2KS1A

Heterodimeric association of transmembrane domains of erbb1 and erbb2 receptors enabling kinase activation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Spatial Structure of the Transmembrane Domain Heterodimer of ErbB1 and ErbB2 Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 44
sequence length 44
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ks1A00
2KS1A 1BGYD 2RMZA 1SQVD 3L71D 5TJHA 1EZVD 3L75D 1ZRTD 2L91A 1P84D 3PRJA 3L70D 5KLIB 2BCCD 4PD4D 3PLNA 2N9YB 5KKZB 1BE3D 1PP9D 2KNCB 3TGUD 1L0ND 3TDKA 2RN0A 2QJPB 2A06D 2Y0DA 3CX5D 3PHLA 2Q3EA 3BCCD 2QJYB 3ITKA 2IBZD 2QJKB 3H1HD 4U3FD 2Y0CA 3GG2A 4A7PA 1PPJD 3PTZA 4D6TD 3FWLA 2FYUD 3GW6A 3H1KD 1BCCD 1NTMD 3H1ID 1NTZD 3H1LD 3L74D 3KHUA 4RJTA 2JWAA 3L73D 5KLVD 3L72D 3VMAA 1NU1D 2QG4A 3TF5A 1SQBD 1KB9D 1NTKD 2YIUB 2O3JA 1SQQD 2Y0EA 3H1JD 2FYNB 1L0LD 4EDFA 2K9JB 1KYOD 3CXHD 1SQXD 1SQPD 3CWBD
chains in the Genus database with same CATH superfamily
1QLED 1VQ9P 2CPSA 3NFQA 2L91A 4OVNF 3V2QA 3KPEA 5KAIE 1NU1E 1HGZA 3VP9A 3FX0A 3SWYA 1FDMA 3ZDMA 2R32A 1GZLA 1R8EA 3BATA 3FWNA 1FZEA 5AW8B 1NOHA 2N1TC 3H1JG 3R2PA 3H1HJ 2KS1B 3A5TA 4ZKPA 1LT9B 4Y99C 2QSIA 1J1EC 3IN6A 4H44D 3CWBG 1IFNA 1M1JB 5AVXB 1DX7A 2M3BA 1SS1A 1BE3E 1R5SA 1J1DC 2OYIA 1DEEG 3EWKA 1OZHA 2LR2A 2IX7C 3H1LJ 3VMYA 2B87A 2G3AA 4C7NB 5B66H 1AJYA 2B9BA 3HUSA 2OYHB 3RBXA 2Y9ZA 1EQ7A 3AEGC 1ZXGA 2QG4A 1SQBJ 1FOSF 3L74G 5KLIC 1CZQA 1AFOA 3IR9A 1PGOA 1T2KC 2HPCA 1URQC 3AEAC 1JOCA 1G2CA 1URQB 4XFJA 4H0LB 4EI2A 1U7JA 1NTKG 1L4AA 3RL0D 3RBZA 5L8RJ 5AVSB 1RF1A 3HD7D 1KTMA 4OWFA 3H1JE 1QX8A 1Z56A 1YJ9P 3CXHE 3CWBE 1S5LX 1YBKA 3AEFC 1KQSO 4U3FJ 1FAVA 2PFXA 1SQPG 2YKOA 2YO2A 4D6TD 2E5TA 1SQPK 3OAKA 2IBZI 3H1KD 4PD4E 2P7JA 3JCUH 2Z4EA 1FC2C 1NTMD 3MZWB 4WWIA 3H1IJ 1LWUC 2FYUE 1XTCC 2Q9IA 2XNDH 1PZQA 1G1JA 3L74E 4HJGH 2QM7A 3CC2P 2W27A 3LIEA 1KB9D 1NAFA 4TT3H 3CCUP 1H0TB 1ZOYC 2Q5UA 2O3JA 3F5HA 3GHGB 4CPGA 1PV3A 1NTKE 1SQXJ 4K35A 2K88A 4WY4B 2E76C 1KYOE 2J59M 1EZVD 4UB6H 1ZRTD 3TK1A 3CMEP 1FJPA 3HTKB 1VQLP 2ZYAA 2ZXEB 1K04A 3B5ND 1M90Q 3D71A 2CPBA 4R4MA 3Q5RA 2KNCB 3TNUA 1KD1Q 2POHA 2Q7CA 2E74C 3B5NA 4ASWA 1JEKA 2IYOA 3AEDC 2RN0A 2IZ1A 5M1BA 2KYVA 1SQPE 2ZYDA 1VQOP 2Q3EA 2C0WA 1LTJC 1QGKB 3BCCJ 1YJNP 1L0LG 2Y0CA 1RH5B 2FYZA 2NPSC 1L0LK 4H44C 4L75A 1VQ5P 1OMIA 3P8CE 3L71G 4W7ZA 1JY2P 3A0BE 4H13B 4XE5B 1FZAA 4U7JA 1NTZD 5H2FH 5CJ4A 2BCCG 2ZT9D 5CBOA 1MV8A 3TGUG 1BSNA 1JCCA 4HKZH 3KZIH 4PJ0H 5KJ7C 2O01H 1KILD 4BWNA 2HODB 5KLVE 5B5EE 1L4AB 1SQQD 2WPRA 2KB7P 1JMBA 3MUDC 1KILA 5TISH 4ZKUA 3G9RA 1ZV8A 4R4LA 1KQFB 1MFZA 3L36A 3SWKA 5KAIH 4EOTA 1N73A 3L70D 1NGMB 1OXZA 3RL0C 2OQQA 3S1KA 2YMYA 5CCGD 3HD7C 3U1CA 1X0TA 1UIIA 1HBWA 3E7KA 2ZAEB 1L0LE 5BU8B 1JMMA 5CCGA 2H7HA 2OYOA 1FZCB 2B88A 5GTHE 1JTHB 3CXHI 3L71E 3RK3D 2XV5A 3MD0A 2QJYB 3A2AA 3ITKA 2QJKB 5APWA 4IOIH 3QH9A 4DJGA 1RE3C 1USDA 1K9MQ 5CBNA 2O01J 1JCDA 3AE7C 2M3EA 1T8ZA 2BCCE 2G8YA 1JY3P 3CCSP 3CCLP 2XZRA 3TGUE 1BCCJ 4PD4I 4HB1A 3CCRP 1IFDA 1GW4A 1M7LA 2ZVOB 2E75B 1PP9G 3L73D 3L72D 4DT0A 3CLQA 3EFFK 1NU1J 4KJMA 3TF5A 4LLHA 4Y28J 3S9OA 1A02F 4JBZA 4N3YB 1BDDA 4EDFA 1RHZB 2KS1A 2KP8A 1BGYJ 1LT9A 5AW4B 2C9NY 1SP4A 1M1JA 1J2JB 2E42A 1KYOI 4LC1A 1H8AA 3GLMA 1FE6A 2Q6QA 3OA7A 2AEMA 1VF5D 4EIJA 2JEEA 1LT1A 1GL2D 1BE3J 4C7NA 1RQVA 3CXHH 2OYHA 2JKVA 2RKLA 1AA0A 2JWDA 4QMAA 4I1LA 3H1HD 2FFDC 5APVA 4PD4H 4OGQC 5CCHC 1GTWA 2KZIA 4OGQB 3A7OA 3L75G 1PP9E 1URQA 1HTLC 5DJTB 3H1LD 2FYNC 1IZNB 3H1KE 3HRNA 2ZT9C 2O1JA 2XDJA 1G1IA 1M1KQ 2WT7B 1OVUA 1SQBD 4YTPC 2KSEA 3V2RA 4JPZB 2P2UA 1YHQP 1ZN5A 4IFMA 1SVFA 2E5YA 3H1JJ 1IC2A 5KKZC 2H89C 4UB8E 5AW9B 4L74A 4KHXA 3CWBJ 1W5CE 5AW3B 1N7SC 5TJHA 2D2CB 1HH0A 2KXPB 2B89A 2GA1A 4JYCA 3VMXA 1OVRA 2WZ7A 2M0BA 3CD6P 3AE5C 2YMKA 3VTPC 2JO1A 2N9YB 2IYPA 4ASVA 3TDKA 2QA4P 4GKGA 3Q5SA 2BEQD 2J58A 2AXCA 1LTAC 1EDLA 1KC8Q 3RK3C 1H0TA 3L75E 4U3FD 4GODA 5APXA 1S9KE 3AECC 4WY4D 3GHGA 2ZYGA 3A0BH 1SQVG 1SQVK 1OIPA 2YIUC 4WY4A 1NWQA 3H1ID 3HTKA 1WT6A 3UIAA 2N1TB 3OJAB 2A45H 3A3YB 4Y99B 1J1EB 2P10A 2KNCA 2YKPA 2HLOA 5B5EH 4KT0J 1ZW0A 2FKWB 2ZVNB 5GTIE 1NVOA 3W68A 1J1DB 1RF0C 3BRVB 3CMAP 1ZMEC 1S1CX 5AVVB 2K9JB 2XU6A 4L76A 3IFMA 3SSUA 1PPJG 1SQXD 4M3LA 2WSEH 3L73G 1SQPJ 5AW1B 1X8YA 3AE9C 5AVUB 2FYUG 3VMZA 3WUTA 3F89A 2FYUK 3PRJA 3Q3DA 4PV1C 5KLIB 2WMMA 1SFCC 1VF5C 1WRGA 1GL2C 2HFED 1MKMA 1HVVA 1LP1B 3SFDC 2NZ2A 5GTHH 3BASA 1L4AD 1Q7YQ 4OH8B 2Y0DA 3TSIA 1SQVE 1KQLA 2HODA 3BCCD 1NTKK 3RK2C 3PH0A 1S5LH 2IFNA 2ITAA 3T97B 2P1JA 1N8RQ 3MIWA 1JM0A 3NXSA 1OWAA 3PP5A 3G6EP 2WSEJ 3SFEC 1EXJA 3MTUE 2IFMA 1L0NG 2JR8A 1L0NK 1PPJE 3L73E 1S2EA 3H1LG 2DW3A 1FZCA 2HG5D 1JTHA 1LWUB 1L0LJ 4IL6E 1YTZT 4AUWA 2K1AA 3L71J 1H89A 2R3CA 4N78E 4NPDA 1LTSC 3H32B 1GK6A 3MGNA 1K05A 1X79B 1FDOA 5APTA 2E75D 2BCCJ 1YQ4C 3C8VA 4I6MC 5KLVG 1MUUA 5KLVK 1U7MA 2FXPA 2E76B 2UWJE 3GF3A 3PJSK 2A06D 3CX5D 1YQ3C 3FGAD 1JY3O 2VRSA 1Q90D 1CW5A 2GM4A 2YXRB 1P84E 5CHXA 1W2BO 3H1HE 3R4YA 3AE3C 1GDTA 2E74B 4JYBA 1IFMA 1BCCD 1L0NE 1RY3A 3P8MC 3L4FA 1VQMP 2XKMA 4NPEA 2R5DA 1OVVA 1LTJB 1NHLA 1IK7A 1ZP0C 4DCKA 3H1LE 2OYIC 2NPSB 3M0DA 4H44B 1NU1D 1FZGA 4IFDK 3H1IG 3HUSC 4UB8H 5K5GB 1YITP 1NJIQ 1BGYD 4N6JA 3RGUA 1IFJA 2H8PD 5BU5A 4WVZA 1FDIA 4RESB 2QJPC 3KYQA 5AW5B 1K73Q 2V7QH 3TYYA 1DEBA 1AVOA 5E79H 1KV4A 3H6PA 2MKVA 1SQXG 1BE3D 1PP9J 1RE4A 2I8DA 1U57A 2WSSH 3OW2O 1JUNA 1OFCX 1JNMA 1DD3A 2WT7A 2W8ZA 1RF1C 1EXIA 4YXWH 2KOGA 2WVRA 3RL0B 4B86A 2JJLA 2IZ0A 3HD7B 2D2CD 3P32A 2M5AB 1VQ7P 2O01N 3AE2C 1FZFA 5KAFE 5DJUB 3V4QA 4O9BA 3M91A 3S4RA 1Y47A 1VQ6P 2K3RA 1NH4A 3H1IE 4C7RA 5AVQB 3HE5B 3L35A 2V7QJ 1QEXA 5GTIH 2QRXA 4GT1A 1KMIZ 3IAOA 2KLUA 5AVRB 1LTIC 3H1JD 1EDIA 1FBMA 1GMJA 3CXHD 4GOFA 3CWBD 3KXDA 5C39A 2WTYA 4WBAA 4D6TG 1KFMA 3EQ2A 3CCQP 3H1KG 3L75J 1SQXE 3LW5H 1FOSE 5AW7B 1NTMG 1IFPA 2N1TD 1NTMK 3P7KA 4PD4D 1CI6B 2N1TA 1Q82Q 4I7ZC 1KQGB 3GF7A 2ZJSE 3B5NC 3NTNA 3CCVP 1BSHA 2K9JA 3BCCE 1P84I 2K9YA 4Z1MH 1EZVG 2LKMA 1AQTA 2Y9YA 3MHVA 4GOEA 2N9BA 2OARA 1NKNA 2YKQA 5AW6B 1QL1A 1HJBA 3V2NA 3U59A 1DH3A 1T2KD 4WB4A 1M8OB 1URQD 3I56P 4YXDC 3LW5J 3AE4C 2FFDB 3M9BA 4H0LD 1LP1A 4D6TE 2FY8A 2W6JH 2WSCH 1GU5A 3D70A 4ZNCA 1DIPA 3HE4B 4IL6H 1LTGC 2MJZA 2FYNB 3M06A 4I2LC 2JDIH 1USEA 3G71P 2ZT9B 1NTME 1SQPD 3I5CA 1SQVJ 3AEEC 4AQRD 3O6QB 1KILC 3T97A 3O8ZA 4IL6X 4IFFA 1VDFA 1NTZG 2OGUA 1NTZK 1ZLLA 1AV1A 1KB9E 3PLNA 5KKZB 3K5BA 1KYOH 1N73C 5APQA 3A0HE 2K37A 1N7SB 2M8RA 3V4WA 4W7YA 1PGJA 2W6AA 1SQQG 3RL0g 1EZVE 1SQQK 1Y8AA 4ZMDA 1P84H 3CX5E 1ZRTE 3B71A 1NAYA 5CCGC 4DOJA 3PTZA 1LWUA 3AE8C 1OW6A 1HUCA 2KUBA 2FYUJ 2WSCJ 1JY3N 3D6ZA 2OTKE 3AEBC 3H32A 3L70G 3WUUA 2LXCB 3L74J 2IDBA 3KHUA 2R5BA 3RK3B 1LJ2A 3C1LA 5AVZB 4JF7A 1EDKA 1WMKA 1N86A 2E76D 4RO0A 1FJKA 1GU4A 1GW3A 1H88A 1S4XA 2L5GB 1NTKJ 2YIUB 4TLFA 1PGQA 3FXEA 2QE7H 2WWWA 1L0LD 1GK4A 3BRTB 1NTZE 2E74D 2RMZA 2H88C 3NMDA 3L71D 3WU2E 5BVZA 2GUVA 1VQPP 1PFIA 1BGYE 1D7MA 1VQ8P 2V4HA 2H43A 2BEZF 3II6A 1LT9C 2BCCD 1KILE 2NPSD 1M1JC 3TGUD 1SQQE 1LTJA 1L0NJ 3L72G 2W83C 4H13D 3U1AA 1IO4A 2NPSA 5AVWB 4C46A 2OTLP 2AEJA 4PV1B 2AXTE 1OX3A 2OYHC 4A7PA 1SFCB 1VF5B 2O1KA 3L70E 1GL2B 1RQUA 5KJ7D 5KAFH 3GW6A 1PIXA 2XNXA 3B4SA 5EFWB 1FU1A 1T3UA 1JY2O 2WPVB 5KJ7A 3RK2B 3VMAA 3RK3E 5KLVJ 3SWFA 3M9HA 3MUDA 2QIWA 2PAJA 3N4XA 4H0LC 1VQKP 3H1HG 3Q2YA 1JB0J 3BVHA 4LGDE 3HD7A 2M5AA 1YTZI 1YI2P 1VPCA 3L72E 2W6BA 1KFNA 2KI7B 1KORA 2E43A 4MN4C 2AEFA 1ZR4A 1IFIA 1PP9D 1KB9I 3CCEP 2GUSA 3L37A 3N7NA 1QVGO 4HH2A 4BRYB 3I55P 3HE5A 1SQBG 2Z5IA 1RE3A 1SQBK 1QL2A 2IBZD 1AQ5A 2YO3A 1EZVI 1VQNP 3CX5I 5APUA 2FBWC 2Z5HA 2W90A 3TGUJ 2PP6A 3CCJP 2KIKA 3FWLA 3USSA 3W67A 5APYA 3JC22 1GD2E 3GHGC 1KZUB 2A45G 4DZOA 1UIXA 2KK7A 4RJTA 1E79H 4WY4C 4EYYQ 2QVAA 1CI6A 5APSA 1T3JA 1Q86Q 2SPZA 2FXMA 3E1IA 1E5WA 1EC5A 4U3FG 2I1JA 1Y9BA 1T6AA 3V2PA 2OYIB 3L75D 1S72P 3EFGA 2B87B 1S9KD 3D6YA 3CC4P 5AVTB 1KB9H 1VL2A 2PRRA 3HUSB 1SQBE 2WITA 3CC7P 3A0HH 4OGQD 5CCHD 1LNQA 2JP3A 1M56D 4H13C 2WPQA 2QJPB 4GDOA 2FFDA 3ABVC 5CCHA 2HPCB 3CX5H 3VOPA 3VN0A 3KDPB 1G2CB 3HE4A 4NPFX 2LXBA 1X22A 1HWTC 2KZJA 4D6TJ 5AVYB 1SQXK 3WUVA 3CI9A 3H1KJ 1L4AC 2KSJA 3FXDA 3O6QA 1NTMJ 1RF1B 3C9IA 1LGHB 3M0AA 3GMAA 3Q5PA 5B66E 4K3AA 1N7LA 1N7SD 4U3FE 1LTTC 5AW2B 2HR3A 1QVFO 4AYCA 1M57D 1N7SA 1K8AQ 1JO5A 1L2PA 2ZFCA 3BCCG 3G4SP 3WU2H 1SQVD 3CCMP 1SLQA 1FZCC 1IK9A 2QM8A 2QJYC 2QJKC 4RKUJ 1DD4A 1S5LE 3WMM0 2YXQB 5AW0B 2YNYA 3PHLA 1FS0E 2AXTH 1HF9A 3M9QA 2E75C 1PPJD 2J5UA 1YYCA 1BDCA 2FYUD 1VQ4P 4I7ZB 2R44A 3LIDA 3JCUE 3Q1MA 1NTZJ 3L74D 2IBZG 3TNUB 3IF4A 2QEXP 1NKZB 4N78D 3B5NB 3E1RA 3G3ZA 2JWAA 1RF0A 4HYTB 4W80A 1Q81Q 1JY2N 1NTKD 2A06G 4PV1D 1SQQJ 5CJ0A 1FZBA 1SFCD 3M0DC 1MZ9A 1KYOD 2C0XA 2WSFH 1SFCA 1MFTA 3B8EB 2I1KA 2WPSA 1GL2A 2PGDA 1KN7A 1BCCG 1AVYA 4UB6E 1PGPA 1P84D 2P67A 1EDJA 3L70J 5KTBA 1YIJP 1OW7A 2NRGA 3RK2D 1S3JA 2HYNA 4GIFA 2R3SA 1L0ND 3QWOC 3VYIA 1YJWP 3CL3D 3KQGA 3V6IA 1NU1G 2RH0A 1R5LA 2ZXXA 2P58A 1NU1K 2C9LY 1KILB 1LTBC 2Q3IA 1RE4C 3MP7B 3H25A 2OTJP 3P8CD 3GG2A 1HGVA 1PL5A 2IBZE 1BGYG 3V5BA 2A45I 3CPWO 1N73B 2IPPA 4YPCA 2WQYC 1HJ0A 2BASA 1XTGB 1N2DC 1TU3F 1CSBA 2KLVA 3JSVC 4JQ0D 1ZR2A 5H2FE 1Q2NA 2WSFJ 1A02J 1NO4A 2A06E 2Q1KA 1BE3G 3AE1C 5KLVD 3L73J 3L72J 2D2CC 1NYHA 3KZIE 5CMZA 4PJ0E 4BRYA 1X9VA 4XA4A 1OW8A 2Y0EA 3VP8A 1W2EA 2CK3H 3AE6C 1IJDB 1BCCE 5E79E 4L73A 5TISE 2FXOA 4BXLA
chains in the Genus database with same CATH topology
2KS1A 1BGYD 2RMZA 1SQVD 3L71D 5TJHA 1EZVD 3L75D 1ZRTD 2L91A 1P84D 3PRJA 3L70D 5KLIB 2BCCD 4PD4D 3PLNA 2N9YB 5KKZB 1BE3D 1PP9D 2KNCB 3TGUD 1L0ND 3TDKA 2RN0A 2QJPB 2A06D 2Y0DA 3CX5D 3PHLA 2Q3EA 3BCCD 2QJYB 3ITKA 2IBZD 2QJKB 3H1HD 4U3FD 2Y0CA 3GG2A 4A7PA 1PPJD 3PTZA 4D6TD 3FWLA 2FYUD 3GW6A 3H1KD 1BCCD 1NTMD 3H1ID 1NTZD 3H1LD 3L74D 3KHUA 4RJTA 2JWAA 3L73D 5KLVD 3L72D 3VMAA 1NU1D 2QG4A 3TF5A 1SQBD 1KB9D 1NTKD 2YIUB 2O3JA 1SQQD 2Y0EA 3H1JD 2FYNB 1L0LD 4EDFA 2K9JB 1KYOD 3CXHD 1SQXD 1SQPD 3CWBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KS1 A;  1BGY D;  2RMZ A;  1SQV D;  3L71 D;  5TJH A;  1EZV D;  3L75 D;  1ZRT D;  2L91 A;  1P84 D;  3PRJ A;  3L70 D;  5KLI B;  2BCC D;  4PD4 D;  3PLN A;  2N9Y B;  5KKZ B;  1BE3 D;  1PP9 D;  2KNC B;  3TGU D;  1L0N D;  3TDK A;  2RN0 A;  2QJP B;  2A06 D;  2Y0D A;  3CX5 D;  3PHL A;  2Q3E A;  3BCC D;  2QJY B;  3ITK A;  2IBZ D;  2QJK B;  3H1H D;  4U3F D;  2Y0C A;  3GG2 A;  4A7P A;  1PPJ D;  3PTZ A;  4D6T D;  3FWL A;  2FYU D;  3GW6 A;  3H1K D;  1BCC D;  1NTM D;  3H1I D;  1NTZ D;  3H1L D;  3L74 D;  3KHU A;  4RJT A;  2JWA A;  3L73 D;  5KLV D;  3L72 D;  3VMA A;  1NU1 D;  2QG4 A;  3TF5 A;  1SQB D;  1KB9 D;  1NTK D;  2YIU B;  2O3J A;  1SQQ D;  2Y0E A;  3H1J D;  2FYN B;  1L0L D;  4EDF A;  2K9J B;  1KYO D;  3CXH D;  1SQX D;  1SQP D;  3CWB D; 
#chains in the Genus database with same CATH topology
 1QLE D;  1VQ9 P;  2CPS A;  3NFQ A;  2L91 A;  4OVN F;  3V2Q A;  3KPE A;  5KAI E;  1NU1 E;  1HGZ A;  3VP9 A;  3FX0 A;  3SWY A;  1FDM A;  3ZDM A;  2R32 A;  1GZL A;  1R8E A;  3BAT A;  3FWN A;  1FZE A;  5AW8 B;  1NOH A;  2N1T C;  3H1J G;  3R2P A;  3H1H J;  2KS1 B;  3A5T A;  4ZKP A;  1LT9 B;  4Y99 C;  2QSI A;  1J1E C;  3IN6 A;  4H44 D;  3CWB G;  1IFN A;  1M1J B;  5AVX B;  1DX7 A;  2M3B A;  1SS1 A;  1BE3 E;  1R5S A;  1J1D C;  2OYI A;  1DEE G;  3EWK A;  1OZH A;  2LR2 A;  2IX7 C;  3H1L J;  3VMY A;  2B87 A;  2G3A A;  4C7N B;  5B66 H;  1AJY A;  2B9B A;  3HUS A;  2OYH B;  3RBX A;  2Y9Z A;  1EQ7 A;  3AEG C;  1ZXG A;  2QG4 A;  1SQB J;  1FOS F;  3L74 G;  5KLI C;  1CZQ A;  1AFO A;  3IR9 A;  1PGO A;  1T2K C;  2HPC A;  1URQ C;  3AEA C;  1JOC A;  1G2C A;  1URQ B;  4XFJ A;  4H0L B;  4EI2 A;  1U7J A;  1NTK G;  1L4A A;  3RL0 D;  3RBZ A;  5L8R J;  5AVS B;  1RF1 A;  3HD7 D;  1KTM A;  4OWF A;  3H1J E;  1QX8 A;  1Z56 A;  1YJ9 P;  3CXH E;  3CWB E;  1S5L X;  1YBK A;  3AEF C;  1KQS O;  4U3F J;  1FAV A;  2PFX A;  1SQP G;  2YKO A;  2YO2 A;  4D6T D;  2E5T A;  1SQP K;  3OAK A;  2IBZ I;  3H1K D;  4PD4 E;  2P7J A;  3JCU H;  2Z4E A;  1FC2 C;  1NTM D;  3MZW B;  4WWI A;  3H1I J;  1LWU C;  2FYU E;  1XTC C;  2Q9I A;  2XND H;  1PZQ A;  1G1J A;  3L74 E;  4HJG H;  2QM7 A;  3CC2 P;  2W27 A;  3LIE A;  1KB9 D;  1NAF A;  4TT3 H;  3CCU P;  1H0T B;  1ZOY C;  2Q5U A;  2O3J A;  3F5H A;  3GHG B;  4CPG A;  1PV3 A;  1NTK E;  1SQX J;  4K35 A;  2K88 A;  4WY4 B;  2E76 C;  1KYO E;  2J59 M;  1EZV D;  4UB6 H;  1ZRT D;  3TK1 A;  3CME P;  1FJP A;  3HTK B;  1VQL P;  2ZYA A;  2ZXE B;  1K04 A;  3B5N D;  1M90 Q;  3D71 A;  2CPB A;  4R4M A;  3Q5R A;  2KNC B;  3TNU A;  1KD1 Q;  2POH A;  2Q7C A;  2E74 C;  3B5N A;  4ASW A;  1JEK A;  2IYO A;  3AED C;  2RN0 A;  2IZ1 A;  5M1B A;  2KYV A;  1SQP E;  2ZYD A;  1VQO P;  2Q3E A;  2C0W A;  1LTJ C;  1QGK B;  3BCC J;  1YJN P;  1L0L G;  2Y0C A;  1RH5 B;  2FYZ A;  2NPS C;  1L0L K;  4H44 C;  4L75 A;  1VQ5 P;  1OMI A;  3P8C E;  3L71 G;  4W7Z A;  1JY2 P;  3A0B E;  4H13 B;  4XE5 B;  1FZA A;  4U7J A;  1NTZ D;  5H2F H;  5CJ4 A;  2BCC G;  2ZT9 D;  5CBO A;  1MV8 A;  3TGU G;  1BSN A;  1JCC A;  4HKZ H;  3KZI H;  4PJ0 H;  5KJ7 C;  2O01 H;  1KIL D;  4BWN A;  2HOD B;  5KLV E;  5B5E E;  1L4A B;  1SQQ D;  2WPR A;  2KB7 P;  1JMB A;  3MUD C;  1KIL A;  5TIS H;  4ZKU A;  3G9R A;  1ZV8 A;  4R4L A;  1KQF B;  1MFZ A;  3L36 A;  3SWK A;  5KAI H;  4EOT A;  1N73 A;  3L70 D;  1NGM B;  1OXZ A;  3RL0 C;  2OQQ A;  3S1K A;  2YMY A;  5CCG D;  3HD7 C;  3U1C A;  1X0T A;  1UII A;  1HBW A;  3E7K A;  2ZAE B;  1L0L E;  5BU8 B;  1JMM A;  5CCG A;  2H7H A;  2OYO A;  1FZC B;  2B88 A;  5GTH E;  1JTH B;  3CXH I;  3L71 E;  3RK3 D;  2XV5 A;  3MD0 A;  2QJY B;  3A2A A;  3ITK A;  2QJK B;  5APW A;  4IOI H;  3QH9 A;  4DJG A;  1RE3 C;  1USD A;  1K9M Q;  5CBN A;  2O01 J;  1JCD A;  3AE7 C;  2M3E A;  1T8Z A;  2BCC E;  2G8Y A;  1JY3 P;  3CCS P;  3CCL P;  2XZR A;  3TGU E;  1BCC J;  4PD4 I;  4HB1 A;  3CCR P;  1IFD A;  1GW4 A;  1M7L A;  2ZVO B;  2E75 B;  1PP9 G;  3L73 D;  3L72 D;  4DT0 A;  3CLQ A;  3EFF K;  1NU1 J;  4KJM A;  3TF5 A;  4LLH A;  4Y28 J;  3S9O A;  1A02 F;  4JBZ A;  4N3Y B;  1BDD A;  4EDF A;  1RHZ B;  2KS1 A;  2KP8 A;  1BGY J;  1LT9 A;  5AW4 B;  2C9N Y;  1SP4 A;  1M1J A;  1J2J B;  2E42 A;  1KYO I;  4LC1 A;  1H8A A;  3GLM A;  1FE6 A;  2Q6Q A;  3OA7 A;  2AEM A;  1VF5 D;  4EIJ A;  2JEE A;  1LT1 A;  1GL2 D;  1BE3 J;  4C7N A;  1RQV A;  3CXH H;  2OYH A;  2JKV A;  2RKL A;  1AA0 A;  2JWD A;  4QMA A;  4I1L A;  3H1H D;  2FFD C;  5APV A;  4PD4 H;  4OGQ C;  5CCH C;  1GTW A;  2KZI A;  4OGQ B;  3A7O A;  3L75 G;  1PP9 E;  1URQ A;  1HTL C;  5DJT B;  3H1L D;  2FYN C;  1IZN B;  3H1K E;  3HRN A;  2ZT9 C;  2O1J A;  2XDJ A;  1G1I A;  1M1K Q;  2WT7 B;  1OVU A;  1SQB D;  4YTP C;  2KSE A;  3V2R A;  4JPZ B;  2P2U A;  1YHQ P;  1ZN5 A;  4IFM A;  1SVF A;  2E5Y A;  3H1J J;  1IC2 A;  5KKZ C;  2H89 C;  4UB8 E;  5AW9 B;  4L74 A;  4KHX A;  3CWB J;  1W5C E;  5AW3 B;  1N7S C;  5TJH A;  2D2C B;  1HH0 A;  2KXP B;  2B89 A;  2GA1 A;  4JYC A;  3VMX A;  1OVR A;  2WZ7 A;  2M0B A;  3CD6 P;  3AE5 C;  2YMK A;  3VTP C;  2JO1 A;  2N9Y B;  2IYP A;  4ASV A;  3TDK A;  2QA4 P;  4GKG A;  3Q5S A;  2BEQ D;  2J58 A;  2AXC A;  1LTA C;  1EDL A;  1KC8 Q;  3RK3 C;  1H0T A;  3L75 E;  4U3F D;  4GOD A;  5APX A;  1S9K E;  3AEC C;  4WY4 D;  3GHG A;  2ZYG A;  3A0B H;  1SQV G;  1SQV K;  1OIP A;  2YIU C;  4WY4 A;  1NWQ A;  3H1I D;  3HTK A;  1WT6 A;  3UIA A;  2N1T B;  3OJA B;  2A45 H;  3A3Y B;  4Y99 B;  1J1E B;  2P10 A;  2KNC A;  2YKP A;  2HLO A;  5B5E H;  4KT0 J;  1ZW0 A;  2FKW B;  2ZVN B;  5GTI E;  1NVO A;  3W68 A;  1J1D B;  1RF0 C;  3BRV B;  3CMA P;  1ZME C;  1S1C X;  5AVV B;  2K9J B;  2XU6 A;  4L76 A;  3IFM A;  3SSU A;  1PPJ G;  1SQX D;  4M3L A;  2WSE H;  3L73 G;  1SQP J;  5AW1 B;  1X8Y A;  3AE9 C;  5AVU B;  2FYU G;  3VMZ A;  3WUT A;  3F89 A;  2FYU K;  3PRJ A;  3Q3D A;  4PV1 C;  5KLI B;  2WMM A;  1SFC C;  1VF5 C;  1WRG A;  1GL2 C;  2HFE D;  1MKM A;  1HVV A;  1LP1 B;  3SFD C;  2NZ2 A;  5GTH H;  3BAS A;  1L4A D;  1Q7Y Q;  4OH8 B;  2Y0D A;  3TSI A;  1SQV E;  1KQL A;  2HOD A;  3BCC D;  1NTK K;  3RK2 C;  3PH0 A;  1S5L H;  2IFN A;  2ITA A;  3T97 B;  2P1J A;  1N8R Q;  3MIW A;  1JM0 A;  3NXS A;  1OWA A;  3PP5 A;  3G6E P;  2WSE J;  3SFE C;  1EXJ A;  3MTU E;  2IFM A;  1L0N G;  2JR8 A;  1L0N K;  1PPJ E;  3L73 E;  1S2E A;  3H1L G;  2DW3 A;  1FZC A;  2HG5 D;  1JTH A;  1LWU B;  1L0L J;  4IL6 E;  1YTZ T;  4AUW A;  2K1A A;  3L71 J;  1H89 A;  2R3C A;  4N78 E;  4NPD A;  1LTS C;  3H32 B;  1GK6 A;  3MGN A;  1K05 A;  1X79 B;  1FDO A;  5APT A;  2E75 D;  2BCC J;  1YQ4 C;  3C8V A;  4I6M C;  5KLV G;  1MUU A;  5KLV K;  1U7M A;  2FXP A;  2E76 B;  2UWJ E;  3GF3 A;  3PJS K;  2A06 D;  3CX5 D;  1YQ3 C;  3FGA D;  1JY3 O;  2VRS A;  1Q90 D;  1CW5 A;  2GM4 A;  2YXR B;  1P84 E;  5CHX A;  1W2B O;  3H1H E;  3R4Y A;  3AE3 C;  1GDT A;  2E74 B;  4JYB A;  1IFM A;  1BCC D;  1L0N E;  1RY3 A;  3P8M C;  3L4F A;  1VQM P;  2XKM A;  4NPE A;  2R5D A;  1OVV A;  1LTJ B;  1NHL A;  1IK7 A;  1ZP0 C;  4DCK A;  3H1L E;  2OYI C;  2NPS B;  3M0D A;  4H44 B;  1NU1 D;  1FZG A;  4IFD K;  3H1I G;  3HUS C;  4UB8 H;  5K5G B;  1YIT P;  1NJI Q;  1BGY D;  4N6J A;  3RGU A;  1IFJ A;  2H8P D;  5BU5 A;  4WVZ A;  1FDI A;  4RES B;  2QJP C;  3KYQ A;  5AW5 B;  1K73 Q;  2V7Q H;  3TYY A;  1DEB A;  1AVO A;  5E79 H;  1KV4 A;  3H6P A;  2MKV A;  1SQX G;  1BE3 D;  1PP9 J;  1RE4 A;  2I8D A;  1U57 A;  2WSS H;  3OW2 O;  1JUN A;  1OFC X;  1JNM A;  1DD3 A;  2WT7 A;  2W8Z A;  1RF1 C;  1EXI A;  4YXW H;  2KOG A;  2WVR A;  3RL0 B;  4B86 A;  2JJL A;  2IZ0 A;  3HD7 B;  2D2C D;  3P32 A;  2M5A B;  1VQ7 P;  2O01 N;  3AE2 C;  1FZF A;  5KAF E;  5DJU B;  3V4Q A;  4O9B A;  3M91 A;  3S4R A;  1Y47 A;  1VQ6 P;  2K3R A;  1NH4 A;  3H1I E;  4C7R A;  5AVQ B;  3HE5 B;  3L35 A;  2V7Q J;  1QEX A;  5GTI H;  2QRX A;  4GT1 A;  1KMI Z;  3IAO A;  2KLU A;  5AVR B;  1LTI C;  3H1J D;  1EDI A;  1FBM A;  1GMJ A;  3CXH D;  4GOF A;  3CWB D;  3KXD A;  5C39 A;  2WTY A;  4WBA A;  4D6T G;  1KFM A;  3EQ2 A;  3CCQ P;  3H1K G;  3L75 J;  1SQX E;  3LW5 H;  1FOS E;  5AW7 B;  1NTM G;  1IFP A;  2N1T D;  1NTM K;  3P7K A;  4PD4 D;  1CI6 B;  2N1T A;  1Q82 Q;  4I7Z C;  1KQG B;  3GF7 A;  2ZJS E;  3B5N C;  3NTN A;  3CCV P;  1BSH A;  2K9J A;  3BCC E;  1P84 I;  2K9Y A;  4Z1M H;  1EZV G;  2LKM A;  1AQT A;  2Y9Y A;  3MHV A;  4GOE A;  2N9B A;  2OAR A;  1NKN A;  2YKQ A;  5AW6 B;  1QL1 A;  1HJB A;  3V2N A;  3U59 A;  1DH3 A;  1T2K D;  4WB4 A;  1M8O B;  1URQ D;  3I56 P;  4YXD C;  3LW5 J;  3AE4 C;  2FFD B;  3M9B A;  4H0L D;  1LP1 A;  4D6T E;  2FY8 A;  2W6J H;  2WSC H;  1GU5 A;  3D70 A;  4ZNC A;  1DIP A;  3HE4 B;  4IL6 H;  1LTG C;  2MJZ A;  2FYN B;  3M06 A;  4I2L C;  2JDI H;  1USE A;  3G71 P;  2ZT9 B;  1NTM E;  1SQP D;  3I5C A;  1SQV J;  3AEE C;  4AQR D;  3O6Q B;  1KIL C;  3T97 A;  3O8Z A;  4IL6 X;  4IFF A;  1VDF A;  1NTZ G;  2OGU A;  1NTZ K;  1ZLL A;  1AV1 A;  1KB9 E;  3PLN A;  5KKZ B;  3K5B A;  1KYO H;  1N73 C;  5APQ A;  3A0H E;  2K37 A;  1N7S B;  2M8R A;  3V4W A;  4W7Y A;  1PGJ A;  2W6A A;  1SQQ G;  3RL0 g;  1EZV E;  1SQQ K;  1Y8A A;  4ZMD A;  1P84 H;  3CX5 E;  1ZRT E;  3B71 A;  1NAY A;  5CCG C;  4DOJ A;  3PTZ A;  1LWU A;  3AE8 C;  1OW6 A;  1HUC A;  2KUB A;  2FYU J;  2WSC J;  1JY3 N;  3D6Z A;  2OTK E;  3AEB C;  3H32 A;  3L70 G;  3WUU A;  2LXC B;  3L74 J;  2IDB A;  3KHU A;  2R5B A;  3RK3 B;  1LJ2 A;  3C1L A;  5AVZ B;  4JF7 A;  1EDK A;  1WMK A;  1N86 A;  2E76 D;  4RO0 A;  1FJK A;  1GU4 A;  1GW3 A;  1H88 A;  1S4X A;  2L5G B;  1NTK J;  2YIU B;  4TLF A;  1PGQ A;  3FXE A;  2QE7 H;  2WWW A;  1L0L D;  1GK4 A;  3BRT B;  1NTZ E;  2E74 D;  2RMZ A;  2H88 C;  3NMD A;  3L71 D;  3WU2 E;  5BVZ A;  2GUV A;  1VQP P;  1PFI A;  1BGY E;  1D7M A;  1VQ8 P;  2V4H A;  2H43 A;  2BEZ F;  3II6 A;  1LT9 C;  2BCC D;  1KIL E;  2NPS D;  1M1J C;  3TGU D;  1SQQ E;  1LTJ A;  1L0N J;  3L72 G;  2W83 C;  4H13 D;  3U1A A;  1IO4 A;  2NPS A;  5AVW B;  4C46 A;  2OTL P;  2AEJ A;  4PV1 B;  2AXT E;  1OX3 A;  2OYH C;  4A7P A;  1SFC B;  1VF5 B;  2O1K A;  3L70 E;  1GL2 B;  1RQU A;  5KJ7 D;  5KAF H;  3GW6 A;  1PIX A;  2XNX A;  3B4S A;  5EFW B;  1FU1 A;  1T3U A;  1JY2 O;  2WPV B;  5KJ7 A;  3RK2 B;  3VMA A;  3RK3 E;  5KLV J;  3SWF A;  3M9H A;  3MUD A;  2QIW A;  2PAJ A;  3N4X A;  4H0L C;  1VQK P;  3H1H G;  3Q2Y A;  1JB0 J;  3BVH A;  4LGD E;  3HD7 A;  2M5A A;  1YTZ I;  1YI2 P;  1VPC A;  3L72 E;  2W6B A;  1KFN A;  2KI7 B;  1KOR A;  2E43 A;  4MN4 C;  2AEF A;  1ZR4 A;  1IFI A;  1PP9 D;  1KB9 I;  3CCE P;  2GUS A;  3L37 A;  3N7N A;  1QVG O;  4HH2 A;  4BRY B;  3I55 P;  3HE5 A;  1SQB G;  2Z5I A;  1RE3 A;  1SQB K;  1QL2 A;  2IBZ D;  1AQ5 A;  2YO3 A;  1EZV I;  1VQN P;  3CX5 I;  5APU A;  2FBW C;  2Z5H A;  2W90 A;  3TGU J;  2PP6 A;  3CCJ P;  2KIK A;  3FWL A;  3USS A;  3W67 A;  5APY A;  3JC2 2;  1GD2 E;  3GHG C;  1KZU B;  2A45 G;  4DZO A;  1UIX A;  2KK7 A;  4RJT A;  1E79 H;  4WY4 C;  4EYY Q;  2QVA A;  1CI6 A;  5APS A;  1T3J A;  1Q86 Q;  2SPZ A;  2FXM A;  3E1I A;  1E5W A;  1EC5 A;  4U3F G;  2I1J A;  1Y9B A;  1T6A A;  3V2P A;  2OYI B;  3L75 D;  1S72 P;  3EFG A;  2B87 B;  1S9K D;  3D6Y A;  3CC4 P;  5AVT B;  1KB9 H;  1VL2 A;  2PRR A;  3HUS B;  1SQB E;  2WIT A;  3CC7 P;  3A0H H;  4OGQ D;  5CCH D;  1LNQ A;  2JP3 A;  1M56 D;  4H13 C;  2WPQ A;  2QJP B;  4GDO A;  2FFD A;  3ABV C;  5CCH A;  2HPC B;  3CX5 H;  3VOP A;  3VN0 A;  3KDP B;  1G2C B;  3HE4 A;  4NPF X;  2LXB A;  1X22 A;  1HWT C;  2KZJ A;  4D6T J;  5AVY B;  1SQX K;  3WUV A;  3CI9 A;  3H1K J;  1L4A C;  2KSJ A;  3FXD A;  3O6Q A;  1NTM J;  1RF1 B;  3C9I A;  1LGH B;  3M0A A;  3GMA A;  3Q5P A;  5B66 E;  4K3A A;  1N7L A;  1N7S D;  4U3F E;  1LTT C;  5AW2 B;  2HR3 A;  1QVF O;  4AYC A;  1M57 D;  1N7S A;  1K8A Q;  1JO5 A;  1L2P A;  2ZFC A;  3BCC G;  3G4S P;  3WU2 H;  1SQV D;  3CCM P;  1SLQ A;  1FZC C;  1IK9 A;  2QM8 A;  2QJY C;  2QJK C;  4RKU J;  1DD4 A;  1S5L E;  3WMM 0;  2YXQ B;  5AW0 B;  2YNY A;  3PHL A;  1FS0 E;  2AXT H;  1HF9 A;  3M9Q A;  2E75 C;  1PPJ D;  2J5U A;  1YYC A;  1BDC A;  2FYU D;  1VQ4 P;  4I7Z B;  2R44 A;  3LID A;  3JCU E;  3Q1M A;  1NTZ J;  3L74 D;  2IBZ G;  3TNU B;  3IF4 A;  2QEX P;  1NKZ B;  4N78 D;  3B5N B;  3E1R A;  3G3Z A;  2JWA A;  1RF0 A;  4HYT B;  4W80 A;  1Q81 Q;  1JY2 N;  1NTK D;  2A06 G;  4PV1 D;  1SQQ J;  5CJ0 A;  1FZB A;  1SFC D;  3M0D C;  1MZ9 A;  1KYO D;  2C0X A;  2WSF H;  1SFC A;  1MFT A;  3B8E B;  2I1K A;  2WPS A;  1GL2 A;  2PGD A;  1KN7 A;  1BCC G;  1AVY A;  4UB6 E;  1PGP A;  1P84 D;  2P67 A;  1EDJ A;  3L70 J;  5KTB A;  1YIJ P;  1OW7 A;  2NRG A;  3RK2 D;  1S3J A;  2HYN A;  4GIF A;  2R3S A;  1L0N D;  3QWO C;  3VYI A;  1YJW P;  3CL3 D;  3KQG A;  3V6I A;  1NU1 G;  2RH0 A;  1R5L A;  2ZXX A;  2P58 A;  1NU1 K;  2C9L Y;  1KIL B;  1LTB C;  2Q3I A;  1RE4 C;  3MP7 B;  3H25 A;  2OTJ P;  3P8C D;  3GG2 A;  1HGV A;  1PL5 A;  2IBZ E;  1BGY G;  3V5B A;  2A45 I;  3CPW O;  1N73 B;  2IPP A;  4YPC A;  2WQY C;  1HJ0 A;  2BAS A;  1XTG B;  1N2D C;  1TU3 F;  1CSB A;  2KLV A;  3JSV C;  4JQ0 D;  1ZR2 A;  5H2F E;  1Q2N A;  2WSF J;  1A02 J;  1NO4 A;  2A06 E;  2Q1K A;  1BE3 G;  3AE1 C;  5KLV D;  3L73 J;  3L72 J;  2D2C C;  1NYH A;  3KZI E;  5CMZ A;  4PJ0 E;  4BRY A;  1X9V A;  4XA4 A;  1OW8 A;  2Y0E A;  3VP8 A;  1W2E A;  2CK3 H;  3AE6 C;  1IJD B;  1BCC E;  5E79 E;  4L73 A;  5TIS E;  2FXO A;  4BXL A; 
#chains in the Genus database with same CATH homology
 2KS1 A;  1BGY D;  2RMZ A;  1SQV D;  3L71 D;  5TJH A;  1EZV D;  3L75 D;  1ZRT D;  2L91 A;  1P84 D;  3PRJ A;  3L70 D;  5KLI B;  2BCC D;  4PD4 D;  3PLN A;  2N9Y B;  5KKZ B;  1BE3 D;  1PP9 D;  2KNC B;  3TGU D;  1L0N D;  3TDK A;  2RN0 A;  2QJP B;  2A06 D;  2Y0D A;  3CX5 D;  3PHL A;  2Q3E A;  3BCC D;  2QJY B;  3ITK A;  2IBZ D;  2QJK B;  3H1H D;  4U3F D;  2Y0C A;  3GG2 A;  4A7P A;  1PPJ D;  3PTZ A;  4D6T D;  3FWL A;  2FYU D;  3GW6 A;  3H1K D;  1BCC D;  1NTM D;  3H1I D;  1NTZ D;  3H1L D;  3L74 D;  3KHU A;  4RJT A;  2JWA A;  3L73 D;  5KLV D;  3L72 D;  3VMA A;  1NU1 D;  2QG4 A;  3TF5 A;  1SQB D;  1KB9 D;  1NTK D;  2YIU B;  2O3J A;  1SQQ D;  2Y0E A;  3H1J D;  2FYN B;  1L0L D;  4EDF A;  2K9J B;  1KYO D;  3CXH D;  1SQX D;  1SQP D;  3CWB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...