2KSQA

The myristoylated yeast arf1 in a gtp and bicelle bound conformation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
180
Chain Sequence
GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVECVQYCNISFTVWDVGGQDRIRSLWRHYYCNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELCNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNCLKNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Dynamic structure of membrane-anchored Arf*GTP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 44
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ksqA00
4BQSA 4B2IA 4HEJA 1WP9A 3RVBA 4BFUA 2OLKA 1MRSA 1ZIOA 3M4YA 1KMQA 4M1SA 1GOTA 2VA8A 2ZJOA 3KXKA 3AUXA 5CLLA 1VG8A 1E79D 1XPRA 5AWFC 4LX0A 1Q1BA 3PUYA 4NP6A 3THYB 2IXFA 4BECA 2AHOA 1ZBDA 2AXPA 4QM6A 1CR2A 3U3OA 4OYHA 3ICQB 1DVRA 1KHTA 2RB4A 1RZ3A 1J70A 2ZJ2A 3G5UA 2X2EA 3EW9A 4A0HA 5CIWA 4L5BA 2G1KA 1OH7A 2ZUCA 3KJIA 1ZW6A 3Q72A 4LHWA 3BGWA 1P6XA 2EVWX 2JA1A 3BK7A 3I72A 1Z28A 3NBZC 2RGXA 4OBEA 2YZ2A 1GL6A 2A5JA 2JDIA 3LY5A 5KOYA 3TR5A 2FV8A 1UDXA 4OK5A 1WMSA 2QBYB 3QBVA 2O8EA 1KDRA 4MRSA 2IUSA 3RS4A 3B1XA 2CEAA 1G8GA 1X8LA 4DDWA 2UVQA 2FG5A 2WVJA 1W36D 4AWXA 1W2HA 1N6LA 2KJQA 4Q7JB 2WV9A 4CF7A 5EUMA 4HSEA 1DELA 2JLWA 5GJVC 1DBSA 1G19A 1MR3F 2ZYTX 4TLEA 1SQ5A 5IF9A 4EFNA 3K53A 4UKDA 4HB3A 2WM9B 4OHXA 4D0NA 4O2LA 4FWIB 3NWJA 3UATA 1AGRA 4M21A 1W0JD 3A36A 3H1TA 4P3YA 4CDGA 5TMPA 2GILA 4M4SA 4QOSA 1B0UA 4R98A 4JL8A 3KL4A 3ZVMA 2IYRA 1Q57A 2GWHA 2BC9A 1H8EA 4KFTA 5FBLB 1XPUA 5B30A 3TUJC 4N0EA 1X1SA 3UK6A 1FP7A 1Q22A 2IT1A 4A2QA 4B2LA 4LYAA 4EQ6A 3I73A 4Q7KA 4G01B 3KJGA 1VG1A 3PEUA 3FFBA 3ZS8A 4LPKA 2ZRBA 2BBOA 5F9HA 4GOKA 1S96A 2AR7A 2BVNA 2GKSA 1S9DA 3AP3A 3AVOA 4A4DA 4DSNA 4Q9JA 2JCSA 3SFZA 3VX4A 4OKSA 4TMXA 4MKIA 1IM2A 2WJGA 5CM8B 5BN3A 3EPHA 2CL6X 4KFUA 3Q9LA 2CJWB 4O0MA 1NVUQ 2QN6A 1P9WA 2QMUA 1M6NA 2NO1A 3RWMB 1EESA 2B8TA 5GJWC 4WZBE 2J46A 4IHQA 1Y3AA 1NSTA 3P20A 3W3AA 5DISB 5EP1A 1JJ7A 1U81A 3LBHA 5J4YA 3PIRA 3FKQA 1KSHA 2VSOA 5KUTA 2GA8A 1F3OA 1MO3A 3W5IA 4NZYA 1Z6YA 2Q21A 5TXGA 2CK3D 2NZJA 1P2TA 1K5GA 1AZTA 1O87A 4UNRA 2IF2A 3O8CA 1BIFA 3WBJA 1RFLA 2JATA 1R5NA 4LJ5A 2IL1A 4PQRA 2IYTA 3V9PA 2FEOA 1KO7A 2FU5C 3V4RA 1QHGA 1YZQA 4JLVA 4HZIA 4BRUA 4X8MA 1PLKA 2F1HA 2XAUA 4KCGA 3ZVLA 2FOLA 5AR1A 1XEFA 5IT5A 1NRJB 3OE7A 1Z63A 1KI8A 2A30A 1RIFA 3AQ4A 3PUVA 1SZPA 3BB4A 3UWOA 2PLFA 1SXJD 4RFSA 2GZAA 3CBQA 4KXFB 5CYPA 1KK0A 4CEIA 2JLUA 5KSZA 3EX7C 1CKEA 3GEHA 4Z8YA 1KKMA 2FDCA 3QKTA 4URVR 1T6NA 1E2FA 3BC1A 4TLAA 4BFWA 1XTIA 1R0XA 4AY2A 4CT5A 3K1JA 1AK2A 4P4UA 1HYQA 3GFPA 3NIBA 5EE1A 1VMAA 4NBSA 1VYUA 4YMUA 1T0HB 1HE1C 1U8AA 3PQCA 2B6HA 5JBQA 3PEWA 4C2UA 1XDBA 1G8FA 1TX4B 1W47A 3DKVA 1AZSC 2J59A 3LW8A 1XCMA 1W4AA 4LI0A 3PJRA 2VHQA 2QROA 4B3CA 4KVAA 2V6JA 4U02A 3U2QA 4PHTA 4GPTA 5FPSA 5KDDA 4IRUB 1JI0A 3Q5EA 4PHGA 2GJSA 4TYYA 1D2EA 1DAIA 4D80A 2WIBA 4LC1A 5DN6D 1AIPA 3B9PA 2GAOA 4HUQA 3AUYA 1XZQA 1ESNA 4B47A 2WPDA 5JFGA 1NLZA 1JNYA 5DO9A 2J5XA 5J4LA 2I1QA 4NYIQ 2NO0A 4NDZA 5AK0A 4EDHA 2P2LA 3EIEA 3E70C 1OXXK 2FPLA 5G40A 3W5JA 4DLUA 2WJIA 4A15A 3RLFA 3NKVA 2GXSA 4HZUA 4OI1A 1J99A 1Z3IX 2R62A 1E2LA 1PV4A 1Q1EA 4B2PA 3H86A 3A4LA 4LHZA 3BORA 4DSUA 4LYFA 1EWQA 1AQUA 2QT0A 4N1AA 1KO5A 5JJLA 2IXGA 2AK2A 4M2LA 2J0SA 5CDFA 3GLHA 3JVVA 1XXHB 5L3SB 2AWNA 1GRQA 5FTMA 3CPJB 2BWJA 5HE8A 4RKEA 2FFBA 1NL3A 4U5XA 1E2IA 4G5OA 1N0UA 5JEDA 4M53A 3CPEA 4WZAE 5SZJA 2XOKD 2IX3A 3T1QA 5EXXA 1II8B 4MKHA 2H17A 2HCBA 3B78A 3TJZA 4QM7A 1VYVA 1QHNA 1MO5A 2F3TA 4D82A 1FTSA 1ZC4A 2O8FB 4F4IA 5AUQA 2R8RA 1II9A 1QVAA 2PX3A 4FINA 4V02A 1XMSA 4F4JA 3U44A 1N6IA 4KSCA 1IBRA 2GJ9A 3EIHA 2QP4A 4A8JB 1XF9A 2BEKA 1QHSA 1GKIA 3I1FA 2E87A 2IYYA 1WRBA 3HP1A 3TE6A 1YJ5A 3AVWA 3VFDA 4A8JC 1G21E 4CVNA 4DUGA 2WWWA 3O8BA 2GEUA 1UKEA 1KJWA 1NMZA 3ZD6A 1MRNA 2YOGA 3IO5A 2IF0A 3I5XA 3KFVA 1TQ6A 1MO4A 2EYQA 1W46A 2JLSA 4DDVA 1EFRD 4M8NE 3K0SA 3W8NA 1OXTA 2WMOB 2F1RA 3GFOA 2GCOA 1KI6B 3ONWA 4LZZA 4B3GA 3CH4B 3VR3A 2NPIA 4DWJA 3TLXA 3QVUA 1M1YE 2WWIA 2ONJA 2PH1A 4GBMA 1U0LA 2BHRA 4OQFA 4A0RA 2C9CA 1QHHA 3U6KA 4GP7A 4Z51A 1K5DA 1VHLA 4LWZA 3UMFA 4YMTA 5HE9A 2AFIE 1DG1G 3OEEA 1UBGA 4C7OA 3T1OA 1G20E 4MDEA 3MJHA 3KUCA 3K09A 3CX8A 4ESHA 4Q21A 1W4RA 2AL7A 3IPXA 3CW2A 1IOZA 1Q12A 5C46F 4XSGA 4B3BA 1ZU5A 3CM0A 3TMKA 1RYHA 3NC1C 3ZD7A 2YHSA 1W4CA 1G4AE 1XD8A 2VL7A 4LJ7A 5DYIA 2QE7A 2ORVA 3FYHA 1R4AA 3C4JA 1SVSA 1N6PA 3VKGA 3O47A 3PFIA 2CHVA 1G5TA 3LBIA 4IVPA 2ZS7A 4KV9A 1Z47A 2HF9A 4XVUA 2WICA 4P32A 3T35A 1B23P 2OEPA 3Q7QA 4AG5A 1HEIA 3GJ6A 2HXYA 3I4LA 2BMFA 1MV5A 2PCJA 4LHVA 3TH5A 2BOVA 2AKYA 2IYVA 3NC0C 4W5HA 4LJYA 4FD2A 2IHYA 3H2YA 4D81A 1KNXA 4Q9LA 3FMIA 4V0KA 5TB5A 2R6AA 2PJRA 2O0JA 4C2TA 2GJKA 2RMKA 1KI9A 1T9HA 5E7MA 4NYMQ 4JJKA 4CZ2A 2JLQA 1D8TA 2ZRFA 2ZR9A 3U4QB 2HJGA 3VU9A 2CMKA 2JASA 3ZIAA 2F3RA 3RYTC 2LKDA 1PZNA 4D25A 3UKDA 3CF0A 2QNRA 2WAXA 1E1QD 1R8QA 1OXSC 1VDZA 1D9XA 5AJZA 1LS6A 3TQCA 2OUKA 4A0FA 2W0MA 4AK9A 2EW1A 3NHAA 5J47A 1ZNZA 1HQCA 4HLQB 4PPNA 4PZYA 1E9EA 1YZKA 2ZTSA 5CJPA 1E2JA 2XZPA 3GLIA 1ZM2A 2D62A 2Q9AA 2QT1A 2I1VB 1FPMA 4PQYA 2JJ8A 4N3NA 3ZH9B 2IYXA 2Q3MA 3IHLA 3GLIE 1XD2B 1MO6A 1WA5A 2RGGA 3IEUA 3K9GA 4ITRC 1ZAKA 2ZSBA 4ZKEA 1KI4A 4M1MA 1RJ9B 1PLLA 3X1DA 1CTQA 3GMTA 2PMKA 2BMJA 3GLGB 4UNSA 1NLFA 3SJCA 4HAWA 3RS2A 5FI0B 4IDPA 5B2ZA 3PUXA 1ZM7A 4M9XA 3AVVA 2FGJA 3FMOB 5B58C 2NZ8A 3RS3A 4FN5A 1L4UA 4PSKA 1JALA 2QPAA 4RSGA 2NMVA 1VCIA 2WMNB 3FPAA 1OIVA 2GJ8A 5JCZA 3MGCA 4LDJA 4OI0A 3UXMA 3MUFA 2HT1A 2QAGB 4P4SB 1XTSA 4Q4AA 2JJ1D 4MYUA 3HWSA 1SVLA 1N0WA 4XOIA 5BQ5A 1CJTC 1WQ1R 2QAGC 1XB2A 4EPVA 2Q9CA 1ANKA 4IVRA 5DI9A 2WJVA 1XWIA 2FSGA 4W9MC 1SVWA 4C0AC 3PUZA 5LDDC 1JBKA 1W48A 2FA9A 1XNJA 3RRNA 2XTNA 4Y0VA 3VR2A 1P7CA 2VBCA 1QG4A 1VHTA 3A1WA 4A0GA 1OH8A 1X3SA 4CW7A 2J87A 1UDWA 1R0WA 4XD7A 2LCFA 2IYSA 3KTAA 2IUUA 1UBCA 4JVNA 3I8XA 4NMMA 4Q9HA 2C78A 4BGDA 3SFVA 5JEEA 2CHGA 2CCGA 2J1LA 1KI2A 3F0TA 4A2PA 5HR5A 4CEJB 2V1XA 1R5BA 1OIXA 3TUZC 2HDNB 2QEQA 2Z4SA 3TGPA 1E2DA 2BDTA 3B2EA 2QY9A 1JAHA 1SKYE 1KY3A 5KYKA 1KKLA 1KSFX 2W6ID 1NLYA 1LFDB 1OV4A 2ATVA 2OO7A 2ORIA 2W2XA 2ZJBA 3HYTA 1OKKA 1JB1A 3C41J 4IDOA 5C4GB 4Q4HA 1E2MA 4EPTA 3AVPA 1FX0B 2QU8A 2GRJA 2QQ0A 2J0UA 3MG9A 4YLGA 4C0QC 2V1UA 5F9FA 1D2MA 4NCNA 3B5JA 3ND8A 5CLQA 4RKFA 4PTLA 2V6IA 2D2FA 4LJAA 5GVRA 2A78A 4JLKA 1E96A 2DHRA 4QBIA 1E2GA 1E2NA 1GAJA 2IUTA 4LHYA 4WA7A 2IYLD 1PUJA 4ZV4A 1CJVC 3EASA 3SYNA 5FTLA 1ZMXA 2YWFA 5KO2A 1GFIA 3CX6A 1NN0A 2VHUA 4HI0E 4BZPA 3HJNA 3IQXA 3EAQA 3D7MA 3PCRB 1TQDA 3A4MA 3K70D 4UNPA 2J7PA 1DS6A 2F6RA 1FTNA 1EFCA 3KQLA 1W1WA 4Y0AA 4UXJA 5CIQA 4D0GA 4CRWB 3QEJA 4AYXA 1TF5A 3P4YA 3BFKA 1DTSA 1G8YA 2BM1A 4HAVA 5FTJA 1XEXA 2F9LA 1ELOA 5ANRB 2KB0A 1H8HD 1R5OA 1JR3D 1LV7A 5H1YA 3MMPA 3VNUA 3U6BA 4FCTA 4TYWA 3UG6A 3EZFA 4Q03A 3QOFA 1F60A 3LX8A 3CB4A 4AKEA 3MWKA 2D4HA 1N6HA 4AG6A 3WYFA 2P5SA 2JLRA 1HURA 4A82A 4A92A 1VCMA 3GLFA 1E6CA 2AFHE 1MT0A 2IHBA 5EP2A 4TZ6A 1DAKA 4HLCA 2AXNA 4ZCLA 4ZPXA 2ANBA 2O8DA 2ZANA 3DMDA 4EJSA 1BYIA 4EFMA 4Z8XA 4OI4A 2J0QA 4DKXA 1II0A 5HKKD 4NYJQ 4C0BA 1F6BA 1Q20A 1N6NA 1VG0B 4C0LA 2ERYA 3KQUA 2WSMA 2O5VA 1NMYA 2D06A 1XX6A 2BJVA 4QNRA 3RRMA 4IXMA 3NEJA 3K0CC 4JBYA 4B6EA 1OB2A 3TR0A 1XJ0A 1F2TA 3VKWA 2A5FA 4DCTA 1YZLA 2WWFA 1D9ZA 3LXXA 4US0R 2R6CA 5JI2E 3SEAA 5EJEA 1ZD1A 1XD9A 4FMCF 1Q3TA 4O3MA 4DC9A 2FZLA 4PC7A 2OFXA 1CULC 5FOTA 1HE8B 1T91A 2PJZA 2A2ZA 1V5WA 2FFQA 5SZKB 5FOSA 5TARA 3UMSA 3QXJA 4IDNA 2GNOA 4BLRA 3FVQA 1TF2A 1OFHA 1SHZA 3QXCA 1AM4D 2ZE6A 3QKRB 2V9PA 3OEHD 4RJLA 3QXSA 3KB1A 5D3MA 1UAAA 1MABA 4GFDA 1KSJA 1XTQA 5IK2A 4UNQA 4E09A 1OJLA 3DHWC 4PC1A 2ZAMA 2G9NA 4M9QA 3VAAA 2V3CC 2CCJA 5DYGA 1E1RD 4JLAA 1OHHD 1E0AA 2IC5A 1M74A 3QENA 4NL4H 1R8SA 4FMCB 4KBGA 1VECA 4JLDA 4L16A 4NCJA 4US2R 4JBXA 2WOJA 4YXWA 1E1RA 2WJHA 4AIIA 4PC6A 3CF6R 1NN1A 3C5HA 2GZHA 3L2OB 2QM8A 1C4OA 1TUIA 2Z5FA 3KKQA 1HT2E 1N6RA 3IGFA 1Q1ZA 3CRQA 1GRRA 2PX0A 4I99A 3D31A 5BN4A 3EIQA 1S3SA 2RGNA 3P27A 4M1KA 3SHFA 1RRFA 3B6EA 2YOFA 1I4TD 4EAQA 3NDBB 4B34A 2CVHA 2LKCA 1W2GA 3RS0A 4PPGA 2GCNA 3GJ8A 3D8BA 1L7VC 1E79A 1GTVA 2GJAA 3D6TB 2F7SA 4B48A 4KYIB 4C9BA 3CWZA 4EKDA 1Z2AA 4V0LA 1GITA 5CITA 3R9IA 2ZUDA 3AP2A 4UJ5A 3U3RA 5IRCD 3EWSA 2O0KA 2HUPA 1UKZA 2BMEA 4W5WA 2OE2A 2OCBA 5CB8A 4LUCA 3K0FA 1P4SA 2ZI9A 4LV8B 4NKRA 4PZZA 3HPQA 121PA 3M6AA 3LLMA 3N2EA 1IAQA 4ARZB 3R8FA 2QBYA 1MKYA 1GNQA 4RD0A 3ZGXA 2F43A 1BYUA 3OIUA 3UIEA 4XSHA 4YMSA 2O8BA 3SDZA 3BFVA 2FSHA 2H8KA 3HR7A 5LD2B 3WBKA 1JR6A 3NH9A 5HPYB 3MRSA 5FUWA 1N5KA 4QJ3A 3ADBA 1FNMA 3KDSE 3P26A 2O8EB 3RRYA 3C15C 4J0QA 3CRRA 5LD2C 1TUEA 3CF2A 3AF0A 4Q00A 3KXIA 2OAP1 3JVUA 3TIFA 2YYZA 3TK1A 2H57A 3FKSD 221PA 4KYUA 1G17A 2A7QA 1KDTA 1U9IA 2OCAA 3EG5A 2Q9BA 1GILA 2AK3A 5IHPA 2VSXA 2VP2A 3LQQA 2FFHA 4RCZA 2A5DA 3BXZA 1CR1A 3LVQE 1EK0A 2FF7A 1P62B 5JCPA 5EUQB 1W0JA 2UZIR 3SOPA 4AD8A 3CKLA 4E03A 2CLSA 2GXQA 2QTHA 3KKPA 1ETUA 3BERA 1U8YA 1VKJA 3O8DA 1DADA 4URZR 1L2TA 1YZNA 2DFKB 2GESA 1R6BX 3GJ0A 1FUKA 4PHFA 3WRYC 4HLUA 5J5CA 3R9XA 2DPXA 2QZ4A 1AS3A 3AVQA 4OJQA 5TY0A 3W6NA 4EQ6B 4B75A 1M7HA 4R9UC 2OFWA 2JAQA 5JZVA 3IIMA 1U90A 2ZJ8A 1GL9B 1W44A 1T5LA 4BFXA 4GMDA 4YONB 3OIVA 3FGNA 4R2HA 2W00A 1CJKC 5J4VA 1IY0A 1YR8A 2CJWA 2V54A 3BJIC 4QJ5A 3ADCA 1Z06A 4II7A 3NH6A 2W83A 5CK5A 2PZGA 3FHOA 4W5JA 1EX6A 2FN4A 2VF8A 1JQLB 1M7BA 2VHCA 2GBLA 1T3LA 4LJ8A 5C1BA 4DLZA 1GZSA 4TTPA 4XJXA 2WWYA 4PSVA 1GUAA 5EXPA 8OHMA 2DBYA 5KSPA 4G5RA 4B44A 4MDFA 1RE0A 5K8TA 4A36A 3VR1A 2IEYA 4FWTA 4GP6A 2QPTA 2XXAA 4KAXA 3BAFA 4KVGA 521PA 3ZQ6A 2Y8EA 4ACBA 1N5JA 3AVUA 1TL7C 2QENA 3PVSA 3G0HA 2YINC 2CK3A 4BLTA 4HB0A 4A9AA 2HEIA 3S1AA 4JLNA 4QG7A 3DO6A 4HDCA 1DEKA 2Z0MA 3ADDA 4B32A 3NVAA 4Q01A 3EPLA 4DT1A 1NNEA 3IQWA 3L82B 4DCVA 1R7RA 1YR7A 2GDJA 2WJJA 2ZI3A 3U7GA 2VLIA 2YOHA 1EG7A 3FTQA 1J7KA 1CU1A 1Z6GA 4KLZA 1Z5ZA 5HZHA 1ZD9A 1VCNA 2A9KA 3R8CA 1N2CE 3B82A 4H1VA 2ZJZA 1IY1A 2ZETA 4URYR 4HB4A 3DEFA 4TQAA 2OXRA 3CNNA 3GPLA 3CR8A 2ORWA 1A5TA 4GSYA 5SZHB 1SXJA 4ASUD 2OAQ1 1TAGA 3NBFA 3QG1A 3K0EA 4Q1CA 3QNUA 2BBWA 4JVSB 4LBVA 2DYKA 3AKYA 4RFSB 4MRNA 4CGZA 1XZPA 1ZU4A 3F8TA 1Z6XA 1VIAA 3SBEA 1OH5A 4G0NA 1IN7A 3JZAA 4CEIB 2Q3FA 2XX3A 4FCVA 3W90A 5FPHA 2IYQA 1E9FA 1SVKA 3QQ5A 2XTMA 2Z4RA 4FIDA 2YC4C 1XEWX 2N1BA 1ZIPA 4F7WA 5FPTA 4NCIA 3GJ3A 3F5FA 4DDUA 2CBZA 5LB2A 1VIYA 1XTJA 1NN5A 2XSZD 3BB3A 4QL3A 4EPXA 3X1YA 1UEJA 2C9YA 4NONA 4C0HA 3RC8A 1VTKA 4M1WA 3BS4A 3W34A 4DLTA 4BASA 4TL8A 2ZJ5A 5FBWB 2P65A 2J7KA 2QMEA 2B21A 1CR0A 1NG9A 2ZRDA 3OAAD 1YVDA 3VR5A 3LV8A 1GP2A 4DHEA 2A5YB 5DN6A 2WWGA 3PEVA 3FHCB 2IWRA 4DZZA 1HQYE 3B9QA 3LNCA 1Q0UA 1Z0DA 4HUQB 4Z1MD 3PITA 4JIMA 4URXR 1CRPA 4HYYA 2QP3A 1W0KD 2XZLA 4TWZA 5TVKA 4WZ6A 4TMVA 4I1OA 3REFA 4BFVA 1DE0A 4UJ3A 3BH6A 3IBYA 3LA6A 3SR0A 1M2OB 1W0KA 4HZUB 1H65A 3EC1A 1DO0A 1E9SA 4BLSA 4NU0A 4E22A 5FBQB 2D2EA 3WNDA 1KY2A 4XWAA 5CDFE 3GLHE 3LWNA 1TPZA 5F98A 5C18A 2G88A 1TADA 1S4QA 3FWYA 1G41A 3QXHA 4FXPA 2EFGA 1C1YA 1R0ZA 1XXHA 3QPUA 2VP9A 5L3SA 4B43A 4ON9A 4TQUS 3NBXX 3QF4A 1KJZA 4US1R 3MWJA 5H8WA 3DDCA 1C9KA 1NY6A 2WSSD 4LK2A 1MH1A 4B71A 2AX4A 2XOKA 4KLNA 2P6RA 3QI2A 3BB1A 4P0TA 4K81B 4ACAA 1IY2A 5J4HA 3K9NA 4X8OA 1NF3A 4I81A 4JT4A 4JYCA 5FPKA 4KI0A 3E1SA 2BBSA 3DM9B 1IN6A 1Q1QA 2OILA 4IKEA 1IN8A 1M34E 1WBBA 4AKIA 1I4LD 3CNOA 4NCHA 3U44B 1ZRHA 4NTZA 2QI9C 1KYIA 2GK7A 3ZVNA 1Z83A 2ZEJA 2MSDB 2O8CA 4OK6A 1CJMA 2IK8A 1NVWQ 2OM2A 3QY0A 4O2RA 4P33A 4TT3D 1G291 1VPLA 4BUJA 3QF7A 3PG5A 5H70A 1NVVQ 2XGJA 1T0JB 1JXMA 2D7CA 1KIMA 1JQJC 1D5CA 3L0SA 4XVRA 5G3YA 4IOJA 5LB4A 5G3ZA 3C16C 2P6UA 3DZ8A 1RC8A 3QUSA 1G7RA 4V0NA 3RRZA 1EFRA 1N6KA 2DFNA 4LOAA 1LB1B 1XTKA 1ZCAA 1KI6A 2JIZD 2PCLA 1QF9A 3ECCA 3IKJA 4NYIR 4L8GA 3TW8B 2OBMA 4Q47A 3LH5A 4MA4A 2GCOB 2WKQA 2QM7A 1Z8FA 4BZXA 2ZI4A 3DKPA 3LO5A 3TBKA 5JSZB 4DLRA 2ZPTX 4IJMA 5CYOA 2GF9A 3OFND 1QG2A 2ZM5A 2J0VA 5KNCA 2G1JA 2ZVQX 3EWAA 3L8ZA 1OYYA 3OHMA 3AVXA 1P72A 4MRVA 3T1TA 2ZU0C 1ZM3A 5AJWA 2G6BA 1T4GA 4Z54A 3TVTA 2DFTA 2ODNA 1OF1A 3B85A 3WYAA 2DCUA 1NJFA 4C0SA 5JHGB 2RAPA 4BZQA 5K8UA 1KSGA 1YZUA 1W49A 3HR8A 3MLEA 5FI1B 4A6XA 3U3KA 3K09C 5FTNA 2D74A 1ZUHA 3LD9A 4B3DA 1Z07A 4XTRA 2XJ9A 3CR7A 1Q21A 2RCNA 3VTKA 5JWOA 1FZQA 1JXOA 4F38A 1JAIA 3M0EA 3KXLA 2FEMA 5EP3A 2WIAA 2JLZA 4Q4JB 1EGAA 3PEYA 3BWDD 4FMBB 1NSFA 4RZ3A 2DWOA 3QKSB 3RABA 4C4PA 3TVDA 1TTTA 2YWHA 4C0KA 3MCAA 1ESMA 2DWPA 2XZOA 3TRFA 4YMVA 3THOA 2ZJAA 4B33A 4AC9A 2FWRA 4LJ9A 1XMJA 3AF4A 3EPJA 4MGZR 1NI3A 3TAUA 1GVNB 3WNCA 4KSBA 3OIYA 4RZUA 4DLYA 1DAEA 1ZP6A 2GXAA 1YRAA 3QG5A 1BMFD 1PLJA 4M9ZA 1U94A 5AJXA 4D0LB 3T15A 3LXRA 1ZCBA 2HYDA 4UQOA 2XJ4A 4JKYA 4DLVA 2MSEB 2KI5A 2QORA 2XNDD 3K0AA 1RVDA 1TQ4A 3QIAA 4JS0A 4RD2A 2W6JD 3WXMA 4ZIRA 2EFCB 3AF1A 3A4NA 2MSCB 3L8YA 3V00A 1E1QA 5L8VA 1R10A 1T8TA 2BCGY 3VR4A 4DIDA 2P3SA 3OZXA 2B7CA 4YMWA 6Q21A 1FQJA 4L4UA 4PQFA 1YZTA 3NTUA 4B3FX 4HDOB 4QHTA 2QRNA 3A6PC 2CVFA 3A1TA 1ZNXA 5A4JA 1E2PA 3EZ2A 2RHMA 5E7JA 3AH8A 2X1VA 3GLIB 1IJEA 3FE2A 3TUIC 4G5SA 2C9OA 4TN1A 4F91B 3ZDQA 4MGYR 2UZ3A 1N5IA 1YU9A 5M04A 4OQLA 3UG7A 1JPJA 1RJ9A 3RANA 4ABYA 3W8RA 4CEHA 4Q4LA 3GFTA 2ZYWX 2DY1A 4M0LA 4G3XA 3PXGA 4C30A 1OFIA 3T5DA 5DHFA 1CF4A 3AKEA 3MSXA 3AKCA 1DAGA 2EWVA 3GD7A 4E07A 1NIJA 1GIAA 1NBMD 3IIKA 3VNVA 1ZUIA 2OLJA 4KBFA 2H92A 3RSLA 4PO9A 3GP8A 3UPUA 4MKFA 4RD6A 4ZO4A 4Q5IA 2ZE7A 5EE9A 1P61B 3TW4A 2H16A 1UM8A 2XTZA 2ZRIA 3OIWA 1GKYA 1NBMA 4JZKA 1QHXA 2JJ1A 2YNMA 2C95A 4JL5A 1HUQA 5FTKA 4Q4AB 3V4FA 3I61A 2QGZA 2NTYC 1FNNA 1LTQA 4IEEA 3I32A 1U0HC 1KMHA 5DHAA 5KTYA 2W0SA 1RW4A 4ZDJA 3EZ7A 2IXEA 2Z6VA 1XCPA 4NYMR 4PO1A 3F3YA 2DFLA 1T3HA 2OCPA 3U7EB 3THXA 2G77B 1E0KA 3KFXA 4TTRA 4MQBA 1YR6A 2I4IA 2BIFA 1T8UA 4QNMA 2R6GA 4MITA 3WY9A 1BOFA 2IBMA 4PPQA 3VR6A 4DB4A 4GI7A 1KO8A 4OK3A 3BH7A 2L0XA 1QHIA 3RSOA 2KWIA 4BFTA 4DEYA 3KKOA 5JS7A 5EE3A 1O3YA 3CPHA 5CM9C 4BLOA 4G5GA 3LW7A 1SKYB 1YZGA 3WHKA 4TLCA 1US8B 2ZYVX 2W6IA 2FZ4A 1IJFA 1G3QA 4DB2A 4BFZA 4CIDA 1L4YA 1AN0A 1XU4A 2A3RA 4HB2A 2REBA 2IW3A 4LSGA 4A2WA 4ZI3A 4MGKR 2ZSEA 4B76A 2UKDA 2X2FA 4HATA 4JLMA 1ZJ6A 1G6OA 2J0UB 3L0IB 3A1UA 5FBRB 1I2MA 3I8SA 1BS1A 4QRHA 2J9RA 5FOUA 4WXPA 2N46A 3Q8XB 4I4LA 2ZRMA 2XB2A 4IVQA 2X19A 3GCGA 2KE5A 4C3ZA 2J45A 621PA 5FL7D 4JYBA 1UBEA 2DR3A 5EE5B 1XMVA 3FMPB 2HLDD 5DLQC 4QBHA 1G7CA 1P9NA 4X8LA 3MWYW 4PSAA 4LJ6A 1CEEA 4V03A 3CRVA 2PEZA 4BLQA 2OHFA 4LBZA 1E9CA 1G3IA 5KDOA 3FMFA 1E4VA 3X2SA 2IS4A 4URWR 2HJVA 3X1ZA 4DSTA 1A82A 4S35A 5JECA 2JEOA 1H8HA 2C03A 1G16A 3QEOA 1JR3A 2ZSDA 3ZJYA 2CNWD 3LQRA 3K70C 5CB6A 4UXIA 3QVVA 4G5QA 3KZ1E 1OH6A 4GT1A 1FP6A 2HT6A 3H0KA 1COWD 3GLFE 4EPRA 4BFYA 4TSFD 4LJ4A 2D3WA 3M1IA 3RS7A 3SQWA 4LCBA 2ZRAA 4R2IA 1ZNYA 3AKDA 4B35A 5BN5A 2VHJA 3VKHA 4Q1BA 5JJIA 4RZ2A 1ONBA 2DB3A 1Q44A 1P73A 1WB9A 4BEBA 5FH9A 2ZE8A 1LW7A 2PLRA 3IBGA 3WMFA 3R7WA 2O8DB 4BRWA 3I62A 4EJSB 2REXB 1LVGA 3N70A 5HKKA 4N0DA 2VH5R 1FMJA 2WWHA 2V7QD 5CK4A 1PUIA 4E5UA 1E2EA 4Q1EA 3U3MA 5A0FA 4QBFA 4KJZA 4EJSC 3IEVA 4PFSA 2VO1A 5TV2A 1F48A 2ZRHA 4Q1FA 5E3HA 3WRXC 1HT1E 3DPUA 5DI3A 3B8HA 1W5TA 4H9GA 5BYJA 1YHNA 4Q7MB 2Q3HA 2PMDA 1DO2A 2JJ2D 2VEDA 4AURA 3P32A 5A5GA 5AUOB 5JRJA 2WZQA 1G3MA 4JMPA 4P4TA 1Z2CA 2AD5A 5GJBA 5IDVA 4DJTA 5L3QB 3SJAA 5FL3A 3CONA 5KPJA 1XRJA 1OFUX 4D4LA 4ZI2A 2AWOA 4D4KA 1R2QA 2NO9A 4YDSA 3OEHA 4GMXA 1GKUB 3LX5A 3UWKA 5FUYA 2W58A 1W5SA 4KITB 1MOZA 3GEIA 3ICEA 2G0NA 3RS5A 3DL0A 3THWA 4QBGB 1MABB 5D3QA 2EFDB 2GHIA 1AS0A 1OHHA 5EZ6B 3T12A 2W2VA 5K8IA 1F2UA 2K5UA 5DSZA 4KFRA 4LC0A 2WJYA 1I4DD 3B1YA 1S1CA 2ZRCA 4MYTA 4TLDA 3CRMA 1KK1A 4V0MA 5JLJA 2VPPA 4DLXA 1G3UA 1NN3A 2VF7A 2EU8A 3CRW1 2P0EA 4ILEA 4RY2A 4V0ME 3HU2A 4LBYA 5TDHA 4DCNA 4D26A 4U7DA 1FFHA 2OT3B 3ZYCA 1G64A 2HXSA 4QGAA 2VTKA 3B1WA 4YQFA 3TQFA 4NYJR 4OJKA 4Q66C 2P5TB 4JBWA 1N0VC 3EZ9A 2ODEA 3THYA 3U3JA 5EZ5A 2FSIA 2ZVPX 1KGDA 4R7ZA 5K8LA 4BEJA 2Q0HA 3GJ4A 2RGNC 4OL0A 2PZEA 4I1VA 1K8RA 2ZI6A 1G7TA 4MRRA 2PEYA 4A1FA 2EFHB 3G82C 2B7BA 3LAWA 3Q7PA 4PZLA 1IHUA 1NVXQ 2QPOA 3DOFA 3X1WA 4OHYA 4RCYA 2YWGA 4DIEA 1TEXA 2IEZA 2ZREA 2ZQ5A 5EQTA 3HPRA 2R6FA 1KI3A 4JT2A 1G6HA 2JDID 4OQXA 4KU4A 3LFUA 2QMOA 1UKYA 2WKPA 1XMIA 3SHWA 5EXTA 3SYKA 3K0FB 4JLJA 4ARZA 4XVQA 1P2UA 3WMEA 4WIAA 1GNRA 3SBDA 2QMHA 3DOEA 4AI6A 4JL6A 1X8KA 3SNHA 1E3MA 4DLWA 2F43B 2PZFA 1HV8A 4PC2A 4YDHB 2O8BB 1CP2A 2OV2A 4FMDF 1SULA 2NO6A 1Z0KA 1FW6A 4S2EA 3RDPA 5FR2A 2ZIAA 4NH0A 1E2QA 1W36B 2IYUA 3UMRA 1EFTA 1G18A 2Z43A 1ZVQA 4ZDWA 3VX3A 3K8YA 3FKSA 4TYPA 1KTVA 1KNQA 2R9VA 3JZMA 4HAUA 1W36C 2HCJB 1L8QA 3REGA 3WP0A 3OF5A 2KSQA 1ZINA 3BOSA 3B13B 4POAA 3I5YA 4Q48A 2ZROA 1AS2A 1E4YA 1JEEA 3BE4A 1H8ED 5FUXA 4WAUA 1Z6TA 1VCOA 1PVOA 4HLDA 1U9IC 1G5RA 4R71A 2REOA 5KHOC 1GM5A 4NCKA 821PA 4GRAA 2ZJYA 5EE0A 1FL9A 1ZM4A 5BYKA 4O25A 3KJHA 4FMDB 4TYNA 2CCKA 3L0PA 5L3VA 2NQ2C 5EXSA 2O52A 5JWRA 4Q02A 1HY3A 2ZS9A 3W3ZB 1ODFA 1G3RA 4Q1DA 3SU8A 4HLUC 2ANCA 3AVYA 1E99A 1DARA 2H1LA 4XWOA 1Z0JA 2ZITA 1XP8A 2FPMA 4JLPA 3P4XA 4Q9KA 5KNBA 2F55A 2GF0A 1IXRC 2RKOA 3N2IA 4LGMA 5GJCA 2ZR0A 3B7GA 4IOMA 3CUEF 3B1VA 1BO6A 3HDTA 4CYMA 1E98A 3J81k 4URUR 1OXUA 1XEWY 2ZI5A 1J8MF 4MUAA 4QFMA 3NEYA 3KQKA 3KQNA 4D4MA 4KO8A 1JJVA 4KODA 3B60A 2ODWA 1E9RA 4JJZA 2GBLC 1S2MA 4K8OA 1EX7A 3CLVA 1NKTA 3EA0A 4TZ0A 2FSFA 2XXAB 2AN9A 1KDOA 5E4FA 1WBDA 1J90A 3GQBA 4LBWA 2OSBA 1FUUA 4HAXA 1T5IA 1AA9A 2A5GA 3HU1A 3S1AB 4LV5B 4RZXA 3RAPR 1KK2A 2JLXA 4IW3B 4DT1B 2RGEA 1I2DA 2WKRA 3OE7D 1W4BA 3IIJA 3U61B 3Q5DA 5FOWA 2EWWA 4M1TA 2OBNA 2E1RA 3U7FB 3PV0A 3U7HB 3B1ZA 1SXJE 2RGBA 4W7SA 2C98A 1Z6AA 4XTCS 5F3WB 3NHBA 2ONKA 4QHSA 4ASUA 2OFOA 5KU1A 1OE0A 3FHTA 2AKAB 3SJZA 1CS4C 1KDPA 4KHZA 4DRZA 4EUNA 1LY1A 1S0UA 1SXJB 5FBVB 4F92B 4TMWA 4RVCA 4ZDIA 2GZDA 2LWIA 4PR0A 1EWRA 2FMXA 1JECA 2NO7A 3CZPA 1DG3A 1SXJC 2C96A 1OYWA 4Q1AA 3W6PA 3BRWD 3EA5A 1D6JA 3ASZA 1GG2A 5CJ2A 2ZE5A 4QHYA 2ZRJA 3VQTA 3QJYA 1QDEA 3K9HA 5ELXA 2SHKA 4BPBA 2GCPA 4MYHA 3KJEA 4IOKA 2ZU6A 4ZCIA 1J8YF 1GNPA 1M8PA 3AF2A 2VQSA 2QA5A 4B74A 2XSZA 3EARA 1E0SA 1WDTA 4IFEA 4NHOA 1X86B 5E7IA 1Z08A 3T5GA 1J2JA 2ZRGA 2ZRPA 3IHWA 2D7DA 4XIGS 5JS8A 3LVRE 2WPDD 3OAAA 1KZ7B 3SI7A 3VHXA 4DEXA 3RNLA 2QL6A 2OZEA 3PENA 5G53C 1SVOA 1QVRA 1V43A 1YQTA 2EQBA 3K9LA 1OSNA 3R9WA 5AUNB 5KDLA 2VHTA 3ADKA 4GOXA 1DAFA 3H84A 4GZLA 4Z1MA 1GDDA 2W2TA 2FPKA 5AJYA 3WYGA 1G4UR 4TYQA 3QPVA 1DOAA 2X77A 2FNAA 4UXHA 3U60B 4L9WA 2ZSAA 2G3YA 2Q6TA 2QQEA 1AGPA 2VP0A 3DM5A 2IYWA 4G1UC 1G5PA 3AB3A 3ZZ0A 4WW0A 1S9HA 5E95A 1XPOA 4MH0R 4MRPA 2AD1A 4AKGA 1RRPA 5SZIA 3WHLA 3GLHB 1XXHE 3QXXA 1RRGA 1SVIA 4JVMA 2ERXA 4OHVA 2XB4A 1NIPA 1E9AA 2QTFA 2GXUA 3IUYA 1XFAA 3AF3A 5GADl 1II8A 2OBLA 2QP9X 4A6PA 2MMCA 4FI3C 3SQXA 2O8FA 3QF4B 3T34A 2WSSA 3AGPA 4RFVA 3RWOA 1ZD8A 1GRNA 2ASEA 4PX9A 3ZLJA 1U8ZA 3QPWA 4A8JA 2EYUA 1UADA 4AKHA 2VP5A 3N5CA 1IXZA 3FOZA 3ZZTA 4WVFA 5F2EA 2BCJQ 3SZRA 5HCNA 2FJUA 1EXMA 1TF7A 3A58B 1UEIA 4I1UA 4C0JA 4GNKA 5JHHB 4DCUA 4DUGD 3EPKA 2ECKA 2FE4A 2C77A 1P3JA 2CL7X 4MYCA 2H7VA 2TMKA 2O8CB 4TT3A 1VYTA 3KB2A 2PT5A 4MKGA 3SN6A 1X6VA 4K46A 4RD1A 1QHYA 2N42A 1ZUNB 1KZGB 3UANA 3A8TA 1K6MA 2JIZA 5AJVB 5J4KA 4JKIA 2WBLC 4IDHA 5L3RA 4MUBA 1E94E 1QHHB 3DZDA 4F4CA 4PANA 3R20A 1KK3A 4TL7A 3GEEA 3CX7A 3OEED 1Z0FA 5JSZA 3MFYA 4WOPA 1KAGA 4C7OB 2EFEB 5LPNA 3BBPA 3OFNA 1HA3A 1NMXA 2GEVA 1LNZA 2WWXA 4HDQB 1EFHA 1Q3HA 1IXSB 1WE2A 1E32A 2F1IA 3DVLA 1UFQA 4AYWA 1TMKA 4WXRA 1DAHA 4QKQA 1IONA 4RD3A 3C5CA 1NP6A 4PPFA 4RD4A 1IN4A 1P9RA 3ZS9A 3T06B 4BFSA 1KO1A 2QE7D 2R6DA 4I1SA 4NE2A 5LBIA 2C5LA 1WF3A 1Y63A 3L0OA 1WCV1 2ZRNA 2QTVB 2ZRKA 1KI1A 2QRZA 5KSYA 1A4RA 3C7KA 4QXAA 1E2KA 5B57C 3SJBA 1XJQA 3AP1A 4Q4JA 1IQPA 1BKDR 1A1VA 5HTKA 2PL3A 2QAJA 3TSZA 5KNDA 4JLOA 2XITA 3QKSA 1QBKC 3O8RA 4OHWA 4PC3A 2ZYUX 5GVSA 1DAMA 5BW8A 2NGRA 2QSYA 2QG6A 3D3QA 2YC2C 1YKSA 4ZKDA 4LRWA 1NVVR 2F1JA 4HAYA 1E69A 4IOLA 1ZNWA 4DCSA 3U4QA 1OXVA 1CIPA 4OI2A 5JMTA 1BMFA 3BFXA 4JVLA 4P31A 2WTUA 1JPNA 4QGFA 3VU9B 3ZIAD 2ZS8A 2ZRLA 2CHQA 3C8UA 3VMFA 2J41A 1OIWA 2BMDA 2GEDA 4IEIA 2HV8A 4D6PA 1NG1A 2ATXA 2XNDA 3BIFA 4PAOA 4LY6A 4LV6A 4TMTA 4MGIR 2W6JA 1S8FA 2V55B 1NY5A 3ND9A 3K0AB 2I3BA 2VYFA 4EIWA 2FFAA 4ZIRB 2C8VA 1SVMA 2CDNA 1SKQA 2GTPA 1Z29A 4GZMA 1XD2A 4KFSA 2CE7A 4HAZA 4CT4B 3IPYA 4EFLA 3T61A 5H68A 1E9BA 1TQ2A 5B64A 1ZYUA 4ZDKA 1A2KC 1OLOA 2C04A 3IILA 4TL6A 4PAQA 1LS1A 3LRPA 3H4MA 1SHKA 1CR4A 2NOAA 2BV3A 2VP6A 3GLGA 2R65A 4U00A 3NDPA 3ASYA 3PR1A 3W9YA 2J3EA 1G9XA 1OPXA 2YV5A 4Q19A 4TMZA 1N5LA 3KKMA 3GLGE 1BH2A 1XTRA 4GOJA 3BD9A 2YVUA 1FOEB 2H18A 4CEHB 4DLSA 2G0TA 2F9MA 5KSOA 4BE7B 1TU4A 1Z0IA 3HU3A 4F93B 1CLUA 2RGDA 4LHXA 1UBFA 3QKUA 2ZSFA 2WOOA 3X1XA 2QAGA 3GJXC 4IXNA 4P4SA 4TMKA 4B3XA 2Z83A 3CNLA 1N25A 2XNSA 1PJRA 1U2RA 4YC7A 1E2HA 3NBYC 4JSTA 5JWHA 5FUVA 5FR1A 3RC3A 1NBME 3A37A 1A2BA 4M9SA 4GL2A 1N6OA 4M22A 1X1RA 4FW9A 4OHZA 3A1VA 1VG9B 3I92A 3ZZUA 2OESA 3AGQA 2YJTD 2NPFA 1XBTA 4X8HA 4Q18A 3FFAA 1LF0A 4TL9A 3WMGA 2FH5B 1TEVA 1TU3A 2RGAA 5DIFA 2ODBA 2ZR7A 5HZKA 1U98A 4PHHA 1S1MA 1KMHB 1XCGB 1CJUC 4LYJA 5DE3A 1R0YA 4XD7D 1G7SA 1E9DA 2C99A 4CEJA 3LBNA 4OQMA 3THXB 1P75A 3KTAB 4LPSA 2ZXUA 3SE0A 3KX2A 4UNNA 3LLUA 1HH4A 3TSWA 5G41A 1W7AA 2CL0X 3QBTA 2QUZA 1AKEA 2VP4A 1A7JA 4JSYA 5HCIA 1FX0A 4D2IA 4ZCMA 1FQKA 1OKKD 3FB4A 1JEDA 2PT7A 2V8OA 4FCWA 4BWYA 2GVZC 1US8A 1T3SA 4Q4HB 3GJ7A 2DWQA 5P21A 4XWKA 3SC3A 1U0JA 1Z22A 4B6FA 4DDTA 3CIOA 4DBLC 1OT3A 1KO4A 4BLPA 5C2JB 2CE2X 2VRWA 2JLYA 1LF5A 2BEJA 4LYHA 1GWNA 2FX3A 2R2AA 3CZQA 3KKNA 4L9SA 2GETA 3AEZA 3W6OA 1NJGA 2IYZA 2KBEA 3MWLA 2RHDA 4HUTA 3KQHA 3IO3A 4V0OA 1DPFA 5FFMA 3MAAC 5FL7A 3PUWA 1P2VA 4QGHA 2HLDA 5EP4A 3EC2A 2J7PD 3TSOA 2OXCA 1KI7A 4IFBA 4PO8A 1XJCA 1P60A 5J40A 4IDQA 3RHFA 2PBRA 3SYLA 1P2SA 1YRBA 1NKSA 1AQYA 4DVGA 2IA5A 1YR9A 3L43A 3K70B 2R44A 4TQ9A 4XH9B 2VSFA 4GDFA 4PAMA 1EFUA 1XEXB 2O0HA 2CLCX 5JI3E 1HTWA 3MJRA 4WBSA 3AVTA 1IN5A 2RGCA 1JR3E 1QRAA 5FOVA 5FOXA 3HYRA 5UKDA 2FGKA 2JLVA 1D2NA 2QSZA 4DSOA 3T1VA 4ESVA 4TLBA 2H5EA 2BKEA 4Q9IA 2CNWA 2CLDX 3VHLB 721PA 2OCYC 2GAAA 2ZI7A 4QJ4A 5AUPB 5JRZA 4EPWA 2RH5A 1OW3B 1RPZA 3Q85A 3BH0A 3E5HA 3GLFB 2BBTA 1COWA 1X8JA 4TSFA 2BM0A 1RYFA 2G83A 1E0JA 3C14C 3CWQA 1OB5A 2ZAOA 3K0CA 1G1MA 1QZXA 4M1OA 1N3BA 3GJ5A 2VIIA 1UF9A 2HF8A 4H1UA 1G8HA 1CBUA 2YWEA 3IDQA 2BJWA 3WNBA 1F5NA 2E9SA 3R7WB 1KJYA 2V7QA 2JGNA 1Z0AA 1CRQA 2NIPA 1F2TB 1YE8A 2MMGA 3KUDA 2CXXA 1GSIA 3EZ6A 3A1SA 4D4JA 1UJ2A 3CO5A 4OQNA 2GK6A 4QGGA 2GVDC 3TNFA 3EXAA 5KPDA 3CH5A 3QSYA 3NG1A 5DI3B 2OG2A 2JJ2A 5DNYB 1S3GA 5BWMA 3NXSA 2IS1A 1U99A 2P6NA 1AJEA 3QKRA 5JJKA 2WAYA 2IWHA 5L3QA 2B92A 4QC2A 3ETLA 1RKBA 2YKGA 1WXQA 1ZM9A 2XEXA 2BKUA 3QE0A 4AYTA 3DMNA 1FMLA 4TTQA 4Q7LA 4ERNA 1UKVY 1OFTA 5D3MB 2IS2A 1ZC3A 1UPTA 5IK2D 1TNDA 3SS8A 3ZVRA 2X8AA 2ZUBA 1CXZA 3FDIA 3I3SR 4DXAA 2HYIC 2IS6A 1KOFA 4NPHA 2WHXA 1SGWA 2C2HA 3OESA 3ZQJA 1M7GA 2V4ZA 1GL7A 4M1YA 3THWB 3P1JA 4JLBA 4PXAA 4YXWD 5DGXA 3TAHA 5C4MA 2NG1A 4B73A 1G8PA 3AV0B 2QGNA 1F2UB 3TKLA 3LDAA 5BXQC 3WP1B 421PA 3Q3JB 1KAOA 2B8WA 5FPYA 4EPYA 3U5ZB 3E2IA 2KBFA 1RRCA 4L15A 5DH9A 1P5ZB 3AM1A 1AKYA 3MD0A 2P67A
chains in the Genus database with same CATH superfamily
3LX6A 4Z49A 3PNVA 4B2IA 2X76A 4HEJA 4ZOBA 2CMFA 1JWLA 1INLA 1B8VA 2W4QA 5TF0A 1ZIOA 3LT1A 2Q6KA 1KMQA 5FO1A 3T7AA 1PJZA 1U31A 3AUXA 3ZKWB 5CLLA 3OM9A 4CU5A 2Z56A 4FNGA 4L3WA 1E79D 1GPBA 5AWFC 3PUYA 1YKGA 4BQIA 4QUDA 1UAYA 3C4QA 2AI2A 3QW4B 2OQVA 4QM6A 3W9BA 3VNQA 4D5GA 4D42A 3WADA 2WMDA 2HD4A 3KOXA 4E0BA 1Q1AA 1DVRA 4UEJA 3U0BA 5J2TB 1HG0A 1TM1E 1TYCA 1CQIA 3OKAA 3PQ6A 3EW9A 4A0QA 1Q5PA 4A0HA 2ZPAA 2G1KA 4GMKA 4JB2A 3KJIA 1U04A 4KLRA 3UUGA 4D3FA 4LHWA 4D9NA 2WR8A 3BK7A 1MVNA 3I72A 1GUDA 2A9PA 3N0WA 3PNLA 2IKQA 3E23A 3SSOA 3ZWDA 5BNZA 3M9WA 3FLMA 1H1DA 3AK4A 4WXMA 2YVLA 4TX1A 3R8XA 1HOTA 1P2DA 2G28A 2Q4BA 3PF8A 1ZR4A 2O8EA 4O59O 4MAFA 2QM0A 3O03A 3RWBA 2HMSA 1P3Y1 1N6LA 2XCRB 1RXSA 1AXEA 5FV4A 1GNSA 1Q92A 1LBHA 2YHIB 5G1PA 3PF9A 5E1MA 4IDEA 2C7PA 3B53X 2JI8A 3DE1X 3BIJA 4HSEA 5EIHA 4A73A 4YX9A 2IHJA 1JZTA 3UC9A 3H87A 1PG5A 3WGIA 4D3YA 1T2UA 2AW5A 4TLEA 5IF9A 1JJAA 5L9AA 3LX4A 2UZ0A 4TT8A 3K2QA 4HB3A 1CK4A 4OHXA 4U7WA 4D0NA 3FBTA 3WLSA 4KPYA 2CJXA 1AGRA 1JH9A 5JT1A 5FHQA 1XQXA 2ZZMA 4FYHA 1LJUA 4M4SA 4PCLA 4PE5B 4I5FA 1NJSA 2IYRA 1BFDA 4QX6A 4X85A 4KFTA 1XPUA 3T9AA 3C3JA 4OQ4A 2H9YA 3I6MA 3P0EA 1RYYA 4P93A 2P2DA 1DL5A 4LYAA 1NUSA 4WY8A 4G01B 3V8EA 3ZWAA 1I3LA 1VG1A 4NAHA 4NESA 4Z7NB 1N5DA 2DLDA 2QTRA 2ZRBA 4LPKA 4R1PA 5DNWA 4C78A 3ZVKA 1YC2A 2AR7A 3KB8A 3IRVA 4GE0A 3WL4A 1ZKMA 4OSPA 3UGTA 2R5FA 2GF2A 4X6UA 3V4LA 3AP3A 3NTOA 3QVOA 4JOBA 5F3RA 3TWOA 4P0QB 4GMHA 2JCSA 1PZHA 4TMXA 1L5KA 5BN3A 1Y8QB 1XA4A 5CM8B 3ER8A 2UYHA 1J25A 3HYNA 1O94D 3UMJA 1GPUA 2CJWB 2Q3LA 2P6OA 5K3OA 4EHDA 2NZYA 3DFFA 1IBMB 1E58A 1UM9B 4MCJA 5H0IA 3TW6A 1AKNA 2G08A 5DM2A 2VHXA 2QRPA 3H13A 3RWMB 3T9CA 3QUQA 2HQOA 3UHPA 2CYBA 2VKQA 3W3AA 5DISB 2XVAA 4BJHB 3CLUD 1JJ7A 4ENUA 1IAVA 3C87A 1JFRA 1RYBA 1U3GA 1O58A 3N28A 4RM2A 1KSHA 2VSOA 3DLIA 3CWCA 3TAXA 4F4UA 1VL2A 1MO3A 1W5AA 3HBNA 5FNZA 2AG0A 1E5LA 1JLLB 2HNBA 2ALJA 2D1TA 5DTJA 5TLSA 4MWDA 2MU1A 2NZJA 4Q6BA 5F1PA 3W9UA 1AZTA 1T9DA 3E9QA 1ADCA 5IKMA 2LDBA 3O8CA 2IF2A 4LGYA 2B25A 2JATA 4WXYB 1ACLA 3WL6A 4D8WA 3H1GA 1QP7A 1N33B 2HMYB 1A9PA 3V4RA 1USKA 1XU9A 4DLKA 1QHGA 1C30B 5B37A 4Z7JA 5JAPA 3OKCA 3L7CA 4CMEC 2VTDA 2AR9A 4M7RA 5C53B 3EQ9A 2D5AA 1OBOA 2RHCA 3NKLA 2O2DA 4KMMA 3PKIA 1RIIA 3OE7A 2RHTA 1GA4A 1KI8A 3N9IA 3PUVA 3H4VA 3I5MA 4Y67A 2Q5IA 3OCUA 3CLHA 1CYEA 3N1UA 2PLFA 2VDJA 1USWA 1BXRB 2GZAA 3CBQA 4KXFB 5CYPA 1KK0A 1D2GA 1HO3A 3MOGA 1YH3A 2JAHA 5IDQA 4EHBA 3BGOS 1LPOA 3HXKA 3B12A 5FWXA 2FDCA 4JP5A 4ZU3A 3MOSA 4UU1A 3P9IA 1AKTA 4TLAA 4BFWA 1I1QB 1ONPA 1HX7A 1KH2A 2UYYA 3VTZA 1BX3A 3W5VA 4ZZ2A 4CT5A 3ERCA 5TQ0B 1HYQA 1ORIA 1JILA 1LLQA 2GFQA 2M1ZA 3H05A 3CNQS 3OQNA 1Z6ZA 4BNDA 4YMUA 1Z62A 1X8XA 4GOND 3A31A 3F7OA 3QVLA 2NUAB 2I3DA 5D84A 1X9IA 1TX4B 2PGJA 3JX9A 4OB8A 2P69A 4IJWA 2GN8A 3AY0A 3DKVA 1W52X 4GPAA 3ZWPA 2XLCA 1W4AA 4ZZ1A 1JSCA 4HX9A 2O8NA 4WKPA 4B3CA 2FUG1 2ZBVA 3U2QA 1XZAA 1N2EA 4GPTA 1X7XB 1FZTA 1RAGA 1XZBA 4IRUB 4BO9A 2PUDA 3VR5D 3OZFA 1QYDA 2WIBA 4AUKA 5JJBA 1AIPA 3B9PA 5M29A 3FROA 2P1RA 2XCUA 4B47A 3LK7A 1NLZA 3PGMA 5JAOA 1C1XB 4YV7A 4EHNA 4Y9SA 5DO9A 4E4RA 1YJQA 2XDWA 3EIXA 1VSUA 4N8DA 4BMNA 3AHHA 2I1QA 3I4CA 2NO0A 1P4JA 3PRYA 3AUFA 1PBNA 2EKZA 3EIEA 4WN3A 3DLAA 1QIIA 3FHLA 4RZHA 2GT1A 2J3IA 1D2RA 3E70C 3WGUA 2F67A 4OMDA 1Y0BA 3GT7A 3VVLA 4JH0A 1ZVVA 2WJIA 1Y1KE 2Z9DA 2GXSA 3B51X 4HZUA 2H9IA 3ZGYA 1UBKS 4YRLA 4I55A 1K7CA 4P8RA 2LCQA 4EHJA 1F8GA 2R62A 1NQAO 4OXNA 4EVIA 3ANSA 1V4BA 4WBNF 3DB1A 2G36A 1P29A 4LYFA 1IE3A 1IOLA 2QT0A 3HLTA 3DMPA 4FNMA 3DOIA 1KO5A 4YA6A 2IXGA 5H16A 2XHZA 2AK2A 4BN4A 4IVNA 1SWWA 2HK7A 3LHKA 3ZXXA 1E77A 2YH2A 1YS7A 1V1MB 3FYUB 2HADA 5FTMA 3CPJB 3FUVA 4WZAA 5JLAA 1J5XA 3U9SA 5HE8A 4RKEA 2FFBA 1NL3A 3KQQA 4U5XA 1ZH0A 1XLTA 2G17A 2ZQZA 3E22A 2UZ4A 5JEDA 4M53A 3CPEA 4WZAE 5SZJA 3V8RA 2ZSKA 4RX1A 1II8B 3SJUA 3MYRA 5I4CA 3OTQA 1MO5A 3BX1A 3VDQA 3NDIA 2OHOA 1FTSA 1X7HA 2O8FB 4FFNA 4F4IA 3WLHA 5C9ZA 5AUQA 2R8RA 1II9A 2QUJA 2O3QA 4V02A 4FGUA 4F4JA 2K4MA 2JIBA 2GJ9A 3STYA 3EIHA 2FI1A 1JA0A 1XMOB 1I0ZA 4G63A 4FEAA 4ZP1A 3DO8A 3I1FA 5I5GA 1PSZA 3HP1A 5KYWB 2XUAA 3AR5A 4JU8A 4PNHA 3ZJ4A 3JS5A 2WWWA 5IT0A 1UKEA 1HT0A 1NMZA 2WUWE 1SCKA 4GH5A 2YOGA 3DYBA 3C4VA 2ZWOA 3IO5A 3QNMA 4KIWA 4RORA 4U0KA 3EYAA 3ZXUB 4B82A 3KT3A 4DDVA 4PG7A 4W5QA 4S3MA 1TYEB 3WK8A 4OLFA 5HF5A 1T4DA 2F1RA 5IAEA 4WXHA 5KZMB 1BZYA 3AR9A 4JOQA 3S7ZA 4DIOA 1MAUA 2JAOA 2NVOA 2R1TB 2NPIA 1DV1A 2W2PA 2XKAA 3CH4B 3FR8A 4L4SA 4TKZA 3RC9A 3TLXA 2J3MA 3K6SA 1KXZA 2VK8A 1C80A 4OD0A 1JEYA 1VI6A 2J85A 2BHRA 4OQFA 1L5HB 3IAM1 4MKXA 3ZCVA 2AFIA 1TVEA 2QQFA 3U6KA 3NEAA 2H7YA 2DJ5A 5ADWA 3S8YA 1XXLA 1FUEA 4NMXB 4YMTA 3GLRA 1G20A 1PG2A 1DG1G 2AFIE 2B5OA 2CLHB 2XQGA 3OEEA 5HE9A 1ADYA 4B80A 4C7OA 3T1OA 4UTVA 1RWVA 1G20E 3TQQA 4AJNA 3FIUA 1FRQA 1VE5A 1X70A 1PL0A 2I9PA 2XAAA 2C54A 3AHJA 1LH0A 3K94A 1C9EA 1IOZA 3TLAA 3AY7A 2C57A 2DQ4A 4CUZA 4H18A 1VOTA 3NC1C 3ET5A 3GP5A 3FNBA 2VL7A 3GVCA 1CY8A 2TMGA 4DMGA 2QYTA 3R4CA 2C59A 2NXEA 2FX2A 3BIWA 1C0LA 1YL5A 5CH8A 3VKGA 3QITA 4DHWA 3AR6A 2NXJA 1G5TA 3D6AA 1FU7A 4OFXA 1DO8A 2Q5EA 4ERXA 2ZS7A 3PJDA 4AZ0A 4I5EA 4KV9A 1Z47A 2PSSA 2Q28A 1JQKA 2HF9A 3IYLW 4DL9A 4DMFA 2J67A 1NM5C 1B23P 3DUFB 4RPLA 4I8IA 3FWKA 1W19A 2AGVA 2OV4A 3HBJA 4RLSA 4ESEA 4LHVA 4XRRA 2C7BA 2VATA 1BX0A 2NSYA 5JBIA 1L4FA 4LJYA 4Y6SA 5DSXA 4BY9E 1DKLA 2IHYA 1IWOA 1KNXA 4GLJA 3C3CA 1HL3A 3H6HA 5CB4B 5FWNA 3JYPA 3WHIA 4RGBA 4DUYB 4HFMA 3ZIDA 2RMKA 1KI9A 1EE9A 2AVNA 2MDTA 2QL9A 1Q0LA 1T9HA 3IIIA 3A3KA 4TTVA 4JJKA 4FVTA 1YVEI 4CZ2A 3TG2A 3WQSB 4Q3OA 2CMKA 2IZ6A 2JASA 3RIMA 4YUWA 4LF4B 1SY7A 5LBUA 4XLZA 2R8YA 3AZQA 4NNPA 4I14A 1FJHA 5JAZA 2R96A 1OXSC 5DLPA 1A8UA 7MHTA 1D9XA 4EG8A 4Q3KA 2OUKA 1SBQA 4MRAA 4MICA 2EW1A 2H63A 4HLQB 4N7JA 2ZKLA 1YZKA 2ZTSA 1CRZA 3ELBA 3I05A 4HADA 1ZM2A 1TFUA 2GJ4A 2Q9AA 4E5SA 4HXFB 3BK2A 4O3FA 4NABA 5JDCC 3TQIA 2IYXA 1RYEA 4N03A 1XD2B 2CLFB 4EVRA 4M54A 1WA5A 5CLIA 4MMXB 5KWJA 1E7MA 1WB4A 2NUTB 3Q0TA 4WY2A 1U9CA 1ZAKA 5HF9A 4J29A 4M1MA 4R1NA 1KC1A 1RJ9B 3M83A 3KT0A 4E31A 1R0BA 1EVZA 3GMTA 1PZMA 4J0DA 3PICA 2JBHA 4DREA 3DH0A 1WUJS 4J0IA 3KXDA 1RPJA 4E2FA 4YJ2F 1H6AA 4XGQA 1W581 3LM8A 3DOJA 4KZPA 5JIBA 2V7XA 4M9XA 1H4SA 2C5EA 4AJOA 2NZ8A 3EDQA 5C34B 3RS3A 1BE1A 1L4UA 2X0KA 1OI3A 2Y77A 5AFSA 1VKNA 4DPLA 5F12A 3PQEA 4CV1A 1LFAA 4OI0A 3UFXB 4GPEA 3EF3A 5KX5A 3RRXA 2DLCX 3AUAA 4I3GA 2YNMD 4YRPA 1H3EA 1T6ZA 1SVLA 1GPLA 1N0WA 5BQ5A 2I71A 1JKJA 2DKNA 4CTKA 2BFMA 1XB2A 2Z09A 2F59A 4HS4A 4MTLA 2FN3A 2XA2A 3RYFB 4D9CA 2CFCA 1SIWA 2Q9CA 2WJVA 1EJ0A 4B4KA 2NTJA 4W9MC 2GD0A 5IZCC 1ESEA 1GPH1 1W48A 1TZ2A 4GLLA 1AKMA 2YRXA 4R1QA 5C7OO 3W5DA 2QDXA 1NAIA 1QO9A 1PTJC 1WHSB 3HTXA 1VHTA 2QS9A 3OCCA 4B4DA 4AS1A 3AFHA 2F48A 3IXLA 3FZQA 4GF5A 2J87A 1JIIA 1UDWA 1P7PA 4P58A 3UPDA 5B5SA 2PUGA 3UT5B 4FNOA 2O2HA 4I4TA 4RLQA 2NW6A 2BR5A 3VR6D 1U2EA 4C7KA 4ZI7F 3OZUA 3ADOA 2I78A 2P79A 1TJ5A 2CCGA 1KI2A 1Q15A 2J1LA 3D4BA 3F0TA 3RGGA 4AB1A 3QVTA 5K3FB 4CEJB 3TTWA 1WDLA 2GD1O 1R6VA 4GMGA 3H8VA 1KE2A 1HMYA 2Q4EA 2QY9A 2ZTHA 3L6CA 1KY3A 2XADA 1OAAA 4R51A 2XB6A 1Y48E 1JB1A 3C41J 1KQPA 2XKBA 1KVRA 2ICAA 2VK2A 3U4AA 3EXIA 3VISA 4EPTA 3OQIB 2QQ0A 2OZLA 4C0QC 5A9RA 4X3CA 4ENTA 2YQ5A 4H7FA 5H5JA 1XAHA 1LSSA 2EZUA 2BHNA 4RKFA 4EGFA 4F96A 3OUTA 4EK9A 1YB6A 1E96A 1OI7A 1ULTA 3A26A 5HKAA 2C2WA 2VNKA 1E2GA 5JXHA 1GAJA 3D8HA 4V3BA 5JXJA 4QEKA 5IU6A 4S1VA 3PFHA 2IYLD 4L08A 4DJJA 1PUJA 1ZIXA 1GZ3A 1N4DA 3SYNA 5KO2A 5IXJA 4DJEC 3B1FA 1C9MA 4BV3A 1CQZA 5BMVA 4CIAA 1NN0A 1FEZA 2VHUA 1VGRA 3OWHA 1EFPB 2VQFB 4D7AA 6ADHA 2JC3A 3T0IA 2BL4A 5LXTA 4NPAA 1TQDA 2HBYA 5T6MA 3K70D 1BU8A 1EUYA 1T5BA 1XLWA 4HFJA 2XVXA 1FTNA 4LXUA 5CXXA 1W1WA 3EH2A 4JYPA 1D0VA 2PE5A 4ZI5A 3QEJA 1S5PA 3V6MA 3M1AA 3BIOA 1EAYA 1H2XA 3BTOA 2X7XA 1BOOA 2BM1A 3D5TA 1CDOA 3BK1A 3RODA 5J1SB 2V9ZA 1ELOA 3QYPA 4AIRA 5A0TA 3LKDA 4CDRA 4OM8A 4CQMB 4GVLA 3LSTA 3IFSA 3IAS6 3MLBA 5H1YA 3RUFA 3MMPA 2H2WA 2QN8A 1Z68A 2IHTA 3H16A 5AXBA 5LZ5A 4D41A 2AX3A 1WTCA 2H2GA 4ZK6A 1J0BA 1KZ9A 1OBVA 3O4GA 5FQOA 3H17A 3JAWA 2G1PA 4KHPB 2P5SA 5C1PA 4A82A 3ROGA 5IG2A 2ZUUA 3I2HA 4FYVA 1E6CA 2IH2A 1MT0A 5BN5B 5EP2A 3JTMA 4U7GA 2RC5A 1VL6A 4HLCA 2Y6VA 3M3DA 2QTNA 4EYEA 4XDGA 2O8DA 4JP8A 2G9VA 4C2UA 2YZMA 2YY6A 1QQAA 3DEYX 2H29A 4R41A 4EFMA 3WGJA 2Q2WA 1PQUA 1XN1A 1ZLYA 4LJSA 3I9V6 3FDZB 4UARA 4KRXA 4O4HA 5FYDA 2KX7A 1FNDA 5TGZA 1Z7GA 1Q20A 4MWBA 1N6NA 1KY4A 2WAAA 5JDIC 4MB6A 4JC0A 5SYNA 3B52X 3T94A 4J4BA 2JRLA 5JNLA 3RASA 4Z4GA 1D5WA 3ACDA 3RRMA 1VJCA 1GPWB 3NEJA 5TNXA 5J3JA 2BMAA 3K0CC 3LOPA 1U1CA 5AW9A 4CGYA 3ER9A 1T1IA 3GO4A 4IKPA 1XJ0A 4Z53A 1IOWA 3GLUA 5K3SA 1XRRA 4KB5A 1F20A 1YZLA 3NBMA 1O6ZA 2GBCA 1NWHA 2WWFA 2XCQA 3AX6A 3HC7A 3HB5X 5U4QA 4ALIA 4W5TA 4OLBA 5HHTA 1T1SA 2VPZA 2VPTA 3GXBA 3ZY4A 1YBVA 4F5DA 4S05A 1DC7A 3CEPB 3RYCA 4O3MA 4DC9A 3VPHA 3FY4A 3C1OA 3VPCA 3M4ZA 5DX0A 4TM8A 4XSVA 1KEWA 3E7PA 3SHTA 1BROA 1V5WA 3WLOA 1MN6A 4HQRA 1SCAA 3UMSA 2HRDA 3QA9A 1BWSA 1TF2A 4NENB 2XNKA 2IP4A 3QXCA 5IC5A 2ZE6A 1TU0A 3LPNA 1SRRA 4BIIA 3KB1A 5JBNA 2AJBA 4GI3A 3TB6A 4I50B 2WU1A 1SURA 2QE6A 3HN6A 1NOIA 3PYLA 2G9NA 2J9GA 1OBCA 1RI2A 4L02A 1QQ6A 3L7LA 3KR2A 1KBQA 3A4TA 4QRIA 1OD6A 2B1JA 1I1OA 4UHCA 3ABIA 5EQDA 4ZCSA 2ZFUA 1OVMA 2FSPA 1VECA 4KBGA 3A2NA 2NU7A 4LQLA 4GKVA 3FGZA 1NULA 1PK8A 3RM3A 1C1DA 4MYSA 5SY4A 4X93A 2DQYA 3CF6R 3BWYA 3EY9A 3W4IA 5F51A 4KW7A 1X0XA 3C5HA 5ICGA 1EWVA 2NADA 4YRJA 3NCHA 3FBGA 1C4OA 3W79A 4PG8A 4JROA 5CDUA 4BP8A 1HT2E 5KEIA 1JIKA 3CRQA 3E8SA 1Y34E 1F9EA 4DNPA 3SF8B 1QF6A 2NT3A 2GA9A 2Z08A 5CBPB 4L2IA 3LUAA 3NJ8A 5T3UA 1S3SA 4IV0A 3WL7A 3P27A 3ZD9A 3UMYA 4P34A 3BICA 4L6AA 4YJFA 2P35A 3E3AA 1QFZA 2AXQA 4LYYA 4Z86A 4R7TA 3L8DA 2EP5A 2HRCA 2VPYA 3AR7A 3FR7A 2CVHA 1EGVB 4F2HA 1QPBA 2GCNA 2DQKA 1L7VC 2AKEA 4MP6A 4XQCA 1E79A 1GTVA 2GJAA 3PQDA 5C81A 5CCBA 4MCIA 4C9BA 3ONNA 4LF9B 5L53A 1Z2AA 3VYSB 5F1YA 1LQTA 2P6MA 5A71A 1T8RA 4JUDX 3AP2A 3MB8A 2C83A 3M34A 1Z7WA 1YASA 3UB2A 5BWCA 4UE6A 2WLSA 3KQTA 5BSVA 1ZMRA 2HDOA 2O0KA 2YXEA 4DMCA 5BSRA 1E5TA 2BMEA 5A7GA 4PTYA 3IR7A 1UBOS 1HI9A 4IDGA 5G4LA 4EG3A 1CQIB 1TA0A 4FC6A 2XMCA 3CKMA 1H5NA 4IPTA 3AF5A 5EKSA 3DTTA 1A96A 3UJBA 3ANXA 3EUEA 1JLRA 1DWUA 1SU6A 1EZ1A 1LBQA 2C84A 1YI1A 2AQHA 2V45A 3MTJA 1HDOA 1W73A 3HR7A 2FSHA 4JKOA 4O0LA 5LD2B 1JR6A 3QOWA 3UHJA 4RKQA 1BC5A 2QTWB 6PFKA 3KDSE 2O8EB 1XTUA 1R00A 3DBOB 1L4HA 3C15C 2AHRA 1BD3A 4KKVA 5THXA 2ZWMA 2B94A 3TN7A 4QTYA 4LDPA 1P19A 4X6LA 2OHVA 3S1SA 4XJVA 1T6BY 3L04A 2YYZA 1ZG3A 1DMSA 1PGNA 2JGJA 3DMTC 3IBFA 3KTFA 4N82A 5CMLA 3FKSD 3U49A 3WZLA 3EG5A 1KDTA 2VDVE 1TQ8A 2JGLA 2Q9BA 2VI5A 2GPWA 4D99A 2VP2A 4P4LA 1N75A 2VHEA 3I04A 1VMEA 2FLKA 1CRLA 3IAS1 4KR0A 3LVQE 1EK0A 4MVJH 4RTKA 3BQMB 3SBXA 2TECE 3CKLA 1YBMA 1FTGA 1V95A 3QLEA 2WA2A 1GZ5A 5LU9A 3JYHA 1C8LA 1P2FA 1TDJA 3C1AA 3GMDA 3OM1A 4M38A 2IH4A 1ZXLA 1OPRA 3NW9A 4BLVA 2P7HA 2GESA 1SC9A 1R6BX 4F5EA 1FUKA 4R9SA 2QVGA 1ZIYA 4YK7A 5J5CA 3ROEA 3L5KA 1HFEL 4I19A 4GXTA 2X58A 3DAGA 3RQIA 3WRWA 2DETA 2AJTA 1H23A 3QU9A 4HXGA 1K7FB 4KDRA 2F1KA 3F7NA 2D4AA 2IDMA 2DPGA 3LDHA 3PNMA 2PMFA 1T0BA 4W6QA 2GYYA 3W2IA 4B75A 3I9V1 3NJRA 2PS9A 4JJIA 3IIMA 4R2MA 4J0KA 5BUZA 3A11A 5L7WA 1JYFA 3E9RA 3OIVA 2O3TA 1Z34A 5EESA 1CJKC 1TJYA 5J4VA 1IY0A 1ZGGA 1O94A 2GKGA 2V54A 3C8HA 2HTFA 3HVKA 3WISA 3ADCA 3CUTA 3NH6A 1E3LA 2OHXA 2W83A 4PRLA 5CK5A 3FHOA 4W5JA 3O82A 2FN4A 3QPBA 5EKUA 5HP4A 4WK4B 2AEJA 1RRKA 1SEPA 2Q8QA 1M7BA 4AXXA 2GBLA 2AZ4A 4LJ8A 4DMHA 1GZSA 3ZI4A 2WWYA 4OXRA 3CN9A 3EQ8A 4MK4A 1RJWA 4MVXA 1QAMA 5E3IA 5EXPA 1FDWA 5K4AA 2DBYA 5KSPA 8OHMA 3MBOA 4ZO8A 4B44A 5K8TA 3B70A 5CB0A 3THRA 1C8KA 4GP6A 4NG4A 5KJ1A 1ZZEA 4KAXA 4KVGA 2X5OA 521PA 2Y8EA 4ACBA 3UBMA 4K05A 4FDMA 1B0AA 1TL7C 4KWCA 2WHEA 2YX1A 4KVFA 3PVSA 2GAIA 2Q46A 3EGXA 6REQA 3S1AA 5JISA 3DO6A 1ZJWA 4HDCA 3PNOA 5LZ7A 2QZZA 4BO6A 1JFFA 2P1ZA 4J75A 1P81A 3WBFA 4B32A 5KINB 4B6GA 2P11A 4DT1A 1NNEA 3IDZA 5K6AA 1FVXA 3LFTA 3TOZA 3QPCA 4R0VA 5T4EA 3G9XA 1L8AA 1GR1A 3FTQA 1J7KA 1EP9A 4KLZA 3L9WA 3LWBA 4JJ8A 4RMGA 5IHXA 3ZHYA 2IRWA 4HN9A 4PFQA 1MDFA 2F17A 3L1KA 5CHYA 4H1VA 3R8CA 3ZHXA 3ABOB 3WLLA 1IY1A 4URYR 2J5QA 1E2BA 1UJMA 1ULBA 1ZN8A 1H1TA 3ZE8A 1KAQA 4L3OA 4I5IA 3PNSA 1B76A 1IB6A 1IDOA 1ATZA 1R9GA 2Q2NA 1EJ2A 4HDMA 4YREA 4ASUD 4EGJA 4UREA 3NBFA 2WIGA 2DAPA 3K0EA 1KDVA 2FVYA 4LBVA 4JVSB 3DE2X 3NI2A 1XZPA 1EGHA 3SBEA 1Z6XA 5BR4A 2X14A 4G0NA 1Y81A 2SECE 3I2YX 3LG2A 4WEQA 3HVHA 5I7AA 4B40A 1S8OA 3D2LA 3PDJA 4EY5A 1SZJG 4H7PA 1SVKA 2NYVA 1D09A 4RESA 2IFTA 4A6EA 2PLAA 4FIDA 2YC4C 2GBGA 1U02A 1SAYA 3Q9NA 5FPTA 1O9HA 2KS6A 4Z3DA 3U4GA 3T4XA 1KQOA 4QOFA 5C3UA 8ABPA 2CHUA 4A8HA 4Q3NA 1Y3CE 3OLYA 1DXOA 4DLLA 2XSZD 1PEAA 3EGDA 3T3IA 4EPXA 4BNDB 2HDHA 4NONA 1S2DA 3NGLA 2XKJE 1Q11A 4DLTA 1BMTA 4F9FA 4TL8A 4EMBA 1VBMA 2ZJ5A 2BAGA 1W9MA 2HREA 5K2OA 2B21A 1CR0A 1B8PA 5L7TA 4J1QA 2YS6A 3OQ6A 5K0FA 2ZRDA 3OAAD 5EKTA 3N8GA 3VR5A 1LBSA 3QPDA 4GGPA 4DHEA 3OX2A 1IZ8A 2A5YB 3ZTYA 2OMKA 3A6LA 3PEVA 1DAOA 5JVDF 3HCRA 1GDTA 2W6QA 2NYAA 1KU6A 5HA5A 2IWRA 2XR1A 3DCIA 4M0EA 1MJGA 4O4JF 1D2HA 3LNCA 1EVIA 2RHGB 1T3TA 1Z0DA 1CX9B 3A27A 5EOVA 1MUUA 4KGXA 2D5CA 1W0KD 4TWZA 3VZBA 4WZ6A 3SLRA 5MF6A 2Y0PA 2WNHA 2FP4A 1H69A 3UJ7A 4I1OA 4YAIA 1UIRA 1B6GA 4XUDA 4EB8A 1DE0A 3H1EA 2L42A 3M5WA 1K3UB 1IUPA 4AZ3B 1KRWA 5IT4A 5AQ1A 3IBYA 4NZPA 1T34A 3AFGA 1CUAA 2C58A 3V1UA 3S81A 2HWYA 1YDMA 2Q3CA 4HZUB 5JROA 3DDSA 2BLNA 3EC1A 4PYIA 4BVHA 4BLSA 3KWFA 5FBQB 1UT6A 1NJ2A 1T13A 4KO1S 4PGFA 3JQQA 3RTBA 5CDFE 3GLHE 4MW7A 5F98A 3WIDA 5C18A 2G88A 3ZTWA 2AG1A 3WGNA 4O1HA 2GVNA 3QBJA 2EFGA 3M8KA 1XXHA 4EG0A 2VF5X 2BFOA 2VP9A 3ER6A 3MRTA 3STUA 4GMFA 4B43A 3OU6A 4ON9A 1GQQA 2FW6A 3W06A 4BQQA 3FTDA 4MPPA 1VPEA 4LK2A 1GRCA 4WZAB 5E9AA 4ZJPA 4QO7A 2WZBA 4KEAA 4PZ9A 1V8PA 2MJLA 3E22B 5AM1A 2BRUA 2EW2A 3BB1A 3MT0A 4ZOEA 1XCLA 4K81B 5DGCA 2DPHA 4FE7A 5CA0F 4ACAA 4PZ0A 1AHPA 3JAKA 4PM4A 4RTSA 1GTRA 4JT4A 4N54A 2J9YB 5LZ9A 4CV0A 5DNEA 5FPKA 4KI0A 2ZUVA 3E1SA 5HF6A 3DM9B 1IN6A 4IKEA 5JFTA 4NBKA 1OXKB 4AKIA 1WBBA 4FM9A 1I4LD 4YWHA 1RWNA 3PDHA 3T7KA 2ZAIA 1K0FA 2FCRA 4OHPA 1S2GA 2C5HA 1RU3A 5IAKA 1Z5UA 4KQ9A 3QE4A 2P41A 1NW9B 4JWKA 3DFZA 3VDXA 4O2RA 2LRHA 4P33A 1SHLA 4UBNA 3LL7A 1G291 1VPLA 2DP4E 1CLEA 4LOJA 4MW2A 4UTOA 1ODSA 3QF7A 3QWIA 5H70A 5DTMA 3PEEA 1JQJC 1O97D 1D5CA 4XVRA 4FZJA 5FNVA 1A7KA 5G3YA 3P0RA 5K0NA 2YWJA 3U37A 4XVCA 3C16C 4R31A 4C29A 1W5BA 2M32A 2P6UA 2X5NA 1CP3A 2Y93A 3DZ8A 1L5LA 3UJ8A 1CE8A 1BN7A 4MUHA 1LJLA 2FEXA 3SOZA 1ZN9A 2HOQA 3PNBA 4RVGA 2HQRA 4BN0A 1HE3A 5PGMA 4MA4A 4Y6PA 2WKQA 1UK8A 1Z8FA 4BZXA 4TQGA 1DC4A 1WJGA 1WXFA 3DKPA 3NOQA 3X1MA 1JEYB 1CVIA 1N34B 3TBKA 4L85A 2ZPTX 4L28A 1P5JA 2E48A 5CYOA 2AFIB 1TIBA 4JR0A 1UC8A 2P4QA 3IUMA 3JRWA 3EWAA 1L0BA 1IXYA 4RH1A 4Y7DA 4KX3A 4ZVPA 1NE2A 3E2MA 3AVXA 1G20B 1KZYC 1R1DA 3EDMA 2EP8A 3KE9A 2ZU0C 5AXDA 2OYRA 3TLEA 4F6LA 4Z54A 4C4YA 4O5OA 4WFIA 1ICEA 2GX6A 2VWHA 4Q7EA 1NR1A 2E89A 3EBOA 2ODNA 1OF1A 2DCUA 1NJFA 4C0SA 2RAPA 3BCHA 4BZQA 1W59A 1KSGA 3K1AA 3FTNA 2P8SA 3RVJA 3S99A 4B17A 2YVAA 5IAOA 2DHDA 2PG3A 4XGRA 2RHOA 2JGRA 3EODA 1A8SA 1GTL1 4XTRA 4AKSA 2IU4A 2O5EA 3W6UA 3AYZB 3NFRA 4Z4IA 1QYRA 4P1ZA 1YJCA 5EP3A 1IRIA 3BTSA 3W78A 2EL7A 3JQCA 4QTTB 2YFKA 4FMBB 4WCFA 1ZN7A 3L8GA 4AZ0B 3ITKA 1DIGA 3D5QA 5D5PA 1IULA 3P0IA 1TTTA 3EIUA 4C0KA 1LLUA 5DCYA 4K9RA 4GOLD 2ZG6A 1XUOA 1BGVA 3IE0A 2ZJAA 4UBMA 3THOA 4B33A 4YMVA 5CCEA 4ZT7A 4RTJA 4IWYA 3TAUA 1NDUA 7ABPA 1JN0A 2CVOA 3OIYA 1GO2A 3CINA 4B6SA 2LIPA 5I7OA 4FJ2A 3IA7A 3E5NA 1GN9A 3H5LA 1BMFD 3CEAA 3HACA 4NK5A 4Z9YA 3DEKA 4X97A 5FPPA 4D0LB 1OGIA 3Q1LA 3ESDA 3WP0A 3S55A 1KVTA 4RUKA 2XJ4A 4JKYA 5CUQA 5I47A 3H1AA 1PNVA 1DBPA 2I03A 4H7DA 1ZHHA 3L77A 3K2IA 5DIZA 1CETA 1PZEA 2J08A 1TQ4A 1XTPA 3A1DA 3KYJB 4JS0A 4RD2A 3CLRD 5AOVA 5BQOA 3WXMA 1GSHA 1FY2A 3DBHA 3MILA 3N76A 4ZIRA 2MSCB 1PQWA 2FWNA 3AV3A 1T8TA 4R1TA 3T38A 5AW3A 3O21A 2B7CA 1NUUA 4YN3A 1YZTA 2RGUA 1RACA 3HJCA 4B3FX 1GSAA 1M8FA 1BDJA 4XUEA 1NUAA 5A5DA 4UOEA 4NWIA 1J56A 3T3DA 2YMMA 3TX2A 1ZNXA 3GEDA 1E2PA 1UXKA 4PZUA 5A4JA 1PVDA 5TS2A 2ZB8A 3AH8A 1VJDA 2X1VA 1IJEA 3DE4X 3FE2A 5BY2A 2HAEA 5A9SB 5I4BA 4G5SA 4DILA 4F91B 3EOAI 4RHTA 2R0QC 3UPTA 1Z6QA 4MHTA 5IEBA 3CJRA 2UZ3A 4IIYA 4OQLA 4WD3A 4KQFA 5EZYF 4AVYA 3LYAA 1JPJA 5EKXA 4ABYA 3WLQA 4XEUA 3RF7A 3PJGA 1FFAA 4Q16A 1DDGA 5BSMA 1Q77A 2OGZA 4Z1OA 1E3WA 3IP8A 2ZYWX 4M0LA 2BCEA 4G3XA 4ZVNA 1ZO8A 3I37X 3G68A 4Q1VA 1BS9A 2PVPA 3FZGA 4YPVA 1ODLA 2DOKA 4ZREA 4RJJA 1TTHA 3V42A 5C52B 1XA0A 2JAXA 4E07A 4OXIA 1NIJA 3ELWA 4LECA 5H80A 4RYDA 2ZJFA 5D3KA 3GP8A 2A67A 3E9NA 4UMFA 3OFKA 3UPUA 4MKFA 3PL1A 1YR1A 1J9ZA 2F4VB 2ZE7A 3OBIA 4PBRA 3HNOA 3OZBA 1A71A 3OIWA 1NRWA 1QE0A 4WFJA 1GKYA 3H1BA 4M1ZA 1XVTA 2C2GA 1QHXA 2YNMA 3OWXA 1RHKA 4GPZA 1YVRA 3FWZA 2R8XA 1JW9B 4Y7CA 4C2BA 3KPVA 3V4FA 3WICA 5KX5B 3I61A 3RSGA 3SDSA 3BT7A 1FNNA 2W6ZA 4IEEA 3I32A 1U0HC 4WADA 3L1VA 1JKJB 2ODTX 2WB4A 3TIVA 3PQ2A 1RW4A 1WCXA 4DCPA 4DV7B 2XUQA 4XYLA 3PC4A 3U48A 2Z6VA 1XCPA 4PO1A 2J5BA 4QOHA 2H4ZA 5BV8A 2G77B 2C88A 4J49A 3A9WA 1BA3A 1TA9A 4MQBA 5E7QA 1CB0A 1XWFA 4X71A 1L8LA 3W2HA 3WGQA 1Y7IA 2JFUA 2BIFA 3LPMA 4JQSA 2JW5A 3RRFA 3ICOA 5EY5B 1PR4A 1YS6A 1YS4A 4EVSA 2IBMA 4PPQA 3EZNA 1MFZA 3N7TA 3V7WA 3OQHA 3VR6A 4E3WA 3U16A 1NNI1 4CHTA 3TZCA 4I4TB 3BH7A 3JQAB 1QHIA 3A6DA 2HWUA 4ZJZA 2Y99A 4XASA 3T3NA 3VTAA 2HHJA 2NVUA 3KKOA 3GGGA 1QPGA 2EKLA 3WAGA 4I9FA 4DR5B 3I2FA 2ZT5A 3R41A 1YZGA 3WHKA 5LA6A 4TLCA 1KHHA 2ZYVX 2I0FA 4BGVA 4DBLE 1ZH8A 4IIEA 5COQA 4UM7A 1G3QA 1D1SA 4F6CA 1A76A 1ILEA 3D0KA 4LWPA 3MJEA 5TQVA 4IR7A 3DBLA 1BTOA 1CQJB 1DKNA 4LSGA 1NVBA 3EMDA 4UM9D 1MXFA 3MSCA 3RB8A 4KN5A 4B76A 2UKDA 3KAJA 3EXIB 3PPWA 4KAJA 5A03A 1ZJ6A 2I7CA 5BQPA 1QCCA 2OZLB 2OAGA 3DZCA 2QTMA 2ZBFA 2FPIA 2OD9A 4IZOA 1JAYA 2Q1TA 1JDTA 3Q8XB 1EPUA 4LZPA 4CDNA 2ZRMA 4JASB 4NDNE 4ESOA 1T26A 1M5UA 2XYQA 1OWOA 2X19A 3EVAA 3GCGA 2D5IA 1KR2A 5FL7D 4UVDA 3URMA 4JYBA 1U5AA 4R1SA 1XMVA 5EE5B