2KS1A

Heterodimeric association of transmembrane domains of erbb1 and erbb2 receptors enabling kinase activation
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
GCPAEQRASPLTSIISAVVGILLVVVLGVVFGILIKRRQQKIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Spatial Structure of the Transmembrane Domain Heterodimer of ErbB1 and ErbB2 Receptor Tyrosine Kinases
pubmed doi rcsb
molecule keywords Receptor tyrosine-protein kinase erbB-2
molecule tags Transferase
source organism Homo sapiens
total genus 12
structure length 44
sequence length 44
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2ks1A00
1PP9D 2IBZD 3KHUA 1KYOD 2A06D 3BCCD 1BCCD 2K9JB 3CXHD 1NU1D 2FYUD 1SQXD 2FYNB 4D6TD 1P84D 2KNCB 3H1HD 1SQQD 2N9YB 3L74D 2Y0DA 3L71D 2BCCD 3L73D 3ITKA 3PHLA 2QG4A 3H1JD 2O3JA 2RMZA 3H1LD 2QJYB 2YIUB 3L72D 3FWLA 3CX5D 3GG2A 3TGUD 1BE3D 1NTMD 3GW6A 5KLIB 3VMAA 3L75D 1SQPD 5KKZB 2QJPB 1SQBD 2L91A 1NTKD 1NTZD 1ZRTD 2Y0CA 1KB9D 3TF5A 4A7PA 3H1ID 2Y0EA 4U3FD 2KS1A 3TDKA 4RJTA 1BGYD 4EDFA 2RN0A 1L0LD 3H1KD 3PRJA 5TJHA 2JWAA 3CWBD 1L0ND 3PLNA 3L70D 3PTZA 1PPJD 5KLVD 1EZVD 2QJKB 2Q3EA 4PD4D 1SQVD
chains in the Genus database with same CATH superfamily
1NTMK 2IBZD 3KHUA 1Y47A 1GTWA 5CCHD 2P58A 2Y9YA 5DJTB 1NVOA 3CCLP 1W5CE 2Z4EA 3Q2YA 1BE3G 3B5ND 1BGYG 5KJ7D 2ZYAA 1MV8A 3RL0g 2FYNB 1S1CX 1J1EB 2BEZF 4JQ0D 3H1KE 3HD7C 1Q86Q 1OFCX 1VQNP 1NTKE 4Y99B 5APUA 2RMZA 2R44A 3P8CE 3HE4B 3SFDC 2I8DA 1KORA 1L0LJ 1M56D 1NJIQ 5APSA 1AVYA 2JDIH 5B66E 2CK3H 2FKWB 2ZXXA 4OGQD 1PPJE 2WT7A 3VN0A 1PGOA 1L4AB 3MUDA 1KYOH 2H8PD 1VF5B 2W6BA 1N73B 3L73E 4AUWA 2YO3A 4OVNF 2V7QJ 5AW0B 4C46A 5AVZB 2QJKB 3G6EP 1P84H 4IL6E 1RQUA 3II6A 3B8EB 2WPSA 1M90Q 4M3LA 4PD4D 2GUSA 2B87B 1LTSC 2NRGA 3L72G 1JTHB 4LLHA 1OX3A 2W83C 3E1RA 2VRSA 2FFDA 3AE9C 3M0DC 1ZW0A 2XDJA 1E79H 2GUVA 2H43A 1M1JB 1WRGA 1YJWP 1SQBE 1H8AA 1USDA 3N7NA 2KI7B 2POHA 1LJ2A 1EZVE 4NPEA 4C7RA 2AXCA 2YIUB 3BRTB 2FYZA 3HE5A 4GDOA 4I7ZC 1RF0C 1NKZB 5B5EE 5GTIH 2ZVOB 5KKZB 2E76B 3H25A 3RK3E 3V2QA 1JNMA 2YKQA 3T97B 1FC2C 3AEAC 1R5SA 1HVVA 5AW2B 1SQQK 1PGPA 3K5BA 4I1LA 3L70J 1OVUA 1X9VA 4WY4C 2JWAA 3L70D 2WMMA 4H0LB 4C7NB 4D6TG 2WSFJ 3WUTA 1YIJP 3IN6A 2ZAEB 1KILB 1GU5A 1GL2C 3JC22 2QM8A 5K5GB 2J59M 3BCCJ 1N7SA 2O01N 3CX5H 1NYHA 3BCCD 2KZIA 1ZOYC 3RBZA 1BE3E 1BGYE 2N1TB 4DCKA 1HJ0A 4XA4A 1KB9H 1KILE 4K35A 1PIXA 1RH5B 2A45G 4UB8H 2O3JA 3A0HH 1NH4A 2KYVA 3KPEA 1LWUA 3TNUB 2IPPA 5CCHA 2Q9IA 1KB9I 2K37A 3WMM0 4ASWA 1L0NG 5GTHH 5AW9B 3B5NA 5KLIB 5KLVG 1PL5A 1QL1A 1NTZJ 1OW8A 5KJ7A 1KYOE 2L91A 2H7HA 1NTZD 4BRYA 1FZAA 1JB0J 1LTJB 5AVYB 2A45H 2D2CB 4NPDA 1SQQG 4L74A 3S9OA 1Y8AA 1Q7YQ 3U1CA 3CMEP 2BCCG 2E74D 2KSEA 1P84E 2JJLA 4H44D 2A06G 4GOEA 2HPCB 1EXIA 5KAIE 1SQXJ 1JCCA 2DW3A 3NFQA 3CPWO 1EXJA 3AE1C 1T3UA 3H1IG 1N73C 1OZHA 3L72E 1IO4A 4RKUJ 2LKMA 3TGUE 1HUCA 3HD7B 2QJKC 1FZCA 3HUSA 3ABVC 5GTIE 3PHLA 5C39A 3GF7A 1IFNA 1JY2P 1N7LA 1IC2A 1OVVA 3SFEC 2IBZG 4JF7A 4ASVA 2WQYC 4U3FE 4L73A 4TT3H 5KAFH 3KXDA 2OYHA 1X8YA 4LC1A 3Q5RA 3C8VA 4R4MA 2KLUA 3RK3C 1PP9G 5CBOA 3LIDA 3TYYA 1Q81Q 1QX8A 3OAKA 2YIUC 2IFMA 1JUNA 3CWBJ 3PRJA 2OYIC 3C1LA 1BCCG 3VMZA 1VQ6P 3WU2E 1FZFA 3CWBD 3H32B 3M9BA 1Q2NA 2ZXEB 1T6AA 3V2PA 4CPGA 2KLVA 3JCUH 2M0BA 1LTBC 3L74J 4D6TE 4KHXA 1H88A 3L74E 3NTNA 2L5GB 1E5WA 1LP1B 1OXZA 2WTYA 2IZ0A 1SFCC 4UB8E 4BWNA 1NAYA 3L75G 1NU1D 1S72P 3A0HE 2FYUD 3H1HJ 1BDCA 1DEEG 2KNCB 1RE3C 3H1HD 3KYQA 2XU6A 1AQ5A 4RESB 4U7JA 5KTBA 2R3SA 1IFPA 1OW6A 3H1LJ 1VQ4P 1KILC 1ZV8A 4BXLA 3H1LD 1GMJA 4I7ZB 1M1KQ 3CL3D 3FWNA 3NMDA 3FWLA 4PJ0H 1SQPJ 4ZMDA 1KFNA 1SQPD 2IYPA 4XFJA 3GF3A 1L0NE 5KLVE 4IL6X 4PD4H 1LT9C 1KQSO 3O6QB 2M5AB 1N8RQ 5CHXA 4N6JA 3HTKB 1MKMA 3PJSK 1CSBA 2BCCE 3A2AA 3CLQA 2P1JA 1VL2A 3PLNA 1CI6A 3O8ZA 2A06E 3CD6P 3SSUA 1W2EA 1HTLC 5CJ0A 1LTJC 4NPFX 2NPSC 3CCEP 1GL2B 5AVSB 2LXBA 3G9RA 4WY4D 1KQFB 1CZQA 3BASA 2C0WA 1NTZK 2QM7A 1FU1A 4N3YB 3IF4A 1URQD 3H1IE 2K9JB 1U7MA 4L76A 2R5BA 3EFGA 2OQQA 2Q5UA 5BVZA 1LGHB 4IFMA 1HF9A 3C9IA 2WSEJ 5KAFE 1MFTA 4HKZH 4I6MC 2WZ7A 2M3EA 2W6JH 3RK2C 2JWDA 3H1KJ 2IBZE 2BASA 3VMYA 3BCCG 1NTKJ 4MN4C 1EDIA 1NTKD 2WSFH 3R4YA 5AW5B 1NO4A 5TISH 2AXTE 1SQVG 5CCGC 4PV1C 3TF5A 3P8CD 2P7JA 2Q3IA 1H0TB 2P2UA 5APQA 1PP9E 1ZMEC 2WVRA 4HH2A 1FDOA 2WWWA 1L0LD 2KS1B 2BEQD 1VQ8P 3N4XA 4GOFA 3MUDC 1N2DC 2RKLA 1PPJD 2OARA 1JCDA 1FZEA 1BCCE 3CXHE 3MTUE 1JO5A 3H1JG 1KV4A 2E75C 1YI2P 3L36A 3L73J 1CW5A 3EFFK 5APVA 3L71E 2QE7H 3G71P 3JSVC 1JY2O 1VQ9P 1NTMG 4K3AA 1LTIC 1D7MA 2QRXA 1FOSE 1VQLP 1L4AD 1LTTC 3VTPC 2ZFCA 3L75E 2FFDC 1VF5D 1T2KC 3ITKA 2MJZA 2YNYA 2QEXP 2YXQB 2ZYDA 2Z5HA 3VYIA 1GW4A 2WSCH 1EDLA 2HFED 4PD4E 3B4SA 1SQBJ 1Q90D 3RK3B 1SQBD 1AV1A 2H88C 1UIXA 5EFWB 1YJ9P 4UB6E 3I55P 1NU1K 3SWKA 1SS1A 1G2CA 2FYUK 2ZYGA 1YYCA 2OYIB 1NAFA 4GKGA 3IAOA 1KQLA 1RF1A 3Q3DA 2R3CA 2PGDA 3L37A 2Q3EA 1PFIA 3V6IA 3Q5SA 1JY2N 4YXDC 1EDJA 1GW3A 1SQPK 1VQ5P 1K04A 2ZT9C 4EYYQ 1SFCB 2E76D 3WUVA 4JYBA 2Q7CA 2C0XA 2PFXA 3AEFC 3ZDMA 3GHGA 1N7SC 3FGAD 1K8AQ 4H13B 1JY3O 1AJYA 1FZBA 3LIEA 3CCSP 3G3ZA 3QWOC 2JP3A 1T8ZA 4H0LD 4DZOA 5AW3B 1BE3J 1BGYJ 3CCRP 4WY4A 1S2EA 3OJAB 1BE3D 3UIAA 1S5LH 4W7YA 3A7OA 2H89C 1IZNB 1LWUC 3RL0B 1USEA 4DJGA 1URQA 2HODB 1KILD 5CCHC 1NU1G 1FE6A 5H2FH 2FYUG 1YQ4C 1LT9B 3B5NC 1AQTA 2ZJSE 3H1HG 1WMKA 1OWAA 5KJ7C 3PH0A 2ITAA 3MZWB 1SQVE 1N86A 4RJTA 2JEEA 2OTJP 1PGQA 2E5YA 2N1TD 4WB4A 1SVFA 3CCQP 4L75A 3RGUA 3V5BA 4AQRD 4HJGH 1XTGB 2NPSB 2IX7C 2I1JA 1FDMA 1VQKP 3KZIH 2QA4P 4GODA 1EQ7A 5AVXB 3H1JE 1S9KE 1NTKK 2AEMA 3S4RA 5APTA 1QL2A 1IK9A 1WT6A 1YBKA 2NPSD 2D2CD 1SQXD 1PGJA 1NTME 1XTCC 2MKVA 2N9YB 1L0LK 3PP5A 3CC4P 5APXA 1QVGO 1FZCC 3HE4A 3L72J 3IR9A 3RK2B 3TGUJ 3L72D 4YPCA 3CCVP 3HRNA 1EC5A 2V4HA 2JR8A 3TK1A 3TGUD 1GK6A 5AW7B 3V2RA 2QJPB 4WBAA 3E7KA 4PV1B 1L4AA 4TLFA 4U3FJ 1ZR2A 2OYHC 2WT7B 4U3FD 5DJUB 1N73A 1NHLA 3HD7D 4ZNCA 1HJBA 4EIJA 1RY3A 1KTMA 2IZ1A 5CCGD 1VDFA 1RHZB 1FJKA 2B87A 5AVWB 2E75B 3USSA 2CPSA 5AVRB 1JTHA 2FXOA 1AA0A 1QGKB 2WSEH 2KOGA 1SQBK 4HB1A 3D71A 4YXWH 1IFDA 3AEBC 1L0LG 3AECC 3CX5E 4D6TJ 1M1JA 2B9BA 4EI2A 4D6TD 2FFDB 2PAJA 3A0BH 3L74D 2Y0DA 1AFOA 1ZRTE 1KB9E 2JKVA 2WPQA 3AE4C 3L4FA 3HE5B 5CMZA 3CC2P 1OVRA 3P8MC 4N78E 2O01J 5GTHE 4H13C 3T97A 1KN7A 2J5UA 1NU1E 2FYUE 3CI9A 1RE4A 3S1KA 3AEDC 3I56P 1FS0E 4LGDE 3MIWA 1HH0A 3Q1MA 3AEGC 5APYA 1JY3P 4C7NA 1L0NJ 5TJHA 2K88A 2V7QH 1L0ND 3W67A 5KLVJ 4IL6H 1NKNA 3RL0C 5KLVD 1KILA 3FXEA 2BCCJ 1SQQE 2ZT9B 4AYCA 2XNXA 4Y28J 2KIKA 4JBZA 2A06D 1N7SB 1MFZA 2ZVNB 2N1TA 2E74C 4QMAA 2IDBA 3F89A 4H44C 1QVFO 1A02F 3VOPA 2QG4A 1ZLLA 2LXCB 2KP8A 1IFIA 3H1IJ 3TNUA 2SPZA 2QJYC 3M91A 3V4WA 1EZVI 3L70G 1LWUB 3GW6A 1LNQA 3OA7A 1GL2D 3VMAA 1LTJA 1GDTA 3B5NB 1MZ9A 3AE7C 3D70A 5E79H 4IFFA 3M0AA 4BRYB 4A7PA 3RBXA 2N9BA 1DD4A 1SQXK 2GM4A 2K9YA 3H1KD 4RO0A 4I2LC 1X22A 1KQGB 2HPCA 1Z56A 1A02J 2QJPC 1FOSF 3OW2O 1PP9J 1VQOP 3Q5PA 2PRRA 1PP9D 2YMKA 3JCUE 2OTLP 4OGQB 3A0BE 3CMAP 1BCCJ 3HD7A 3E1IA 5CJ4A 1BCCD 3CXHD 1VQ7P 1J1DB 2AEFA 3BATA 1QEXA 1NTZG 5CCGA 1MUUA 1L0LE 1LTAC 3L71J 1IK7A 1FZCB 3L71D 1S3JA 4KT0J 3L73D 3HUSB 5AVQB 2KUBA 1H89A 3M06A 1BDDA 4ZKUA 4WWIA 3V4QA 3L75J 1UIIA 3R2PA 5AVVB 3L75D 2YKOA 5BU8B 2FBWC 3GMAA 4PJ0E 1YTZI 1M7LA 4XE5B 1SQXG 4DT0A 4GT1A 1L2PA 2OYHB 1KYOI 2G8YA 1JOCA 4EOTA 4EDFA 3H32A 4OH8B 3AE2C 1P84I 1GK4A 5KAIH 2W27A 2WPVB 3TGUG 2P67A 3D6ZA 1KD1Q 1DD3A 1EZVD 3AE8C 1ZN5A 1RF1C 3P32A 1FJPA 3VP8A 1FAVA 4W80A 2XV5A 1LP1A 2YKPA 2M3BA 3AE6C 3V2NA 3M0DA 4U3FG 4IOIH 3LW5J 1SP4A 3RK3D 1BSNA 2Q1KA 2FY8A 3EWKA 2KNCA 1NGMB 2LR2A 3VP9A 2KSJA 3GHGC 2UWJE 1L0NK 1RF0A 5KLVK 3KQGA 2K1AA 3CCJP 1W2BO 2O1JA 3M9HA 5E79E 3CCMP 2HYNA 1LTGC 2M8RA 3CWBG 4OWFA 2KXPB 3QH9A 2KB7P 1HGVA 4O9BA 3L70E 1JEKA 3O6QA 2Y0CA 1KMIZ 2M5AA 1SFCD 3L74G 2IYOA 5AW4B 1URQC 5TISE 3HTKA 4IFDK 1BGYD 3FX0A 3WU2H 3NXSA 4H13D 2HG5D 2W8ZA 1BSHA 3BCCE 3BVHA 1J2JB 2OTKE 1CI6B 1GL2A 1SQVJ 1SQVD 4Z1MH 2QIWA 2QVAA 2YXRB 3CX5I 3H1LG 1S5LX 5AW1B 2KZJA 4DOJA 3AE3C 1KYOD 1G1JA 1G1IA 3RL0D 2K9JA 4R4LA 3F5HA 2E74B 1PZQA 1SQPG 4H44B 1P84D 2O01H 3CCUP 2FYNC 3SWFA 1J1EC 3H1JJ 3VMXA 1JM0A 1S4XA 1NTZE 2RH0A 3H1JD 1S9KD 1DX7A 2QJYB 2WITA 5AW8B 4OGQC 1M57D 1R8EA 2IFNA 2K3RA 4Y99C 1JY3N 2WSCJ 1NTMJ 3MHVA 3GG2A 1GZLA 1NTMD 2YMYA 2QSIA 2GA1A 3SWYA 1J1DC 2A45I 3AE5C 1SLQA 1U7JA 2O1KA 1PV3A 5M1BA 4ZKPA 2PP6A 3KDPB 1R5LA 2XNDH 1YHQP 1EDKA 3HUSC 1H0TA 1NWQA 1K05A 3G4SP 1K73Q 1SQXE 2R5DA 2KS1A 1L4AC 3TSIA 2P10A 2HR3A 1YTZT 3P7KA 1VF5C 1FBMA 3PTZA 5AVUB 1VQPP 2CPBA 3EQ2A 2Y9ZA 3MP7B 1JMMA 3RK2D 3A3YB 3MGNA 1NOHA 1U57A 3B71A 2E43A 3M9QA 1K9MQ 2B88A 4PV1D 3H1KG 2FXPA 2JO1A 1AVOA 3MD0A 1NTKG 1GU4A 1OW7A 1IFMA 2R32A 2Z5IA 2NZ2A 1M1JC 2XKMA 3CC7P 4KJMA 2FXMA 4YTPC 2W90A 2OYOA 3W68A 3GLMA 2YO2A 3CX5D 1QLED 5L8RJ 2E75D 1TU3F 1HGZA 1PPJG 2AXTH 1OMIA 2IBZI 1S5LE 3CWBE 1IJDB 1DEBA 1ZRTD 5KKZC 2E76C 5APWA 1KB9D 1DH3A 5H2FE 1Q82Q 2OYIA 1KFMA 3L71G 3L73G 5B66H 2RN0A 1G2CB 2WPRA 2HLOA 4N78D 1T2KD 1RE4C 4B86A 1FZGA 3CXHH 1Y9BA 1NU1J 1RF1B 3L35A 1X0TA 1YJNP 2FYUJ 4H0LC 1LT1A 2KK7A 1ZXGA 1ZP0C 3H1HE 3BRVB 3CXHI 5AW6B 1SFCA 2J58A 5CBNA 3KZIE 2WSSH 3H1LE 3IFMA 1M8OB 2AEJA 1RE3A 3FXDA 1HWTC 5AVTB 1SQBG 2B89A 1SQQJ 2E5TA 1HBWA 1EZVG 3GHGB 1SQQD 1SQPE 1YQ3C 2N1TC 2BCCD 1VQMP 4WVZA 4JYCA 2XZRA 2G3AA 1RQVA 1FDIA 1ZR4A 5BU5A 3D6YA 3U59A 4W7ZA 1KZUB 2I1KA 3H6PA 1SQVK 1X79B 2HODA 3AEEC 4WY4B 2Q6QA 4PD4I 1LT9A 1DIPA 1KC8Q 2ZT9D 4UB6H 5KLIC 2C9LY 1URQB 2C9NY 4HYTB 3H1ID 2D2CC 5B5EH 2OGUA 2Y0EA 1N7SD 2W6AA 3TDKA 1OIPA 1VPCA 3U1AA 3A5TA 3WUUA 4GIFA 1IFJA 3LW5H 2NPSA 1T3JA 3I5CA 1JMBA 1GD2E 2E42A 4JPZB 1YITP
chains in the Genus database with same CATH topology
1PP9D 2IBZD 3KHUA 1KYOD 2A06D 3BCCD 1BCCD 2K9JB 3CXHD 1NU1D 2FYUD 1SQXD 2FYNB 4D6TD 1P84D 2KNCB 3H1HD 1SQQD 2N9YB 3L74D 2Y0DA 3L71D 2BCCD 3L73D 3ITKA 3PHLA 2QG4A 3H1JD 2O3JA 2RMZA 3H1LD 2QJYB 2YIUB 3L72D 3FWLA 3CX5D 3GG2A 3TGUD 1BE3D 1NTMD 3GW6A 5KLIB 3VMAA 3L75D 1SQPD 5KKZB 2QJPB 1SQBD 2L91A 1NTKD 1NTZD 1ZRTD 2Y0CA 1KB9D 3TF5A 4A7PA 3H1ID 2Y0EA 4U3FD 2KS1A 3TDKA 4RJTA 1BGYD 4EDFA 2RN0A 1L0LD 3H1KD 3PRJA 5TJHA 2JWAA 3CWBD 1L0ND 3PLNA 3L70D 3PTZA 1PPJD 5KLVD 1EZVD 2QJKB 2Q3EA 4PD4D 1SQVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 D;  2IBZ D;  3KHU A;  1KYO D;  2A06 D;  3BCC D;  1BCC D;  2K9J B;  3CXH D;  1NU1 D;  2FYU D;  1SQX D;  2FYN B;  4D6T D;  1P84 D;  2KNC B;  3H1H D;  1SQQ D;  2N9Y B;  3L74 D;  2Y0D A;  3L71 D;  2BCC D;  3L73 D;  3ITK A;  3PHL A;  2QG4 A;  3H1J D;  2O3J A;  2RMZ A;  3H1L D;  2QJY B;  2YIU B;  3L72 D;  3FWL A;  3CX5 D;  3GG2 A;  3TGU D;  1BE3 D;  1NTM D;  3GW6 A;  5KLI B;  3VMA A;  3L75 D;  1SQP D;  5KKZ B;  2QJP B;  1SQB D;  2L91 A;  1NTK D;  1NTZ D;  1ZRT D;  2Y0C A;  1KB9 D;  3TF5 A;  4A7P A;  3H1I D;  2Y0E A;  4U3F D;  2KS1 A;  3TDK A;  4RJT A;  1BGY D;  4EDF A;  2RN0 A;  1L0L D;  3H1K D;  3PRJ A;  5TJH A;  2JWA A;  3CWB D;  1L0N D;  3PLN A;  3L70 D;  3PTZ A;  1PPJ D;  5KLV D;  1EZV D;  2QJK B;  2Q3E A;  4PD4 D;  1SQV D; 
#chains in the Genus database with same CATH topology
 1NTM K;  2IBZ D;  3KHU A;  1Y47 A;  1GTW A;  5CCH D;  2P58 A;  2Y9Y A;  5DJT B;  1NVO A;  3CCL P;  1W5C E;  2Z4E A;  3Q2Y A;  1BE3 G;  3B5N D;  1BGY G;  5KJ7 D;  2ZYA A;  1MV8 A;  3RL0 g;  2FYN B;  1S1C X;  1J1E B;  2BEZ F;  4JQ0 D;  3H1K E;  3HD7 C;  1Q86 Q;  1OFC X;  1VQN P;  1NTK E;  4Y99 B;  5APU A;  2RMZ A;  2R44 A;  3P8C E;  3HE4 B;  3SFD C;  2I8D A;  1KOR A;  1L0L J;  1M56 D;  1NJI Q;  5APS A;  1AVY A;  2JDI H;  5B66 E;  2CK3 H;  2FKW B;  2ZXX A;  4OGQ D;  1PPJ E;  2WT7 A;  3VN0 A;  1PGO A;  1L4A B;  3MUD A;  1KYO H;  2H8P D;  1VF5 B;  2W6B A;  1N73 B;  3L73 E;  4AUW A;  2YO3 A;  4OVN F;  2V7Q J;  5AW0 B;  4C46 A;  5AVZ B;  2QJK B;  3G6E P;  1P84 H;  4IL6 E;  1RQU A;  3II6 A;  3B8E B;  2WPS A;  1M90 Q;  4M3L A;  4PD4 D;  2GUS A;  2B87 B;  1LTS C;  2NRG A;  3L72 G;  1JTH B;  4LLH A;  1OX3 A;  2W83 C;  3E1R A;  2VRS A;  2FFD A;  3AE9 C;  3M0D C;  1ZW0 A;  2XDJ A;  1E79 H;  2GUV A;  2H43 A;  1M1J B;  1WRG A;  1YJW P;  1SQB E;  1H8A A;  1USD A;  3N7N A;  2KI7 B;  2POH A;  1LJ2 A;  1EZV E;  4NPE A;  4C7R A;  2AXC A;  2YIU B;  3BRT B;  2FYZ A;  3HE5 A;  4GDO A;  4I7Z C;  1RF0 C;  1NKZ B;  5B5E E;  5GTI H;  2ZVO B;  5KKZ B;  2E76 B;  3H25 A;  3RK3 E;  3V2Q A;  1JNM A;  2YKQ A;  3T97 B;  1FC2 C;  3AEA C;  1R5S A;  1HVV A;  5AW2 B;  1SQQ K;  1PGP A;  3K5B A;  4I1L A;  3L70 J;  1OVU A;  1X9V A;  4WY4 C;  2JWA A;  3L70 D;  2WMM A;  4H0L B;  4C7N B;  4D6T G;  2WSF J;  3WUT A;  1YIJ P;  3IN6 A;  2ZAE B;  1KIL B;  1GU5 A;  1GL2 C;  3JC2 2;  2QM8 A;  5K5G B;  2J59 M;  3BCC J;  1N7S A;  2O01 N;  3CX5 H;  1NYH A;  3BCC D;  2KZI A;  1ZOY C;  3RBZ A;  1BE3 E;  1BGY E;  2N1T B;  4DCK A;  1HJ0 A;  4XA4 A;  1KB9 H;  1KIL E;  4K35 A;  1PIX A;  1RH5 B;  2A45 G;  4UB8 H;  2O3J A;  3A0H H;  1NH4 A;  2KYV A;  3KPE A;  1LWU A;  3TNU B;  2IPP A;  5CCH A;  2Q9I A;  1KB9 I;  2K37 A;  3WMM 0;  4ASW A;  1L0N G;  5GTH H;  5AW9 B;  3B5N A;  5KLI B;  5KLV G;  1PL5 A;  1QL1 A;  1NTZ J;  1OW8 A;  5KJ7 A;  1KYO E;  2L91 A;  2H7H A;  1NTZ D;  4BRY A;  1FZA A;  1JB0 J;  1LTJ B;  5AVY B;  2A45 H;  2D2C B;  4NPD A;  1SQQ G;  4L74 A;  3S9O A;  1Y8A A;  1Q7Y Q;  3U1C A;  3CME P;  2BCC G;  2E74 D;  2KSE A;  1P84 E;  2JJL A;  4H44 D;  2A06 G;  4GOE A;  2HPC B;  1EXI A;  5KAI E;  1SQX J;  1JCC A;  2DW3 A;  3NFQ A;  3CPW O;  1EXJ A;  3AE1 C;  1T3U A;  3H1I G;  1N73 C;  1OZH A;  3L72 E;  1IO4 A;  4RKU J;  2LKM A;  3TGU E;  1HUC A;  3HD7 B;  2QJK C;  1FZC A;  3HUS A;  3ABV C;  5GTI E;  3PHL A;  5C39 A;  3GF7 A;  1IFN A;  1JY2 P;  1N7L A;  1IC2 A;  1OVV A;  3SFE C;  2IBZ G;  4JF7 A;  4ASV A;  2WQY C;  4U3F E;  4L73 A;  4TT3 H;  5KAF H;  3KXD A;  2OYH A;  1X8Y A;  4LC1 A;  3Q5R A;  3C8V A;  4R4M A;  2KLU A;  3RK3 C;  1PP9 G;  5CBO A;  3LID A;  3TYY A;  1Q81 Q;  1QX8 A;  3OAK A;  2YIU C;  2IFM A;  1JUN A;  3CWB J;  3PRJ A;  2OYI C;  3C1L A;  1BCC G;  3VMZ A;  1VQ6 P;  3WU2 E;  1FZF A;  3CWB D;  3H32 B;  3M9B A;  1Q2N A;  2ZXE B;  1T6A A;  3V2P A;  4CPG A;  2KLV A;  3JCU H;  2M0B A;  1LTB C;  3L74 J;  4D6T E;  4KHX A;  1H88 A;  3L74 E;  3NTN A;  2L5G B;  1E5W A;  1LP1 B;  1OXZ A;  2WTY A;  2IZ0 A;  1SFC C;  4UB8 E;  4BWN A;  1NAY A;  3L75 G;  1NU1 D;  1S72 P;  3A0H E;  2FYU D;  3H1H J;  1BDC A;  1DEE G;  2KNC B;  1RE3 C;  3H1H D;  3KYQ A;  2XU6 A;  1AQ5 A;  4RES B;  4U7J A;  5KTB A;  2R3S A;  1IFP A;  1OW6 A;  3H1L J;  1VQ4 P;  1KIL C;  1ZV8 A;  4BXL A;  3H1L D;  1GMJ A;  4I7Z B;  1M1K Q;  3CL3 D;  3FWN A;  3NMD A;  3FWL A;  4PJ0 H;  1SQP J;  4ZMD A;  1KFN A;  1SQP D;  2IYP A;  4XFJ A;  3GF3 A;  1L0N E;  5KLV E;  4IL6 X;  4PD4 H;  1LT9 C;  1KQS O;  3O6Q B;  2M5A B;  1N8R Q;  5CHX A;  4N6J A;  3HTK B;  1MKM A;  3PJS K;  1CSB A;  2BCC E;  3A2A A;  3CLQ A;  2P1J A;  1VL2 A;  3PLN A;  1CI6 A;  3O8Z A;  2A06 E;  3CD6 P;  3SSU A;  1W2E A;  1HTL C;  5CJ0 A;  1LTJ C;  4NPF X;  2NPS C;  3CCE P;  1GL2 B;  5AVS B;  2LXB A;  3G9R A;  4WY4 D;  1KQF B;  1CZQ A;  3BAS A;  2C0W A;  1NTZ K;  2QM7 A;  1FU1 A;  4N3Y B;  3IF4 A;  1URQ D;  3H1I E;  2K9J B;  1U7M A;  4L76 A;  2R5B A;  3EFG A;  2OQQ A;  2Q5U A;  5BVZ A;  1LGH B;  4IFM A;  1HF9 A;  3C9I A;  2WSE J;  5KAF E;  1MFT A;  4HKZ H;  4I6M C;  2WZ7 A;  2M3E A;  2W6J H;  3RK2 C;  2JWD A;  3H1K J;  2IBZ E;  2BAS A;  3VMY A;  3BCC G;  1NTK J;  4MN4 C;  1EDI A;  1NTK D;  2WSF H;  3R4Y A;  5AW5 B;  1NO4 A;  5TIS H;  2AXT E;  1SQV G;  5CCG C;  4PV1 C;  3TF5 A;  3P8C D;  2P7J A;  2Q3I A;  1H0T B;  2P2U A;  5APQ A;  1PP9 E;  1ZME C;  2WVR A;  4HH2 A;  1FDO A;  2WWW A;  1L0L D;  2KS1 B;  2BEQ D;  1VQ8 P;  3N4X A;  4GOF A;  3MUD C;  1N2D C;  2RKL A;  1PPJ D;  2OAR A;  1JCD A;  1FZE A;  1BCC E;  3CXH E;  3MTU E;  1JO5 A;  3H1J G;  1KV4 A;  2E75 C;  1YI2 P;  3L36 A;  3L73 J;  1CW5 A;  3EFF K;  5APV A;  3L71 E;  2QE7 H;  3G71 P;  3JSV C;  1JY2 O;  1VQ9 P;  1NTM G;  4K3A A;  1LTI C;  1D7M A;  2QRX A;  1FOS E;  1VQL P;  1L4A D;  1LTT C;  3VTP C;  2ZFC A;  3L75 E;  2FFD C;  1VF5 D;  1T2K C;  3ITK A;  2MJZ A;  2YNY A;  2QEX P;  2YXQ B;  2ZYD A;  2Z5H A;  3VYI A;  1GW4 A;  2WSC H;  1EDL A;  2HFE D;  4PD4 E;  3B4S A;  1SQB J;  1Q90 D;  3RK3 B;  1SQB D;  1AV1 A;  2H88 C;  1UIX A;  5EFW B;  1YJ9 P;  4UB6 E;  3I55 P;  1NU1 K;  3SWK A;  1SS1 A;  1G2C A;  2FYU K;  2ZYG A;  1YYC A;  2OYI B;  1NAF A;  4GKG A;  3IAO A;  1KQL A;  1RF1 A;  3Q3D A;  2R3C A;  2PGD A;  3L37 A;  2Q3E A;  1PFI A;  3V6I A;  3Q5S A;  1JY2 N;  4YXD C;  1EDJ A;  1GW3 A;  1SQP K;  1VQ5 P;  1K04 A;  2ZT9 C;  4EYY Q;  1SFC B;  2E76 D;  3WUV A;  4JYB A;  2Q7C A;  2C0X A;  2PFX A;  3AEF C;  3ZDM A;  3GHG A;  1N7S C;  3FGA D;  1K8A Q;  4H13 B;  1JY3 O;  1AJY A;  1FZB A;  3LIE A;  3CCS P;  3G3Z A;  3QWO C;  2JP3 A;  1T8Z A;  4H0L D;  4DZO A;  5AW3 B;  1BE3 J;  1BGY J;  3CCR P;  4WY4 A;  1S2E A;  3OJA B;  1BE3 D;  3UIA A;  1S5L H;  4W7Y A;  3A7O A;  2H89 C;  1IZN B;  1LWU C;  3RL0 B;  1USE A;  4DJG A;  1URQ A;  2HOD B;  1KIL D;  5CCH C;  1NU1 G;  1FE6 A;  5H2F H;  2FYU G;  1YQ4 C;  1LT9 B;  3B5N C;  1AQT A;  2ZJS E;  3H1H G;  1WMK A;  1OWA A;  5KJ7 C;  3PH0 A;  2ITA A;  3MZW B;  1SQV E;  1N86 A;  4RJT A;  2JEE A;  2OTJ P;  1PGQ A;  2E5Y A;  2N1T D;  4WB4 A;  1SVF A;  3CCQ P;  4L75 A;  3RGU A;  3V5B A;  4AQR D;  4HJG H;  1XTG B;  2NPS B;  2IX7 C;  2I1J A;  1FDM A;  1VQK P;  3KZI H;  2QA4 P;  4GOD A;  1EQ7 A;  5AVX B;  3H1J E;  1S9K E;  1NTK K;  2AEM A;  3S4R A;  5APT A;  1QL2 A;  1IK9 A;  1WT6 A;  1YBK A;  2NPS D;  2D2C D;  1SQX D;  1PGJ A;  1NTM E;  1XTC C;  2MKV A;  2N9Y B;  1L0L K;  3PP5 A;  3CC4 P;  5APX A;  1QVG O;  1FZC C;  3HE4 A;  3L72 J;  3IR9 A;  3RK2 B;  3TGU J;  3L72 D;  4YPC A;  3CCV P;  3HRN A;  1EC5 A;  2V4H A;  2JR8 A;  3TK1 A;  3TGU D;  1GK6 A;  5AW7 B;  3V2R A;  2QJP B;  4WBA A;  3E7K A;  4PV1 B;  1L4A A;  4TLF A;  4U3F J;  1ZR2 A;  2OYH C;  2WT7 B;  4U3F D;  5DJU B;  1N73 A;  1NHL A;  3HD7 D;  4ZNC A;  1HJB A;  4EIJ A;  1RY3 A;  1KTM A;  2IZ1 A;  5CCG D;  1VDF A;  1RHZ B;  1FJK A;  2B87 A;  5AVW B;  2E75 B;  3USS A;  2CPS A;  5AVR B;  1JTH A;  2FXO A;  1AA0 A;  1QGK B;  2WSE H;  2KOG A;  1SQB K;  4HB1 A;  3D71 A;  4YXW H;  1IFD A;  3AEB C;  1L0L G;  3AEC C;  3CX5 E;  4D6T J;  1M1J A;  2B9B A;  4EI2 A;  4D6T D;  2FFD B;  2PAJ A;  3A0B H;  3L74 D;  2Y0D A;  1AFO A;  1ZRT E;  1KB9 E;  2JKV A;  2WPQ A;  3AE4 C;  3L4F A;  3HE5 B;  5CMZ A;  3CC2 P;  1OVR A;  3P8M C;  4N78 E;  2O01 J;  5GTH E;  4H13 C;  3T97 A;  1KN7 A;  2J5U A;  1NU1 E;  2FYU E;  3CI9 A;  1RE4 A;  3S1K A;  3AED C;  3I56 P;  1FS0 E;  4LGD E;  3MIW A;  1HH0 A;  3Q1M A;  3AEG C;  5APY A;  1JY3 P;  4C7N A;  1L0N J;  5TJH A;  2K88 A;  2V7Q H;  1L0N D;  3W67 A;  5KLV J;  4IL6 H;  1NKN A;  3RL0 C;  5KLV D;  1KIL A;  3FXE A;  2BCC J;  1SQQ E;  2ZT9 B;  4AYC A;  2XNX A;  4Y28 J;  2KIK A;  4JBZ A;  2A06 D;  1N7S B;  1MFZ A;  2ZVN B;  2N1T A;  2E74 C;  4QMA A;  2IDB A;  3F89 A;  4H44 C;  1QVF O;  1A02 F;  3VOP A;  2QG4 A;  1ZLL A;  2LXC B;  2KP8 A;  1IFI A;  3H1I J;  3TNU A;  2SPZ A;  2QJY C;  3M91 A;  3V4W A;  1EZV I;  3L70 G;  1LWU B;  3GW6 A;  1LNQ A;  3OA7 A;  1GL2 D;  3VMA A;  1LTJ A;  1GDT A;  3B5N B;  1MZ9 A;  3AE7 C;  3D70 A;  5E79 H;  4IFF A;  3M0A A;  4BRY B;  4A7P A;  3RBX A;  2N9B A;  1DD4 A;  1SQX K;  2GM4 A;  2K9Y A;  3H1K D;  4RO0 A;  4I2L C;  1X22 A;  1KQG B;  2HPC A;  1Z56 A;  1A02 J;  2QJP C;  1FOS F;  3OW2 O;  1PP9 J;  1VQO P;  3Q5P A;  2PRR A;  1PP9 D;  2YMK A;  3JCU E;  2OTL P;  4OGQ B;  3A0B E;  3CMA P;  1BCC J;  3HD7 A;  3E1I A;  5CJ4 A;  1BCC D;  3CXH D;  1VQ7 P;  1J1D B;  2AEF A;  3BAT A;  1QEX A;  1NTZ G;  5CCG A;  1MUU A;  1L0L E;  1LTA C;  3L71 J;  1IK7 A;  1FZC B;  3L71 D;  1S3J A;  4KT0 J;  3L73 D;  3HUS B;  5AVQ B;  2KUB A;  1H89 A;  3M06 A;  1BDD A;  4ZKU A;  4WWI A;  3V4Q A;  3L75 J;  1UII A;  3R2P A;  5AVV B;  3L75 D;  2YKO A;  5BU8 B;  2FBW C;  3GMA A;  4PJ0 E;  1YTZ I;  1M7L A;  4XE5 B;  1SQX G;  4DT0 A;  4GT1 A;  1L2P A;  2OYH B;  1KYO I;  2G8Y A;  1JOC A;  4EOT A;  4EDF A;  3H32 A;  4OH8 B;  3AE2 C;  1P84 I;  1GK4 A;  5KAI H;  2W27 A;  2WPV B;  3TGU G;  2P67 A;  3D6Z A;  1KD1 Q;  1DD3 A;  1EZV D;  3AE8 C;  1ZN5 A;  1RF1 C;  3P32 A;  1FJP A;  3VP8 A;  1FAV A;  4W80 A;  2XV5 A;  1LP1 A;  2YKP A;  2M3B A;  3AE6 C;  3V2N A;  3M0D A;  4U3F G;  4IOI H;  3LW5 J;  1SP4 A;  3RK3 D;  1BSN A;  2Q1K A;  2FY8 A;  3EWK A;  2KNC A;  1NGM B;  2LR2 A;  3VP9 A;  2KSJ A;  3GHG C;  2UWJ E;  1L0N K;  1RF0 A;  5KLV K;  3KQG A;  2K1A A;  3CCJ P;  1W2B O;  2O1J A;  3M9H A;  5E79 E;  3CCM P;  2HYN A;  1LTG C;  2M8R A;  3CWB G;  4OWF A;  2KXP B;  3QH9 A;  2KB7 P;  1HGV A;  4O9B A;  3L70 E;  1JEK A;  3O6Q A;  2Y0C A;  1KMI Z;  2M5A A;  1SFC D;  3L74 G;  2IYO A;  5AW4 B;  1URQ C;  5TIS E;  3HTK A;  4IFD K;  1BGY D;  3FX0 A;  3WU2 H;  3NXS A;  4H13 D;  2HG5 D;  2W8Z A;  1BSH A;  3BCC E;  3BVH A;  1J2J B;  2OTK E;  1CI6 B;  1GL2 A;  1SQV J;  1SQV D;  4Z1M H;  2QIW A;  2QVA A;  2YXR B;  3CX5 I;  3H1L G;  1S5L X;  5AW1 B;  2KZJ A;  4DOJ A;  3AE3 C;  1KYO D;  1G1J A;  1G1I A;  3RL0 D;  2K9J A;  4R4L A;  3F5H A;  2E74 B;  1PZQ A;  1SQP G;  4H44 B;  1P84 D;  2O01 H;  3CCU P;  2FYN C;  3SWF A;  1J1E C;  3H1J J;  3VMX A;  1JM0 A;  1S4X A;  1NTZ E;  2RH0 A;  3H1J D;  1S9K D;  1DX7 A;  2QJY B;  2WIT A;  5AW8 B;  4OGQ C;  1M57 D;  1R8E A;  2IFN A;  2K3R A;  4Y99 C;  1JY3 N;  2WSC J;  1NTM J;  3MHV A;  3GG2 A;  1GZL A;  1NTM D;  2YMY A;  2QSI A;  2GA1 A;  3SWY A;  1J1D C;  2A45 I;  3AE5 C;  1SLQ A;  1U7J A;  2O1K A;  1PV3 A;  5M1B A;  4ZKP A;  2PP6 A;  3KDP B;  1R5L A;  2XND H;  1YHQ P;  1EDK A;  3HUS C;  1H0T A;  1NWQ A;  1K05 A;  3G4S P;  1K73 Q;  1SQX E;  2R5D A;  2KS1 A;  1L4A C;  3TSI A;  2P10 A;  2HR3 A;  1YTZ T;  3P7K A;  1VF5 C;  1FBM A;  3PTZ A;  5AVU B;  1VQP P;  2CPB A;  3EQ2 A;  2Y9Z A;  3MP7 B;  1JMM A;  3RK2 D;  3A3Y B;  3MGN A;  1NOH A;  1U57 A;  3B71 A;  2E43 A;  3M9Q A;  1K9M Q;  2B88 A;  4PV1 D;  3H1K G;  2FXP A;  2JO1 A;  1AVO A;  3MD0 A;  1NTK G;  1GU4 A;  1OW7 A;  1IFM A;  2R32 A;  2Z5I A;  2NZ2 A;  1M1J C;  2XKM A;  3CC7 P;  4KJM A;  2FXM A;  4YTP C;  2W90 A;  2OYO A;  3W68 A;  3GLM A;  2YO2 A;  3CX5 D;  1QLE D;  5L8R J;  2E75 D;  1TU3 F;  1HGZ A;  1PPJ G;  2AXT H;  1OMI A;  2IBZ I;  1S5L E;  3CWB E;  1IJD B;  1DEB A;  1ZRT D;  5KKZ C;  2E76 C;  5APW A;  1KB9 D;  1DH3 A;  5H2F E;  1Q82 Q;  2OYI A;  1KFM A;  3L71 G;  3L73 G;  5B66 H;  2RN0 A;  1G2C B;  2WPR A;  2HLO A;  4N78 D;  1T2K D;  1RE4 C;  4B86 A;  1FZG A;  3CXH H;  1Y9B A;  1NU1 J;  1RF1 B;  3L35 A;  1X0T A;  1YJN P;  2FYU J;  4H0L C;  1LT1 A;  2KK7 A;  1ZXG A;  1ZP0 C;  3H1H E;  3BRV B;  3CXH I;  5AW6 B;  1SFC A;  2J58 A;  5CBN A;  3KZI E;  2WSS H;  3H1L E;  3IFM A;  1M8O B;  2AEJ A;  1RE3 A;  3FXD A;  1HWT C;  5AVT B;  1SQB G;  2B89 A;  1SQQ J;  2E5T A;  1HBW A;  1EZV G;  3GHG B;  1SQQ D;  1SQP E;  1YQ3 C;  2N1T C;  2BCC D;  1VQM P;  4WVZ A;  4JYC A;  2XZR A;  2G3A A;  1RQV A;  1FDI A;  1ZR4 A;  5BU5 A;  3D6Y A;  3U59 A;  4W7Z A;  1KZU B;  2I1K A;  3H6P A;  1SQV K;  1X79 B;  2HOD A;  3AEE C;  4WY4 B;  2Q6Q A;  4PD4 I;  1LT9 A;  1DIP A;  1KC8 Q;  2ZT9 D;  4UB6 H;  5KLI C;  2C9L Y;  1URQ B;  2C9N Y;  4HYT B;  3H1I D;  2D2C C;  5B5E H;  2OGU A;  2Y0E A;  1N7S D;  2W6A A;  3TDK A;  1OIP A;  1VPC A;  3U1A A;  3A5T A;  3WUU A;  4GIF A;  1IFJ A;  3LW5 H;  2NPS A;  1T3J A;  3I5C A;  1JMB A;  1GD2 E;  2E42 A;  4JPZ B;  1YIT P; 
#chains in the Genus database with same CATH homology
 1PP9 D;  2IBZ D;  3KHU A;  1KYO D;  2A06 D;  3BCC D;  1BCC D;  2K9J B;  3CXH D;  1NU1 D;  2FYU D;  1SQX D;  2FYN B;  4D6T D;  1P84 D;  2KNC B;  3H1H D;  1SQQ D;  2N9Y B;  3L74 D;  2Y0D A;  3L71 D;  2BCC D;  3L73 D;  3ITK A;  3PHL A;  2QG4 A;  3H1J D;  2O3J A;  2RMZ A;  3H1L D;  2QJY B;  2YIU B;  3L72 D;  3FWL A;  3CX5 D;  3GG2 A;  3TGU D;  1BE3 D;  1NTM D;  3GW6 A;  5KLI B;  3VMA A;  3L75 D;  1SQP D;  5KKZ B;  2QJP B;  1SQB D;  2L91 A;  1NTK D;  1NTZ D;  1ZRT D;  2Y0C A;  1KB9 D;  3TF5 A;  4A7P A;  3H1I D;  2Y0E A;  4U3F D;  2KS1 A;  3TDK A;  4RJT A;  1BGY D;  4EDF A;  2RN0 A;  1L0L D;  3H1K D;  3PRJ A;  5TJH A;  2JWA A;  3CWB D;  1L0N D;  3PLN A;  3L70 D;  3PTZ A;  1PPJ D;  5KLV D;  1EZV D;  2QJK B;  2Q3E A;  4PD4 D;  1SQV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...