2KSQA

The myristoylated yeast arf1 in a gtp and bicelle bound conformation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
180
Chain Sequence
GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVECVQYCNISFTVWDVGGQDRIRSLWRHYYCNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELCNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNCLKNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dynamic structure of membrane-anchored Arf*GTP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
molecule keywords ADP-ribosylation factor 1
total genus 44
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ksqA00
1TF2A 4BLSA 3CB4A 3QVUA 4KVAA 3DM9B 3BFKA 2DB3A 2WPDA 5JBQA 1G64A 3CH5A 4F91B 2PMDA 4PPQA 4TSFD 2GA8A 4Z51A 3RYTC 2VSOA 3CNNA 5ANRB 1US8A 3ONWA 3CX6A 1P62B 3PFIA 3SC3A 4URVR 5BW8A 4KSCA 4OQFA 2P6RA 4TMXA 4EJSA 4IOLA 2ZJZA 3V00A 3MCAA 5K8UA 1TUIA 4GRAA 2HYDA 4BWYA 2F1RA 1MABB 4RZUA 2BKUA 1ETUA 2NZJA 4NONA 1TEVA 4EAQA 3E5HA 3W5JA 1KDOA 4M9XA 3HYRA 4NP6A 4RSGA 4B3DA 1XCMA 4CRWB 3LAWA 4JLKA 5TDHA 3HJNA 5G3YA 3RS0A 4PXAA 2FG5A 2YC2C 4FMDB 1FUUA 1L4UA 3C8UA 3CONA 2D7CA 4L5BA 4AG6A 3E70C 4AYXA 2DHRA 3GJ7A 5L3RA 1G3QA 5JFGA 4PFSA 1TL7C 2H1LA 1WB9A 4K46A 4IFBA 2ZI7A 3PUXA 2UKDA 4JYBA 2NGRA 5KDLA 1SULA 2J41A 3PV0A 4CEIA 1Z63A 2FGJA 1P60A 1T9HA 2ZJAA 4DDTA 4AK9A 4A36A 2GXSA 1COWD 1U0JA 3QEOA 4ON9A 5BXQC 2O8CB 2O8DA 4BZXA 4YMWA 2R6GA 3A4LA 2GBLA 2O0JA 4URZR 1XPUA 3IEUA 4IVQA 5KUTA 2O8FB 1E0AA 2BHRA 2RB4A 2R65A 3UMSA 3CX7A 5CIQA 4P4SA 1AKYA 3U7GA 2V1XA 2WWWA 2ZRLA 4DC9A 4KFUA 5KU1A 4ACAA 1HQCA 1E2HA 3CPEA 1D9XA 4TTRA 2JJ8A 2W2XA 3PEUA 4AWXA 4WA7A 4O25A 5JEEA 3HR8A 4TL7A 1OIXA 1S96A 5FTNA 5JI2E 1PLKA 4OJKA 2GVZC 2VLIA 4DVGA 3NH9A 2ZJ8A 3QOFA 4IDPA 1FFHA 2EYQA 3I73A 4FMCB 4HZUB 4JIMA 1GM5A 1W0JD 4MKFA 1W4RA 2J87A 5TB5A 3BFVA 2WIBA 1P2UA 1KY3A 1UBEA 1OH5A 5FH9A 1F2UB 1RRPA 3R7WA 3B7GA 4MITA 2GILA 3A1SA 3Q5EA 3ZZUA 4ZKDA 5TMPA 4G5SA 3RVBA 4NHOA 2HF8A 3U3RA 2QM8A 1QHYA 4QHTA 1X1SA 1G8GA 5LB2A 1TQDA 2QMUA 2NMVA 2GZDA 4QJ5A 4QBFA 5HR5A 3IHWA 3B9PA 3BERA 4ZV4A 4TZ6A 2ZR9A 1E3MA 2D74A 2QAGB 2PT7A 3QQ5A 1UKZA 3NDPA 1S1CA 4KXFB 2KSQA 1E96A 4HAXA 2YOHA 4IDQA 4Q1FA 1NJGA 1T5LA 1E9DA 4GOXA 1Z2AA 3IIJA 2C99A 3HU1A 4TYPA 4DCTA 3ZD7A 4HAVA 5M04A 2PZGA 1BO6A 1N2CE 1ANKA 2NPIA 1MO3A 1Z8FA 2JDID 3A37A 3ND8A 5EXTA 2JATA 3T1OA 3FPAA 2ZE5A 3VKGA 3OEHD 2AXPA 1NVXQ 4GZLA 2WHXA 3LX8A 2ZVQX 2BC9A 4GOKA 4HDQB 2FPLA 2XB4A 3QKRB 1PVOA 1IY0A 4X8MA 5JCZA 4IDNA 4TLAA 3SFZA 5JHGB 3IBYA 5EXSA 3AM1A 3KJHA 4C0HA 2VP6A 1S9DA 1KK0A 2FX3A 2VBCA 3ZQJA 3QXXA 1W36C 4HYYA 1U8AA 1P7CA 3CRMA 1E2QA 3GQBA 4RFSA 4EFLA 2W00A 3QG1A 5KO2A 4D2IA 2A78A 4A15A 2WSSA 1JQJC 1E0KA 1AN0A 1CJKC 1Q21A 1U8ZA 2ODWA 3RLFA 4LJAA 3RHFA 3QKSB 4BGDA 2ZSDA 3GLFA 1VYTA 2AX4A 1WXQA 5EP2A 1NLYA 5J4KA 3SHFA 4N0DA 1OH7A 3B1VA 1W4BA 2ODEA 5CIWA 5EUMA 4B6FA 4HB3A 4Z1MA 2OZEA 3B60A 4BASA 2A3RA 4FI3C 2P5TB 1CR0A 1XEWX 1AM4D 4M1YA 2REXB 3ZD6A 4QM6A 1YZNA 3V4FA 2J0UB 3TH5A 4B74A 4C0QC 1XFAA 1ZJ6A 2QPOA 5AWFC 5AUOB 2QRNA 3U4QB 3D6TB 2GEVA 3ASZA 4P31A 2QROA 1IXZA 3BJIC 1GUAA 1P5ZB 3GFTA 4OHVA 1KJYA 5B58C 5JJLA 4UNRA 4NCNA 5CJ2A 3DZDA 3ZVRA 4QGGA 3PENA 5KNBA 4CF7A 2ZRCA 2W58A 2IEYA 2ATVA 1KDRA 5K8LA 3FKSD 5AJWA 2F9MA 4E03A 3DL0A 4II7A 4R9UC 3B6EA 4F4CA 1LS1A 4OL0A 3NEJA 5HE9A 2HT6A 2VSFA 2QTFA 4DDWA 1E9SA 2EW1A 4TSFA 1E69A 1T0HB 2RKOA 4GBMA 2ZTSA 5EXXA 3RDPA 1JR6A 2J5XA 3VAAA 1QG2A 3TW8B 1LF0A 1M7BA 2ZJ5A 2AD1A 4NCHA 1HTWA 1R4AA 3A58B 3EPKA 2ZRJA 1CIPA 1OB2A 4GL2A 4XJXA 1QVAA 3AF1A 3WXMA 1D2NA 1G20E 2D06A 1D2EA 5BWMA 3N70A 3NEYA 2OBLA 2OAQ1 2AK3A 2O0KA 5EZ6B 1IN8A 4JSYA 4BLRA 4Q03A 4K8OA 3OZXA 1KK2A 1RYFA 1Z08A 2QORA 2WWIA 1UF9A 3KFVA 4BZQA 5J4HA 5GJVC 1NBMA 2ZI9A 3EX7C 2EWWA 4B3XA 3K0SA 3B78A 3Q5DA 3VR3A 5KPDA 2V3CC 2HEIA 3T1TA 4LBVA 4I99A 5GADl 5GJCA 3EPJA 2W83A 1P2TA 1ZBDA 2HUPA 3KZ1E 5AUNB 4TYQA 3AVOA 2ZAOA 1Z0KA 5C1BA 4XWOA 2PMKA 4BRWA 1EFRA 3P32A 4WOPA 5CLLA 4D0GA 2ZAMA 4Q4HB 1U9IC 4KFSA 1RRCA 3H86A 1WBBA 2RGCA 3KFXA 3QNUA 4A92A 3O8RA 3Q85A 1BIFA 3HR7A 2VHQA 4B47A 3EIEA 3RSLA 1ESMA 1PLJA 4AC9A 3KQUA 4PPNA 2HXSA 4GI7A 3AVPA 5J40A 2ZUBA 3QKTA 2ZYVX 1EGAA 1N0VC 3N2IA 4PAQA 2KI5A 4BFSA 4QGHA 4LBZA 5BN4A 1QHIA 4RZXA 2UZ3A 1Q1EA 5L3QA 1T91A 2HDNB 4JLBA 1TEXA 2FU5C 2F43B 2QL6A 3KL4A 1S9HA 4LC1A 2VIIA 3CWZA 2W0MA 4ZCMA 5D3MB 5CB8A 1OXVA 3L0SA 4LHVA 3K0FA 2ZJ2A 5FUVA 1SVKA 2CE2X 4LV5B 2FH5B 3FVQA 3VNUA 1AGRA 1U0HC 1ZD1A 3K70D 4QHSA 4JKYA 4HB0A 2GCOB 1E2KA 3CH4B 1N0UA 1DPFA 5EXPA 2IF2A 3C16C 1EESA 2VP9A 1EX7A 1W5SA 1KKLA 1U0LA 3SYLA 5JSZA 1Z22A 1A5TA 2VA8A 3R7WB 1DO2A 5H68A 2W6JA 3ETLA 4UNSA 3RS5A 1DE0A 5JZVA 1YHNA 1UEIA 4QL3A 3LBHA 2E1RA 4IOKA 4V0NA 1ZIPA 4IXMA 3U7FB 2ZREA 1OSNA 2BBSA 4NYMQ 1ZD9A 4AI6A 3THWA 4C2UA 4D25A 5TARA 3KB1A 5J5CA 3NBZC 1VKJA 1XMSA 1GNQA 1JBKA 2Q3HA 4KCGA 3RC3A 2IUUA 2BMJA 3H4MA 4EFNA 2XX3A 2CJWB 4BZPA 2XZOA 1IJEA 2WV9A 4XIGS 3GD7A 2UZIR 4N0EA 1AS0A 3NBYC 1VCIA 5JS8A 2F9LA 1VYVA 2XNDD 3OIVA 1JPNA 3L0OA 3OE7A 4RJLA 4FIDA 5FUYA 4MRVA 1S3SA 3SOPA 3HU3A 5LPNA 1G3IA 1HEIA 1JR3A 3LVRE 5DH9A 1FTSA 2X2FA 1II8B 1KHTA 1A7JA 2ZI6A 1QHSA 1V5WA 4NPHA 4M1MA 4Q1CA 1IBRA 1Q1QA 4ZIRB 1ZUNB 2B7CA 3BAFA 3TSZA 2ZUCA 2Q9BA 1YZGA 3RRZA 4EPYA 3QEJA 3NC0C 3TR5A 3SU8A 4EIWA 2IA5A 3IPXA 3AGPA 1KSGA 1HT1E 1W49A 3O8BA 4OK6A 2ODBA 3FHOA 1F48A 4HAZA 2EFHB 5GJBA 4BEBA 3QKRA 4LSGA 3GFPA 1MOZA 4PQRA 2ZI3A 421PA 4PTLA 3LQRA 1A82A 5FPSA 3FFAA 3C15C 2JLUA 2V54A 3RS2A 3MWKA 1CR4A 4NE2A 5LB4A 3AP2A 4X8OA 1OW3B 2PH1A 4LJ7A 1KOFA 3LY5A 2RGNC 4DSTA 2PZFA 4GOJA 2CK3A 1CKEA 4C9BA 2D7DA 1I2DA 4R98A 3FB4A 1KZGB 1NIJA 5L3VA 1COWA 1ELOA 2ZRAA 4NYJQ 3THOA 5BYKA 2C78A 5CYPA 3BIFA 1MKYA 3FTQA 1GIAA 4D0LB 4PSKA 4XSGA 1KNQA 1AGPA 2QSYA 1Z6TA 4JL6A 2UVQA 2AKYA 5KNDA 2ZE7A 4B43A 2DY1A 2OM2A 3FHCB 1S4QA 1P73A 4BLPA 3LW8A 1A2KC 2ODNA 3D31A 4ZDWA 2A5FA 1YKSA 2I3BA 4W5WA 3OE7D 4DCVA 2XXAA 1S3GA 4QC2A 3A1WA 1F2TA 2IYQA 4C0BA 4KYIB 1OH8A 5JHHB 4LJ6A 2GJAA 1YRAA 4A2WA 4OQXA 3AVVA 1SKQA 3MD0A 4FINA 1KSFX 1MO6A 1YR7A 3BS4A 2C96A 1W7AA 1QHHB 3EWAA 3UWOA 3ND9A 2K5UA 4LYAA 2H18A 4QBHA 2NO6A 4I1SA 4PC7A 1NF3A 5FFMA 1KKMA 3U3MA 3AVWA 1J2JA 3D7MA 3PUVA 2FEOA 2IXGA 2J7KA 3EC2A 3FYHA 3NIBA 2IUTA 4OHXA 2EQBA 4YMVA 4QRHA 4Q4AB 4D4MA 1ZC3A 2IX3A 2JGNA 1PJRA 4DHEA 1EFUA 2CHVA 3W5IA 3EXAA 2D2FA 4YONB 1HE1C 1Z83A 2G88A 1T3SA 2GCPA 5HCIA 2FA9A 3QXSA 2SHKA 3CNLA 1KO4A 1XTJA 4HLQB 4NCIA 4OI2A 2OHFA 3GLIB 3AUXA 4N1AA 5FOUA 2W2VA 1G8YA 1W0KA 4F38A 2IUSA 2FSHA 1P6XA 1ZNZA 3B2EA 1OIVA 1GFIA 1W4AA 3EA5A 1ZRHA 3NBXX 3PXGA 1T8TA 3JVUA 4MUBA 5LD2B 3WNCA 2DWOA 4KYUA 1XDBA 5EE3A 3ZYCA 3ZJYA 2H57A 1D9ZA 5FI0B 1OV4A 2HCJB 1GNPA 1JAHA 1MV5A 3MJRA 5A5GA 1Z6AA 2OCPA 4RD1A 4A6XA 4BFTA 2O8BB 1Q12A 2OCBA 3LRPA 3I92A 3VKHA 3KB2A 1X1RA 1IJFA 3QF4A 4IDOA 2ANBA 5FBWB 4C4PA 2JJ1A 1SXJA 1UBGA 4M0LA 2VPPA 2CMKA 5L3SA 4B48A 4GZMA 4W9MC 4DCUA 1NVVQ 2IXEA 3SFVA 2GEUA 1Q44A 3RABA 4XVUA 1HY3A 3D3QA 2PCJA 4EJSB 3TSOA 1YU9A 2CHGA 2F7SA 4BLOA 3BB1A 1YR6A 5EJEA 3BRWD 1IOZA 4U7DA 2ZVPX 3AVQA 2GDJA 4JLOA 1Q57A 4TYWA 4FD2A 1L7VC 1DELA 2ORVA 2WMOB 4TMWA 2J0SA 1WRBA 1XX6A 2FPKA 4UQOA 3H0KA 3I8XA 4GP6A 4RFVA 5FBLB 3OAAA 4IJMA 4Q4JB 4WZ6A 2YC4C 2ONJA 1R8QA 3KDSE 1GRNA 3ZLJA 4PZYA 4A4DA 2FDCA 2V6JA 2FZ4A 5KPJA 4RFSB 4B3FX 3NTUA 4DSUA 3JZAA 4IOMA 1HV8A 3HP1A 1G41A 1UDWA 2Y8EA 2WWXA 4D26A 3CZQA 4BFXA 5JLJA 4HDCA 2C8VA 5CK4A 2G0TA 4PC3A 1Y3AA 1YZLA 1Z2CA 2BDTA 2GZAA 1NSTA 2IHYA 3FMIA 3NXSA 4M1WA 4Y0VA 4CEIB 4PC1A 1G19A 4C0JA 4TYNA 4IXNA 2IC5A 1P72A 2YKGA 1SXJE 1L2TA 3EWSA 3LQQA 1N3BA 2O0HA 1Z5ZA 2GTPA 2Q3FA 3QF4B 2HT1A 4BE7B 4YMUA 4KODA 4E5UA 4JT4A 2XEXA 1AIPA 2Z5FA 3IKJA 1GRQA 5EQTA 3BOSA 2VQSA 1S0UA 3AQ4A 2OBNA 4G5QA 1ZU4A 5KYKA 3U4QA 2YWGA 1UBFA 4MRRA 4Q7MB 1NMXA 4DXAA 5FL7D 2YOGA 3L2OB 2HV8A 1ZW6A 1CS4C 4MDFA 1WE2A 1E9RA 1I4DD 5F2EA 3IIMA 5FOVA 1XPOA 1CR1A 2H7VA 4GMDA 3AKCA 1NKSA 4CYMA 1R10A 5AJYA 4A9AA 1O3YA 1H8ED 2WJGA 2ZYTX 1RC8A 5DI9A 1N6PA 1P2SA 2EFCB 1DO0A 3KUDA 4FCWA 2W0SA 4I1UA 3QPVA 1CF4A 2IYSA 3PQCA 1XEXA 4OQMA 5JS7A 3UK6A 4KI0A 5L8VA 4HDOB 5BN3A 3HYTA 4PO1A 3WP0A 2JLYA 1RVDA 3GJ3A 3SEAA 1G7CA 1G6OA 3LX5A 4FN5A 1L8QA 3RNLA 3VNVA 4TMZA 3BB4A 1Z06A 1GRRA 2QUZA 2RCNA 2XTMA 4Q47A 1R2QA 2QQEA 4M9SA 3DO6A 4M4SA 2BMDA 3U3KA 4FXPA 1ZM3A 3TUJC 3QI2A 2B21A 2JLXA 4DUGD 3RRNA 3W8RA 2OV2A 4WVFA 3M0EA 2KE5A 4CEHA 1N5KA 2X1VA 1Z0FA 5JECA 4Q00A 2DFNA 1XEFA 5DGXA 4H1UA 4R2HA 3CF6R 2DFLA 1XD2A 2AFIE 3PR1A 4Q7JB 1ONBA 4C2TA 1OXTA 4P3YA 4PHHA 2HXYA 2ATXA 5E3HA 4DLVA 4OHZA 3NDBB 3AVXA 1U98A 4OHYA 4AKGA 2BOVA 4NYIQ 1G17A 3W34A 1QZXA 3IGFA 5FPKA 3FMOB 3UIEA 3UANA 3T5GA 3WHKA 3FMPB 4TLEA 4JSTA 5HZKA 1P9WA 4CEJA 5C4MA 1U94A 3TMKA 4YC7A 2QNRA 5TV2A 3LA6A 4LJ9A 4XH9B 4JL8A 1Z29A 2ZS7A 3FKSA 1SXJB 2GJ8A 4MRNA 2FSGA 3B82A 4JLNA 1KO8A 3TIFA 3EZ6A 3SJAA 2X19A 2PJRA 1LVGA 5JEDA 2JLWA 1EK0A 3K70B 1XF9A 5A0FA 2GJ9A 2F1JA 3OEEA 2FFAA 3AKDA 3U3OA 3SE0A 2OEPA 5LD2C 1F2TB 2J9RA 3S1AB 2WSMA 4ZO4A 1GDDA 3PEWA 4AD8A 1Z28A 4ZI3A 3NC1C 3A4NA 3EG5A 3K0AA 3T12A 1K5DA 5JJIA 2PT5A 4ABYA 2W6ID 4NMMA 4TLDA 2VYFA 2C9OA 2RGBA 2Z4RA 3DEFA 2ZSBA 3QF7A 1E0JA 2HCBA 3CRW1 1KZ7B 1ZC4A 3K70C 4QHYA 1RFLA 3P20A 1N6OA 4Z8XA 2P5SA 3K8YA 2QEQA 3EPHA 1X8LA 3WY9A 3PUYA 1DS6A 1H65A 4MH0R 2ZI5A 3CF2A 3GEIA 4LCBA 4DLWA 1UEJA 4TMVA 4LV8B 3NH6A 4AURA 2VP5A 4M1TA 2J0QA 3QUSA 1WDTA 4JBXA 4TN1A 4IVRA 1N6KA 3U7HB 1FZQA 1XMVA 1T0JB 4ZKEA 3I4LA 4P33A 3CLVA 1M34E 4U5XA 1R5NA 3K9NA 2RGXA 3I61A 2CCGA 5FOTA 5FTJA 4B35A 4O0MA 4LJ5A 1G16A 2XOKD 4MKIA 4ZDIA 2D2EA 4ASUA 3A36A 3AF3A 2ECKA 3QPWA 2GBLC 1HT2E 2FFHA 1NBMD 3GEEA 3SBDA 1VG1A 3TQFA 5C46F 2GVDC 1NN1A 2C2HA 1JPJA 3P4XA 5DLQC 5FBQB 5CDFA 3M1IA 1VYUA 3F3YA 1KI8A 3AVYA 1OKKD 1RRGA 2NO0A 4JKIA 3X1XA 1NLZA 1KNXA 3UG7A 1Y63A 4HUTA 2ZXUA 4CT4B 1E4VA 3C4JA 1RZ3A 3VX4A 1XXHB 1QRAA 4NZYA 3TK1A 3H84A 3TRFA 2O8EA 2HLDA 2OE2A 4PHGA 5BYJA 3T5DA 3EASA 1CBUA 4AKHA 2EFDB 4D80A 4A0HA 5E7JA 2R6CA 2P67A 3EC1A 1P3JA 4LHYA 2Q6TA 2QMOA 1ZUIA 2AD5A 2BJWA 2FEMA 3KQNA 1Q20A 4IFEA 4XD7D 4DRZA 1P9NA 2ZRKA 2AWNA 1CULC 1NRJB 1OT3A 2REOA 5G3ZA 4F4JA 2ASEA 3B85A 1LNZA 3MWYW 2QG6A 3MGCA 3QBTA 2YINC 1ZM7A 1DAHA 3IQXA 4FMCF 521PA 1HURA 3JVVA 2WBLC 4ASUD 1Q22A 1KI6A 4ZCIA 1VHLA 4RD3A 1PV4A 1T6NA 3IO5A 1XBTA 1OJLA 1TU4A 1UJ2A 2NO7A 3G0HA 4ZI2A 3GLFE 2ZRMA 3NHAA 4EUNA 5CITA 2D3WA 3B1XA 4IW3B 2YV5A 5EP4A 1NMYA 5CM9C 4RD0A 3ICQB 3CR7A 3SN6A 3WMFA 4L9SA 4DDVA 2XNDA 1W0JA 3FE2A 2AKAB 2DBYA 5A4JA 3SQWA 1LF5A 2CVFA 4CGZA 2G0NA 1W2GA 3BC1A 1H8EA 2WAXA 1W48A 4XSHA 4NCJA 4D4KA 4LZZA 4PC2A 2C9CA 1XCGB 1KI2A 3C5HA 3PITA 5FL7A 2QP4A 3DOFA 4G3XA 2BM1A 3CBQA 2NPFA 3A1UA 2FFQA 3WRXC 1G21E 4D81A 3K1JA 4TZ0A 1GKIA 3VR1A 2ZSFA 3OHMA 1CRPA 3U60B 3AEZA 5DISB 1EWRA 4LHXA 4LYJA 4EQ6B 2ORIA 5KSYA 5L3QB 1ZCAA 3L0PA 3SZRA 4Q19A 4A8JA 2JIZA 3K0AB 2BIFA 3BB3A 3ZS9A 3ZZ0A 2FPMA 2ZQ5A 1CRQA 2O8EB 1KGDA 1Q1ZA 3VQTA 4I1VA 1LFDB 4I4LA 3LO5A 2ZPTX 4P0TA 1AZSC 2MSCB 1NSFA 2ZRHA 2R6AA 1KO1A 3T61A 1N6IA 1TPZA 1XU4A 2PEZA 2AR7A 4Q1EA 1TNDA 1XJQA 5DSZA 2HJVA 3KUCA 4PAOA 2GNOA 3B9QA 1KI7A 4KO8A 1G1MA 1HA3A 1NN0A 2QTHA 3A4MA 3N5CA 5FTKA 3K9GA 4Q01A 3EA0A 2ERXA 2AFHE 2QM7A 2VF8A 3ZH9B 2WPDD 3CX8A 2FOLA 1K8RA 4KITB 3AP1A 4V0MA 3TJZA 4PQFA 1Z0JA 4PANA 1G291 2HLDD 4OYHA 1I4LD 1KI6B 5CLQA 1GAJA 1ZIOA 2OBMA 1GL7A 1T4GA 2XZLA 2DWPA 2VEDA 2A9KA 1OXSC 1NL3A 2WSSD 1U99A 1A2BA 1E2PA 2YZ2A 2ZE6A 4KAXA 3X1ZA 2FV8A 4MUAA 3U3JA 2QENA 3QKSA 3EAQA 1NG1A 3TBKA 3MMPA 5D3QA 3SDZA 3AF2A 3DDCA 4M53A 1JXMA 1G6HA 1B0UA 4FWIB 4QBIA 4BFYA 3QVVA 2PL3A 1VIYA 2G1KA 4Q9LA 5IK2D 1JEDA 4WBSA 3IEVA 1EFHA 4HAYA 1TQ4A 2DYKA 4L15A 2QI9C 2QPTA 3THXA 1TU3A 2A5DA 3DKVA 5AUPB 1IXRC 3SYKA 2IYWA 3SYNA 2WKRA 2VHJA 1SVMA 4MGYR 4EFMA 1RKBA 4DLRA 3S1AA 2PX3A 4I1OA 1PUJA 4B76A 4US2R 5HKKA 4PO8A 3F5FA 2LKCA 1VPLA 4C7OB 2CK3D 1R0ZA 2BMFA 2YNMA 4DSNA 5HPYB 1VDZA 2WWHA 2O8BA 2WAYA 4HLCA 4M1SA 3QENA 5EUQB 4KHZA 3C7KA 1CU1A 4DZZA 3J81k 4DB2A 1E99A 3ADKA 2GF9A 5F98A 3BE4A 2X77A 5P21A 2QQ0A 1BKDR 2ZJBA 3CRRA 4LDJA 1JB1A 1XMIA 4LJ8A 3TNFA 3ZS8A 4F4IA 5KNCA 1FNNA 3BH6A 3T06B 5CM8B 2KB0A 4PO9A 4ZDJA 3ZVNA 4KU4A 1Z0IA 2CL7X 2A30A 3LLMA 2C04A 4MKGA 3SBEA 3DM5A 3CWQA 1XZPA 3K0CC 4L4UA 1OB5A 4WW0A 1SHKA 2ONKA 3OIYA 4RD2A 4DJTA 2HYIC 2YYZA 4BQSA 4LPSA 4NCKA 4TLBA 1J70A 1XTRA 1OPXA 5H70A 4B34A 2A5JA 1OE0A 3EZ9A 5EZ5A 1XTQA 3ECCA 4NBSA 2CE7A 3SS8A 1AKEA 2AWOA 3KJEA 3UKDA 4QNRA 4IRUB 2C9YA 1T3LA 2R2AA 5K8TA 1WMSA 2NZ8A 4JLVA 4A0RA 2CLSA 2J3EA 4TQ9A 1XMJA 1FNMA 1Z6GA 2V4ZA 4B75A 1XRJA 3UXMA 4KFTA 5H1YA 1Z0DA 1P4SA 1JR3E 5SZHB 4ARZB 4MYHA 3RANA 2O5VA 2XSZD 5DYIA 4DUGA 1GKYA 3FHTA 1BS1A 2VH5R 1T3HA 2RHMA 1GZSA 1ZMXA 1KDPA 1G8PA 3VTKA 1G18A 2WKQA 1IM2A 2JASA 2ZIAA 5FTMA 4EPXA 1JQLB 1E79D 5DHFA 4ZCLA 1NN5A 2WWYA 3L43A 3P26A 4HEJA 1ZNYA 2IWRA 1KIMA 2R6DA 1Q1BA 3U6BA 4X8LA 1Z6YA 1RYHA 3EZFA 1YJ5A 3D8BA 1X86B 4FCTA 1E94E 2J7PA 4HAWA 1Q3HA 3WYAA 1FMJA 2Z83A 1JJ7A 1OLOA 5DI3B 2O8CA 4MRSA 3L0IB 1KSHA 1LTQA 4TMTA 3UG6A 1E6CA 4OQLA 4TLCA 4XWAA 2E87A 2WM9B 1WA5A 5K8IA 3MRSA 4NYJR 3LH5A 4HZIA 4JBYA 3BD9A 4XTRA 4Q48A 2B92A 3SJZA 1RIFA 1GTVA 3KXLA 4DSOA 2F1HA 4MDEA 1HUQA 4TT3D 4V0LA 5CK5A 3ZZTA 4AG5A 4DKXA 4JJZA 1EG7A 1M6NA 1BH2A 4LHZA 4KLNA 5G53C 1DAMA 2H17A 3LW7A 4DLXA 4JVMA 2J0VA 3AGQA 3LWNA 4Q4JA 2W2TA 2W6JD 4UNNA 3SQXA 2XB2A 3R9IA 3NWJA 1AS3A 2IYRA 2QTVB 4RZ3A 4QNMA 2XTZA 1SVOA 1YQTA 3I72A 4P4TA 3B1ZA 2PLFA 4M22A 4BFVA 5J47A 3BXZA 2Z6VA 3R8FA 2GKSA 2V7QA 1AQUA 4RCZA 5CJPA 1SZPA 5F3WB 1KSJA 4HLUC 4HSEA 1DTSA 1EFRD 3LD9A 4GT1A 3GJXC 3W3ZB 2QT1A 2IYTA 1E2NA 1VG9B 3R9XA 3IBGA 3IO3A 1MH1A 3LV8A 4NYMR 1VG8A 2LCFA 1G3MA 2CLDX 3ZGXA 5FOSA 3B1WA 2YJTD 4JVSB 1CLUA 1E1QA 4ITRC 4PR0A 3MFYA 5JWHA 2ZRNA 3TUZC 1NJFA 4TQAA 4PHTA 4HUQB 4PC6A 3PJRA 4UXIA 121PA 3M4YA 4OI4A 3R8CA 3A6PC 4LWZA 2GRJA 4XOIA 2Q3MA 3K53A 2BCGY 1OFHA 4Q9HA 4ESHA 5E4FA 2QRZA 1W46A 1YZQA 4D82A 3R20A 4MRPA 1VCMA 3THWB 3NBFA 2R62A 1SHZA 3RS7A 3GMTA 4A8JC 4CVNA 1OIWA 4Q5IA 5BN5A 3A1VA 1LY1A 621PA 1OHHA 3K09C 3UATA 1G4AE 5JI3E 1UADA 2KBEA 2QAGC 4UKDA 1LW7A 1NMZA 4URWR 3ZDQA 1UBCA 1OFTA 1XD8A 3FOZA 1DEKA 3WBJA 1XTKA 1OFUX 1IONA 3DMNA 4JJKA 5D3MA 2ZITA 2OCYC 4C0KA 3W3AA 2OSBA 3KKNA 4LV6A 1FMLA 4O2RA 2EVWX 4JVNA 4LOAA 2RGNA 4FWTA 4IVPA 1IY1A 3EPLA 2GEDA 5B30A 3F0TA 3WMEA 2ERYA 3SJCA 4M8NE 1ZUHA 3LFUA 3RWOA 2GK6A 1VIAA 2QZ4A 4Q4AA 3P4YA 3X1YA 4L8GA 3IDQA 1DAKA 1KY2A 3SNHA 1KJZA 1E2DA 1MO5A 2CEAA 1EX6A 1F3OA 2RGGA 4US1R 3VFDA 2R6FA 1GL6A 2NG1A 2PEYA 1XXHE 3DHWC 4POAA 4U00A 1KMQA 2AL7A 3G5UA 4M9QA 4KLZA 4TTPA 4ESVA 1X3SA 2A5GA 4ARZA 1RE0A 1Z07A 3VR6A 1SGWA 1U9IA 4MGIR 4W5HA 1R0YA 1W36B 1ZM9A 4CEHB 1TMKA 4Q1AA 1JJVA 1E9CA 1FPMA 1Q3TA 1XPRA 5CB6A 1I4TD 1C9KA 3CZPA 4JT2A 2FE4A 3K0CA 4HZUA 3KKOA 3NG1A 3AKEA 2V6IA 5C4GB 2Q9CA 1GP2A 2YWHA 5AJVB 4Q9IA 3W6OA 2VL7A 2BKEA 1AZTA 1XNJA 2IT1A 821PA 3KQKA 3EIQA 1R0WA 2ZEJA 3KJGA 1VECA 2G6BA 2P2LA 2QAJA 2O8FA 2GHIA 2JLRA 3K9LA 4IEEA 1JECA 3Q72A 3WMGA 3WNBA 4YLGA 4Y0AA 4GFDA 3GLIA 2O8DB 3DOEA 3PUZA 1YZTA 1W2HA 3MWLA 3C14C 4I81A 2IS6A 2OXCA 2ZRBA 4Z1MD 4A0FA 4B3BA 4UNQA 1XB2A 3CRQA 2DR3A 3I32A 1DBSA 1NIPA 4EPRA 4CW7A 3TQCA 2VP0A 4FMBB 3T34A 2OXRA 2Q9AA 1D2MA 4EKDA 3AVUA 1NN3A 1KAOA 2JDIA 3IUYA 4LI0A 2B8TA 4RKEA 8OHMA 3DZ8A 1O87A 1W4CA 2V7QD 4HUQA 1X6VA 2ZE8A 4R71A 1TAGA 2IS1A 1NVWQ 4R2IA 1U81A 4Q4LA 5KDOA 1NLFA 1W0KD 2BBTA 3OIUA 3ASYA 4AKEA 1FTNA 2GXQA 1CJTC 3BH7A 4TMKA 4EJSC 1TQ6A 1N6LA 4DIEA 4M21A 721PA 3WHLA 1JR3D 1J8MF 1M2OB 1EWQA 2ZSAA 2CBZA 2G77B 2KBFA 3VR5A 2ZRPA 3L8YA 1TUEA 4B44A 2IWHA 1CP2A 3SJBA 1FQKA 4LBYA 2J45A 2EFGA 1G7SA 1II8A 4URUR 4DEXA 2FZLA 2OCAA 4OHWA 1M7HA 2REBA 1BYIA 2IEZA 3RS3A 2OILA 1F6BA 1S2MA 2V1UA 5DE3A 4P4SB 2ZJOA 2TMKA 4X8HA 1HE8B 4H1VA 1ZNXA 2ZETA 5TY0A 1E2JA 2O52A 3IIKA 4URXR 3I1FA 1UKYA 2VP2A 3MG9A 5FOWA 1TTTA 4Q21A 3ZQ6A 4DCSA 4GPTA 3QXJA 3GLFB 3L82B 1S1MA 3QXCA 1BOFA 2XJ9A 4D4JA 3BFXA 2ZU6A 1F5NA 1TQ2A 5IK2A 1KJWA 1RPZA 5DO9A 3O47A 2CLCX 3LXXA 2BBWA 5JWOA 3CW2A 3OFNA 3PIRA 2ZS8A 1XEXB 5JRJA 5DNYB 2FFBA 4HB4A 1DARA 1OYWA 4ZPXA 1XEWY 1NP6A 1N6HA 1TX4B 5JSZB 2F1IA 2C03A 2IXFA 5F9HA 4NH0A 4O2LA 2IYYA 2X8AA 2WJHA 1R6BX 4BFWA 5EP1A 4U02A 1YZUA 4A8JB 4KV9A 4JLDA 1UKVY 2QAGA 4CEJB 1E1QD 3CPJB 3V9PA 1W44A 1VMAA 3PUWA 3A1TA 3UPUA 3OEHA 3KJIA 3UMFA 3RRYA 4BRUA 2Q21A 2XZPA 3L8ZA 1XTIA 3UWKA 2PJZA 5J4LA 1GVNB 1NI3A 3AF0A 2JEOA 1E2LA 5KOYA 3AF4A 1E2EA 1TF5A 1X8JA 4G5RA 1DAIA 5SZJA 5C18A 3K09A 1SKYB 4UJ5A 1FW6A 4OKSA 1KTVA 4BLQA 5SZKB 1J99A 4Q18A 1D5CA 2J7PD 5FUWA 5J4YA 5ELXA 4ILEA 1LS6A 3X2SA 2P65A 3KX2A 4KJZA 4C3ZA 2WMNB 3IQWA 4QM7A 1QHGA 1QHHA 1SVLA 4JLPA 5IHPA 2W6IA 3QG5A 4AIIA 1QDEA 1WP9A 3W6NA 4MYTA 2JJ2A 2ZSEA 4JYCA 3OEED 2MMCA 5IF9A 3B13B 1XTSA 4IKEA 4DLSA 5B64A 1CR2A 3E2IA 4TL9A 3ZVLA 2NQ2C 5DN6D 3LVQE 4PZLA 5EE1A 4B6EA 1MABA 1M8PA 4MGZR 3O8CA 1ZINA 1K5GA 1RJ9A 2VHTA 2AK2A 5EE0A 3CO5A 1IHUA 3GLGA 1IN5A 2QMEA 1WBDA 2B7BA 2WICA 2XITA 2XSZA 4HLUA 4YDHB 1FP7A 4A2QA 4YMSA 5KDDA 2BJVA 1RRFA 2ORWA 5L3SB 5CDFE 1MT0A 2G3YA 2PX0A 3MJHA 5E7IA 3PG5A 3FDIA 2XOKA 4EDHA 1N6RA 4F92B 4JVLA 1F60A 2FF7A 1XJ0A 2P6UA 1OFIA 4HB2A 2P0EA 4W5JA 1NKTA 5TVKA 4RD6A 5KSPA 2XTNA 2F3TA 2WTUA 4AY2A 5FPTA 1QBKC 1EXMA 2F43A 2GK7A 4CZ2A 1FQJA 1N0WA 1PUIA 4OI0A 5SZIA 5KSZA 1LV7A 1KMHB 1ZCBA 2PZEA 3U44A 2CL0X 2KWIA 4EPTA 4DB4A 3KXKA 4TL6A 3AV0B 1NNEA 1E2IA 1G3UA 1VTKA 3AKYA 3Q3JB 4OK5A 5EE5B 2R44A 2ZM5A 3THXB 2DPXA 4V0ME 2OAP1 4EPWA 4A0GA 2LWIA 1BMFD 1OYYA 2J59A 1XJCA 3W8NA 1U2RA 4E22A 1E98A 3TAHA 1C1YA 2VO1A 3VX3A 4DIDA 2GXAA 1W47A 1N5LA 2Z0MA 4GNKA 1K6MA 2J0UA 4MYUA 3IHLA 1QHNA 4A1FA 4F7WA 3GLGE 1D6JA 3GJ4A 5HCNA 3RRMA 1ZU5A 4YQFA 2RMKA 5AUQA 3RWMB 3GLGB 2H5EA 4W7SA 3WYFA 1YR8A 5GJWC 2MSEB 3TGPA 2H8KA 2QGZA 1NVVR 4KSBA 2ANCA 2OFOA 4QOSA 4OQNA 4G5GA 3N2EA 4Q7LA 5AK0A 4LRWA 1H8HD 2ZR0A 2ZANA 5FR2A 3I62A 3EARA 4B3GA 2OLKA 1U8YA 2VSXA 3C5CA 4M9ZA 3NKVA 3G82C 2F55A 4M1OA 3ADBA 3SHWA 1N5IA 2BEJA 3EIHA 1T5IA 5KSOA 4LJ4A 5UKDA 3GFOA 4DT1B 1Z6XA 3I5YA 2IBMA 3GCGA 1M7GA 4LYFA 1JALA 2GZHA 2IHBA 4MKHA 4DBLC 2IS4A 1U90A 1E79A 3KXIA 1I2MA 3ZIAD 4PX9A 4IEIA 1KO5A 4P4UA 2JLQA 1D8TA 2JA1A 3KTAA 4JLAA 5FPHA 4Q9JA 4L9WA 2QA5A 4LC0A 3VMFA 4KFRA 3VU9B 1KI9A 4EPVA 1XCPA 2FMXA 2VF7A 2EU8A 3DMDA 3TKLA 4DLYA 2VHUA 4WXRA 5JRZA 1XP8A 5E7MA 1BYUA 4QGFA 1V43A 3WYGA 3MWJA 1JEEA 3AB3A 3P1JA 4HAUA 2DFKB 1KDTA 1A1VA 3ICEA 1TF7A 2IF0A 2QN6A 4UXHA 5IDVA 5FTLA 5G41A 1NY5A 2HF9A 4GSYA 3Q7PA 4CIDA 4G5OA 1NG9A 3FKQA 3LBIA 5DN6A 1KO7A 2X2EA 4PHFA 3WNDA 4NDZA 2RGDA 3KTAB 4Q02A 2WWGA 3KKMA 4B73A 1UPTA 1M1YE 1KI4A 2OESA 1G7RA 4Q1DA 3W6PA 2JLSA 2CXXA 5EP3A 5EE9A 1OXXK 3P27A 1XD2B 5E95A 1AK2A 4Z54A 3NVAA 2RGEA 5FUXA 5JWRA 2MMGA 2WZQA 3DPUA 1LB1B 4C7OA 3T15A 4DEYA 1SVSA 4HLDA 3GLHE 2EWVA 4KVGA 4XD7A 5DHAA 2XXAB 1KYIA 1GWNA 4OBEA 2OT3B 3UMRA 3K0EA 1ZM2A 3ZIAA 1UDXA 3SR0A 4QKQA 4A82A 1GL9B 1J90A 2WKPA 1A4RA 1PZNA 2GAAA 1FUKA 4Q7KA 2ZRGA 1JNYA 4Q9KA 4V0KA 5DYGA 2FGKA 2PBRA 3QKUA 1B23P 5FBVB 2ZS9A 2GWHA 4YXWA 4AKIA 2OFXA 4PSAA 1PLLA 2WJYA 2WJIA 2RHDA 1IN6A 1NVUQ 4UNPA 2I4IA 1HH4A 4AYWA 2Q0HA 1W5TA 2CHQA 1WCV1 1IY2A 2V55B 3QJYA 5GVSA 1IQPA 4C0LA 3TLXA 3CIOA 4WZAE 2ZRFA 2EFEB 2L0XA 3FFBA 3TSWA 2CDNA 2FSFA 3BH0A 2XAUA 3MLEA 4F93B 2ZR7A 4O3MA 3T35A 1GOTA 4G01B 3U7EB 2IYUA 2H92A 5FL3A 3GP8A 3M6AA 2VHCA 4LK2A 1DAGA 1S8FA 3QPUA 5AR1A 3VKWA 2PCLA 2BEKA 2XNSA 4CT5A 3FGNA 3OAAD 3ADCA 1L4YA 1G9XA 1KMHA 1UFQA 2FSIA 2WOOA 1G3RA 1N6NA 1OF1A 4G1UC 1FX0B 3GLHA 4MA4A 3MAAC 4DT1A 2QP3A 4A2PA 3X1DA 5J4VA 5C2JB 2VP4A 4Q66C 3R9WA 3GPLA 4M2LA 4OI1A 4PZZA 3GJ6A 2RH5A 4URYR 1XD9A 1OXUA 1G5TA 1QF9A 4JLJA 5JMTA 1CTQA 4GP7A 3U44B 3MSXA 1AA9A 4LGMA 3DVLA 3HPQA 5B57C 3I8SA 3K9HA 3H2YA 3PEVA 5TXGA 4NU0A 1EFTA 4JS0A 4C0AC 4D0NA 3KQLA 2F6RA 3IPYA 3FWYA 3RC8A 1SXJD 1MRSA 1US8B 1IN7A 3CF0A 4XWKA 2GXUA 1GILA 4QJ3A 3O8DA 1QVRA 4RCYA 3AP3A 3BGWA 3V4RA 1GNRA 2VTKA 4BEJA 1HYQA 5FI1B 2GF0A 1JAIA 5LBIA 4C0SA 1E2FA 4BPBA 4Q1BA 5LDDC 2DWQA 5KHOC 1NBME 2I1VB 1VG0B 2DCUA 3BBPA 3EW9A 4ERNA 3QXHA 1BMFA 2D4HA 3HU2A 4WIAA 4FW9A 4B71A 4J0QA 4S35A 2NTYC 4BFUA 2GETA 3WRYC 1OKKA 2H16A 4H9GA 4LYHA 1KAGA 1G8FA 3PEYA 4ACBA 1NY6A 1EFCA 4C30A 1UKEA 1DADA 4DLZA 4JZKA 1E9AA 1R7RA 5HE8A 2C98A 5IRCD 4TL8A 3DKPA 4BFZA 2ZU0C 2C77A 3X1WA 4QBGB 3REGA 2FNAA 4TT3A 5DI3A 1R0XA 1FOEB 1KI1A 4YMTA 1KK1A 4LJYA 3HDTA 2E9SA 3PVSA 4MYCA 3Q7QA 1KK3A 3RAPR 4IDHA 4BUJA 2Z4SA 3TAUA 3GJ5A 1II9A 2C95A 2QY9A 2BMEA 2WJVA 4A6PA 2A2ZA 2AHOA 2QE7D 1E2MA 2BV3A 3U5ZB 1JXOA 2G83A 2JAQA 2QPAA 4GDFA 3QY0A 1Q0UA 1QG4A 4KBFA 5HZHA 1WF3A 2V8OA 1ZYUA 2JIZD 2R9VA 3GJ0A 4KBGA 2QU8A 4LUCA 3BWDD 1P2VA 5F9FA 2F3RA 1Z3IX 1P75A 4B2IA 4WAUA 2NIPA 5BQ5A 1XXHA 2QGNA 1CEEA 3C41J 4JBWA 1E0SA 4IOJA 1E9BA 1GSIA 4QXAA 4E07A 4NKRA 3VU9A 1SQ5A 2BCJQ 1E9FA 4US0R 2GJKA 1DOAA 1GG2A 4QG7A 5GVRA 3CKLA 2JCSA 1R5BA 5HTKA 2LKDA 1YR9A 4B33A 3RS4A 1DVRA 3EZ7A 3U6KA 3OIWA 1KI3A 5FR1A 1TADA 1ZNWA 3FMFA 1P61B 4DLUA 4R7ZA 5KTYA 3B1YA 2GJSA 1ESNA 3TR0A 3GJ8A 4PAMA 4RKFA 3RSOA 5B2ZA 2A7QA 1AQYA 1SVWA 2BVNA 2AXNA 2Z43A 2OO7A 2OG2A 1VHTA 2WOJA 1YRBA 1JI0A 2NOAA 2KJQA 1FL9A 3AUYA 3HWSA 1AJEA 3TUIC 2YWEA 2JJ2D 3LDAA 3CR8A 2IL1A 4IHQA 4MQBA 4ZIRA 5AJZA 1YVDA 2R8RA 2QMHA 4OK3A 3GLIE 1E4YA 3BK7A 3CPHA 2BWJA 4NTZA 2RAPA 3SI7A 1E32A 1YE8A 1J8YF 2DFTA 2YOFA 4NL4H 2IK8A 3F8TA 2G1JA 2J46A 3KKPA 4TYYA 2D62A 3REFA 2GESA 1CJVC 1W36D 2C5LA 3U61B 4L16A 2FN4A 2IS2A 1E1RD 2XJ4A 2QT0A 2I1QA 1UM8A 2FJUA 4LY6A 4RD4A 4MGKR 3VR4A 2P6NA 1R8SA 4QJ4A 3CUEF 1IN4A 4UJ3A 1FX0A 3GLHB 4S2EA 4XVQA 1W1WA 4DCNA 4CDGA 2ZUDA 4E09A 2AN9A 3LLUA 3CNOA 3THYB 4PPFA 3AVTA 1SXJC 3B8HA 2BBOA 1CJUC 3VR2A 2XGJA 2ZYUX 5DIFA 1QHXA 2P3SA 3KKQA 4LHWA 1CXZA 1GITA 2N46A 2NO1A 4JL5A 5H8WA 1XZQA 4OJQA 1HQYE 2QSZA 1OHHD 5AJXA 4EQ6A 3VHXA 2CCJA 2OFWA 3CRVA 4B2PA 3BORA 4V03A 3ADDA 4G0NA 3T1VA 4FMDF 2IW3A 3VHLB 3LBNA 5IT5A 1G4UR 5JJKA 3QSYA 2EYUA 1MR3F 1VCOA 4AYTA 2WIAA 2OUKA 2N1BA 2YWFA 3OFND 4YXWD 2QBYB 1IAQA 4JLMA 1VCNA 4QGAA 3TVDA 2JLZA 1E2GA 3LXRA 2A5YB 2ZROA 1FP6A 2HJGA 1RJ9B 3H1TA 3PCRB 1UAAA 2GCNA 3OF5A 4DDUA 4YDSA 4TWZA 4D4LA 4NYIR 4GMXA 1G5RA 4FCVA 1N5JA 4XVRA 2QBYA 2IYLD 3MUFA 2VRWA 4N3NA 1YZKA 3IILA 2WWFA 5G40A 3WBKA 2YVUA 2IYVA 3A8TA 2B8WA 4UXJA 1H8HA 4V02A 3W90A 2CL6X 2CJWA 1RW4A 3EZ2A 3KQHA 4B3CA 3TE6A 3WP1B 2CVHA 1X8KA 5CYOA 4HI0E 2ZI4A 5JCPA 2ZRDA 3GEHA 3QIAA 5FOXA 4Q4HA 1MO4A 3CM0A 1GKUB 2B6HA 4WZBE 4HATA 2PLRA 1ZAKA 4RVCA 3I5XA 4RZ2A 2BM0A 4B32A 2GAOA 4LX0A 2JLVA 1II0A 1DAFA 1ZD8A 3NHBA 1P9RA 3AH8A 3QE0A 2FWRA 6Q21A 1CJMA 3QBVA 1J7KA 1WQ1R 5FPYA 4ZDKA 3TVTA 3HPRA 4LBWA 1C4OA 2GCOA 4WXPA 1G7TA 1IXSB 3Q8XB 2JJ1D 4RY2A 2CNWA 1G5PA 3OESA 1Z47A 3LNCA 4D6PA 3K0FB 3ZVMA 1DAEA 1DG1G 2CCKA 4DLTA 1ZVQA 4JMPA 2NO9A 4TQUS 3W9YA 2QP9X 1DG3A 2ZJYA 4V0OA 2YHSA 3E1SA 4LPKA 3Q9LA 4BLTA 2CNWD 4BECA 4DWJA 2RGAA 1ZP6A 1F2UA 3TW4A 4K81B 1OH6A 2J1LA 2G9NA 1G8HA 2IYZA 1M74A 3T1QA 2OLJA 1Z0AA 1E1RA 2MSDB 1T8UA 1ZM4A 4M1KA 2ZYWX 1AS2A 5HKKD 1XWIA 4TTQA 2QE7A 3I3SR 5FBRB 3JZMA 1R5OA 1ODFA 2ZRIA 3THYA 1MRNA 1N25A 2WVJA 4PPGA 4B2LA 4P32A 4Z8YA 2N42A 4PQYA 3B5JA 2WJJA 4XTCS 1E9EA 2V9PA 221PA 3U2QA 4QFMA 4PSVA 1SVIA 1SKYE 2IYXA
chains in the Genus database with same CATH superfamily
1TF2A 2Q27A 3PYXA 3LDUA 4BLSA 3HCCA 4EI9A 4POOA 3QVUA 3HCWA 3JQAB 4KH1A 4LXQA 3W9SA 2DB3A 5JW6A 4F91B 4NZOA 4QUHA 2IHZA 4TV9F 4JBHA 2PKQP 4J0KA 1X77A 5JXWA 2O54A 1RWPA 5ANRB 3ZBUA 1UK8A 3GNQA 3CX6A 3ONWA 2H0AA 3PDHA 1YGYA 5BW8A 3RRBA 1X2EA 1E6KA 2R6ZA 3EWIA 4E1VA 4EJSA 2P6RA 2ZJ0A 1LQ2A 2J5KA 1HDGO 3MCAA 3RFXA 3V00A 4G89A 4GRAA 1P5HA 2HYDA 3CLSD 4L4XA 3P45A 4BWYA 2CWWA 3Q2IA 1MABB 3OI7A 4AWBA 4UFOA 4CLXA 4O08A 2NZJA 3G0CA 4NONA 4RE5A 2IU3A 4ZRMA 4BMSA 3E5HA 4MOWA 1KDOA 4M9XA 2IEDA 2RG1A 3W5JA 3AR6A 2NAFA 1T43A 3KCQA 3LAWA 3ZTWA 4EHAA 5BR8B 2DLNA 1E58A 1OXKB 3RS0A 3WDSA 3EXG1 2FG5A 4X7MA 2EWMA 3HB4X 4U9UA 4DPKA 3C8UA 2ZP1A 2D7CA 4L5BA 4AYXA 1ZN7A 4JJ8A 1K63A 2DHRA 2C5FA 1G3QA 1NVDA 2JD0A 1VSTA 2R00C 2YMPA 1U1GA 3HN2A 3OEYA 1K0FA 4PFSA 4QXQA 4IFBA 2HAEA 1VHJA 4M8IA 3PUXA 2FR1A 2UKDA 5CH3A 2GN6A 2X14A 1L5KA 3VH1A 1B0ZA 1BD3A 5I6DA 1RJGA 2FGJA 3PKZA 5T5QA 1T2DA 4XSVA 2ZBGA 4ZHSA 2R96A 4AK9A 1D4FA 4PCUA 3QWIA 1COWD 2PNJA 4CKWB 3O8QA 1E3JA 1ORRA 1WPRA 3DBRB 4K28A 1P18A 2W4IA 5EJ4A 3VNRA 4P80A 3A4LA 3B52X 2H2FA 4URZR 1YQWA 2H63A 3P9QA 4LMBA 4OP2A 3M6VA 3KOMA 3R24A 5KUTA 1M8GA 1XCJA 4YECA 5T67A 4GLLA 2O8FB 4L5YA 1K97A 5HQ3A 3CX7A 1X1AA 3BXGA 3LT1A 4MMZB 5CIQA 2YZKA 4C89A 4QDZA 4P4SA 4U7FA 5CT5A 3SK0A 1ZMBA 2V1XA 5FA6A 1DIGA 1HF3A 1ZH2A 4KFUA 3U7GA 3OPVA 1E2HA 1NQWA 4MV5A 1VFPA 1D9XA 3CCCA 4TTRA 4BMPB 1U5BB 4HJRA 4OBXA 4GBGA 2R60A 5EJGA 2QVXX 5BN5B 4AWXA 1QS0A 1T1RA 4MLDA 4R6XA 4TL7A 4XR9A 2YJGA 4HUJA 4MVJD 4NK4A 1N75A 1PLKA 5FTNA 2GVZC 1I6WA 1PNVA 5E2AA 3T3GA 4YV7A 4NULA 3T9FA 3UV3A 3M4JA 1XRMA 3U1BA 1A1SA 1YF3A 3BEDA 3AERB 1A9PA 2P1ZA 3HO6A 1LZKA 4FMCB 3HQ4O 3ITNA 4JIMA 4KVZA 4B6SA 5HS4A 3M2TA 3E6AA 1TE2A 4LW8A 3NGLA 4BGUA 1AQNA 2XQIA 3ESDA 3JYHA 3Q0EA 2WIBA 3I2JA 3VDXA 1KY3A 1J22A 2DJIA 4QECA 3HGTA 3AUUA 5JSYA 2B36A 4C3UA 1NM5A 4F5DA 5LFAA 1I5RA 1AMUA 4ZKDA 4KQEA 1E2UA 2FLVA 4NHOA 4BKPA 1QHYA 1QYCA 2P77A 3HUUA 4H31A 1N2SA 3O4RA 4QHTA 5LB2A 3MUNA 2QMUA 1JDVA 2A9RA 2CUTA 3DUWA 4FUQA 4QJ5A 2JC3A 3B9PA 4WCDA 5EIBD 3DTTA 4Y9RA 2PX6A 5DGTA 4DA0A 1NDUA 5KVSA 3QQ5A 3CR3C 3K9QO 3TOSA 2KSQA 1E96A 3DE7X 4KAJA 3NS7A 4QWMA 3DT6A 5M2QA 2WVAA 4IDQA 4UHFA 4JBGA 2YXLA 4DJJA 4CM1A 4CLOA 3QVOA 2IXTA 1IZ8A 1N2GA 4J7CA 4W5TA 2IBTA 1UT8A 2HA5A 1GPYA 1UPAA 3IIJA 4MR8B 1D2AA 4F2HA 1FXSA 1SBZA 3HU1A 2JIDA 4JR0A 3W78A 4MI3A 4O2AF 1J9EA 2VA9A 3BREA 4HAVA 3OM9A 5HM6A 1JIVA 1O95C 3ND8A 3U56A 3KSBC 3P0EA 1MX5A 4IH4A 4JR1A 3VKGA 3RF7A 3K16A 4N7RA 2ZIZA 4QRDA 2WHXA 4BC1A 4HC4A 1X1TA 2BC9A 2Z8ZA 3ONDA 4GOKA 1CF9A 4J2OA 4PRZA 2FPLA 1RMTA 5IYZF 2HHJA 3BULA 4CLRA 1U3CA 2QAIA 3SFZA 4M6WA 4UULA 3GEMA 4WDRA 2RSLA 3ORRA 3W2GA 4C0HA 2VBCA 1W36C 1T6BY 3ZU5A 2JD2A 1R27A 3UN1A 1E2QA 1BAPA 3QG1A 2NP7A 2J0EA 4A15A 2WSSA 5CVDA 5JYEA 2WFLB 3JTEA 2IZ0A 2YBEA 2DTDA 1RQ7A 1U8ZA 4LKRA 5IXSA 1QBGA 2X2PA 4Y6RA 4BGDA 3LZDA 5CRIA 4CQMB 3UJ6A 3UAXA 2BGJA 4KFCA 1G98A 1NDHA 4RNCA 4NPCA 5CIWA 3W9UA 3I9V6 1E3DA 4IEFB 3JATB 3OPXA 4HB3A 4MUIA 1LWOA 3QVWA 4RXUA 4TTJA 4YHHB 4W8GA 2OR3A 3S1LA 3DVAB 1XEWX 4HEHA 2FI1A 4UREA 1IBMB 2V96A 3L18A 2XCIA 1I80A 3ZD6A 4QM6A 5M34A 1IL0A 1YZNA 4KH0A 4C0QC 2QPOA 4QFBA 3UOGA 2GEVA 1JLMA 1ZH8A 1SG9A 1IXZA 2QROA 3SIXA 4D6XA 1LC0A 2W2KB 3PC8A 2BMWA 2C3OA 5IAGA 5B58C 4UNRA 5DK6A 5CJ2A 4B0OA 3MLBA 3ZVRA 3EDRA 2O20A 2HV9A 1UWKA 3TDMA 4MB6A 1NUHA 1MIHA 2ATVA 4RU1A 5K8LA 3RUPA 2F9MA 4JP1A 4B3JA 3TTVA 4RY9A 3DMFA 4II7A 8ABPA 2WHPB 3IDZA 3HS3A 4YACA 5EHIA 5GZ6A 5CDSA 5KVAA 2F8MA 2WWVD 1RZRD 1JZTA 2AQIA 2VSFA 2QTFA 3TECE 4FQ7A 3HVHA 5IM4A 4TSFA 4Z3OA 1SOMA 4YBZA 1NQ5A 1T0HB 2RKOA 2QX6A 3PDIA 5EXXA 1JR6A 3IAS6 1H2AS 2R11A 3IKLA 4J0CA 3E22B 3KLOA 3VAAA 4E1AA 2GO7A 5IUKC 2AG0A 3ML1A 5LM3A 2YIDA 2ZJ5A 2AD1A 2I2WA 4NCHA 3IJ5A 2EXXA 3FUUA 3S29A 2ICAA 2ZRJA 1CIPA 2QI9F 2CKDA 4NATA 3DCIA 4IV8A 1TKBA 3JD2A 3AF1A 4RSRA 3UTCA 1DJLA 1D2EA 1GZDA 4BKMA 2ABWA 2OBLA 3EOAI 2O0KA 2OAQ1 5H80A 4UVDA 3W34A 5I47A 4ZAWA 3PTZA 4JSYA 4Q03A 1U2DA 1ZJWA 3F6PA 4L5CA 2DPYA 3L79A 5AM1A 1Z08A 4C20A 1UF9A 2G04A 5DBFA 5FORA 4BZQA 3HVKA 4RBNA 4FHFA 2YRXA 2VBGA 3AW8A 3P5BA 3Q6MA 1EJBA 4HRYA 3EX7C 1CUWA 3EGCA 2YVQA 3B78A 4K05A 4KUEA 3VR3A 3AHGA 3R3WA 4XGRA 4ML3A 4P83A 1N9KA 3LVBA 5IFLA 1JSRA 3AETB 3U09A 1NZJA 4HWTA 4OB8A 2HUPA 3KZ1E 3TR6A 1EZ1A 1ZUWA 3FWNA 3K2BA 5BN4B 3V32A 1RT9A 2VDNB 3DHYA 4LVUA 5C1BA 1U0FA 3AL3A 2EQAA 1V4NA 1VIDA 1P44A 1EFRA 1ZI9A 2ENUA 3P32A 3PDWA 2FZCA 4WOPA 5CLLA 4BATA 1DMSA 2ZAMA 3AJAA 1E1LA 1U1EA 2WP8J 3EZLA 1JT9A 1NOJA 4MWTA 4Q4HB 5CYFA 5D1HA 5DDIP 4BDTA 3RUCA 3OE5A 2RGCA 3D2BA 4A92A 4ZVLA 3Q85A 1WB6A 3HR7A 3VA7A 1V1MA 3EIEA 4L4ZA 5JMWA 4YI3A 3DYVA 3ZHOA 3PI7A 4J0JA 4NX2A 1Y42X 2HXSA 4PPNA 5HKLA 3H9QA 1W88B 4UE6A 3ER6A 4MMXB 2X13A 5E0OA 5C8ZA 1F6DA 2X4IA 4K6HA 3CLUC 4PAQA 2MYUA 3VSCA 1A27A 5AQEA 2C8LA 4RZXA 3F3MA 2UZ3A 1Q1EA 1CZKA 2VTEA 3E27A 3OOEA 4ZAGA 3V34A 3EN0A 1ZJYA 2FU5C 3KL4A 3USZA 3LVFO 1S9HA 4B82A 1QVWA 1TTPB 2VIIA 1Z34A 3JY6A 3KIPA 1NNUA 1ARZA 4Q7QA 4D79A 4ZCMA 2PUDA 3A4IA 1XTZA 3GDOA 2CE2X 2HWYA 2A35A 1BE6A 2WIKA 2BGLA 2D1SA 1AGRA 2B0JA 1U0HC 1G21A 1SHUX 1C7ZA 1I4EB 2VHEA 3N8IA 4R6WA 3FF4A 1CIVA 3R5KA 1SCIA 3OQMA 3GUHA 4HB0A 1IQRA 3OH8A 2GCOB 3TVYA 3UJDA 1H9BA 4YPOA 1E2KA 2O1SA 3KCNA 3WV4A 1N0UA 3DEAA 3GVXA 4N12A 1Y5RA 4U9IS 1XVVA 1K2VN 2VP9A 1EESA 5TQ2A 4YCLA 3EGXA 1KKLA 1DQRA 1AVTA 3I12A 3KAKA 4XGQA 5JSZA 2VA8A 3K2IA 3R7WB 4DCCA 3OQPA 4ALLA 3ETLA 3ONVA 4NOLA 4UNSA 2GGSA 3RK1A 3FOFC 4DNQA 3H4VA 1XYYA 1YHNA 1NWHA 3EDYA 1UEIA 4BKOA 2O2SA 2DBQA 4KXNA 4QQNA 1OX4B 4ZHQF 1NF2A 3OPNA 4IOKA 4BEWA 1XYGA 1LSJA 4LFAB 5AVTA 1T9AA 1BVHA 4INZA 5SYMA 4XDHA 4L73A 4DHWA 3UPTA 5FXMA 4NYMQ 4YWHA 3THWA 2G80A 4MMYB 2GBIA 2XMGA 3LC7O 2JH9A 4Z2AA 4C2UA 3KHKA 2C4UA 2R00A 3ABZA 3EY9A 3NBZC 4GGOA 1VE3A 1XMSA 3HNRA 4HN2A 3D7RA 2CLMB 4KCGA 4DQXA 2XTAA 1CJBA 4E32A 2C9BA 3H4MA 4EFNA 2ZT6A 2YVKA 1Y9JA 3PE4A 1LTHR 4LZJA 3TZ6A 4PX2A 3GD7A 2UZIR 1P91A 3FCXA 1AS0A 4N0EA 1VCIA 2G07A 4MUFA 3GZJA 3FSGD 2XNDD 3L0OA 2QSUA 1J0EA 2PUVA 2A0YA 2C4HA 4Y6GB 5A3VA 4EGQA 3DXXA 1G3IA 1LJLA 2JHPA 4DIUA 4BFCA 2Q5FA 5CXUA 5KQSA 4TS9A 2H4FA 2JGFA 3OECA 5DH9A 2Y1WA 1FTSA 1I2CA 1GARA 3PCXA 5DX1A 3RT1A 3UGQA 1I3LA 3E9CA 1QMPA 2ZDQA 3DFIA 3EUAA 4JODA 4HDSA 3VZBA 4ALIA 4M1MA 1UJCA 4F6LA 2GTHA 1MCZA 1AQLA 1EVLA 1ZUNB 2B7CA 3BAFA 3TSZA 2V6GA 2ZUCA 3WQBA 2P3LA 1FDUA 1TD1A 4YRQA 3RRZA 3ZX4A 4C5AA 3KEOA 1NQUA 3TR5A 3SU8A 4GKJB 3IPXA 3D3EA 4IJVA 3Q98A 1EMDA 1W49A 4K9MA 5CT6A 5CX1A 1TLLA 1UKCA 3T7SA 5KREA 5FJIA 4OK6A 5CBKA 1JILA 4O0LA 1ZS9A 4FDUA 2HLNA 5BSUA 4TRMA 4N0MA 2I7TA 3LGSA 2CFRA 1QQ7A 2CVZA 5I7HA 4OVKA 3KU1A 1DBPA 4MB2A 1PD1A 3BN3A 5E8JA 3QMWA 5HIKA 1TLTA 1BQEA 3LQRA 3OTQA 5FPSA 3EIWA 1YJAA 5EWMA 1CZRA 4KO1S 3UC5A 2E55A 4M86A 3C15C 1ZCZA 1JA1A 3O8NA 1U2EA 4FJ0A 4P3XA 3RS2A 1UINA 5B1HA 3MWKA 3AXSA 2EKBA 5ARCA 4MHTA 1KIAA 3KLNA 3AP2A 4TKUA 2ARKA 2X3YA 3VR0A 1OBFO 2PH1A 2H00A 3TL2A 2VAXA 2PZFA 2CYCA 5B4VA 5KNBD 2CK3A 1NVFA 2IOFA 4YO8A 4B6OA 4W5OA 3BRSA 2GPJA 1L6IA 4DOMA 1RYEA 4R98A 5IZCA 1OXMA 2X5JO 2ZM6B 8AT1A 1ELOA 4H4CA 2ZRAA 4YLEA 3THOA 4KIGA 3BWVA 5B12A 3G0BA 3QFHA 4NS1A 4YR9A 4PINA 4JDUA 2XUHA 4OKNA 4XSGA 4XFKA 3G5MA 1GG8A 1SXPA 4B79A 1GUZA 4MJ3A 3UVEA 1RS0A 2P9GA 4OIMA 1B8UA 3K92A 1L6RA 2UZ1A 4JL6A 4OXIA 2XWQA 4P35A 4ZJPA 1I1HA 4B43A 2OM2A 4L6CA 1WMFA 1UAYA 4ZOLA 1JHYA 3H0EA 4R81A 4XUDA 5B6IA 2ODNA 4PX5A 1V6SA 1I4OA 1NW3A 1ZMTA 3CZ5A 1LWNA 1ZFNA 4HNQA 5L3RA 1K75A 3A1WA 3HJFA 2JHFA 1UBRS 1G2IA 1ZGBA 2IYQA 4X41A 2EJUA 5I7WA 1NQAO 4KYIB 3UWPA 3T0IA 3LX4A 1CUSA 5JHHB 1OH8A 5KQGA 4K9DA 3GH1A 3NB0A 3ZW9A 1MO6A 2J3MA 1TUBB 4DRXB 4IYJA 5JPIA 3CH6A 1MB4A 4PHCA 4ZXPA 1QHHB 4S05A 2WD8A 4EL0A 2H18A 4QBHA 3PF8A 4PC7A 2A92A 3PGMA 1EFVB 1KKMA 2C84A 3U3MA 4YT4A 1Y89A 3D7MA 3PUVA 1TFUA 2J7KA 4UAGA 4AMGA 1TGYA 3FYHA 3NIBA 3ONFA 5ALNA 5ESXA 4YY3B 3PGLA 3BMCB 3PKIA 4BMVA 3MT9A 1O7JA 1GU1A 5TMDA 3ROEA 1EFUA 5ALIA 3W5IA 4PZ9A 1DLIA 4DHEA 4YONB 3KTOA 2RBEA 2DG2A 2Y76A 3QE3A 4B09A 1U80A 3L6OO 1EBFA 4HGQA 4I50B 2C42A 4HGOA 2FA9A 1MB2A 4BP3A 4EY5A 1KO4A 2FRVA 4EA7A 1UBNA 1F1JA 4P3OA 4QO8A 4YNBA 4D9KA 3WLRA 2HCRA 2BKLA 2V03A 1U6IA 2WC1A 4P36A 4X1KB 5ALMA 5FOUA 4L9AA 1NXPA 4Q3BA 1W0KA 1P7YA 2IUSA 2FSHA 3SEFA 3WZLA 1AKTA 1ZNZA 1G42A 1GFIA 3B2EA 3ZE6A 4AJEA 4DSAA 3ELDA 1RNLA 3G13A 4IUYA 4MUBA 1WR8A 2YXNA 5AKJA 5LD2B 2IUYA 1N1MA 5J59A 1XDBA 4TVBA 1SXIA 2BJHA 4E5DA 2COKA 3NHLA 5J1SB 2YJNA 4RM2A 1YBFA 4QDOA 2OCPA 3SIWA 3GUYA 3JWEA 2XE6A 3MLAA 4RD1A 4C2BA 3H9CA 2AOTB 5JD4A 4XB1A 5DTRA 5H5JA 3STVA 4EJMA 3GNSA 3MYRA 4RLQA 7MDHA 2FP3A 3EFBA 4FEAA 5GOZA 2VATA 1X1RA 1MVLA 3JQBC 5JBNA 1U8UA 4MUKA 5FO0A 3IQEA 3ZDCA 1NBOA 2ANBA 2BT4A 2LIPA 5CTAA 1DP4A 1T9GS 1X7XA 4AO7A 5JUWA 1MTZA 2JJ1A 4LY9A 2Z09A 5FA8A 1K6IA 4CNQA 5L3SA 2HB6A 4W9MC 1CPYA 2G1UA 4ETMA 1LDMA 2PD6A 3SE7A 1HDEA 3SFVA 1Q44A 4XVUA 2O2ZA 3R9XB 3WLQA 5A1TA 1ZQ9A 2B5VA 4UOZA 3BIOA 4IPTA 3WAJA 2CHGA 1YU9A 3G0GA 1YRHA 1YR6A 2AE1A 5H02A 1M3SA 2QVYX 3AVQA 3Q8MA 3VM6A 1B26A 2AJBA 4G1EB 2W93A 4FD2A 2PZ8A 3EGEA 4OP1A 3T3NA 3WRYA 2JEYA 2HSJA 2Y9PB 3PU6A 3PRKE 4ZA2A 1WRBA 3WJ1A 1FFAA 1OA1A 2FPKA 3AZOA 4B4OA 2BTEA 3U7QB 5FBLB 1JIKA 3OAAA 1F0NA 2BGIA 1CQJA 2P9BA 2WD9A 2O50A 4JEHA 4WY8A 4C4AA 5IFKA 4ZYXA 1ZMOA 3ZLJA 1N3YA 2WT4A 3QVJA 3CS3A 4KXUA 4PZYA 1W5BA 1JJFA 2D2XA 1HYEA 3CNBA 4MI9A 2ZBFA 4PCAA 2QX7A 3GLVA 3X3HA 4B7UA 1XZGA 3ZHUA 1M6YA 3ZDXB 3PJGA 3DFMA 2CDCA 1DQSA 1HV8A 2LTAA 1G41A 1UDWA 2Y8EA 2YICA 2XE4A 3V2HA 3KOWA 5AJHA 5JLJA 4HDCA 4KQCA 3FX2A 3GRPA 5DLDA 1J06A 3Q7EA 4GKBA 5I7AA 4FYKA 4MO9A 4QU9A 1YZLA 2QRJA 2IHYA 1LFAA 3FMIA 1NSTA 4HAIA 1QQ5A 2NTNA 3QVSA 4IDBA 1IHDA 1TZCA 2B34A 4JN6B 3FVVA 4PC1A 4C0JA 1WZ2A 3A4YA 3OOWA 3EWSA 5BQOA 3KO8A 1IQ0A 2B3DA 3HJRA 1AHPA 4E5UA 2XEXA 3EAGA 2WJZB 2Z5FA 4EATA 3TN7A 3BKWA 3BOSA 2HK7A 3UHJA 2VQSA 1M0SA 2YJ4A 3EODA 1GEEA 1P7PA 1QONA 2XY4A 3HXKA 4MAAA 3U1VA 4Z4QA 3CYFA 1ZU4A 3M34A 2JZNA 4DXAA 1NMXA 4RY8A 1EVIA 1B16A 1YQ9A 3HYCA 4LQLA 2E82A 4NFLA 5FL7D 4CDNA 1SUDA 4E2ZA 1EIWA 4V39A 4CM3A 4DXHA 5DJ5A 4RTSA 3W5BA 4KKVA 1WE2A 2RE8A 5DX8A 2KLBA 5F2EA 2B4YA 2IIVA 4GMDA 3RVNA 2P9ZA 3FMGA 1R10A 1T8WA 5AJYA 4GE3A 1O3YA 1WUHS 2ZYTX 1D7OA 2XMPA 3PXEA 1N6PA 4FCWA 3OY2A 2D5AA 4ZTZB 2IOHA 4X7BA 5ITVA 2BGWA 2OWEA 1YJXA 3UK6A 3UXHA 3UW1A 1E3SA 5L8VA 5BN3A 2QTZA 5CCDA 5ULLA 4D9CA 5AW9A 3WP0A 1NXQA 1B93A 4PWZA 3SEAA 3CKKA 2YTZA 3MELA 3TAXA 3FN4A 5HMLA 2VPQA 3N2GA 2CNBA 3DCNA 4JQOA 1UK9A 3G2JA 4CJXA 4DTCA 2CSXA 3BWXA 2V3VA 3OPYA 3IV6A 1L7EA 1LPBB 5KU7A 4BIIA 3MMXA 1E7QA 1L8OA 1TYDE 4WBXC 4OYRA 5ADVA 1OFGA 2PJUA 3QI2A 4LDQA 4MQLA 3TUJC 2DC1A 3O2QB 3RRNA 2OV2A 3G0OA 3W8RA 4ARAA 2OQIA 5BSVA 2VPYA 1LK0A 2A6PA 2EV9A 2W71A 1MOPA 2DFNA 1XEFA 5EFZA 3CGWA 2H85A 1NW6A 5FRDA 2DFLA 5BSGA 2AFIE 3T3OA 1AF7A 1W34A 2NYRA 5ER9A 5FTWA 1OXTA 3CEPB 2EJVA 3AVXA 3NDBB 3WGHA 5KOJA 1RHMA 4GMFA 2A3NA 2BFPA 3BD7A 1Q74A 5IDYA 3TPCA 2ZB4A 5DV9A 4G36A 4NYIQ 3M49A 4OHYA 4NAVA 2VT7A 2MSNA 1X0XA 2X5KO 2UAGA 3JR7A 5H0IA 3IGFA 1AURA 2D59A 1RWMA 2WSLA 1XHFA 3BA6A 4GG1A 3FMPB 2PBFA 2NZXA 4TLEA 3GEDA 4CEJA 2PYIA 5AOBA 1U94A 3ILXA 2JCBA 3HR4A 4M1ZA 3PJFA 4F46A 2JH3A 3LA6A 2FLWA 4YP0A 4DIFA 3R3HA 3IUJA 4JL8A 4A03A 3OQBA 1SXJB 4MRNA 4TV8B 1W1UA 4XB6B 3O2NA 3OZ7A 3B82A 2C7QA 2Q1WA 1C3VA 2AC2A 2R6R1 4LRYA 2MTBA 4TX1A 2CLEB 1B4DA 1PDVA 4I4NA 1CUEA 4QUKA 2NXEA 3SJAA 2VNAA 3QU2A 4N82A 1CT9A 4AZTA 4Z9BA 1LVGA 1WSAA 4BMOB 4QAQA 1NXSA 1SHJA 2QOEA 4MV7A 4ED9A 5FOQA 1CNEA 2MT9A 4J1NA 5F1YA 2HSEA 1F2TB 3S1AB 1MEOA 1TRKA 1ABEA 1Z28A 1UBLS 4ZT2A 4ZI3A 3T12A 3GGOA 1KR2A 1BXGB 4M0KA 1AXGA 1UMKA 3OZSA 3ZWMA 4DNFA 4NMMA 4U1RA 3TB4A 4F2GA 2C9OA 2RGBA 2Z4RA 3QF7A 1Y1LA 4PBSA 3K70C 3CRW1 3MOIA 1OMOA 2ZUVA 3AFNA 1FFWA 3CG0A 4Z8XA 4R0VA 2GBPA 1E89A 1JWAB 4XYMA 1Y0BA 1YK0A 1SBIA 3WY9A 3PFBA 4AWAA 4BVBA 1Y8QB 4DNXA 1U3UA 1GUYA 2JFFA 2Q3BA 2BF4A 4PM4A 1DOZA 3V9AA 4ZYUA 2B5WA 1P8JA 3OIDA 1YE5A 3GAMA 3GEIA 4LCBA 1A4XA 1I5OA 2NTJA 1F7VA 1F4LA 4AURA 2IYOA 2J0QA 2AEMA 1DLJA 4JBXA 3UMMA 1P33A 2ID4A 9LDTA 3U7HB 1U63A 4P33A 3ITEA 5JXIA 3KQWA 4DR5B 3LF1A 1OTYA 5I9TA 2JHGA 3AG5A 4U5XA 1I6MA 1Z2EA 4BEVA 5FOTA 2I4MA 3ESRA 4IUBS 2P4HX 5FTJA 3TLEA 2L19A 4O0MA 2ODTX 4N3GA 4B35A 4LJ5A 4MKIA 4ZDIA 5KMGA 1CDDA 4ASUA 4DMMA 3A36A 3AF3A 2ECKA 4FNAA 1HT2E 1NBMD 3DBHA 2VYND 4LF7B 1NN1A 4EMSA 2H5IA 1JPJA 3P4XA 1XRSB 3EEIA 3ZTTA 2A94A 3IUBA 2NUPA 3IV9A 5FBQB 3UH0A 1BVYF 3CH7A 1LSSA 4RKQA 1IVNA 3ROXA 2HIHA 4C04A 4UDOA 1ZHFA 1ZGGA 2YDXA 4JKIA 3X1XA 1F8XA 4GOND 3PHGA 1CDEA 1LQUA 2C1EA 1NLZA 4MVJF 1CY2A 1NV8A 5ENVA 2G40A 3CUWA 4Y6PA 1E4VA 3WQRA 3C7CB 1OWOA 2WE7A 3CTMA 3NOXA 3P9YA 3Q40A 3N58A 4LTNA 4QBFA 3IJPA 1XA3A 5IJAA 3M1AA 2IPXA 1YB7A 3D2AA 3DXZA 2OE2A 2PS9A 1PJSA 1YE3A 2LV8A 5LBTA 2XCOA 1CBUA 3OT1B 2QRQA 3PBKA 4LQCA 2ZJ4A 3UB3A 2B1QA 4V38A 3ZNQA 3BSYA 4L5AA 3R0VA 3ZXUB 3JAWB 2P67A 5KJ1A 2G72A 2I29A 5K99A 2IOFK 1ZUIA 2OTCA 2QMOA 1X94A 2D1RA 1F7UA 4UU0A 1OY1A 1SUEA 4BP1A 3EH1A 1M1UA 3GMDA 3M5PA 4L3WA 1T6YA 4DRZA 3LIIA 3ZWKA 2ZRKA 4ALJA 4JP8A 1OT3A 1R6XA 2GH1A 1JTFA 3EBPA 4GAEA 3RPEA 3B85A 3MWYW 1LNZA 1GGJA 1K5HA 1TMGE 2NUTB 2DFVA 3DQQA 4O2BA 2VCYA 4XYEA 2C4WA 4BTVA 4NECA 2J07A 1BWQA 3QBTA 1XV5A 2PUJA 1KP9A 1K7XB 5F1PA 2GHTA 4Y2PA 4XQ9A 1U2PA 2VJAA 2NU7B 3DW3X 2Z9BA 3K94A 1Z5VA 3KZXA 4NQZA 1VZ2A 2WY2D 1OVGA 4Z9FA 3VSEA 1KI6A 5B53A 2W70A 3SQXA 2GPAA 3GFGA 2H7CA 3ZQKA 1VB5A 4G81A 3W2IA 3G5LA 3SOZA 3B1JA 5C7YA 4F9GA 1GQYA 3K2QA 4ZI2A 6AT1A 3P2MA 5GONA 3FXAA 1B0PA 2DJ5A 1QVVA 2J4DA 2YV5A 4I8DA 3TJRA 4BNIA 4JI2B 4RD0A 4UNIA 4MV3A 3SN6A 3WMFA 1U0RA 1JIQA 4PG5A 4DDVA 1ND6A 2I1WA 3LWZA 1V2HE 5CLFA 2AKAB 2JGRA 3TRDA 3MJ4A 5JBIA 3R09A 1G4HA 2CJYA 2HPVA 2IIBA 1YJBA 2OYCA 1VJTA 2WAXA 3HO1A 4BNUA 1A5SB 3HSSA 3ZHCA 2YCLA 3KWJA 5AMXA 1N5RA 4MUHA 4DMKA 2DMRA 4Z4GA 4OH7A 5IDQA 1ECLA 1GD1O 1RYDA 2X0IA 5LZ4A 3LDFA 3HCFA 2OA0A 3O9MA 4W1RA 2WU0A 4G3XA 4F1WA 1SM4A 1Q7CA 2BM1A 2C5EA 3CBQA 1T1SA 3DFKA 4RACA 2NPFA 1YA4A 3VR2D 5D6OA 3O3NB 5J2TF 4LF5B 2I03A 3IURA 2IDKA 1S8AA 1JMKC 1IBSA 2XUQA 2ZSFA 3I76A 3NBUA 4FHZA 3OHMA 4QLOA 5CHEA 4A5OA 1AXRA 1QJ4A 1A71A 3GPBA 5K0GA 3IPCA 2J5QA 2EFJA 2NQ8A 1ZCAA 3LXMA 4Y2HA 4EG1A 3BB3A 3ZS9A 4QPJC 1CRQA 1YOVA 2AG1A 2Q1YA 1W1IA 1VM6A 2O8EB 1KGDA 4F86A 3VQTA 2IHNA 2RC6A 1QRUA 2ZPTX 4F9EA 5K8CA 2BFEA 2MSCB 3HL0A 3T61A 2I67A 4NXNB 1N6IA 4LXUA 1PJAA 1X7XB 2QN1A 3OF3A 5IH7A 2HI0A 4QU0A 4Q1EA 1XQWA 2K6GA 1ECJA 1VKRA 1H5UA 1X1BA 1X7YA 3KUCA 4J4HA 4DR3B 1R50A 1G1MA 3N5CA 4JAVC 1FMFA 3BMXA 3GUCA 4L02A 3AYXB 4HBZA 2HH9A 2YRWA 4Q01A 4QXRA 4WBNA 2QM7A 4R8SA 3ZJTA 2JD1A 3BIWA 3ZH9B 1CEYA 2A0UA 4A2CA 2FOLA 3V8QA 1I3MA 4HV4A 5KBYA 4R40A 3AP1A 2PE5A 4EYSA 1EVKA 3KOOA 5E38A 1Z0JA 3KUKA 4D97A 4OYHA 4QFDA 5CVUA 4ND8A 3OLYA 5CLQA 2XYRA 3C0KA 4OXRA 4PU0A 4WLUA 1EXWA 4F11A 4PYLA 4X44A 3WWZA 2DWPA 4O4JA 3UICA 2VEDA 2WU3A 2A9KA 3T0FA 1NL3A 2WSSD 4LIPD 3U17A 3RYCA 3UQZA 4X1KA 1A2BA 2SICE 2FV8A 4JK3A 1PQPA 3QV2A 2RAFA 3U3JA 2P69A 4AO6A 5A04A 2R7KA 3PFHA 3QKSA 3M6UA 3N2NA 1NG1A 4RW0A 3R3UA 3G2QA 3MMPA 4XKJA 4J16C 4EH1A 1NP7A 3SDZA 1QFMA 1SCAA 3AF2A 1QGZA 3DDCA 3G1WA 4KPUB 3AHEA 1NU8A 1C1XA 3QVGA 4YIKA 1JXMA 5KC9A 3RAFC 1ADYA 1B0UA 2CXQA 4NBWA 2HSDA 1YVRA 2G1KA 5IK2D 1DWPA 1EFHA 4HAYA 2DYKA 3SQLA 2QI9C 3PK0A 4JI0B 1W76A 2EW8A 4WZAA 5LXTF 4B7ZA 2SCUA 4UTRA 1WCIB 4JP3A 4Y1RB 2JCYA 4DGSA 1EVEA 1IXRC 2IZOA 4CF5A 3OQHA 4EFMA 1SVMA 4EYOA 3GAZA 4XGIA 3N59A 3VYUB 4P2BA 2PDAA 3D43A 4O4HB 4PO8A 5BWNA 1M73E 2CK3D 4HFJA 2VDLB 1D0VA 3GIDA 3EW7A 2X3UA 1ZZEA 3E5MA 3N8HA 2WWHA 4DQVA 4O1IA 2AR9A 2VN8A 3GBSA 3KSUA 2ADMA 1Y5LA 1JAXA 2G28A 3MPOA 4U6QA 1MXHA 3E0XA 4GR4A 5EUQB 2OVBA 1JT2A 3C7KA 2W9XA 1H2BA 2GM5A 3EE6A 2ZT7A 5FQNA 3IEPA 1R4MB 3N0TA 1Q0PA 4G26A 4DB2A 3MJCA 2GF9A 2YV1A 3ZXXA 1GR0A 5C1PA 5HTOA 4UEWA 1RQPA 2QQ0A 3CRRA 3LT0A 4XIJA 5IBQA 5P21A 3TNFA 3FUXA 4B3MB 3FLMA 5ALDA 5EIOA 1R6UA 1M6VA 5HIMA 3ZVNA 3PB3A 3VHQA 1Z0IA 2HJHA 3EXEB 1H3EA 1CG6A 4QTUB 3OJLA 4MLCA 1OREA 5C31A 3UV7A 3K6KA 2JGEA 3QFTA 1F4VA 2GWRA 4F21A 1I7PA 2Q1UA 4GLJA 5PGMA 5EEHA 4YRKA 4JKOA 1OB5A 2ONKA 1JQBA 4HXYA 3T41A 1ACLA 3WLTA 1U0SY 5IEBA 2E2WA 2YYZA 5BWLA 5CIYA 4NCKA 4I0WB 1OPXA 3AOEA 3G23A 3MC1A 4HYQA 2A5JA 2XV1A 1QFXA 1W73A 2YFKA 1XTQA 3KKLA 3QYAA 4AZWA 4II3A 3I9MA 4H17A 2X8JB 4C76A 5A02A 4JY7A 3UKDA 2EP7A 4ZEVA 3JQ9C 5K8TA 3FDJA 3FPJA 4JI8B 4R1SA 2NZ8A 2PVCA 4C5BA 2H9AA 3BZBA 13PKA 3L06A 1XMJA 3TL3A 2JRCA 4N40A 1OFUA 3W1WA 1P1CA 4JR2A 4R3NA 5H1YA 1U28A 1Z0DA 2V74B 2DKFA 2Q1XA 1X15A 2FZWA 4MYHA 4QGBA 2FK7A 2IZ1A 4YJFA 4ZOCA 3RANA 3H05A 2HWKA 4EMTA 3S8MA 1GKYA 5I01A 4MQEB 5KYNA 1QGUB 1WY7A 1FP4A 2X0FA 1EBBA 2Q7XA 3JPYA 1XZBA 4KXYA 4R1TA 3ELUA 3LKZA 5HBRA 2DERA 2LP4Y 1IRXA 3BHJA 4PGAA 3VTKA 2WKQA 1J00A 2ZIAA 1DQPA 1H4VB 1DFHA 2P3QA 3SKVA 2J85A 1EP2B 4AAYA 4KXVA 1N32B 4QOFA 5DHFA 1QH9A 2SECE 3L43A 4HEJA 2J3HA 4PZAA 3VU3A 3F5SA 4P81A 1Y9EA 4LJSA 2RCYA 1XQ9A 1OYOA 1Z6YA 4X8LA 5AXCA 4GGPA 1RYHA 3N05A 4GU5A 4UUBA 3EZFA 4I46A 2J5RA 3A9UA 4CM8A 3LPLA 4HAWA 1Z25A 3OURA 3UT5A 3LOPA 2DULA 4I3FA 3FETA 1OLOA 5DI3B 2Q3LA 1BRMA 1TO6A 1R12A 3RUFA 5DSTA 2XBMA 2H4YA 3KE8A 2NSYA 3QUCA 2I71A 4ZREA 5AOCA 3UG6A 1PJTA 1P0FA 3K6SA 3DYIA 3KYJB 4UEOA 3L7IA 4H35A 2E87A 1LLUA 4KIUA 3QLJA 4AIRA 5K8IA 1MENA 1EXDA 1W8DA 3LH5A 4HZIA 3QU7A 1KA9H 4H1HA 4IVNA 2VJLA 4XTRA 3RO7A 3E8SA 1RIFA 4F3RA 4BWVA 4Q0MA 3EF0A 1PZHA 2F1HA 1S89A 5C8YB 4N49A 1IEQA 1PR2A 3PC2A 1W581 4HXGA 2P2ZA 4LHZA 4KLNA 5IVPA 1MN6A 1VDMA 3HA3A 2H17A 4FVTA 3HMQA 4DLXA 4K9RA 5TJ9A 4C87A 3UT5B 3V4VB 2O7NA 3Q15C 3S2IA 4DIKA 1E6LA 1DC4A 1LVUA 2K4MA 3H5VA 1PJ4A 3L1JA 3TYXA 3NWJA 4S2UA 1K2WA 2IYRA 2PG3A 1I33A 1YQTA 1OPRA 5EYPA 3WNZA 4ZP1A 5I7OA 4A3SA 5EZYF 4CIYA 4BFVA 2ECPA 2BH2A 4CMEA 3NVMB 5J47A 1XKLA 2CXSA 3AMVA 3QUTA 2FW7A 1AQUA 4RCZA 3EVTA 4IWYA 5B7QA 4Q3DA 1X7WA 5LDHA 3S81A 3KEFA 1NA5A 4AJLA 1DTSA 1EFRD 3SBXA 4NJEB 4CM5A 1I7DA 1SFRA 2O2IA 3NV7A 2QTAA 1E2NA 1TMYA 2WJ4A 4LFCB 4LRSB 4R8RA 1PT9A 3LCJA 5AW7A 1MH1A 5EUCA