1K82 A;  4FCW A;  4JI6 M;  4EIW A;  3QAU A;  3QYB A;  1QAO A;  2KNZ A;  3D8B A;  4IBG A;  1D0K A;  2LVN C;  2R65 A;  4P17 A;  2HHH M;  4MGH A;  4B3T M;  3E21 A;  2L7I A;  3AV0 A;  4JI7 M;  1IFY A;  2L2D A;  1L8Q A;  2WSC F;  3MK6 A;  2R4J A;  1HT1 E;  4FWD A;  2C96 A;  1IM2 A;  2JY7 A;  2YFQ A;  2Z7J A;  1YE9 A;  2DNA A;  3B9P A;  3R9X B;  4GH9 A;  3L27 A;  5ITR A;  4AKI A;  1DGB A;  3BOS A;  2Z4S A;  3KOX E;  2C9C A;  1GLN A;  2EUC A;  1D2N A;  1WGL A;  2R45 A;  3E46 A;  1QAM A;  1R2Z A;  2YR0 A;  4LJ6 A;  2ZAN A;  2D7E A;  2L09 A;  1N34 M;  5KPT A;  2C9O A;  4X66 M;  1Y8G A;  4JI3 M;  2QQ8 A;  2WSF F;  1UM8 A;  4DV3 M;  1RU3 A;  1VG5 A;  2YQZ A;  3VDP A;  2C5R A;  4DR7 M;  2EJS A;  3I04 M;  3M7G A;  3WHK A;  4FWH A;  1L1T A;  3AFH A;  3CTW B;  1MJG M;  4G6Z A;  3GPU A;  1TGU A;  1HQY E;  2KRK A;  3LW5 F;  2N35 A;  3QWL A;  5C1B A;  3RGP A;  4LRS A;  2EKK A;  2UUC M;  4YHH M;  3SYK A;  3BXW A;  2K0B X;  1H6U A;  4FCT A;  4DR1 M;  1JQJ C;  4OX9 M;  2DHR A;  4PDG A;  3SAU A;  3Q8X A;  1K3W A;  3I4V A;  2DEN A;  2L4F A;  3HU2 A;  2VF8 A;  3IG8 A;  4JI4 M;  4L4U A;  1DV0 A;  2VQE M;  2QHO B;  5C18 A;  3U6D A;  1ORY B;  3DFZ A;  2M60 A;  3HZJ A;  4ZPX A;  1V33 A;  2A5Y B;  3KFU G;  3U6L A;  3BBZ A;  4D81 A;  3U60 A;  1ZV1 A;  3GLI E;  4ITQ A;  1MX0 A;  3GO8 A;  4Q7J A;  3KSX A;  4BLC A;  4G4R A;  3KS4 A;  3K8Z A;  1QZE A;  2MH8 A;  1OIP A;  3FRI A;  2F5Q A;  1Z59 A;  4LFC M;  4GHL A;  1GJT A;  3K92 A;  3J2P B;  3JR4 A;  8CAT A;  4FVM A;  1XB2 B;  2DHY A;  3SAV A;  5H37 D;  1EE8 A;  2DZO B;  4HL4 A;  2CV2 A;  1HQC A;  1G41 A;  4NXM M;  1WXQ A;  2C98 A;  2ZAO A;  1KSF X;  3GLH A;  3H4M A;  4ANR A;  3KOW E;  5DNY A;  3GLF E;  2DAI A;  3B7Z A;  1GL7 A;  2JWS A;  1GO5 A;  2VQF M;  1NSF A;  4MGY E;  3DOA A;  1IXS B;  3EIH A;  3B89 A;  1N75 A;  2FOI C;  4LJA A;  1PJS A;  3L28 A;  1IY1 A;  4KOD A;  5DFL A;  4LF8 M;  4BB9 A;  1HT2 E;  2AHM A;  3FD9 A;  2HCB A;  3U61 B;  3T1Y M;  1ZMU A;  2KZS A;  3GRU A;  1PGY A;  1XXH A;  2OOB A;  1D0L A;  4CJ6 A;  3ZCB B;  3J27 B;  2B3T A;  4F2L A;  5E6J A;  5KO3 A;  1NHG C;  3SAS A;  2GQF A;  3FUT A;  2O5R A;  5E26 A;  4AW4 A;  4M9Z A;  2LXE A;  1JR3 A;  4G4Q A;  1IY2 A;  5F3W A;  2RKO A;  4LCB A;  3KP1 E;  3PNV A;  1HR0 M;  4IJE A;  2FNA A;  3PVS A;  2EKF A;  4IIW A;  3UK6 A;  3C3E A;  1YUB A;  2VF7 A;  4M0W A;  2CRU A;  1R6B X;  2R6F A;  2F4V M;  3UZU A;  3J80 S;  1C7Y A;  5FTN A;  3GQ3 A;  2E5L M;  2Z4R A;  4NOO B;  3FTF A;  3HKP A;  4LG2 A;  1CUK A;  3DA1 A;  2XLJ A;  3OTO M;  4OVZ A;  1UFZ A;  5ITU A;  4CHT B;  3RGS A;  1WHC A;  1GAB A;  1HJP A;  4JI5 M;  2CFO A;  1XMQ M;  4W5W A;  3U6O A;  1NO1 A;  1IN8 A;  2DZN B;  4IBB A;  4D82 A;  4K0K M;  4L78 A;  4AKH A;  2JA2 A;  1PJT A;  3GQ5 A;  4GMQ A;  3FUV A;  1Z5B A;  1P3Q Q;  2LVQ D;  1VDD A;  2LTU A;  2YNM D;  2APL A;  3HGI A;  1N36 M;  2DWM A;  2KDL A;  3F92 A;  1W5T A;  2P5T A;  4LFA M;  3VK8 A;  2QBY B;  2D7H A;  4L15 A;  1PJI A;  3SAT A;  3ZC7 B;  1GVN A;  2W82 A;  3HX3 A;  3FTD A;  2OPF A;  2QP9 X;  1IQP A;  3FKE A;  3KS8 A;  3CF6 E;  4JN6 A;  1VEK A;  4QHT A;  3T38 A;  1G8P A;  2HKJ A;  2Y0Q A;  4RF0 A;  4BBA A;  3L29 A;  4LZZ A;  2UXB M;  3M0E A;  2XFT A;  3KDS E;  2J7O A;  3U5Z B;  5GKN A;  3GLG B;  3PXG A;  1WIV A;  2GNO A;  3HHW A;  4DR3 M;  3PFI A;  1Q39 A;  4B3M M;  3KW6 A;  5EXP A;  2JY5 A;  4P16 A;  4G4O A;  1HNX M;  4M9S A;  4XGI A;  2LHC A;  1A5T A;  1I94 M;  4L6V 6;  4B7H A;  3U6Q A;  2XEP A;  5ITT A;  2UUA M;  1QYR A;  1IXS A;  2R46 A;  2C99 A;  4QOS A;  4RNA A;  5EQT A;  4AI6 A;  3TWL A;  1NHW C;  5JI2 E;  3AOE A;  4Z8X A;  4GKK M;  3EIE A;  1YSY A;  2HL7 A;  1IN5 A;  3I01 M;  2BJV A;  1TTE A;  2JP7 A;  1E94 E;  3T15 A;  2V1C A;  3NBI A;  3CF0 A;  4KLN A;  1JR3 D;  2BWE A;  4R71 A;  5LMN M;  3ZQJ A;  2BWB A;  3TE6 A;  2JXN A;  4F1I A;  3GPX A;  1E9R A;  3GLH E;  1TDZ A;  1L1Z A;  3LQR A;  1NV9 A;  2L4E A;  1MU5 A;  4UN2 B;  2ZAM A;  4HEO A;  5EXT A;  4YY3 M;  2MGW A;  1N33 M;  1QDR A;  1NNU C;  3L25 A;  1N32 M;  1PRB A;  4DV4 M;  4GC5 A;  4I4L A;  2Y20 A;  3GPY A;  2CHG A;  3W67 A;  2Z3X A;  4REZ A;  2VII A;  5KPZ A;  1LV7 A;  1BVS A;  3FTC A;  2QCU A;  2LVO C;  3HJS A;  4A3V B;  1QQW A;  1Z5A A;  4NL4 H;  4IJF A;  1NY5 A;  3RE8 A;  1XHB A;  1SXJ D;  1Q3C A;  2FE8 A;  1QVR A;  1DGH A;  2Q2E B;  5FLX S;  1L2C A;  4IBI A;  3SAW A;  4LF7 M;  5EXS A;  4MGK E;  1ZAE A;  2XGN A;  1DO0 A;  4B3S M;  1QAQ A;  2LNH C;  3FTE A;  1Z6T A;  2UUB M;  3HJ8 A;  4DUZ M;  4LJ4 A;  4LJ8 A;  5ITX A;  1G71 A;  2DAE A;  1VEJ A;  4NRW A;  1NNJ A;  2O01 F;  3LCV B;  3LQQ A;  4Y28 F;  5EP1 A;  2FS1 A;  3IEC A;  4XBO A;  2CEA A;  1PM5 A;  2DWL A;  2CV0 A;  2UXC M;  2FH0 A;  3L26 A;  4MGZ E;  3TWK A;  2UU9 M;  2NQ8 C;  4RKU F;  3K9O A;  4IBE A;  4X62 M;  3U61 A;  1DGH B;  3AOG A;  4FW9 A;  5DYI A;  2DZL A;  3HU1 A;  4GEW A;  3SC3 A;  1HNW M;  4AZF A;  1VEG A;  2G5G X;  2L7H A;  4LY6 A;  4DR2 M;  1OKS A;  1GL6 A;  2DAM A;  3J81 S;  1T43 A;  3VDU A;  4NC6 A;  5EP4 A;  5ITQ A;  5L8R F;  2QPA A;  2F5P A;  2K6B A;  1IBL M;  4LJ5 A;  1DGF A;  3GLF A;  1OFI A;  4M0D A;  2H1R A;  4LF5 M;  4B7G A;  1SXJ C;  2OO9 A;  2JZ1 A;  2BJW A;  3T6P A;  3HJQ A;  3J7A S;  3FE3 A;  4JI8 M;  3VKH A;  2QSF X;  4LF9 M;  3IG5 A;  4LFB M;  2JY8 A;  3HU3 A;  4FCV A;  2R4E A;  1LTM A;  2DAG A;  2WZJ A;  3GP1 A;  1XNR M;  1SXJ B;  2ZTD A;  2F5O A;  2XZF A;  2ZBK B;  4I5S A;  1QDT A;  4QNM A;  4LGY A;  3I4Y A;  2R0I A;  4CGY B;  2X4A A;  1OQY A;  3GLI A;  2I7P A;  3NWL A;  4JXJ A;  2DWZ B;  5KPR A;  3VLF B;  3GLI B;  1OAI A;  2JNH A;  4JI0 M;  2DWN A;  4IBF A;  2VDB B;  3FYD A;  2KA6 B;  2QZ4 A;  2XSZ D;  3B74 A;  1L2B A;  4AG6 A;  2G8L A;  4X65 M;  4GIT A;  2LVA A;  5IWA M;  1JR3 E;  1ZQ9 A;  2JUJ A;  5ITX E;  1DGG A;  3A46 A;  2CHQ A;  1XMO M;  2X49 A;  2XFS A;  1IN6 A;  3R8F A;  5JI3 E;  1NVM A;  2LBC A;  3J7B A;  4WW0 A;  5KQD A;  3KVW A;  3GRY A;  5EXX A;  4IBC A;  3ZH9 B;  1GJS A;  3Q8G A;  4GKJ M;  4I8O A;  3THG A;  4NSR A;  1IN7 A;  1GKI A;  3V76 A;  4B7F A;  1IY0 A;  1QAN A;  1EFU B;  2MJ5 B;  2DI0 A;  2V1U A;  3VKG A;  1WGN A;  3LVW A;  3MJ5 A;  3HHZ A;  3MMP A;  3E9S A;  1WJ7 A;  3GRR A;  3LVV A;  3PNY A;  5FTM A;  1R2Y A;  2UXD M;  3B7N A;  3W68 A;  3RFW A;  2X8A A;  3FUW A;  3U6C A;  1TR8 A;  1SXJ E;  2DKL A;  3HY5 A;  3FRH A;  2XSZ A;  3I51 A;  3JAM S;  2MR9 A;  3U6S A;  2Y21 A;  4NSO B;  1J5E M;  1XNQ M;  1IBM M;  1NY6 A;  1R7R A;  1SG9 A;  1KFV A;  3GRV A;  3K2L A;  3TPZ A;  1QUS A;  4MH0 E;  2CHV A;  1T3T A;  1W5S A;  4IBK A;  5IZ7 D;  4X64 M;  3AL0 C;  3A45 A;  1OTR A;  2L6O A;  5ITY A;  1Q02 A;  1VQ1 A;  3SFZ A;  3SAR A;  1AIP C;  3SMP A;  3A42 A;  4LGM A;  4NXN M;  3TQS A;  2EA0 A;  2EO2 A;  1AUA A;  2RGH A;  4MGI E;  2XF3 A;  3KXE C;  1J09 A;  4QOZ C;  3H4J A;  1D0M A;  1MN3 A;  2DAK A;  2RRU A;  1Z5C A;  1TH4 A;  1TH3 A;  4MM3 B;  4DR4 M;  4DV0 M;  1EIJ A;  1OAO C;  1VDL A;  1QZM A;  2R18 A;  1PJQ A;  4DUY M;  2DXI A;  4MB7 A;  1OFH A;  2MRO B;  3UJN A;  2XZU A;  1E9S A;  2JZ0 A;  4WP2 A;  1XXH B;  2R62 A;  4LF6 M;  5FSW A;  3FUX A;  4IBD A;  5A2Q S;  2CE7 A;  1TDH A;  1QUT A;  2D7G A;  4R7G A;  2H5X A;  4DV7 M;  2KHH A;  2KW0 A;  4DR5 M;  1HNZ M;  3LCU A;  2F5S A;  3T1H M;  1XC8 A;  1T6O A;  1XWI A;  1C1K A;  2QNJ A;  4GC9 A;  2QBY A;  3GQ4 A;  1SXJ A;  3FUU A;  4LRT A;  4GRI A;  4JI1 M;  2LH0 A;  1N78 A;  4RF1 A;  5BR8 M;  1G59 A;  3TL4 X;  3WHL A;  4II7 A;  5IT9 S;  4LJ7 A;  3GLF B;  4AQY M;  4DV1 M;  2OOA A;  3MHV C;  1ZMW A;  3VFD A;  1IN4 A;  4IBJ A;  3C58 A;  5EP3 A;  1V34 A;  4AKG A;  1I4W A;  3W0F A;  1XXH E;  2KZU A;  2G3Q A;  2ZM6 M;  2CP8 A;  3M6A A;  4Z6Y A;  4PCZ A;  1OIZ A;  1JB0 F;  2ZTC A;  7CAT A;  4B3R M;  4XK8 F;  4JV5 M;  4PDI A;  4DBG B;  2CWB A;  3TWM A;  4L8R C;  1YLA A;  3K1J A;  4KT0 F;  3FYC A;  1DO2 A;  3ILK A;  3AJI B;  3AOE C;  4HLQ A;  3UMM A;  3SYL A;  3SHG B;  1IXR C;  3HHX A;  4DR6 M;  3VK7 A;  1R5L A;  2R44 A;  4PD2 A;  2XH9 A;  4G3O A;  4D80 A;  4AG5 A;  3SMS A;  2HAK A;  4B08 A;  3UGJ A;  3U5Z A;  2LWX A;  4L16 A;  5FTL A;  5KQ8 A;  2M5Z A;  3KOY E;  2KRU A;  4G4N A;  4DV6 M;  4TUW A;  2KXE A;  3C3D A;  2K9D A;  3KOZ E;  4FD2 A;  5LMU M;  4QHS A;  5BPV A;  2KNA A;  3E4R A;  4LZJ A;  3GLG A;  1PJJ A;  3SHF A;  1N77 A;  4NRV A;  3A98 B;  3KP0 E; 
#chains in the Genus database with same CATH homology
 4DV2 M;  2I7N A;  4QNR A;  2CV1 A;  4R3D A;  3D8L A;  4JYA M;  4LF4 M;  3U6M A;  2K47 A;  1NJF A;  1IXZ A;  4M9X A;  1L2D A;  1IBK M;  2FFJ A;  1KYI A;  1G4A E;  3HWS A;  5EP2 A;  3W0L B;  2CUZ A;  3GLH B;  1X37 A;  1TH2 A;  2V6Z M;  3JR5 A;  4WUR A;  1G3I A;  4CIS A;  4DV5 M;  1K3X A;  2F5N A;  5FTJ A;  2BNK A;  4OW0 A;  5EJC A;  2KEB A;  2ERC A;  4GIP A;  4LJ9 A;  4GHA A;  1OJL A;  3U6P A;  1FNN A;  3SBJ A;  2OQ4 A;  3U60 B;  4JI2 M;  3GPP A;  4OU7 A;  2Y0T A;  5DYG A;  3LMM A;  4FWG A;  4KHP M;  3AKZ A;  3L2A A;  5IRE B;  1FJG M;  1S3S A;  3CF2 A;  3HHY A;  4S12 A;  1J7K A;  5FTK A;  4KO8 A;  2J7N A;  1NJG A;  3DZD A;  3KSJ A;  2RGO A;  4OVZ B;  2DVW B;  4PT5 A;  1E32 A;  3U6E A;  4I81 A;  1Q3B A;  2QEN A;  1K82 A;  4FCW A;  4JI6 M;  4EIW A;  3QAU A;  1QAO A;  3D8B A;  4IBG A;  2R65 A;  2HHH M;  4MGH A;  4B3T M;  2L7I A;  3AV0 A;  4JI7 M;  1L8Q A;  3MK6 A;  2R4J A;  1HT1 E;  4FWD A;  2C96 A;  1IM2 A;  2YFQ A;  2Z7J A;  1YE9 A;  3B9P A;  3R9X B;  4GH9 A;  3L27 A;  5ITR A;  4AKI A;  1DGB A;  3BOS A;  2Z4S A;  3KOX E;  2C9C A;  1GLN A;  2EUC A;  1D2N A;  2R45 A;  1R2Z A;  1QAM A;  2YR0 A;  4LJ6 A;  2ZAN A;  2D7E A;  2L09 A;  1N34 M;  5KPT A;  2C9O A;  4X66 M;  4JI3 M;  1UM8 A;  4DV3 M;  2YQZ A;  3VDP A;  2C5R A;  4DR7 M;  3M7G A;  1L1T A;  3WHK A;  4FWH A;  3AFH A;  3CTW B;  4G6Z A;  3GPU A;  1TGU A;  1HQY E;  2KRK A;  3QWL A;  5C1B A;  3RGP A;  4LRS A;  2UUC M;  4YHH M;  3SYK A;  4FCT A;  1H6U A;  4DR1 M;  1JQJ C;  4OX9 M;  2DHR A;  4PDG A;  3SAU A;  3Q8X A;  1K3W A;  3I4V A;  3HU2 A;  4JI4 M;  3IG8 A;  4L4U A;  2VQE M;  5C18 A;  3U6D A;  1ORY B;  3DFZ A;  2M60 A;  4ZPX A;  3KFU G;  2A5Y B;  3U6L A;  4D81 A;  3U60 A;  4ITQ A;  1MX0 A;  3GO8 A;  3KSX A;  4BLC A;  4G4R A;  3KS4 A;  3K8Z A;  2F5Q A;  1Z59 A;  4LFC M;  4GHL A;  3K92 A;  3J2P B;  3JR4 A;  8CAT A;  4FVM A;  3SAV A;  5H37 D;  1EE8 A;  2DZO B;  4HL4 A;  2CV2 A;  1HQC A;  1G41 A;  4NXM M;  1WXQ A;  2C98 A;  2ZAO A;  1KSF X;  3GLH A;  3H4M A;  3KOW E;  5DNY A;  1GL7 A;  2VQF M;  1NSF A;  4MGY E;  3DOA A;  1IXS B;  3EIH A;  1N75 A;  2FOI C;  4LJA A;  3L28 A;  1IY1 A;  4KOD A;  4LF8 M;  4BB9 A;  1HT2 E;  2AHM A;  3FD9 A;  2HCB A;  3U61 B;  3T1Y M;  2KZS A;  3GRU A;  1XXH A;  3ZCB B;  3J27 B;  5E6J A;  5KO3 A;  1NHG C;  3SAS A;  3FUT A;  2O5R A;  5E26 A;  4AW4 A;  4M9Z A;  2LXE A;  1JR3 A;  4G4Q A;  1IY2 A;  5F3W A;  2RKO A;  4LCB A;  3KP1 E;  3PNV A;  1HR0 M;  4IJE A;  2FNA A;  3PVS A;  4IIW A;  3UK6 A;  1YUB A;  4M0W A;  1R6B X;  2F4V M;  3UZU A;  3J80 S;  5FTN A;  3GQ3 A;  2E5L M;  2Z4R A;  4NOO B;  3FTF A;  3HKP A;  4LG2 A;  3DA1 A;  2XLJ A;  3OTO M;  4OVZ A;  5ITU A;  4CHT B;  3RGS A;  4JI5 M;  2CFO A;  1XMQ M;  4W5W A;  3U6O A;  1IN8 A;  2DZN B;  4IBB A;  4D82 A;  4K0K M;  4L78 A;  4AKH A;  2JA2 A;  3GQ5 A;  4GMQ A;  3FUV A;  1Z5B A;  2DWM A;  3HGI A;  1VDD A;  2YNM D;  1N36 M;  1W5T A;  2P5T A;  4LFA M;  3VK8 A;  2QBY B;  2D7H A;  4L15 A;  1PJI A;  3SAT A;  3ZC7 B;  1GVN A;  2W82 A;  3FTD A;  2OPF A;  2QP9 X;  1IQP A;  3FKE A;  3KS8 A;  3CF6 E;  4JN6 A;  4QHT A;  3T38 A;  1G8P A;  2HKJ A;  2Y0Q A;  4RF0 A;  4BBA A;  3L29 A;  4LZZ A;  2UXB M;  3M0E A;  2XFT A;  3KDS E;  2J7O A;  3U5Z B;  5GKN A;  3GLG B;  3PXG A;  3HHW A;  4DR3 M;  3PFI A;  1Q39 A;  3KW6 A;  5EXP A;  4P16 A;  4G4O A;  1HNX M;  4M9S A;  4XGI A;  1I94 M;  4B7H A;  3U6Q A;  2XEP A;  5ITT A;  2UUA M;  1QYR A;  2R46 A;  2C99 A;  4QOS A;  4RNA A;  5EQT A;  4AI6 A;  3TWL A;  1NHW C;  5JI2 E;  3AOE A;  4Z8X A;  4GKK M;  3EIE A;  1YSY A;  2HL7 A;  1IN5 A;  3T15 A;  2BJV A;  1E94 E;  2V1C A;  3NBI A;  3CF0 A;  4KLN A;  1JR3 D;  5LMN M;  3TE6 A;  3GPX A;  1E9R A;  1TDZ A;  1L1Z A;  3LQR A;  1MU5 A;  2ZAM A;  5EXT A;  4YY3 M;  1N33 M;  1NNU C;  3L25 A;  1N32 M;  4DV4 M;  4GC5 A;  4I4L A;  2Y20 A;  3GPY A;  2CHG A;  2Z3X A;  4REZ A;  2VII A;  5KPZ A;  1LV7 A;  3FTC A;  2QCU A;  3HJS A;  4A3V B;  1QQW A;  1Z5A A;  4NL4 H;  4IJF A;  1NY5 A;  3RE8 A;  1XHB A;  1SXJ D;  1Q3C A;  2FE8 A;  1QVR A;  1DGH A;  2Q2E B;  5FLX S;  1L2C A;  4IBI A;  3SAW A;  4LF7 M;  5EXS A;  4MGK E;  1ZAE A;  2XGN A;  1DO0 A;  4B3S M;  1QAQ A;  2LNH C;  3FTE A;  1Z6T A;  2UUB M;  3HJ8 A;  4DUZ M;  4LJ4 A;  4LJ8 A;  5ITX A;  4NRW A;  1NNJ A;  3LQQ A;  2DWL A;  5EP1 A;  1PM5 A;  4XBO A;  2CV0 A;  2UXC M;  2CEA A;  3L26 A;  2UU9 M;  4MGZ E;  3TWK A;  2NQ8 C;  4IBE A;  4X62 M;  3U61 A;  1DGH B;  3AOG A;  4FW9 A;  5DYI A;  3HU1 A;  3SC3 A;  1HNW M;  4AZF A;  2G5G X;  2L7H A;  4LY6 A;  4DR2 M;  1GL6 A;  3J81 S;  3VDU A;  5EP4 A;  5ITQ A;  2QPA A;  2F5P A;  1IBL M;  4LJ5 A;  1DGF A;  3GLF A;  1OFI A;  4M0D A;  2H1R A;  4LF5 M;  4B7G A;  1SXJ C;  2BJW A;  3HJQ A;  3J7A S;  4JI8 M;  3VKH A;  4LF9 M;  3IG5 A;  4LFB M;  3HU3 A;  4FCV A;  2R4E A;  3GP1 A;  1XNR M;  1SXJ B;  2F5O A;  2XZF A;  2ZBK B;  4I5S A;  4QNM A;  4LGY A;  3I4Y A;  4CGY B;  2X4A A;  3GLI A;  2I7P A;  3NWL A;  4JXJ A;  2DWZ B;  5KPR A;  3VLF B;  3GLI B;  2DWN A;  4JI0 M;  4IBF A;  3FYD A;  2KA6 B;  2QZ4 A;  2XSZ D;  1L2B A;  4AG6 A;  2G8L A;  4X65 M;  4GIT A;  5IWA M;  1ZQ9 A;  5ITX E;  1DGG A;  3A46 A;  2CHQ A;  1XMO M;  2X49 A;  2XFS A;  1IN6 A;  3R8F A;  5JI3 E;  1NVM A;  4WW0 A;  3J7B A;  5KQD A;  3KVW A;  3GRY A;  5EXX A;  4IBC A;  3ZH9 B;  4GKJ M;  4I8O A;  3THG A;  4NSR A;  1IN7 A;  1GKI A;  4B7F A;  1IY0 A;  1QAN A;  2V1U A;  3VKG A;  3LVW A;  3MJ5 A;  3HHZ A;  3E9S A;  3GRR A;  3LVV A;  3PNY A;  5FTM A;  1R2Y A;  2UXD M;  3RFW A;  2X8A A;  3FUW A;  3U6C A;  1SXJ E;  2XSZ A;  3I51 A;  3JAM S;  3U6S A;  2Y21 A;  4NSO B;  1J5E M;  1XNQ M;  1IBM M;  1NY6 A;  1R7R A;  1KFV A;  3GRV A;  3K2L A;  3TPZ A;  4MH0 E;  2CHV A;  1T3T A;  1W5S A;  4IBK A;  5IZ7 D;  4X64 M;  3AL0 C;  3A45 A;  2L6O A;  5ITY A;  3SFZ A;  3SAR A;  4B3M M;  3SMP A;  3A42 A;  4LGM A;  4NXN M;  3TQS A;  2EA0 A;  2EO2 A;  2RGH A;  4MGI E;  2XF3 A;  3KXE C;  1J09 A;  4QOZ C;  1Z5C A;  1TH4 A;  1TH3 A;  4MM3 B;  4DR4 M;  4DV0 M;  1QZM A;  2R18 A;  2DXI A;  4DUY M;  4MB7 A;  1OFH A;  3UJN A;  2XZU A;  1E9S A;  1XXH B;  2R62 A;  4LF6 M;  5FSW A;  3FUX A;  4IBD A;  5A2Q S;  2CE7 A;  1TDH A;  2D7G A;  4R7G A;  4DV7 M;  2KW0 A;  4DR5 M;  1HNZ M;  2F5S A;  3T1H M;  1XC8 A;  1XWI A;  1C1K A;  2QBY A;  4GC9 A;  3GQ4 A;  1SXJ A;  3FUU A;  4LRT A;  4GRI A;  4JI1 M;  2LH0 A;  1N78 A;  4RF1 A;  5BR8 M;  1G59 A;  3TL4 X;  3WHL A;  4II7 A;  5IT9 S;  4LJ7 A;  3GLF B;  4AQY M;  4DV1 M;  3MHV C;  3VFD A;  1IN4 A;  4IBJ A;  3C58 A;  5EP3 A;  4AKG A;  1I4W A;  3W0F A;  2KZU A;  2ZM6 M;  3M6A A;  4Z6Y A;  4PCZ A;  4B3R M;  7CAT A;  4JV5 M;  4PDI A;  4L8R C;  3TWM A;  3K1J A;  3FYC A;  1DO2 A;  3ILK A;  3AJI B;  3AOE C;  4HLQ A;  3UMM A;  3SYL A;  3SHG B;  1IXR C;  3HHX A;  4DR6 M;  3VK7 A;  4PD2 A;  2XH9 A;  4D80 A;  4AG5 A;  3SMS A;  4B08 A;  3UGJ A;  3U5Z A;  2LWX A;  4L16 A;  5FTL A;  5KQ8 A;  2M5Z A;  3KOY E;  2KRU A;  4G4N A;  4DV6 M;  4TUW A;  2KXE A;  3KOZ E;  4FD2 A;  5LMU M;  4QHS A;  5BPV A;  3E4R A;  4LZJ A;  3GLG A;  1PJJ A;  3SHF A;  1N77 A;  4NRV A;  3A98 B;  3KP0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...