2KRUA

Solution nmr structure of the pcp_red domain of light-independent protochlorophyllide reductase subunit b from chlorobium tepidum. northeast structural genomics consortium target ctr69a
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
b'MGELSWTAEAEKMLGKVPFFVRKKVRKNTDNYAREIGEPVVTADVFRKAKEHLGGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Light-independent protochlorophyllide reductase subunit B
publication title Solution NMR structure of the PCP_red domain of light-independent protochlorophyllide reductase subunit B from Chlorobium tepidum. Northeast Structural Genomics Consortium Target CtR69A
rcsb
source organism Chlorobaculum tepidum
molecule tags Oxidoreductase
total genus 17
structure length 63
sequence length 63
ec nomenclature ec 1.3.7.7: Ferredoxin:protochlorophyllide reductase (ATP-dependent).
pdb deposition date 2009-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08369 PCP_red Proto-chlorophyllide reductase 57 kD subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.550 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kruA01
2KRUA 2YNMD 2L09A
chains in the Genus database with same CATH superfamily
2KHHA 3KDSE 3UMMA 4IBKA 3FUWA 4LF4M 4CISA 1WGLA 3HKPA 3I01M 3R8FA 2LXEA 2R65A 2FFJA 4B3RM 4XBOA 1PJJA 1R5LA 2N35A 1MX0A 3Q8XA 4IJFA 4AQYM 2X4AA 2XFTA 4GH9A 2JZ0A 4MM3B 2LNHC 5FSWA 5FLXS 4QHSA 1QQWA 1QDRA 3HY5A 4DV0M 2MGWA 2DWLA 5EXXA 4IBBA 4DR4M 2MH8A 2CHGA 3GP1A 2QCUA 3B7QA 5EP3A 1R2ZA 1XMOM 3SATA 4LJ6A 1LV7A 3K9PA 5C18A 4LFCM 2X49A 1L2DA 2RGHA 3MJ5A 3W67A 3UGJA 1G8PA 1KSFX 3L28A 4L8RC 3NBXX 3SMSA 3C58A 1Q3CA 1N78A 4REZA 2DKLA 4KO8A 4EIWA 4X65M 4NSOB 4FCWA 4KLNA 1IY1A 4M0WA 1X37A 4DV5M 2XSZD 2I7NA 1OFIA 1NNJA 2JA2A 5KPRA 4IBFA 4LF9M 4DR5M 1TDZA 3M6AA 3U60A 1OJLA 5EP2A 4DR2M 4IBCA 2GNOA 2RGOA 2L09A 2DHYA 2EKKA 3KOZE 1XC8A 3RGSA 2Z8YM 4LJ5A 5ITUA 2VIIA 2ERCA 4JV5M 2LH0A 1T43A 3HGIA 1ZMUA 3B74A 4IBDA 1IN5A 2RKOA 1G59A 4F1IA 3KFUG 2DAMA 3U5ZA 1D2NA 1NHGC 1E32A 2I7PA 2KNZA 1ZV1A 4LJAA 1IN6A 2O01F 3I4YA 3KOYE 4OU7A 3HWSA 2F5PA 4LRTA 3TWMA 3QYEA 1QDTA 1CUKA 3LW5F 1PGYA 4JI2M 3GRUA 1XXHA 3LVVA 1VG5A 3HJSA 4MGZE 1I94M 4JI0M 2CV2A 3U60B 2F4VM 1HNWM 3CF0A 2QBYA 3I4VA 3KS4A 2R0IA 4P16A 2LVAA 2OO9A 3SHGB 4ZPXA 2C98A 1V92A 3E4RA 1JQJC 2QENA 3QAUA 4OVZA 1BVSA 3E9SA 3FUVA 2H5XA 1YUBA 2LWXA 1IN4A 4FCTA 1YLAA 1VEGA 2VF7A 5EP4A 1V34A 3T1YM 3UJNA 3FTEA 1NO1A 2H1RA 1NV9A 1HNXM 4DV3M 2HCBA 4M9XA 3J80S 5IT9S 2L6OA 3B7ZA 3TQSA 4NC6A 3U6DA 1NJGA 3DFZA 3FTFA 5DNYA 3SAWA 4FWGA 4JI1M 1D0KA 3IHPA 3ZC7B 2QBYB 3LCUA 1HQCA 4GC9A 3U6QA 3J81S 2C9CA 2E5LM 4K0KM 2JY7A 1W5TA 1TDHA 1G3IA 3GRRA 1N77A 2O5RA 5DFLA 4JXJA 2G5GX 3U61A 3LQRA 3GPPA 1IBLM 2AHMA 2YFQA 5FTLA 5IWAM 4LF5M 2EO2A 1GL6A 3U6PA 2XFSA 4LGYA 4B7GA 3LVWA 3M7GA 2BNKA 4HEOA 4II7A 1D0LA 2K0BX 3PFIA 1OKSA 3KOXE 4GIPA 1OIPA 4QOZC 1VEJA 1R4GA 3AL0C 5KO3A 4LGMA 1IXSA 1DGHB 1KFVA 3JR4A 2CRUA 4IBJA 4GC5A 2L7HA 1IFYA 3FTCA 3JAMS 1WJ7A 1QAOA 3C9PA 3MK6A 3AJIB 3V76A 2KEBA 1AUAA 5F3WA 1Y8GA 2J7OA 1SXJE 2CWBA 4PT5A 1GL7A 3RGPA 2Z4SA 2LHCA 3GLHE 4W5WA 5KQ8A 5A2QS 1N33M 1OAOC 4IBGA 2O25A 5LMNM 1PJSA 4KHPM 2VQFM 4XK8F 4AKHA 3KP1E 1WXQA 5EJCA 4CJ6A 2DAIA 2RRUA 3HU2A 4QNRA 2Y21A 2DHRA 4JI3M 4PDIA 4R7GA 1IXSB 5DYIA 4BB9A 1NNUC 3W0FA 3GLGB 4GHAA 1QANA 4DV6M 1GO5A 3TWLA 1QZEA 4AKIA 3K1JA 3SHFA 5FTJA 1S3SA 3T38A 2DZLA 4AG5A 3HHZA 4IBIA 4X62M 4WP2A 1ZMVA 3AOEA 1K82A 1E9SA 2CFOA 2MJ5B 2J5YA 2R4EA 3ZCBB 1IXZA 1A5TA 4AW4A 3THGA 1IN7A 3LMMA 1N36M 2XF3A 4AI6A 3GLFA 1L8QA 2LVPC 5KPTA 5IREB 2LVNC 2UU9M 2DWZB 2Z7JA 4LJ9A 4L16A 3UK6A 1GABA 2KDLA 1UFZA 1R6BX 1G71A 4DR1M 2XH9A 1VQ1A 3SAUA 3UZUA 4D81A 2KW0A 3K9OA 1L2BA 3CF6E 4FWHA 4LY6A 2LHGA 4I4LA 2P5TA 1XNRM 3GLIE 1LTMA 3U6SA 1QUSA 2K9DA 4D80A 3GQ3A 2KRKA 1T6OA 4DUZM 3J27B 4B3MM 2DAKA 4MGIE 2R4JA 2VF8A 5FTMA 5ITRA 3C3EA 4GRIA 3AV0A 3GLFB 3KP0E 3PVSA 2D7GA 1MJGM 4PD2A 1PJIA 1JR3A 2NQ8C 2HWJA 4X64M 5ITXE 1SG9A 2L7IA 1PJQA 2WSEF 1TGUA 4AG6A 1OQYA 3AOEC 4B7HA 4X66M 4L15A 2UUCM 2KNAA 5ITYA 1DGGA 1D0MA 3HZJA 2ZAOA 1DO2A 2LVQD 1Q39A 1NY5A 1ZAEA 2ZTDA 3R9XB 3RE8A 1K3WA 4NXNM 3L25A 1EE8A 3SAVA 3AKZA 2XEPA 3HJ8A 3ZH9B 3KXEC 3SFZA 3PNVA 1R7RA 2JZ1A 3PXGA 3VDPA 1E9RA 2UXBM 2YQZA 1IQPA 4DR6M 4B3SM 2CEAA 2FOIC 2M60A 4G3OA 2Q2EB 1N75A 3M0EA 3U5ZB 1EFUB 1IBKM 2JNHA 3AFHA 1IY2A 4B3TM 2DWNA 1AIPC 4LFBM 4G4QA 1TH4A 3HJQA 4LFAM 2R18A 4CIZA 2VDBB 2ZM6M 1YE9A 5ITTA 1SXJC 2QNJA 4WURA 4BLCA 4GHLA 4YY3M 1V33A 4BBAA 3LQQA 1UM8A 1XXHB 4NL4H 3RFWA 2DWMA 2K6BA 2C96A 3EIEA 2FH0A 3VKGA 4LCBA 4TUWA 2J7NA 2JY8A 2LTUA 2BWEA 2ZTCA 2F5OA 2V6ZM 1HT2E 2CHQA 2CV0A 2WSCF 2LVOC 3J2PB 3KSJA 3TL4X 4GKJM 1VEKA 1IBMM 4OVZB 2DAGA 2X8AA 2OOAA 4DV4M 2XZFA 1PM5A 2CV1A 2APLA 1E94E 1XB2B 4D82A 4NRWA 3VKHA 1NV8A 1TTEA 3TPZA 1J09A 3AOGA 4JI5M 2V1UA 2QP9X 3C3DA 3U6LA 3VK7A 1MU5A 1VDDA 2BWBA 4L4UA 4MGYE 1OIZA 2FS1A 4DV1M 4NOOB 1NJFA 2Z4RA 1G4AE 1TF0B 4P17A 2ZBKB 4GEWA 2KZUA 3FRHA 3VLFB 4DV7M 2YR0A 1HNZM 3GRYA 3E21A 2KXEA 2BJVA 1ORYB 4GKKM 4IIWA 3BXWA 2HKJA 1XMQM 1C1KA 4RF1A 3U61B 2HL7A 3B9PA 1GJSA 2F5SA 3H4JA 2QZ4A 1IY0A 3HHWA 3MHVC 2ZAMA 1Q02A 2XGNA 2Y20A 2QSFX 4B08A 4OW0A 2CHVA 4CGYB 2KRUA 1P3QQ 1IM2A 3KW6A 3NBIA 4MGHA 2DNAA 1IXRC 2JWSA 5EXPA 1WIVA 4JI6M 1DO0A 1HR0M 3I04M 3FTDA 1JB0F 3SARA 2G8LA 1EIJA 2LBCA 2Y0QA 2FNAA 4KT0F 3TWKA 5FTNA 3GQ5A 3U6CA 5LMUM 5H37D 1JR3D 1OFHA 4I81A 1G41A 1K3XA 4IJEA 4G4OA 4JN6A 1PRBA 4AKGA 1GVNA 4LF8M 2MR9A 3L2AA 1TH2A 5EQTA 3ZQJA 3IG5A 1KYIA 2KA6B 3BBZA 5JI3E 2HHHM 2K47A 3D8BA 3B7NA 1WR1B 2W82A 4WW0A 1QAMA 2XLJA 3HX3A 3A45A 2D7HA 2M5ZA 3GO8A 3DOAA 4QHTA 1DV0A 4I5SA 4ANRA 4DBGB 4LG2A 1ZMWA 2KZSA 3KOWE 5EP1A 1QZMA 1XXHE 4LRSA 3SASA 3LCVB 1TH3A 1XWIA 1HT1E 1GJTA 2DI0A 1Z59A 3U6MA 1F4IA 3FRIA 3FE3A 3GPUA 3GQ4A 3VDUA 1QUTA 2JUJA 1SXJA 2L4EA 3GLHA 1WHCA 2L4FA 4LF7M 2KNVA 3VFDA 2VQEM 1DGFA 5ITQA 3K2LA 4JI7M 2XZUA 4G6ZA 4QOSA 1C7YA 3CF2A 4I8OA 2R45A 4XGIA 2EUCA 1L2CA 3OTOM 4RKUF 5GKNA 1PJTA 3F92A 5BR8M 4PDGA 2QPAA 2Z3XA 4IBEA 3HHXA 4AZFA 4MGKE 2JP7A 3A46A 2DVWB 5KPZA 2F5NA 3EIHA 2UUBM 1NSFA 1T3TA 2A5YB 2DENA 3K92A 3U6EA 4KODA 4NXMM 3J7BA 3QWLA 3J7AS 3D8LA 1GKIA 4GMQA 1N32M 1FNNA 4Q7JA 1SXJB 3H4MA 4M0DA 3Q8GA 8CATA 3SBJA 3GLHB 3L27A 3FUUA 3KSXA 1R2YA 3CTWB 2OPFA 2OQ4A 2DAEA 1QAQA 3E46A 1OTRA 2UXDM 3NWLA 1QVRA 4OX9M 2R46A 3FD9A 4R71A 3IG8A 7CATA 4RNAA 3FYDA 3FUXA 2QQ8A 4JYAM 2WSFF 1WGNA 4RF0A 2DZNB 1NVMA 1Z5BA 3SYKA 3B89A 2DZOB 1Z6TA 2HAKA 4M9ZA 5L8RF 3BOSA 4LZJA 2Y0TA 3VK8A 5FTKA 5KQDA 3GLGE 2JY5A 3I51A 2BJWA 4R3DA 1J7KA 4G4RA 1ZQ9A 3K8ZA 5DYGA 4HL4A 2D7EA 2ZANA 3WHKA 1HJPA 3GLIA 2UXCM 4Z8XA 3DZDA 2JXNA 3HHYA 4NSRA 4LF6M 1NY6A 5IZ7D 3FKEA 2MROB 3FYCA 2JY6B 3T15A 3ILKA 2XSZA 2WZJA 4A3VB 4CHTB 1W5SA 4FVMA 3HU3A 4FWDA 2CUZA 3A42A 4NRVA 3T6PA 3W0LB 4MB7A 2GQFA 5ITXA 1RU3A 3W68A 1L1ZA 4DR7M 3A98B 1N34M 2F5QA 2L2DA 4LJ4A 4F2LA 4DR3M 2C99A 2QHOB 4L6V6 5E26A 4DV2M 1I4WA 1Q3BA 3PNYA 4JI4M 3QYBA 4Z6YA 1XNQM 1NHWC 3GPXA 2DXIA 1MN3A 1DGHA 2C5RA 4UN2B 2V1CA 3GLIB 1FJGM 1XHBA 2EJSA 3SMPA 4G4NA 4FCVA 4L78A 2R44A 3DA1A 3GRVA 5E6JA 4PCZA 4FD2A 5BPVA 1Z5CA 3GPYA 1Z5AA 4MH0E 3L26A 3WHLA 4Y28F 3HU1A 2C9OA 3GLFE 3KVWA 1L1TA 2R62A 4M9SA 3CGWA 1HQYE 5JI2E 4DUYM 1H6UA 1OAIA 4LZZA 4HLQA 5EXSA 2OOBA 1DGBA 1SXJD 2B3TA 2CE7A 4FW9A 3GLGA 4LJ7A 2UUAM 1TR8A 2G3QA 2CP8A 2EA0A 3MMPA 4S12A 3FUTA 4ITQA 3IECA 2R6FA 3T1HM 3L29A 3SC3A 5EXTA 2EKFA 4QNMA 4YHHM 3KS8A 1QYRA 3TE6A 1GLNA 1J5EM 4GITA 4JI8M 3JR5A 3SYLA 1YSYA 1JR3E 4B7FA 1IN8A 2FE8A 2YNMD 4LJ8A 5C1BA 3U6OA 1VDLA
chains in the Genus database with same CATH topology
3KDSE 3UMMA 4IBKA 3FUWA 4LF4M 4CISA 3HKPA 3R8FA 2LXEA 2R65A 2FFJA 4B3RM 4XBOA 1PJJA 1MX0A 3Q8XA 4IJFA 4AQYM 2X4AA 2XFTA 4GH9A 4MM3B 2LNHC 5FSWA 5FLXS 4QHSA 1QQWA 4DV0M 2DWLA 5EXXA 4IBBA 4DR4M 2CHGA 3GP1A 2QCUA 5EP3A 1R2ZA 1XMOM 3SATA 4LJ6A 1LV7A 5C18A 4LFCM 2X49A 1L2DA 2RGHA 3MJ5A 3UGJA 1G8PA 1KSFX 3L28A 4L8RC 3SMSA 3C58A 1Q3CA 1N78A 4REZA 4EIWA 4KO8A 4X65M 4NSOB 4FCWA 4KLNA 1IY1A 4M0WA 1X37A 4DV5M 2XSZD 2I7NA 1OFIA 1NNJA 2JA2A 5KPRA 4IBFA 4LF9M 4DR5M 1TDZA 3M6AA 3U60A 1OJLA 5EP2A 4DR2M 4IBCA 2RGOA 2L09A 3KOZE 1XC8A 3RGSA 4LJ5A 5ITUA 2VIIA 2ERCA 4JV5M 2LH0A 3HGIA 4IBDA 1IN5A 2RKOA 1G59A 3KFUG 3U5ZA 1D2NA 1NHGC 1E32A 2I7PA 4LJAA 1IN6A 3I4YA 3KOYE 4OU7A 3HWSA 2F5PA 4LRTA 3TWMA 4JI2M 3GRUA 1XXHA 3LVVA 4MGZE 3HJSA 1I94M 4JI0M 2CV2A 3U60B 2F4VM 1HNWM 3CF0A 2QBYA 3I4VA 3KS4A 4P16A 3SHGB 4ZPXA 2C98A 3QAUA 3E4RA 1JQJC 2QENA 4OVZA 3E9SA 3FUVA 1YUBA 2LWXA 1IN4A 4FCTA 3T1YM 5EP4A 3UJNA 3FTEA 2H1RA 1HNXM 4DV3M 2HCBA 4M9XA 3J80S 5IT9S 2L6OA 3TQSA 3U6DA 1NJGA 3DFZA 3FTFA 5DNYA 3SAWA 4FWGA 4JI1M 3ZC7B 2QBYB 1HQCA 4GC9A 3U6QA 3J81S 2C9CA 2E5LM 4K0KM 1W5TA 1TDHA 1G3IA 3GRRA 1N77A 2O5RA 4JXJA 2G5GX 3U61A 3LQRA 3GPPA 1IBLM 2AHMA 2YFQA 5FTLA 5IWAM 4LF5M 2EO2A 1GL6A 3U6PA 2XFSA 4LGYA 4B7GA 3LVWA 3M7GA 2BNKA 4II7A 3PFIA 3KOXE 4GIPA 4QOZC 3AL0C 5KO3A 4LGMA 1DGHB 1KFVA 3JR4A 4IBJA 4GC5A 2L7HA 3FTCA 3JAMS 1QAOA 3MK6A 3AJIB 2KEBA 5F3WA 2J7OA 1SXJE 4PT5A 1GL7A 3RGPA 2Z4SA 4W5WA 5A2QS 5KQ8A 1N33M 4IBGA 5LMNM 4KHPM 2VQFM 4AKHA 3KP1E 1WXQA 5EJCA 3HU2A 4QNRA 2Y21A 2DHRA 4JI3M 4PDIA 4R7GA 1IXSB 5DYIA 4BB9A 1NNUC 3W0FA 3GLGB 4GHAA 1QANA 4DV6M 3TWLA 4AKIA 3K1JA 3SHFA 5FTJA 1S3SA 3T38A 4AG5A 3HHZA 4IBIA 4X62M 3AOEA 1K82A 1E9SA 2CFOA 2R4EA 3ZCBB 1IXZA 4AW4A 3THGA 1IN7A 3LMMA 1N36M 2XF3A 4AI6A 3GLFA 1L8QA 5KPTA 5IREB 2UU9M 2DWZB 2Z7JA 4LJ9A 4L16A 3UK6A 1R6BX 4DR1M 2XH9A 3SAUA 3UZUA 4D81A 2KW0A 1L2BA 3CF6E 4FWHA 4LY6A 4I4LA 2P5TA 1XNRM 3U6SA 4D80A 3GQ3A 2KRKA 4DUZM 3J27B 4B3MM 4MGIE 2R4JA 5FTMA 5ITRA 4GRIA 3AV0A 3GLFB 3KP0E 3PVSA 2D7GA 4PD2A 1PJIA 1JR3A 2NQ8C 4X64M 5ITXE 2L7IA 1TGUA 4AG6A 3AOEC 4B7HA 4X66M 4L15A 2UUCM 5ITYA 1DGGA 2ZAOA 1DO2A 1Q39A 1NY5A 1ZAEA 3R9XB 3RE8A 1K3WA 4NXNM 3L25A 1EE8A 3SAVA 3AKZA 2XEPA 3HJ8A 3ZH9B 3KXEC 3SFZA 3PNVA 1R7RA 3VDPA 3PXGA 1E9RA 2UXBM 2YQZA 1IQPA 4DR6M 4B3SM 2CEAA 2FOIC 2M60A 1IBKM 2Q2EB 1N75A 3M0EA 3U5ZB 3AFHA 4B3TM 1IY2A 2DWNA 4LFBM 4G4QA 1TH4A 3HJQA 4LFAM 2R18A 2ZM6M 1YE9A 5ITTA 1SXJC 4WURA 4BLCA 4GHLA 4YY3M 4BBAA 3LQQA 1UM8A 1XXHB 4NL4H 3RFWA 2DWMA 3VKGA 2C96A 3EIEA 4LCBA 4TUWA 2J7NA 2F5OA 2V6ZM 1HT2E 2CHQA 2CV0A 3KSJA 3J2PB 3TL4X 4GKJM 1IBMM 4OVZB 2X8AA 4DV4M 2XZFA 1PM5A 2CV1A 1E94E 4D82A 4NRWA 3VKHA 3TPZA 1J09A 3AOGA 4JI5M 2V1UA 2QP9X 3U6LA 3VK7A 1MU5A 1VDDA 4L4UA 4MGYE 4DV1M 4NOOB 1NJFA 2Z4RA 1G4AE 4DV7M 2ZBKB 2KZUA 3VLFB 2YR0A 1HNZM 3GRYA 2KXEA 2BJVA 1ORYB 4GKKM 4IIWA 2HKJA 1XMQM 1C1KA 4RF1A 3U61B 2HL7A 3B9PA 2F5SA 2QZ4A 1IY0A 3HHWA 3MHVC 2ZAMA 2XGNA 2Y20A 4B08A 4OW0A 2CHVA 4CGYB 2KRUA 1IM2A 3KW6A 3NBIA 4MGHA 5EXPA 1IXRC 4JI6M 1DO0A 1HR0M 3FTDA 3SARA 2G8LA 2Y0QA 2FNAA 3TWKA 5FTNA 3GQ5A 3U6CA 5LMUM 5H37D 1JR3D 1OFHA 4I81A 1G41A 1K3XA 4IJEA 4G4OA 4JN6A 4AKGA 1GVNA 4LF8M 3L2AA 1TH2A 5EQTA 3IG5A 1KYIA 2KA6B 5JI3E 2HHHM 2K47A 3D8BA 2XLJA 2W82A 4WW0A 1QAMA 3A45A 2D7HA 2M5ZA 3GO8A 3DOAA 4QHTA 4I5SA 4LG2A 2KZSA 3KOWE 5EP1A 1QZMA 3SASA 4LRSA 1TH3A 1XWIA 1HT1E 3U6MA 1Z59A 3GPUA 3GQ4A 3VDUA 1SXJA 3GLHA 4LF7M 3VFDA 2VQEM 1DGFA 5ITQA 3K2LA 4JI7M 2XZUA 4G6ZA 4QOSA 3CF2A 4I8OA 2R45A 4XGIA 2EUCA 1L2CA 3OTOM 5GKNA 5BR8M 4PDGA 2QPAA 2Z3XA 4IBEA 3HHXA 4AZFA 4MGKE 3A46A 2F5NA 2DVWB 5KPZA 3EIHA 2UUBM 1NSFA 1T3TA 2A5YB 3U6EA 3K92A 4NXMM 4KODA 3J7BA 3QWLA 3J7AS 3D8LA 1GKIA 4GMQA 1N32M 1FNNA 1SXJB 3H4MA 4M0DA 8CATA 3SBJA 3GLHB 3L27A 3FUUA 3KSXA 1R2YA 3CTWB 2OPFA 2OQ4A 1QAQA 2UXDM 3NWLA 1QVRA 4OX9M 2R46A 3FD9A 3IG8A 7CATA 4RNAA 3FYDA 3FUXA 4JYAM 4RF0A 2DZNB 1NVMA 1Z5BA 3SYKA 2DZOB 1Z6TA 4M9ZA 3BOSA 4LZJA 2Y0TA 3VK8A 5FTKA 5KQDA 3I51A 2BJWA 4R3DA 1J7KA 4G4RA 1ZQ9A 3K8ZA 5DYGA 4HL4A 2D7EA 2ZANA 3WHKA 3GLIA 2UXCM 4Z8XA 3DZDA 3HHYA 4NSRA 4LF6M 1NY6A 5IZ7D 3FKEA 3FYCA 3T15A 3ILKA 2XSZA 4CHTB 4A3VB 1W5SA 4FVMA 3HU3A 4FWDA 2CUZA 3A42A 4NRVA 3W0LB 4MB7A 5ITXA 1L1ZA 4DR7M 3A98B 1N34M 2F5QA 4LJ4A 4DR3M 2C99A 5E26A 4DV2M 1I4WA 1Q3BA 3PNYA 4JI4M 4Z6YA 1XNQM 1NHWC 3GPXA 2DXIA 1DGHA 2C5RA 2V1CA 3GLIB 1FJGM 1XHBA 3SMPA 4G4NA 4FCVA 4L78A 3DA1A 3GRVA 5E6JA 4PCZA 4FD2A 5BPVA 1Z5CA 3GPYA 1Z5AA 4MH0E 3L26A 3WHLA 3HU1A 2C9OA 3KVWA 1L1TA 2R62A 4M9SA 1HQYE 5JI2E 4DUYM 1H6UA 4LZZA 4HLQA 5EXSA 1DGBA 1SXJD 2CE7A 4FW9A 3GLGA 4LJ7A 2UUAM 2EA0A 4S12A 3FUTA 4ITQA 3T1HM 3L29A 3SC3A 5EXTA 4QNMA 4YHHM 3KS8A 1QYRA 3TE6A 1GLNA 1J5EM 4GITA 4JI8M 3JR5A 3SYLA 1YSYA 4B7FA 1IN8A 2FE8A 2YNMD 4LJ8A 5C1BA 3U6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KRU A;  2YNM D;  2L09 A; 
#chains in the Genus database with same CATH topology
 2KHH A;  3KDS E;  3UMM A;  4IBK A;  3FUW A;  4LF4 M;  4CIS A;  1WGL A;  3HKP A;  3I01 M;  3R8F A;  2LXE A;  2R65 A;  2FFJ A;  4B3R M;  4XBO A;  1PJJ A;  1R5L A;  2N35 A;  1MX0 A;  3Q8X A;  4IJF A;  4AQY M;  2X4A A;  2XFT A;  4GH9 A;  2JZ0 A;  4MM3 B;  2LNH C;  5FSW A;  5FLX S;  4QHS A;  1QQW A;  1QDR A;  3HY5 A;  4DV0 M;  2MGW A;  2DWL A;  5EXX A;  4IBB A;  4DR4 M;  2MH8 A;  2CHG A;  3GP1 A;  2QCU A;  3B7Q A;  5EP3 A;  1R2Z A;  1XMO M;  3SAT A;  4LJ6 A;  1LV7 A;  3K9P A;  5C18 A;  4LFC M;  2X49 A;  1L2D A;  2RGH A;  3MJ5 A;  3W67 A;  3UGJ A;  1G8P A;  1KSF X;  3L28 A;  4L8R C;  3NBX X;  3SMS A;  3C58 A;  1Q3C A;  1N78 A;  4REZ A;  2DKL A;  4KO8 A;  4EIW A;  4X65 M;  4NSO B;  4FCW A;  4KLN A;  1IY1 A;  4M0W A;  1X37 A;  4DV5 M;  2XSZ D;  2I7N A;  1OFI A;  1NNJ A;  2JA2 A;  5KPR A;  4IBF A;  4LF9 M;  4DR5 M;  1TDZ A;  3M6A A;  3U60 A;  1OJL A;  5EP2 A;  4DR2 M;  4IBC A;  2GNO A;  2RGO A;  2L09 A;  2DHY A;  2EKK A;  3KOZ E;  1XC8 A;  3RGS A;  2Z8Y M;  4LJ5 A;  5ITU A;  2VII A;  2ERC A;  4JV5 M;  2LH0 A;  1T43 A;  3HGI A;  1ZMU A;  3B74 A;  4IBD A;  1IN5 A;  2RKO A;  1G59 A;  4F1I A;  3KFU G;  2DAM A;  3U5Z A;  1D2N A;  1NHG C;  1E32 A;  2I7P A;  2KNZ A;  1ZV1 A;  4LJA A;  1IN6 A;  2O01 F;  3I4Y A;  3KOY E;  4OU7 A;  3HWS A;  2F5P A;  4LRT A;  3TWM A;  3QYE A;  1QDT A;  1CUK A;  3LW5 F;  1PGY A;  4JI2 M;  3GRU A;  1XXH A;  3LVV A;  1VG5 A;  3HJS A;  4MGZ E;  1I94 M;  4JI0 M;  2CV2 A;  3U60 B;  2F4V M;  1HNW M;  3CF0 A;  2QBY A;  3I4V A;  3KS4 A;  2R0I A;  4P16 A;  2LVA A;  2OO9 A;  3SHG B;  4ZPX A;  2C98 A;  1V92 A;  3E4R A;  1JQJ C;  2QEN A;  3QAU A;  4OVZ A;  1BVS A;  3E9S A;  3FUV A;  2H5X A;  1YUB A;  2LWX A;  1IN4 A;  4FCT A;  1YLA A;  1VEG A;  2VF7 A;  5EP4 A;  1V34 A;  3T1Y M;  3UJN A;  3FTE A;  1NO1 A;  2H1R A;  1NV9 A;  1HNX M;  4DV3 M;  2HCB A;  4M9X A;  3J80 S;  5IT9 S;  2L6O A;  3B7Z A;  3TQS A;  4NC6 A;  3U6D A;  1NJG A;  3DFZ A;  3FTF A;  5DNY A;  3SAW A;  4FWG A;  4JI1 M;  1D0K A;  3IHP A;  3ZC7 B;  2QBY B;  3LCU A;  1HQC A;  4GC9 A;  3U6Q A;  3J81 S;  2C9C A;  2E5L M;  4K0K M;  2JY7 A;  1W5T A;  1TDH A;  1G3I A;  3GRR A;  1N77 A;  2O5R A;  5DFL A;  4JXJ A;  2G5G X;  3U61 A;  3LQR A;  3GPP A;  1IBL M;  2AHM A;  2YFQ A;  5FTL A;  5IWA M;  4LF5 M;  2EO2 A;  1GL6 A;  3U6P A;  2XFS A;  4LGY A;  4B7G A;  3LVW A;  3M7G A;  2BNK A;  4HEO A;  4II7 A;  1D0L A;  2K0B X;  3PFI A;  1OKS A;  3KOX E;  4GIP A;  1OIP A;  4QOZ C;  1VEJ A;  1R4G A;  3AL0 C;  5KO3 A;  4LGM A;  1IXS A;  1DGH B;  1KFV A;  3JR4 A;  2CRU A;  4IBJ A;  4GC5 A;  2L7H A;  1IFY A;  3FTC A;  3JAM S;  1WJ7 A;  1QAO A;  3C9P A;  3MK6 A;  3AJI B;  3V76 A;  2KEB A;  1AUA A;  5F3W A;  1Y8G A;  2J7O A;  1SXJ E;  2CWB A;  4PT5 A;  1GL7 A;  3RGP A;  2Z4S A;  2LHC A;  3GLH E;  4W5W A;  5KQ8 A;  5A2Q S;  1N33 M;  1OAO C;  4IBG A;  2O25 A;  5LMN M;  1PJS A;  4KHP M;  2VQF M;  4XK8 F;  4AKH A;  3KP1 E;  1WXQ A;  5EJC A;  4CJ6 A;  2DAI A;  2RRU A;  3HU2 A;  4QNR A;  2Y21 A;  2DHR A;  4JI3 M;  4PDI A;  4R7G A;  1IXS B;  5DYI A;  4BB9 A;  1NNU C;  3W0F A;  3GLG B;  4GHA A;  1QAN A;  4DV6 M;  1GO5 A;  3TWL A;  1QZE A;  4AKI A;  3K1J A;  3SHF A;  5FTJ A;  1S3S A;  3T38 A;  2DZL A;  4AG5 A;  3HHZ A;  4IBI A;  4X62 M;  4WP2 A;  1ZMV A;  3AOE A;  1K82 A;  1E9S A;  2CFO A;  2MJ5 B;  2J5Y A;  2R4E A;  3ZCB B;  1IXZ A;  1A5T A;  4AW4 A;  3THG A;  1IN7 A;  3LMM A;  1N36 M;  2XF3 A;  4AI6 A;  3GLF A;  1L8Q A;  2LVP C;  5KPT A;  5IRE B;  2LVN C;  2UU9 M;  2DWZ B;  2Z7J A;  4LJ9 A;  4L16 A;  3UK6 A;  1GAB A;  2KDL A;  1UFZ A;  1R6B X;  1G71 A;  4DR1 M;  2XH9 A;  1VQ1 A;  3SAU A;  3UZU A;  4D81 A;  2KW0 A;  3K9O A;  1L2B A;  3CF6 E;  4FWH A;  4LY6 A;  2LHG A;  4I4L A;  2P5T A;  1XNR M;  3GLI E;  1LTM A;  3U6S A;  1QUS A;  2K9D A;  4D80 A;  3GQ3 A;  2KRK A;  1T6O A;  4DUZ M;  3J27 B;  4B3M M;  2DAK A;  4MGI E;  2R4J A;  2VF8 A;  5FTM A;  5ITR A;  3C3E A;  4GRI A;  3AV0 A;  3GLF B;  3KP0 E;  3PVS A;  2D7G A;  1MJG M;  4PD2 A;  1PJI A;  1JR3 A;  2NQ8 C;  2HWJ A;  4X64 M;  5ITX E;  1SG9 A;  2L7I A;  1PJQ A;  2WSE F;  1TGU A;  4AG6 A;  1OQY A;  3AOE C;  4B7H A;  4X66 M;  4L15 A;  2UUC M;  2KNA A;  5ITY A;  1DGG A;  1D0M A;  3HZJ A;  2ZAO A;  1DO2 A;  2LVQ D;  1Q39 A;  1NY5 A;  1ZAE A;  2ZTD A;  3R9X B;  3RE8 A;  1K3W A;  4NXN M;  3L25 A;  1EE8 A;  3SAV A;  3AKZ A;  2XEP A;  3HJ8 A;  3ZH9 B;  3KXE C;  3SFZ A;  3PNV A;  1R7R A;  2JZ1 A;  3PXG A;  3VDP A;  1E9R A;  2UXB M;  2YQZ A;  1IQP A;  4DR6 M;  4B3S M;  2CEA A;  2FOI C;  2M60 A;  4G3O A;  2Q2E B;  1N75 A;  3M0E A;  3U5Z B;  1EFU B;  1IBK M;  2JNH A;  3AFH A;  1IY2 A;  4B3T M;  2DWN A;  1AIP C;  4LFB M;  4G4Q A;  1TH4 A;  3HJQ A;  4LFA M;  2R18 A;  4CIZ A;  2VDB B;  2ZM6 M;  1YE9 A;  5ITT A;  1SXJ C;  2QNJ A;  4WUR A;  4BLC A;  4GHL A;  4YY3 M;  1V33 A;  4BBA A;  3LQQ A;  1UM8 A;  1XXH B;  4NL4 H;  3RFW A;  2DWM A;  2K6B A;  2C96 A;  3EIE A;  2FH0 A;  3VKG A;  4LCB A;  4TUW A;  2J7N A;  2JY8 A;  2LTU A;  2BWE A;  2ZTC A;  2F5O A;  2V6Z M;  1HT2 E;  2CHQ A;  2CV0 A;  2WSC F;  2LVO C;  3J2P B;  3KSJ A;  3TL4 X;  4GKJ M;  1VEK A;  1IBM M;  4OVZ B;  2DAG A;  2X8A A;  2OOA A;  4DV4 M;  2XZF A;  1PM5 A;  2CV1 A;  2APL A;  1E94 E;  1XB2 B;  4D82 A;  4NRW A;  3VKH A;  1NV8 A;  1TTE A;  3TPZ A;  1J09 A;  3AOG A;  4JI5 M;  2V1U A;  2QP9 X;  3C3D A;  3U6L A;  3VK7 A;  1MU5 A;  1VDD A;  2BWB A;  4L4U A;  4MGY E;  1OIZ A;  2FS1 A;  4DV1 M;  4NOO B;  1NJF A;  2Z4R A;  1G4A E;  1TF0 B;  4P17 A;  2ZBK B;  4GEW A;  2KZU A;  3FRH A;  3VLF B;  4DV7 M;  2YR0 A;  1HNZ M;  3GRY A;  3E21 A;  2KXE A;  2BJV A;  1ORY B;  4GKK M;  4IIW A;  3BXW A;  2HKJ A;  1XMQ M;  1C1K A;  4RF1 A;  3U61 B;  2HL7 A;  3B9P A;  1GJS A;  2F5S A;  3H4J A;  2QZ4 A;  1IY0 A;  3HHW A;  3MHV C;  2ZAM A;  1Q02 A;  2XGN A;  2Y20 A;  2QSF X;  4B08 A;  4OW0 A;  2CHV A;  4CGY B;  2KRU A;  1P3Q Q;  1IM2 A;  3KW6 A;  3NBI A;  4MGH A;  2DNA A;  1IXR C;  2JWS A;  5EXP A;  1WIV A;  4JI6 M;  1DO0 A;  1HR0 M;  3I04 M;  3FTD A;  1JB0 F;  3SAR A;  2G8L A;  1EIJ A;  2LBC A;  2Y0Q A;  2FNA A;  4KT0 F;  3TWK A;  5FTN A;  3GQ5 A;  3U6C A;  5LMU M;  5H37 D;  1JR3 D;  1OFH A;  4I81 A;  1G41 A;  1K3X A;  4IJE A;  4G4O A;  4JN6 A;  1PRB A;  4AKG A;  1GVN A;  4LF8 M;  2MR9 A;  3L2A A;  1TH2 A;  5EQT A;  3ZQJ A;  3IG5 A;  1KYI A;  2KA6 B;  3BBZ A;  5JI3 E;  2HHH M;  2K47 A;  3D8B A;  3B7N A;  1WR1 B;  2W82 A;  4WW0 A;  1QAM A;  2XLJ A;  3HX3 A;  3A45 A;  2D7H A;  2M5Z A;  3GO8 A;  3DOA A;  4QHT A;  1DV0 A;  4I5S A;  4ANR A;  4DBG B;  4LG2 A;  1ZMW A;  2KZS A;  3KOW E;  5EP1 A;  1QZM A;  1XXH E;  4LRS A;  3SAS A;  3LCV B;  1TH3 A;  1XWI A;  1HT1 E;  1GJT A;  2DI0 A;  1Z59 A;  3U6M A;  1F4I A;  3FRI A;  3FE3 A;  3GPU A;  3GQ4 A;  3VDU A;  1QUT A;  2JUJ A;  1SXJ A;  2L4E A;  3GLH A;  1WHC A;  2L4F A;  4LF7 M;  2KNV A;  3VFD A;  2VQE M;  1DGF A;  5ITQ A;  3K2L A;  4JI7 M;  2XZU A;  4G6Z A;  4QOS A;  1C7Y A;  3CF2 A;  4I8O A;  2R45 A;  4XGI A;  2EUC A;  1L2C A;  3OTO M;  4RKU F;  5GKN A;  1PJT A;  3F92 A;  5BR8 M;  4PDG A;  2QPA A;  2Z3X A;  4IBE A;  3HHX A;  4AZF A;  4MGK E;  2JP7 A;  3A46 A;  2DVW B;  5KPZ A;  2F5N A;  3EIH A;  2UUB M;  1NSF A;  1T3T A;  2A5Y B;  2DEN A;  3K92 A;  3U6E A;  4KOD A;  4NXM M;  3J7B A;  3QWL A;  3J7A S;  3D8L A;  1GKI A;  4GMQ A;  1N32 M;  1FNN A;  4Q7J A;  1SXJ B;  3H4M A;  4M0D A;  3Q8G A;  8CAT A;  3SBJ A;  3GLH B;  3L27 A;  3FUU A;  3KSX A;  1R2Y A;  3CTW B;  2OPF A;  2OQ4 A;  2DAE A;  1QAQ A;  3E46 A;  1OTR A;  2UXD M;  3NWL A;  1QVR A;  4OX9 M;  2R46 A;  3FD9 A;  4R71 A;  3IG8 A;  7CAT A;  4RNA A;  3FYD A;  3FUX A;  2QQ8 A;  4JYA M;  2WSF F;  1WGN A;  4RF0 A;  2DZN B;  1NVM A;  1Z5B A;  3SYK A;  3B89 A;  2DZO B;  1Z6T A;  2HAK A;  4M9Z A;  5L8R F;  3BOS A;  4LZJ A;  2Y0T A;  3VK8 A;  5FTK A;  5KQD A;  3GLG E;  2JY5 A;  3I51 A;  2BJW A;  4R3D A;  1J7K A;  4G4R A;  1ZQ9 A;  3K8Z A;  5DYG A;  4HL4 A;  2D7E A;  2ZAN A;  3WHK A;  1HJP A;  3GLI A;  2UXC M;  4Z8X A;  3DZD A;  2JXN A;  3HHY A;  4NSR A;  4LF6 M;  1NY6 A;  5IZ7 D;  3FKE A;  2MRO B;  3FYC A;  2JY6 B;  3T15 A;  3ILK A;  2XSZ A;  2WZJ A;  4A3V B;  4CHT B;  1W5S A;  4FVM A;  3HU3 A;  4FWD A;  2CUZ A;  3A42 A;  4NRV A;  3T6P A;  3W0L B;  4MB7 A;  2GQF A;  5ITX A;  1RU3 A;  3W68 A;  1L1Z A;  4DR7 M;  3A98 B;  1N34 M;  2F5Q A;  2L2D A;  4LJ4 A;  4F2L A;  4DR3 M;  2C99 A;  2QHO B;  4L6V 6;  5E26 A;  4DV2 M;  1I4W A;  1Q3B A;  3PNY A;  4JI4 M;  3QYB A;  4Z6Y A;  1XNQ M;  1NHW C;  3GPX A;  2DXI A;  1MN3 A;  1DGH A;  2C5R A;  4UN2 B;  2V1C A;  3GLI B;  1FJG M;  1XHB A;  2EJS A;  3SMP A;  4G4N A;  4FCV A;  4L78 A;  2R44 A;  3DA1 A;  3GRV A;  5E6J A;  4PCZ A;  4FD2 A;  5BPV A;  1Z5C A;  3GPY A;  1Z5A A;  4MH0 E;  3L26 A;  3WHL A;  4Y28 F;  3HU1 A;  2C9O A;  3GLF E;  3KVW A;  1L1T A;  2R62 A;  4M9S A;  3CGW A;  1HQY E;  5JI2 E;  4DUY M;  1H6U A;  1OAI A;  4LZZ A;  4HLQ A;  5EXS A;  2OOB A;  1DGB A;  1SXJ D;  2B3T A;  2CE7 A;  4FW9 A;  3GLG A;  4LJ7 A;  2UUA M;  1TR8 A;  2G3Q A;  2CP8 A;  2EA0 A;  3MMP A;  4S12 A;  3FUT A;  4ITQ A;  3IEC A;  2R6F A;  3T1H M;  3L29 A;  3SC3 A;  5EXT A;  2EKF A;  4QNM A;  4YHH M;  3KS8 A;  1QYR A;  3TE6 A;  1GLN A;  1J5E M;  4GIT A;  4JI8 M;  3JR5 A;  3SYL A;  1YSY A;  1JR3 E;  4B7F A;  1IN8 A;  2FE8 A;  2YNM D;  4LJ8 A;  5C1B A;  3U6O A;  1VDL A; 
#chains in the Genus database with same CATH homology
 3KDS E;  3UMM A;  4IBK A;  3FUW A;  4LF4 M;  4CIS A;  3HKP A;  3R8F A;  2LXE A;  2R65 A;  2FFJ A;  4B3R M;  4XBO A;  1PJJ A;  1MX0 A;  3Q8X A;  4IJF A;  4AQY M;  2X4A A;  2XFT A;  4GH9 A;  4MM3 B;  2LNH C;  5FSW A;  5FLX S;  4QHS A;  1QQW A;  4DV0 M;  2DWL A;  5EXX A;  4IBB A;  4DR4 M;  2CHG A;  3GP1 A;  2QCU A;  5EP3 A;  1R2Z A;  1XMO M;  3SAT A;  4LJ6 A;  1LV7 A;  5C18 A;  4LFC M;  2X49 A;  1L2D A;  2RGH A;  3MJ5 A;  3UGJ A;  1G8P A;  1KSF X;  3L28 A;  4L8R C;  3SMS A;  3C58 A;  1Q3C A;  1N78 A;  4REZ A;  4EIW A;  4KO8 A;  4X65 M;  4NSO B;  4FCW A;  4KLN A;  1IY1 A;  4M0W A;  1X37 A;  4DV5 M;  2XSZ D;  2I7N A;  1OFI A;  1NNJ A;  2JA2 A;  5KPR A;  4IBF A;  4LF9 M;  4DR5 M;  1TDZ A;  3M6A A;  3U60 A;  1OJL A;  5EP2 A;  4DR2 M;  4IBC A;  2RGO A;  2L09 A;  3KOZ E;  1XC8 A;  3RGS A;  4LJ5 A;  5ITU A;  2VII A;  2ERC A;  4JV5 M;  2LH0 A;  3HGI A;  4IBD A;  1IN5 A;  2RKO A;  1G59 A;  3KFU G;  3U5Z A;  1D2N A;  1NHG C;  1E32 A;  2I7P A;  4LJA A;  1IN6 A;  3I4Y A;  3KOY E;  4OU7 A;  3HWS A;  2F5P A;  4LRT A;  3TWM A;  4JI2 M;  3GRU A;  1XXH A;  3LVV A;  4MGZ E;  3HJS A;  1I94 M;  4JI0 M;  2CV2 A;  3U60 B;  2F4V M;  1HNW M;  3CF0 A;  2QBY A;  3I4V A;  3KS4 A;  4P16 A;  3SHG B;  4ZPX A;  2C98 A;  3QAU A;  3E4R A;  1JQJ C;  2QEN A;  4OVZ A;  3E9S A;  3FUV A;  1YUB A;  2LWX A;  1IN4 A;  4FCT A;  3T1Y M;  5EP4 A;  3UJN A;  3FTE A;  2H1R A;  1HNX M;  4DV3 M;  2HCB A;  4M9X A;  3J80 S;  5IT9 S;  2L6O A;  3TQS A;  3U6D A;  1NJG A;  3DFZ A;  3FTF A;  5DNY A;  3SAW A;  4FWG A;  4JI1 M;  3ZC7 B;  2QBY B;  1HQC A;  4GC9 A;  3U6Q A;  3J81 S;  2C9C A;  2E5L M;  4K0K M;  1W5T A;  1TDH A;  1G3I A;  3GRR A;  1N77 A;  2O5R A;  4JXJ A;  2G5G X;  3U61 A;  3LQR A;  3GPP A;  1IBL M;  2AHM A;  2YFQ A;  5FTL A;  5IWA M;  4LF5 M;  2EO2 A;  1GL6 A;  3U6P A;  2XFS A;  4LGY A;  4B7G A;  3LVW A;  3M7G A;  2BNK A;  4II7 A;  3PFI A;  3KOX E;  4GIP A;  4QOZ C;  3AL0 C;  5KO3 A;  4LGM A;  1DGH B;  1KFV A;  3JR4 A;  4IBJ A;  4GC5 A;  2L7H A;  3FTC A;  3JAM S;  1QAO A;  3MK6 A;  3AJI B;  2KEB A;  5F3W A;  2J7O A;  1SXJ E;  4PT5 A;  1GL7 A;  3RGP A;  2Z4S A;  4W5W A;  5A2Q S;  5KQ8 A;  1N33 M;  4IBG A;  5LMN M;  4KHP M;  2VQF M;  4AKH A;  3KP1 E;  1WXQ A;  5EJC A;  3HU2 A;  4QNR A;  2Y21 A;  2DHR A;  4JI3 M;  4PDI A;  4R7G A;  1IXS B;  5DYI A;  4BB9 A;  1NNU C;  3W0F A;  3GLG B;  4GHA A;  1QAN A;  4DV6 M;  3TWL A;  4AKI A;  3K1J A;  3SHF A;  5FTJ A;  1S3S A;  3T38 A;  4AG5 A;  3HHZ A;  4IBI A;  4X62 M;  3AOE A;  1K82 A;  1E9S A;  2CFO A;  2R4E A;  3ZCB B;  1IXZ A;  4AW4 A;  3THG A;  1IN7 A;  3LMM A;  1N36 M;  2XF3 A;  4AI6 A;  3GLF A;  1L8Q A;  5KPT A;  5IRE B;  2UU9 M;  2DWZ B;  2Z7J A;  4LJ9 A;  4L16 A;  3UK6 A;  1R6B X;  4DR1 M;  2XH9 A;  3SAU A;  3UZU A;  4D81 A;  2KW0 A;  1L2B A;  3CF6 E;  4FWH A;  4LY6 A;  4I4L A;  2P5T A;  1XNR M;  3U6S A;  4D80 A;  3GQ3 A;  2KRK A;  4DUZ M;  3J27 B;  4B3M M;  4MGI E;  2R4J A;  5FTM A;  5ITR A;  4GRI A;  3AV0 A;  3GLF B;  3KP0 E;  3PVS A;  2D7G A;  4PD2 A;  1PJI A;  1JR3 A;  2NQ8 C;  4X64 M;  5ITX E;  2L7I A;  1TGU A;  4AG6 A;  3AOE C;  4B7H A;  4X66 M;  4L15 A;  2UUC M;  5ITY A;  1DGG A;  2ZAO A;  1DO2 A;  1Q39 A;  1NY5 A;  1ZAE A;  3R9X B;  3RE8 A;  1K3W A;  4NXN M;  3L25 A;  1EE8 A;  3SAV A;  3AKZ A;  2XEP A;  3HJ8 A;  3ZH9 B;  3KXE C;  3SFZ A;  3PNV A;  1R7R A;  3VDP A;  3PXG A;  1E9R A;  2UXB M;  2YQZ A;  1IQP A;  4DR6 M;  4B3S M;  2CEA A;  2FOI C;  2M60 A;  1IBK M;  2Q2E B;  1N75 A;  3M0E A;  3U5Z B;  3AFH A;  4B3T M;  1IY2 A;  2DWN A;  4LFB M;  4G4Q A;  1TH4 A;  3HJQ A;  4LFA M;  2R18 A;  2ZM6 M;  1YE9 A;  5ITT A;  1SXJ C;  4WUR A;  4BLC A;  4GHL A;  4YY3 M;  4BBA A;  3LQQ A;  1UM8 A;  1XXH B;  4NL4 H;  3RFW A;  2DWM A;  3VKG A;  2C96 A;  3EIE A;  4LCB A;  4TUW A;  2J7N A;  2F5O A;  2V6Z M;  1HT2 E;  2CHQ A;  2CV0 A;  3KSJ A;  3J2P B;  3TL4 X;  4GKJ M;  1IBM M;  4OVZ B;  2X8A A;  4DV4 M;  2XZF A;  1PM5 A;  2CV1 A;  1E94 E;  4D82 A;  4NRW A;  3VKH A;  3TPZ A;  1J09 A;  3AOG A;  4JI5 M;  2V1U A;  2QP9 X;  3U6L A;  3VK7 A;  1MU5 A;  1VDD A;  4L4U A;  4MGY E;  4DV1 M;  4NOO B;  1NJF A;  2Z4R A;  1G4A E;  4DV7 M;  2ZBK B;  2KZU A;  3VLF B;  2YR0 A;  1HNZ M;  3GRY A;  2KXE A;  2BJV A;  1ORY B;  4GKK M;  4IIW A;  2HKJ A;  1XMQ M;  1C1K A;  4RF1 A;  3U61 B;  2HL7 A;  3B9P A;  2F5S A;  2QZ4 A;  1IY0 A;  3HHW A;  3MHV C;  2ZAM A;  2XGN A;  2Y20 A;  4B08 A;  4OW0 A;  2CHV A;  4CGY B;  2KRU A;  1IM2 A;  3KW6 A;  3NBI A;  4MGH A;  5EXP A;  1IXR C;  4JI6 M;  1DO0 A;  1HR0 M;  3FTD A;  3SAR A;  2G8L A;  2Y0Q A;  2FNA A;  3TWK A;  5FTN A;  3GQ5 A;  3U6C A;  5LMU M;  5H37 D;  1JR3 D;  1OFH A;  4I81 A;  1G41 A;  1K3X A;  4IJE A;  4G4O A;  4JN6 A;  4AKG A;  1GVN A;  4LF8 M;  3L2A A;  1TH2 A;  5EQT A;  3IG5 A;  1KYI A;  2KA6 B;  5JI3 E;  2HHH M;  2K47 A;  3D8B A;  2XLJ A;  2W82 A;  4WW0 A;  1QAM A;  3A45 A;  2D7H A;  2M5Z A;  3GO8 A;  3DOA A;  4QHT A;  4I5S A;  4LG2 A;  2KZS A;  3KOW E;  5EP1 A;  1QZM A;  3SAS A;  4LRS A;  1TH3 A;  1XWI A;  1HT1 E;  3U6M A;  1Z59 A;  3GPU A;  3GQ4 A;  3VDU A;  1SXJ A;  3GLH A;  4LF7 M;  3VFD A;  2VQE M;  1DGF A;  5ITQ A;  3K2L A;  4JI7 M;  2XZU A;  4G6Z A;  4QOS A;  3CF2 A;  4I8O A;  2R45 A;  4XGI A;  2EUC A;  1L2C A;  3OTO M;  5GKN A;  5BR8 M;  4PDG A;  2QPA A;  2Z3X A;  4IBE A;  3HHX A;  4AZF A;  4MGK E;  3A46 A;  2F5N A;  2DVW B;  5KPZ A;  3EIH A;  2UUB M;  1NSF A;  1T3T A;  2A5Y B;  3U6E A;  3K92 A;  4NXM M;  4KOD A;  3J7B A;  3QWL A;  3J7A S;  3D8L A;  1GKI A;  4GMQ A;  1N32 M;  1FNN A;  1SXJ B;  3H4M A;  4M0D A;  8CAT A;  3SBJ A;  3GLH B;  3L27 A;  3FUU A;  3KSX A;  1R2Y A;  3CTW B;  2OPF A;  2OQ4 A;  1QAQ A;  2UXD M;  3NWL A;  1QVR A;  4OX9 M;  2R46 A;  3FD9 A;  3IG8 A;  7CAT A;  4RNA A;  3FYD A;  3FUX A;  4JYA M;  4RF0 A;  2DZN B;  1NVM A;  1Z5B A;  3SYK A;  2DZO B;  1Z6T A;  4M9Z A;  3BOS A;  4LZJ A;  2Y0T A;  3VK8 A;  5FTK A;  5KQD A;  3I51 A;  2BJW A;  4R3D A;  1J7K A;  4G4R A;  1ZQ9 A;  3K8Z A;  5DYG A;  4HL4 A;  2D7E A;  2ZAN A;  3WHK A;  3GLI A;  2UXC M;  4Z8X A;  3DZD A;  3HHY A;  4NSR A;  4LF6 M;  1NY6 A;  5IZ7 D;  3FKE A;  3FYC A;  3T15 A;  3ILK A;  2XSZ A;  4CHT B;  4A3V B;  1W5S A;  4FVM A;  3HU3 A;  4FWD A;  2CUZ A;  3A42 A;  4NRV A;  3W0L B;  4MB7 A;  5ITX A;  1L1Z A;  4DR7 M;  3A98 B;  1N34 M;  2F5Q A;  4LJ4 A;  4DR3 M;  2C99 A;  5E26 A;  4DV2 M;  1I4W A;  1Q3B A;  3PNY A;  4JI4 M;  4Z6Y A;  1XNQ M;  1NHW C;  3GPX A;  2DXI A;  1DGH A;  2C5R A;  2V1C A;  3GLI B;  1FJG M;  1XHB A;  3SMP A;  4G4N A;  4FCV A;  4L78 A;  3DA1 A;  3GRV A;  5E6J A;  4PCZ A;  4FD2 A;  5BPV A;  1Z5C A;  3GPY A;  1Z5A A;  4MH0 E;  3L26 A;  3WHL A;  3HU1 A;  2C9O A;  3KVW A;  1L1T A;  2R62 A;  4M9S A;  1HQY E;  5JI2 E;  4DUY M;  1H6U A;  4LZZ A;  4HLQ A;  5EXS A;  1DGB A;  1SXJ D;  2CE7 A;  4FW9 A;  3GLG A;  4LJ7 A;  2UUA M;  2EA0 A;  4S12 A;  3FUT A;  4ITQ A;  3T1H M;  3L29 A;  3SC3 A;  5EXT A;  4QNM A;  4YHH M;  3KS8 A;  1QYR A;  3TE6 A;  1GLN A;  1J5E M;  4GIT A;  4JI8 M;  3JR5 A;  3SYL A;  1YSY A;  4B7F A;  1IN8 A;  2FE8 A;  2YNM D;  4LJ8 A;  5C1B A;  3U6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...