2KS1A

Heterodimeric association of transmembrane domains of erbb1 and erbb2 receptors enabling kinase activation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Spatial Structure of the Transmembrane Domain Heterodimer of ErbB1 and ErbB2 Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
total genus 12
structure length 44
sequence length 44
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ks1A00
1SQPD 4RJTA 3KHUA 3PHLA 3H1HD 3L75D 1KYOD 1SQBD 1NTMD 2RMZA 1L0ND 5TJHA 2QJKB 1P84D 1SQXD 2Y0CA 3FWLA 3ITKA 1BCCD 2KNCB 2Y0EA 2QJYB 2KS1A 3GG2A 5KLVD 1SQVD 3BCCD 3H1ID 3GW6A 1NU1D 1BGYD 1PP9D 2A06D 2Q3EA 1SQQD 3TGUD 3L70D 3L73D 4A7PA 2RN0A 1PPJD 3CXHD 3TDKA 4PD4D 3L72D 3PLNA 2YIUB 2FYUD 2FYNB 2QJPB 3CWBD 2BCCD 2QG4A 1BE3D 2IBZD 2K9JB 1KB9D 2L91A 3L74D 3CX5D 2N9YB 3PRJA 5KKZB 1NTKD 3PTZA 3L71D 3VMAA 3H1KD 3H1JD 4EDFA 4U3FD 3H1LD 1L0LD 5KLIB 1EZVD 4D6TD 2JWAA 1ZRTD 2Y0DA 3TF5A 2O3JA 1NTZD
chains in the Genus database with same CATH superfamily
2OYIC 1KYOH 1IK7A 1HJ0A 1SQBD 2KOGA 3WUTA 1IFJA 1KD1Q 1LT9A 2I1KA 1BDDA 4BXLA 2W8ZA 2QVAA 5K5GB 2YXQB 4C46A 2OYIB 3B5NA 1FAVA 2XV5A 1FJKA 2I1JA 4LLHA 1M7LA 3CCLP 1KQLA 1NTZJ 1S5LE 1ZV8A 2GA1A 1RE3A 1S5LX 1SQXK 2WPVB 1BGYG 2ZT9B 3G71P 5KLVG 1JY3N 5KLIC 1VPCA 1ZP0C 2M5AB 2WWWA 2JJLA 2YKQA 3L74E 3A0HE 4H0LB 1PGQA 1FBMA 3QH9A 1EZVD 1L0NJ 4I1LA 1RF1C 5AW7B 3D6ZA 1LTJB 4ASVA 2K1AA 1FDIA 1OVUA 2O3JA 1VQ5P 3CLQA 4B86A 1BCCE 4WY4C 5CHXA 4C7NB 3AE9C 4Z1MH 3MGNA 3BCCE 1W2BO 4RO0A 3Q3DA 2R44A 2JWDA 2KIKA 5B66H 3CL3D 3E1IA 2E76B 1BSHA 1URQA 1BGYD 2YNYA 3SSUA 4A7PA 2FXPA 3A3YB 1CI6B 3EFGA 3H1JE 3H1KJ 5AW0B 1URQB 2P1JA 2G3AA 3IAOA 1U7JA 3H1LG 2PRRA 3AE7C 3L70G 3L72J 3M0DC 1VDFA 4HH2A 4BRYA 4YXWH 1OX3A 1HH0A 1HWTC 2D2CD 1EDIA 3O8ZA 1NKZB 1SQPE 1NTMK 1YYCA 3NXSA 1M57D 2YKOA 1KILD 1JB0J 1PP9J 1JMBA 1SFCB 2BEZF 2JP3A 3FXDA 3H1HJ 2K88A 4H13B 5KJ7C 4OGQB 1SQBE 2I8DA 4PJ0H 4PV1C 3AEEC 3B5ND 1SQXJ 2KK7A 5CJ0A 3S1KA 3D71A 2KP8A 3CWBJ 4Y99C 1YQ4C 1NTMD 2BCCJ 2FYUK 1KQGB 1JTHB 1X22A 2KB7P 2Y9YA 3AE6C 3EQ2A 2OTLP 1W5CE 2N1TD 1PFIA 3L70J 4JF7A 1DIPA 5KLVE 3KQGA 2W83C 3WUUA 3L73D 1IK9A 1AVYA 1T3JA 2H89C 5AW2B 1HTLC 3TGUE 2OYOA 3CC2P 1NTMG 1WRGA 2WITA 1JEKA 2N9BA 3VMXA 3G6EP 3Q2YA 1LWUA 1S2EA 4W7ZA 2QEXP 1L4AC 3L74D 5DJUB 5TISH 1KZUB 1R5SA 1RE4C 1EZVE 3SFEC 3WU2E 5AVXB 2R3CA 4M3LA 5GTIE 2WQYC 5KAIH 4MN4C 1NTKG 1VQOP 1S72P 4H13C 2XKMA 3V4QA 1QLED 3L71J 1N7SD 2KLUA 2IDBA 5GTHE 2WZ7A 1L0NG 2XNDH 1KQFB 1S4XA 3SWFA 1A02F 1SQQE 2J58A 3CCEP 3H1IG 1D7MA 2K3RA 3OAKA 1LTAC 3FWLA 1P84D 2IZ0A 2QJKC 5TISE 1BGYE 1VQ7P 3L75E 4I2LC 1MFZA 3VMZA 1HUCA 3M9HA 3VTPC 2CPSA 2P10A 4WY4A 5AVVB 5AW8B 1QEXA 5KAFH 3CCUP 1M90Q 1LJ2A 2J59M 2WSFJ 2WSFH 2WT7A 1EXIA 3JC22 2JDIH 3ABVC 2IBZI 3HE4A 1FJPA 2WTYA 1YTZT 3SWKA 1DEEG 4HB1A 3WMM0 4IL6H 3RK3B 1N73B 1SP4A 1RF1A 1SQPG 4DJGA 2FYUJ 1G2CB 1PIXA 1Y9BA 1YQ3C 5BU5A 1EQ7A 5AW1B 3V6IA 2R32A 4DZOA 5BVZA 1SQXE 1GU5A 1X0TA 5KAFE 1WT6A 3LW5J 2YO3A 3MZWB 3HTKB 3JCUE 1CW5A 2E5TA 1E5WA 3CXHI 3OA7A 3L73J 5AW5B 1K73Q 4WVZA 1SQPJ 2H8PD 2LXCB 2QJKB 4R4MA 2K9JA 1NVOA 5KLVD 2Q7CA 3AEDC 2XDJA 3SWYA 5KAIE 3L72G 1XTCC 3L73E 3V2RA 4C7RA 4EIJA 4ZKPA 3A0BH 1Z56A 1GMJA 2V4HA 3TGUD 1ZR4A 1U57A 3R2PA 2WSEJ 1ZOYC 1JOCA 3N7NA 3AE8C 4WY4B 3H1JJ 5E79E 3HD7B 1QVFO 1PGJA 3H1LE 2QJPB 3AEBC 2YMYA 5B5EH 1LWUC 1LTJC 5KLVK 3A2AA 1J2JB 1EZVI 3O6QB 2M0BA 1L4AD 2BCCE 4IL6E 1RF1B 3BCCJ 4DT0A 2Z4EA 4H0LC 3CMEP 2B9BA 2LKMA 1VL2A 2IYOA 2P7JA 2XU6A 3C9IA 1DX7A 1S3JA 4LC1A 1FZAA 3CMAP 1AVOA 3IN6A 1AV1A 1J1DB 1NU1G 2JWAA 2ZYDA 1VQMP 3K5BA 2P2UA 1PZQA 2K9YA 3GMAA 3L75D 2NZ2A 1KV4A 1USDA 2IZ1A 1Q82Q 4OH8B 2IPPA 1LT9C 1RQUA 1BGYJ 2J5UA 3BASA 1OMIA 3CCSP 5L8RJ 1EDJA 1GDTA 1KFMA 1Y47A 2AXCA 3AECC 3T97B 1FZGA 2HFED 2B88A 2Q3EA 4PV1B 1SQVG 5APXA 1A02J 2M3BA 1HGZA 3P8CE 3U1AA 1VQNP 1LTBC 1M1JC 1FZCC 2A45H 1RE4A 4W7YA 2V7QH 4JBZA 3PH0A 2D2CC 2ZT9C 3HTKA 1M1JA 1SQPK 2E74B 2E76C 3H1JD 2W90A 5GTIH 4GODA 1SQXG 3L75G 1GL2D 4NPDA 3BVHA 3NTNA 5KLIB 1SQVK 2PAJA 3KXDA 3OJAB 3NFQA 1NTZD 1SQPD 1NWQA 2ZT9D 3S4RA 3H1HD 1GTWA 1FE6A 1Q2NA 3WUVA 4D6TJ 3P7KA 1NJIQ 1KILE 2WVRA 3ITKA 4D6TE 1NYHA 4H44D 3M0AA 2YO2A 4H44C 5CCGD 2WSSH 1H8AA 1HGVA 3GF3A 3H1LJ 3A0HH 3MUDC 3V5BA 2WPSA 3C8VA 1SVFA 2FFDA 1RF0C 3TDKA 1NTME 1VF5D 3L72D 1T2KD 1T2KC 1ZXGA 2WSCJ 3RK2B 3II6A 4KHXA 3TGUG 3CCVP 2W6AA 2BCCD 1FZEA 1OW8A 4ZKUA 3C1LA 4XFJA 3CX5D 4PD4I 2E76D 1NAYA 3AEFC 4JYCA 3AEAC 3RL0C 1VQ6P 1WMKA 3RL0D 3MIWA 4WBAA 1SQQJ 4W80A 1BDCA 4OGQC 3P8MC 2Q3IA 3F5HA 1NU1K 1P84I 1T6AA 1UIXA 1SQQG 1SQBG 2HODA 1P84H 3BATA 3HUSB 1KC8Q 3AEGC 1JY3P 3AE1C 1QVGO 3P32A 3HE4B 1L0LG 1EC5A 1L0ND 2RMZA 2P67A 1J1EB 2RH0A 3H32A 4GIFA 4HJGH 3V4WA 3GG2A 5CCHA 2FYZA 1Q86Q 2IX7C 2KYVA 3H1ID 1KILC 1SFCD 1BCCJ 1KILB 2Q5UA 2W27A 1L2PA 3LW5H 3P8CD 4I7ZC 1SQQD 3TK1A 1KYOI 4OGQD 4ASWA 3B5NB 2NRGA 1LTTC 3FXEA 1P84E 1S9KD 3CX5H 1YJ9P 1H0TA 2XNXA 5M1BA 4PJ0E 4LGDE 2QRXA 1LT9B 4TLFA 3RBZA 3Q1MA 3LIEA 1K04A 3L73G 1VQ9P 1GW4A 2CK3H 1SQBK 3ZDMA 1SQQK 1AJYA 3AE4C 2R5BA 4Y28J 4RESB 1ZMEC 3KZIE 3JCUH 1NTZE 2IBZG 1OVVA 3H1HE 1ZRTD 1NO4A 3M06A 1OZHA 2IFNA 3MUDA 2YKPA 3HUSC 4OWFA 3A7OA 1PGOA 4N3YB 1RF0A 4RJTA 2FFDB 2C9LY 3CD6P 5AVUB 1ZN5A 1RY3A 1Q81Q 2Y0CA 1LT1A 1SQXD 1FS0E 3L4FA 3KYQA 4GDOA 2E75B 1JY2P 2WPQA 2XZRA 4IL6X 4KJMA 3GW6A 3L72E 4N78D 3USSA 3GHGB 1YJNP 1NGMB 2JKVA 2ZYGA 3VP8A 3H1KE 3L36A 2KXPB 3U59A 1AQTA 4U3FE 5KLVJ 2YIUB 3RK2C 3L70E 3CX5E 2WT7B 1FZBA 2KS1B 4ZNCA 2H43A 2B87B 2FXMA 4BRYB 2D2CB 2FYUE 3H6PA 3HRNA 1L0LJ 5AVZB 4YTPC 4CPGA 3TNUB 2UWJE 3B71A 1QL1A 5APQA 4EDFA 1M1KQ 1HBWA 3H1LD 2ZJSE 5APVA 2FKWB 4H13D 4UB8E 1VF5C 3G3ZA 4N6JA 1BE3G 3V2QA 2JR8A 3GF7A 1SFCA 3L71G 2IYPA 2O1JA 5AVWB 2QJPC 4EYYQ 1IFPA 1L0NE 4GKGA 1IFDA 3KHUA 3PHLA 2QM7A 3H1IE 1TU3F 2O01H 4IOIH 3U1CA 5CCHC 1PPJG 3R4YA 2OGUA 1EZVG 2QJYB 3TGUJ 1NTMJ 1AA0A 2HODB 5KJ7A 2E74C 3HUSA 2A06D 1S9KE 2Z5HA 5CJ4A 2OQQA 2KZIA 1FZCB 3VMYA 1IFIA 2HYNA 1BE3D 2AEJA 3JSVC 4HYTB 1VQ8P 2G8YA 3MP7B 1N2DC 4C7NA 1E79H 2GM4A 1GU4A 1XTGB 1PGPA 2A06G 4AUWA 1HF9A 3H32B 1JTHA 1L0LD 1NTKE 1ZRTE 3PJSK 1LTJA 2OARA 5H2FH 4DCKA 2QE7H 1FU1A 3EWKA 5B5EE 1FOSE 2SPZA 1CI6A 3L75J 1LWUB 4WWIA 2Q9IA 1FC2C 2FYNC 4K35A 1KYOD 1NOHA 1H0TB 2FYUG 2Q6QA 3MTUE 1EDLA 1Y8AA 2N1TC 2VRSA 1L0LK 2MJZA 2BEQD 2QM8A 2KS1A 2PP6A 3W68A 5APYA 1GL2C 3CCJP 2E42A 4ZMDA 3H1KG 1QX8A 3L70D 1J1DC 1KQSO 1VQ4P 3QWOC 1SQVJ 3AE5C 1PP9E 2DW3A 2ITAA 2FYUD 2NPSB 3L35A 1Q90D 3HD7C 2ZXXA 4R4LA 1M1JB 2QG4A 1YIJP 2IBZD 2Z5IA 5C39A 4IFFA 1HJBA 1FZFA 3PRJA 2N9YB 1YBKA 2NPSA 3VMAA 2R3SA 3Q5SA 1LNQA 1K9MQ 2HPCB 3CPWO 1OIPA 2GUSA 3IFMA 3KPEA 4L73A 1NU1J 5AW9B 1SLQA 1GK4A 2ZVNB 3A5TA 1JNMA 3AE2C 1JY2N 1OFCX 3OW2O 1K8AQ 2OYHA 2KNCA 1JUNA 1GL2A 3BCCG 2ZFCA 1SS1A 5APUA 1MUUA 1FDOA 3MD0A 1EDKA 2A06E 2M3EA 2AEMA 2LR2A 1U7MA 2PFXA 2ZYAA 4JYBA 1KB9E 1NAFA 1NTZG 4H0LD 1MV8A 3V2PA 4BWNA 2M8RA 1IJDB 1N7SC 3B4SA 5GTHH 2CPBA 2QA4P 1PPJD 1EXJA 2OTKE 1K05A 1N73C 3PLNA 1FDMA 2Q1KA 4GOEA 1OVRA 2KI7B 2W6BA 3Q5RA 2K37A 4QMAA 4PD4E 1H89A 2K9JB 3CCMP 4DOJA 1L4AB 2H7HA 1ZR2A 5KKZB 5KKZC 4N78E 2P58A 1L0LE 1T8ZA 1NTKD 1NKNA 3CWBG 4YPCA 4EI2A 1Q7YQ 2E43A 1KB9H 2HR3A 1KB9I 2M5AA 1OWAA 2WSEH 3H1HG 1VF5B 2KSEA 2ZXEB 3HD7A 2GUVA 5APWA 1PP9G 3RK2D 1KYOE 4KT0J 4RKUJ 3RBXA 1URQC 3CI9A 1LTIC 1URQD 2W6JH 1NTKK 1OXZA 1R5LA 3TSIA 4U7JA 4D6TD 1LP1B 2C0XA 2FBWC 1H88A 2KZJA 5H2FE 1UIIA 3FWNA 1USEA 4GT1A 3F89A 2POHA 4L74A 3VN0A 2C9NY 1PP9D 3T97A 1M8OB 2O01N 3RL0g 1SQVE 5KJ7D 2RN0A 3E1RA 3I5CA 4Y99B 4NPEA 5KTBA 2FYNB 3VP9A 3TNUA 1JCDA 3HE5A 2O01J 4L75A 1JMMA 2LXBA 3CC4P 1G1JA 1G2CA 3RK3D 1GK6A 1R8EA 3IF4A 3CC7P 4H44B 1L4AA 1OW7A 3H1IJ 1GL2B 1KMIZ 3H1KD 3CXHH 4UB6E 3CCQP 3Q5PA 3A0BE 1DD4A 1SQBJ 4U3FD 2N1TB 4TT3H 2AXTH 2PGDA 3L71E 3L74G 1GD2E 2FY8A 1BE3J 5CMZA 1AQ5A 1FZCA 3VYIA 1VQKP 3O6QA 2E5YA 1NTKJ 1ZLLA 4O9BA 1KORA 5AVQB 4AYCA 5CCGA 3D6YA 3BRVB 2FXOA 1CZQA 1JO5A 2R5DA 1KN7A 2KNCB 2L5GB 3RK3C 5APTA 4I6MC 1NH4A 1OW6A 2E75C 1X8YA 2AEFA 3WU2H 1W2EA 3H1JG 3V2NA 2OYHB 3G9RA 1IO4A 3CXHD 4I7ZB 1KFNA 3GHGA 3PP5A 1JCCA 1N7SB 1NU1E 3BRTB 4PD4D 3TYYA 3AE3C 3I56P 1NHLA 3HD7D 2NPSC 1QL2A 1IFMA 3MHVA 2HLOA 5AVTB 5CBNA 1S1CX 2KLVA 2Y9ZA 4D6TG 3CWBE 1JY2O 1LTGC 2BCCG 1GZLA 3M9QA 1DD3A 3PTZA 3SFDC 1RHZB 2WMMA 4XE5B 2WSCH 1YITP 2MKVA 1QGKB 1N8RQ 1IC2A 1X9VA 3KZIH 5DJTB 4U3FG 1BE3E 2O1KA 3GLMA 4PD4H 2JO1A 2ZVOB 3B5NC 1HVVA 5CCHD 2YXRB 1YHQP 2HPCA 1SFCC 2A45I 2Y0EA 3HE5B 1G1IA 1SQVD 4L76A 4UB8H 3UIAA 1YJWP 1DH3A 2YMKA 2V7QJ 2BASA 3FX0A 2OYIA 1NTZK 3G4SP 1AFOA 1VQLP 2QIWA 1BCCG 2YIUC 4HKZH 3RK3E 3IR9A 1KTMA 5AW4B 3FGAD 2L91A 1JM0A 3NMDA 3D70A 2H88C 1RH5B 3N4XA 2B89A 5CBOA 3L71D 2KUBA 3L37A 2E74D 1L0NK 2KSJA 1IZNB 1T3UA 2ZAEB 3CX5I 3EFFK 3M9BA 4JQ0D 4K3AA 5E79H 5AW6B 3KDPB 3S9OA 3VOPA 1N7LA 2IBZE 3LIDA 3L74J 3W67A 2Y0DA 5AVYB 5B66E 1LTSC 1M56D 1RQVA 2A45G 4WY4D 1MFTA 3TF5A 2FFDC 4IFMA 4XA4A 5AW3B 1J1EC 1PL5A 4EOTA 1X79B 3M91A 1VQPP 5TJHA 2N1TA 5AVSB 1DEBA 2B87A 2E75D 1BCCD 1JY3O 2HG5D 4JPZB 1YI2P 3BCCD 1MZ9A 3CXHE 5CCGC 2JEEA 1NU1D 1GW3A 1YTZI 4UB6H 4AQRD 5EFWB 1S5LH 2C0WA 1PV3A 2RKLA 2OYHC 3H25A 3E7KA 2AXTE 4GOFA 3CWBD 3CCRP 5BU8B 3I55P 2QJYC 3M0DA 3RGUA 1KB9D 4WB4A 3B8EB 3GHGC 1RE3C 1PPJE 1N7SA 1LP1A 3RL0B 2QSIA 4IFDK 5APSA 2IFMA 1KILA 1N73A 1LGHB 4U3FJ 4NPFX 4PV1D 5AVRB 4YXDC 1CSBA 2NPSD 1IFNA 1N86A 1ZW0A 1BSNA 2WPRA 1FOSF 4OVNF 2OTJP 1MKMA
chains in the Genus database with same CATH topology
1SQPD 4RJTA 3KHUA 3PHLA 3H1HD 3L75D 1KYOD 1SQBD 1NTMD 2RMZA 1L0ND 5TJHA 2QJKB 1P84D 1SQXD 2Y0CA 3FWLA 3ITKA 1BCCD 2KNCB 2Y0EA 2QJYB 2KS1A 3GG2A 5KLVD 1SQVD 3BCCD 3H1ID 3GW6A 1NU1D 1BGYD 1PP9D 2A06D 2Q3EA 1SQQD 3TGUD 3L70D 3L73D 4A7PA 2RN0A 1PPJD 3CXHD 3TDKA 4PD4D 3L72D 3PLNA 2YIUB 2FYUD 2FYNB 2QJPB 3CWBD 2BCCD 2QG4A 1BE3D 2IBZD 2K9JB 1KB9D 2L91A 3L74D 3CX5D 2N9YB 3PRJA 5KKZB 1NTKD 3PTZA 3L71D 3VMAA 3H1KD 3H1JD 4EDFA 4U3FD 3H1LD 1L0LD 5KLIB 1EZVD 4D6TD 2JWAA 1ZRTD 2Y0DA 3TF5A 2O3JA 1NTZD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQP D;  4RJT A;  3KHU A;  3PHL A;  3H1H D;  3L75 D;  1KYO D;  1SQB D;  1NTM D;  2RMZ A;  1L0N D;  5TJH A;  2QJK B;  1P84 D;  1SQX D;  2Y0C A;  3FWL A;  3ITK A;  1BCC D;  2KNC B;  2Y0E A;  2QJY B;  2KS1 A;  3GG2 A;  5KLV D;  1SQV D;  3BCC D;  3H1I D;  3GW6 A;  1NU1 D;  1BGY D;  1PP9 D;  2A06 D;  2Q3E A;  1SQQ D;  3TGU D;  3L70 D;  3L73 D;  4A7P A;  2RN0 A;  1PPJ D;  3CXH D;  3TDK A;  4PD4 D;  3L72 D;  3PLN A;  2YIU B;  2FYU D;  2FYN B;  2QJP B;  3CWB D;  2BCC D;  2QG4 A;  1BE3 D;  2IBZ D;  2K9J B;  1KB9 D;  2L91 A;  3L74 D;  3CX5 D;  2N9Y B;  3PRJ A;  5KKZ B;  1NTK D;  3PTZ A;  3L71 D;  3VMA A;  3H1K D;  3H1J D;  4EDF A;  4U3F D;  3H1L D;  1L0L D;  5KLI B;  1EZV D;  4D6T D;  2JWA A;  1ZRT D;  2Y0D A;  3TF5 A;  2O3J A;  1NTZ D; 
#chains in the Genus database with same CATH topology
 2OYI C;  1KYO H;  1IK7 A;  1HJ0 A;  1SQB D;  2KOG A;  3WUT A;  1IFJ A;  1KD1 Q;  1LT9 A;  2I1K A;  1BDD A;  4BXL A;  2W8Z A;  2QVA A;  5K5G B;  2YXQ B;  4C46 A;  2OYI B;  3B5N A;  1FAV A;  2XV5 A;  1FJK A;  2I1J A;  4LLH A;  1M7L A;  3CCL P;  1KQL A;  1NTZ J;  1S5L E;  1ZV8 A;  2GA1 A;  1RE3 A;  1S5L X;  1SQX K;  2WPV B;  1BGY G;  2ZT9 B;  3G71 P;  5KLV G;  1JY3 N;  5KLI C;  1VPC A;  1ZP0 C;  2M5A B;  2WWW A;  2JJL A;  2YKQ A;  3L74 E;  3A0H E;  4H0L B;  1PGQ A;  1FBM A;  3QH9 A;  1EZV D;  1L0N J;  4I1L A;  1RF1 C;  5AW7 B;  3D6Z A;  1LTJ B;  4ASV A;  2K1A A;  1FDI A;  1OVU A;  2O3J A;  1VQ5 P;  3CLQ A;  4B86 A;  1BCC E;  4WY4 C;  5CHX A;  4C7N B;  3AE9 C;  4Z1M H;  3MGN A;  3BCC E;  1W2B O;  4RO0 A;  3Q3D A;  2R44 A;  2JWD A;  2KIK A;  5B66 H;  3CL3 D;  3E1I A;  2E76 B;  1BSH A;  1URQ A;  1BGY D;  2YNY A;  3SSU A;  4A7P A;  2FXP A;  3A3Y B;  1CI6 B;  3EFG A;  3H1J E;  3H1K J;  5AW0 B;  1URQ B;  2P1J A;  2G3A A;  3IAO A;  1U7J A;  3H1L G;  2PRR A;  3AE7 C;  3L70 G;  3L72 J;  3M0D C;  1VDF A;  4HH2 A;  4BRY A;  4YXW H;  1OX3 A;  1HH0 A;  1HWT C;  2D2C D;  1EDI A;  3O8Z A;  1NKZ B;  1SQP E;  1NTM K;  1YYC A;  3NXS A;  1M57 D;  2YKO A;  1KIL D;  1JB0 J;  1PP9 J;  1JMB A;  1SFC B;  2BEZ F;  2JP3 A;  3FXD A;  3H1H J;  2K88 A;  4H13 B;  5KJ7 C;  4OGQ B;  1SQB E;  2I8D A;  4PJ0 H;  4PV1 C;  3AEE C;  3B5N D;  1SQX J;  2KK7 A;  5CJ0 A;  3S1K A;  3D71 A;  2KP8 A;  3CWB J;  4Y99 C;  1YQ4 C;  1NTM D;  2BCC J;  2FYU K;  1KQG B;  1JTH B;  1X22 A;  2KB7 P;  2Y9Y A;  3AE6 C;  3EQ2 A;  2OTL P;  1W5C E;  2N1T D;  1PFI A;  3L70 J;  4JF7 A;  1DIP A;  5KLV E;  3KQG A;  2W83 C;  3WUU A;  3L73 D;  1IK9 A;  1AVY A;  1T3J A;  2H89 C;  5AW2 B;  1HTL C;  3TGU E;  2OYO A;  3CC2 P;  1NTM G;  1WRG A;  2WIT A;  1JEK A;  2N9B A;  3VMX A;  3G6E P;  3Q2Y A;  1LWU A;  1S2E A;  4W7Z A;  2QEX P;  1L4A C;  3L74 D;  5DJU B;  5TIS H;  1KZU B;  1R5S A;  1RE4 C;  1EZV E;  3SFE C;  3WU2 E;  5AVX B;  2R3C A;  4M3L A;  5GTI E;  2WQY C;  5KAI H;  4MN4 C;  1NTK G;  1VQO P;  1S72 P;  4H13 C;  2XKM A;  3V4Q A;  1QLE D;  3L71 J;  1N7S D;  2KLU A;  2IDB A;  5GTH E;  2WZ7 A;  1L0N G;  2XND H;  1KQF B;  1S4X A;  3SWF A;  1A02 F;  1SQQ E;  2J58 A;  3CCE P;  3H1I G;  1D7M A;  2K3R A;  3OAK A;  1LTA C;  3FWL A;  1P84 D;  2IZ0 A;  2QJK C;  5TIS E;  1BGY E;  1VQ7 P;  3L75 E;  4I2L C;  1MFZ A;  3VMZ A;  1HUC A;  3M9H A;  3VTP C;  2CPS A;  2P10 A;  4WY4 A;  5AVV B;  5AW8 B;  1QEX A;  5KAF H;  3CCU P;  1M90 Q;  1LJ2 A;  2J59 M;  2WSF J;  2WSF H;  2WT7 A;  1EXI A;  3JC2 2;  2JDI H;  3ABV C;  2IBZ I;  3HE4 A;  1FJP A;  2WTY A;  1YTZ T;  3SWK A;  1DEE G;  4HB1 A;  3WMM 0;  4IL6 H;  3RK3 B;  1N73 B;  1SP4 A;  1RF1 A;  1SQP G;  4DJG A;  2FYU J;  1G2C B;  1PIX A;  1Y9B A;  1YQ3 C;  5BU5 A;  1EQ7 A;  5AW1 B;  3V6I A;  2R32 A;  4DZO A;  5BVZ A;  1SQX E;  1GU5 A;  1X0T A;  5KAF E;  1WT6 A;  3LW5 J;  2YO3 A;  3MZW B;  3HTK B;  3JCU E;  1CW5 A;  2E5T A;  1E5W A;  3CXH I;  3OA7 A;  3L73 J;  5AW5 B;  1K73 Q;  4WVZ A;  1SQP J;  2H8P D;  2LXC B;  2QJK B;  4R4M A;  2K9J A;  1NVO A;  5KLV D;  2Q7C A;  3AED C;  2XDJ A;  3SWY A;  5KAI E;  3L72 G;  1XTC C;  3L73 E;  3V2R A;  4C7R A;  4EIJ A;  4ZKP A;  3A0B H;  1Z56 A;  1GMJ A;  2V4H A;  3TGU D;  1ZR4 A;  1U57 A;  3R2P A;  2WSE J;  1ZOY C;  1JOC A;  3N7N A;  3AE8 C;  4WY4 B;  3H1J J;  5E79 E;  3HD7 B;  1QVF O;  1PGJ A;  3H1L E;  2QJP B;  3AEB C;  2YMY A;  5B5E H;  1LWU C;  1LTJ C;  5KLV K;  3A2A A;  1J2J B;  1EZV I;  3O6Q B;  2M0B A;  1L4A D;  2BCC E;  4IL6 E;  1RF1 B;  3BCC J;  4DT0 A;  2Z4E A;  4H0L C;  3CME P;  2B9B A;  2LKM A;  1VL2 A;  2IYO A;  2P7J A;  2XU6 A;  3C9I A;  1DX7 A;  1S3J A;  4LC1 A;  1FZA A;  3CMA P;  1AVO A;  3IN6 A;  1AV1 A;  1J1D B;  1NU1 G;  2JWA A;  2ZYD A;  1VQM P;  3K5B A;  2P2U A;  1PZQ A;  2K9Y A;  3GMA A;  3L75 D;  2NZ2 A;  1KV4 A;  1USD A;  2IZ1 A;  1Q82 Q;  4OH8 B;  2IPP A;  1LT9 C;  1RQU A;  1BGY J;  2J5U A;  3BAS A;  1OMI A;  3CCS P;  5L8R J;  1EDJ A;  1GDT A;  1KFM A;  1Y47 A;  2AXC A;  3AEC C;  3T97 B;  1FZG A;  2HFE D;  2B88 A;  2Q3E A;  4PV1 B;  1SQV G;  5APX A;  1A02 J;  2M3B A;  1HGZ A;  3P8C E;  3U1A A;  1VQN P;  1LTB C;  1M1J C;  1FZC C;  2A45 H;  1RE4 A;  4W7Y A;  2V7Q H;  4JBZ A;  3PH0 A;  2D2C C;  2ZT9 C;  3HTK A;  1M1J A;  1SQP K;  2E74 B;  2E76 C;  3H1J D;  2W90 A;  5GTI H;  4GOD A;  1SQX G;  3L75 G;  1GL2 D;  4NPD A;  3BVH A;  3NTN A;  5KLI B;  1SQV K;  2PAJ A;  3KXD A;  3OJA B;  3NFQ A;  1NTZ D;  1SQP D;  1NWQ A;  2ZT9 D;  3S4R A;  3H1H D;  1GTW A;  1FE6 A;  1Q2N A;  3WUV A;  4D6T J;  3P7K A;  1NJI Q;  1KIL E;  2WVR A;  3ITK A;  4D6T E;  1NYH A;  4H44 D;  3M0A A;  2YO2 A;  4H44 C;  5CCG D;  2WSS H;  1H8A A;  1HGV A;  3GF3 A;  3H1L J;  3A0H H;  3MUD C;  3V5B A;  2WPS A;  3C8V A;  1SVF A;  2FFD A;  1RF0 C;  3TDK A;  1NTM E;  1VF5 D;  3L72 D;  1T2K D;  1T2K C;  1ZXG A;  2WSC J;  3RK2 B;  3II6 A;  4KHX A;  3TGU G;  3CCV P;  2W6A A;  2BCC D;  1FZE A;  1OW8 A;  4ZKU A;  3C1L A;  4XFJ A;  3CX5 D;  4PD4 I;  2E76 D;  1NAY A;  3AEF C;  4JYC A;  3AEA C;  3RL0 C;  1VQ6 P;  1WMK A;  3RL0 D;  3MIW A;  4WBA A;  1SQQ J;  4W80 A;  1BDC A;  4OGQ C;  3P8M C;  2Q3I A;  3F5H A;  1NU1 K;  1P84 I;  1T6A A;  1UIX A;  1SQQ G;  1SQB G;  2HOD A;  1P84 H;  3BAT A;  3HUS B;  1KC8 Q;  3AEG C;  1JY3 P;  3AE1 C;  1QVG O;  3P32 A;  3HE4 B;  1L0L G;  1EC5 A;  1L0N D;  2RMZ A;  2P67 A;  1J1E B;  2RH0 A;  3H32 A;  4GIF A;  4HJG H;  3V4W A;  3GG2 A;  5CCH A;  2FYZ A;  1Q86 Q;  2IX7 C;  2KYV A;  3H1I D;  1KIL C;  1SFC D;  1BCC J;  1KIL B;  2Q5U A;  2W27 A;  1L2P A;  3LW5 H;  3P8C D;  4I7Z C;  1SQQ D;  3TK1 A;  1KYO I;  4OGQ D;  4ASW A;  3B5N B;  2NRG A;  1LTT C;  3FXE A;  1P84 E;  1S9K D;  3CX5 H;  1YJ9 P;  1H0T A;  2XNX A;  5M1B A;  4PJ0 E;  4LGD E;  2QRX A;  1LT9 B;  4TLF A;  3RBZ A;  3Q1M A;  3LIE A;  1K04 A;  3L73 G;  1VQ9 P;  1GW4 A;  2CK3 H;  1SQB K;  3ZDM A;  1SQQ K;  1AJY A;  3AE4 C;  2R5B A;  4Y28 J;  4RES B;  1ZME C;  3KZI E;  3JCU H;  1NTZ E;  2IBZ G;  1OVV A;  3H1H E;  1ZRT D;  1NO4 A;  3M06 A;  1OZH A;  2IFN A;  3MUD A;  2YKP A;  3HUS C;  4OWF A;  3A7O A;  1PGO A;  4N3Y B;  1RF0 A;  4RJT A;  2FFD B;  2C9L Y;  3CD6 P;  5AVU B;  1ZN5 A;  1RY3 A;  1Q81 Q;  2Y0C A;  1LT1 A;  1SQX D;  1FS0 E;  3L4F A;  3KYQ A;  4GDO A;  2E75 B;  1JY2 P;  2WPQ A;  2XZR A;  4IL6 X;  4KJM A;  3GW6 A;  3L72 E;  4N78 D;  3USS A;  3GHG B;  1YJN P;  1NGM B;  2JKV A;  2ZYG A;  3VP8 A;  3H1K E;  3L36 A;  2KXP B;  3U59 A;  1AQT A;  4U3F E;  5KLV J;  2YIU B;  3RK2 C;  3L70 E;  3CX5 E;  2WT7 B;  1FZB A;  2KS1 B;  4ZNC A;  2H43 A;  2B87 B;  2FXM A;  4BRY B;  2D2C B;  2FYU E;  3H6P A;  3HRN A;  1L0L J;  5AVZ B;  4YTP C;  4CPG A;  3TNU B;  2UWJ E;  3B71 A;  1QL1 A;  5APQ A;  4EDF A;  1M1K Q;  1HBW A;  3H1L D;  2ZJS E;  5APV A;  2FKW B;  4H13 D;  4UB8 E;  1VF5 C;  3G3Z A;  4N6J A;  1BE3 G;  3V2Q A;  2JR8 A;  3GF7 A;  1SFC A;  3L71 G;  2IYP A;  2O1J A;  5AVW B;  2QJP C;  4EYY Q;  1IFP A;  1L0N E;  4GKG A;  1IFD A;  3KHU A;  3PHL A;  2QM7 A;  3H1I E;  1TU3 F;  2O01 H;  4IOI H;  3U1C A;  5CCH C;  1PPJ G;  3R4Y A;  2OGU A;  1EZV G;  2QJY B;  3TGU J;  1NTM J;  1AA0 A;  2HOD B;  5KJ7 A;  2E74 C;  3HUS A;  2A06 D;  1S9K E;  2Z5H A;  5CJ4 A;  2OQQ A;  2KZI A;  1FZC B;  3VMY A;  1IFI A;  2HYN A;  1BE3 D;  2AEJ A;  3JSV C;  4HYT B;  1VQ8 P;  2G8Y A;  3MP7 B;  1N2D C;  4C7N A;  1E79 H;  2GM4 A;  1GU4 A;  1XTG B;  1PGP A;  2A06 G;  4AUW A;  1HF9 A;  3H32 B;  1JTH A;  1L0L D;  1NTK E;  1ZRT E;  3PJS K;  1LTJ A;  2OAR A;  5H2F H;  4DCK A;  2QE7 H;  1FU1 A;  3EWK A;  5B5E E;  1FOS E;  2SPZ A;  1CI6 A;  3L75 J;  1LWU B;  4WWI A;  2Q9I A;  1FC2 C;  2FYN C;  4K35 A;  1KYO D;  1NOH A;  1H0T B;  2FYU G;  2Q6Q A;  3MTU E;  1EDL A;  1Y8A A;  2N1T C;  2VRS A;  1L0L K;  2MJZ A;  2BEQ D;  2QM8 A;  2KS1 A;  2PP6 A;  3W68 A;  5APY A;  1GL2 C;  3CCJ P;  2E42 A;  4ZMD A;  3H1K G;  1QX8 A;  3L70 D;  1J1D C;  1KQS O;  1VQ4 P;  3QWO C;  1SQV J;  3AE5 C;  1PP9 E;  2DW3 A;  2ITA A;  2FYU D;  2NPS B;  3L35 A;  1Q90 D;  3HD7 C;  2ZXX A;  4R4L A;  1M1J B;  2QG4 A;  1YIJ P;  2IBZ D;  2Z5I A;  5C39 A;  4IFF A;  1HJB A;  1FZF A;  3PRJ A;  2N9Y B;  1YBK A;  2NPS A;  3VMA A;  2R3S A;  3Q5S A;  1LNQ A;  1K9M Q;  2HPC B;  3CPW O;  1OIP A;  2GUS A;  3IFM A;  3KPE A;  4L73 A;  1NU1 J;  5AW9 B;  1SLQ A;  1GK4 A;  2ZVN B;  3A5T A;  1JNM A;  3AE2 C;  1JY2 N;  1OFC X;  3OW2 O;  1K8A Q;  2OYH A;  2KNC A;  1JUN A;  1GL2 A;  3BCC G;  2ZFC A;  1SS1 A;  5APU A;  1MUU A;  1FDO A;  3MD0 A;  1EDK A;  2A06 E;  2M3E A;  2AEM A;  2LR2 A;  1U7M A;  2PFX A;  2ZYA A;  4JYB A;  1KB9 E;  1NAF A;  1NTZ G;  4H0L D;  1MV8 A;  3V2P A;  4BWN A;  2M8R A;  1IJD B;  1N7S C;  3B4S A;  5GTH H;  2CPB A;  2QA4 P;  1PPJ D;  1EXJ A;  2OTK E;  1K05 A;  1N73 C;  3PLN A;  1FDM A;  2Q1K A;  4GOE A;  1OVR A;  2KI7 B;  2W6B A;  3Q5R A;  2K37 A;  4QMA A;  4PD4 E;  1H89 A;  2K9J B;  3CCM P;  4DOJ A;  1L4A B;  2H7H A;  1ZR2 A;  5KKZ B;  5KKZ C;  4N78 E;  2P58 A;  1L0L E;  1T8Z A;  1NTK D;  1NKN A;  3CWB G;  4YPC A;  4EI2 A;  1Q7Y Q;  2E43 A;  1KB9 H;  2HR3 A;  1KB9 I;  2M5A A;  1OWA A;  2WSE H;  3H1H G;  1VF5 B;  2KSE A;  2ZXE B;  3HD7 A;  2GUV A;  5APW A;  1PP9 G;  3RK2 D;  1KYO E;  4KT0 J;  4RKU J;  3RBX A;  1URQ C;  3CI9 A;  1LTI C;  1URQ D;  2W6J H;  1NTK K;  1OXZ A;  1R5L A;  3TSI A;  4U7J A;  4D6T D;  1LP1 B;  2C0X A;  2FBW C;  1H88 A;  2KZJ A;  5H2F E;  1UII A;  3FWN A;  1USE A;  4GT1 A;  3F89 A;  2POH A;  4L74 A;  3VN0 A;  2C9N Y;  1PP9 D;  3T97 A;  1M8O B;  2O01 N;  3RL0 g;  1SQV E;  5KJ7 D;  2RN0 A;  3E1R A;  3I5C A;  4Y99 B;  4NPE A;  5KTB A;  2FYN B;  3VP9 A;  3TNU A;  1JCD A;  3HE5 A;  2O01 J;  4L75 A;  1JMM A;  2LXB A;  3CC4 P;  1G1J A;  1G2C A;  3RK3 D;  1GK6 A;  1R8E A;  3IF4 A;  3CC7 P;  4H44 B;  1L4A A;  1OW7 A;  3H1I J;  1GL2 B;  1KMI Z;  3H1K D;  3CXH H;  4UB6 E;  3CCQ P;  3Q5P A;  3A0B E;  1DD4 A;  1SQB J;  4U3F D;  2N1T B;  4TT3 H;  2AXT H;  2PGD A;  3L71 E;  3L74 G;  1GD2 E;  2FY8 A;  1BE3 J;  5CMZ A;  1AQ5 A;  1FZC A;  3VYI A;  1VQK P;  3O6Q A;  2E5Y A;  1NTK J;  1ZLL A;  4O9B A;  1KOR A;  5AVQ B;  4AYC A;  5CCG A;  3D6Y A;  3BRV B;  2FXO A;  1CZQ A;  1JO5 A;  2R5D A;  1KN7 A;  2KNC B;  2L5G B;  3RK3 C;  5APT A;  4I6M C;  1NH4 A;  1OW6 A;  2E75 C;  1X8Y A;  2AEF A;  3WU2 H;  1W2E A;  3H1J G;  3V2N A;  2OYH B;  3G9R A;  1IO4 A;  3CXH D;  4I7Z B;  1KFN A;  3GHG A;  3PP5 A;  1JCC A;  1N7S B;  1NU1 E;  3BRT B;  4PD4 D;  3TYY A;  3AE3 C;  3I56 P;  1NHL A;  3HD7 D;  2NPS C;  1QL2 A;  1IFM A;  3MHV A;  2HLO A;  5AVT B;  5CBN A;  1S1C X;  2KLV A;  2Y9Z A;  4D6T G;  3CWB E;  1JY2 O;  1LTG C;  2BCC G;  1GZL A;  3M9Q A;  1DD3 A;  3PTZ A;  3SFD C;  1RHZ B;  2WMM A;  4XE5 B;  2WSC H;  1YIT P;  2MKV A;  1QGK B;  1N8R Q;  1IC2 A;  1X9V A;  3KZI H;  5DJT B;  4U3F G;  1BE3 E;  2O1K A;  3GLM A;  4PD4 H;  2JO1 A;  2ZVO B;  3B5N C;  1HVV A;  5CCH D;  2YXR B;  1YHQ P;  2HPC A;  1SFC C;  2A45 I;  2Y0E A;  3HE5 B;  1G1I A;  1SQV D;  4L76 A;  4UB8 H;  3UIA A;  1YJW P;  1DH3 A;  2YMK A;  2V7Q J;  2BAS A;  3FX0 A;  2OYI A;  1NTZ K;  3G4S P;  1AFO A;  1VQL P;  2QIW A;  1BCC G;  2YIU C;  4HKZ H;  3RK3 E;  3IR9 A;  1KTM A;  5AW4 B;  3FGA D;  2L91 A;  1JM0 A;  3NMD A;  3D70 A;  2H88 C;  1RH5 B;  3N4X A;  2B89 A;  5CBO A;  3L71 D;  2KUB A;  3L37 A;  2E74 D;  1L0N K;  2KSJ A;  1IZN B;  1T3U A;  2ZAE B;  3CX5 I;  3EFF K;  3M9B A;  4JQ0 D;  4K3A A;  5E79 H;  5AW6 B;  3KDP B;  3S9O A;  3VOP A;  1N7L A;  2IBZ E;  3LID A;  3L74 J;  3W67 A;  2Y0D A;  5AVY B;  5B66 E;  1LTS C;  1M56 D;  1RQV A;  2A45 G;  4WY4 D;  1MFT A;  3TF5 A;  2FFD C;  4IFM A;  4XA4 A;  5AW3 B;  1J1E C;  1PL5 A;  4EOT A;  1X79 B;  3M91 A;  1VQP P;  5TJH A;  2N1T A;  5AVS B;  1DEB A;  2B87 A;  2E75 D;  1BCC D;  1JY3 O;  2HG5 D;  4JPZ B;  1YI2 P;  3BCC D;  1MZ9 A;  3CXH E;  5CCG C;  2JEE A;  1NU1 D;  1GW3 A;  1YTZ I;  4UB6 H;  4AQR D;  5EFW B;  1S5L H;  2C0W A;  1PV3 A;  2RKL A;  2OYH C;  3H25 A;  3E7K A;  2AXT E;  4GOF A;  3CWB D;  3CCR P;  5BU8 B;  3I55 P;  2QJY C;  3M0D A;  3RGU A;  1KB9 D;  4WB4 A;  3B8E B;  3GHG C;  1RE3 C;  1PPJ E;  1N7S A;  1LP1 A;  3RL0 B;  2QSI A;  4IFD K;  5APS A;  2IFM A;  1KIL A;  1N73 A;  1LGH B;  4U3F J;  4NPF X;  4PV1 D;  5AVR B;  4YXD C;  1CSB A;  2NPS D;  1IFN A;  1N86 A;  1ZW0 A;  1BSN A;  2WPR A;  1FOS F;  4OVN F;  2OTJ P;  1MKM A; 
#chains in the Genus database with same CATH homology
 1SQP D;  4RJT A;  3KHU A;  3PHL A;  3H1H D;  3L75 D;  1KYO D;  1SQB D;  1NTM D;  2RMZ A;  1L0N D;  5TJH A;  2QJK B;  1P84 D;  1SQX D;  2Y0C A;  3FWL A;  3ITK A;  1BCC D;  2KNC B;  2Y0E A;  2QJY B;  2KS1 A;  3GG2 A;  5KLV D;  1SQV D;  3BCC D;  3H1I D;  3GW6 A;  1NU1 D;  1BGY D;  1PP9 D;  2A06 D;  2Q3E A;  1SQQ D;  3TGU D;  3L70 D;  3L73 D;  4A7P A;  2RN0 A;  1PPJ D;  3CXH D;  3TDK A;  4PD4 D;  3L72 D;  3PLN A;  2YIU B;  2FYU D;  2FYN B;  2QJP B;  3CWB D;  2BCC D;  2QG4 A;  1BE3 D;  2IBZ D;  2K9J B;  1KB9 D;  2L91 A;  3L74 D;  3CX5 D;  2N9Y B;  3PRJ A;  5KKZ B;  1NTK D;  3PTZ A;  3L71 D;  3VMA A;  3H1K D;  3H1J D;  4EDF A;  4U3F D;  3H1L D;  1L0L D;  5KLI B;  1EZV D;  4D6T D;  2JWA A;  1ZRT D;  2Y0D A;  3TF5 A;  2O3J A;  1NTZ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...