2KSQA

The myristoylated yeast arf1 in a gtp and bicelle bound conformation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
180
Chain Sequence
b'GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVECVQYCNISFTVWDVGGQDRIRSLWRHYYCNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELCNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNCLKNST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Dynamic structure of membrane-anchored Arf*GTP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 44
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ksqA00
2C78A 2J3EA 3QUSA 2J45A 2X2EA 1Z28A 3U7HB 2F1HA 5EE0A 4Q4JB 3OAAD 5FL7D 4NH0A 3TW4A 1L8QA 4RD1A 4AWXA 1DARA 1AS2A 4Q48A 2JLUA 3W8NA 4B3DA 1HV8A 2FEMA 3GMTA 4GP7A 4BRWA 4EPRA 5FTMA 3OHMA 3ZS9A 5BN3A 1Z07A 1G17A 1VPLA 4UXIA 3GEHA 2C04A 3I1FA 3V00A 5IDVA 4PFSA 4AKIA 4UXJA 3B1VA 5BYJA 5B57C 2WZQA 5CB8A 1LW7A 3QXSA 4OQXA 4B2PA 3AQ4A 3AVOA 3EC2A 5DLQC 4G5RA 3T5GA 1XMIA 3TAUA 5TXGA 4D2IA 3AUXA 1CBUA 3DOEA 1N6IA 2C5LA 2IL1A 1XPOA 1Q44A 2GKSA 4LGMA 1GWNA 5FI1B 3THWA 5FTLA 5J47A 1U0HC 2P65A 4FMCF 4A0FA 3A4MA 1ZP6A 1E6CA 3AVVA 4JLDA 1M8PA 1PUIA 4DVGA 1K5GA 1F2TA 2LKDA 3FGNA 3ZS8A 4M1TA 1XFAA 2XJ4A 3TSZA 3B6EA 4L4UA 2C99A 3H2YA 5KNDA 2GXUA 3KB2A 3UANA 2VSFA 3REFA 1G8YA 5JWOA 1V5WA 4PSVA 4E09A 5J4VA 2ZRIA 3UMFA 1E2EA 2XJ9A 4GP6A 5KSYA 1XJCA 3AP3A 4FCWA 3D7MA 3DO6A 2A30A 1G5PA 4CIDA 1FP6A 1OFUX 3RSOA 1LS6A 4DDWA 2ZE5A 2WJVA 1KSJA 2UVQA 1CR1A 3EIQA 2OAP1 1G3MA 5EQTA 5BWMA 3DZ8A 5FBRB 1FQKA 3QKUA 1P72A 2JLXA 1OXVA 3ZVLA 2ZU6A 3U4QA 2OILA 1RE0A 4GOJA 4WVFA 4EJSA 4XOIA 2A5DA 2QP3A 1OH7A 2F1JA 2G6BA 3U61B 4IDPA 2CCKA 3IPYA 3WHKA 4JLMA 4IXNA 2VSOA 3DVLA 1S8FA 2JLSA 1W4AA 2IYYA 2V6JA 2XTMA 3B1XA 2QRZA 2NQ2C 3KFVA 3WYGA 2ZRAA 2OV2A 2QG6A 2VA8A 3CKLA 3NWJA 4URWR 1KJYA 4D81A 5KO2A 3D31A 4CEHB 2BJVA 1FL9A 2HT1A 3JVVA 4W5HA 3R9XA 1JR3D 4TL9A 1R2QA 4XD7A 4C7OA 2P2LA 1UBFA 4B73A 3NH6A 4OI4A 1IN8A 1XTKA 2ZRNA 1VYUA 1R0XA 2CMKA 3AKCA 4LCBA 4IVPA 4QGGA 4JLNA 4LJ6A 5KHOC 5AJYA 2O52A 3C5CA 4P33A 4B3XA 3T06B 2R6GA 2JLVA 1AS0A 1D2EA 1OV4A 4RZXA 3OE7A 2GEDA 4F4IA 3AVXA 2DR3A 4DEYA 4URXR 1GITA 3TR0A 3MUFA 4GMXA 3UMSA 4OL0A 1BYUA 1E99A 2IK8A 3KXIA 3IPXA 2CE7A 3BC1A 1G16A 2CK3A 4DUGA 3K53A 2IYXA 4PTLA 4EQ6B 3K0SA 2RGNC 3I73A 1GRNA 2RH5A 3CH5A 1FNNA 4TLBA 2Q21A 2ZR7A 4M1OA 5C46F 1FTSA 2FGJA 3K70C 4HB4A 1Q1ZA 2V4ZA 2XAUA 3IO5A 3LLUA 3B85A 3P26A 4H1UA 4NMMA 1GFIA 1RRFA 5KDLA 3KZ1E 2BBWA 4KFTA 2P0EA 2FU5C 3UG7A 3KQLA 2A3RA 4Y0VA 5CJ2A 3OESA 2JJ1A 4IOMA 4Q03A 3EPHA 4RZ2A 3VU9A 3ZGXA 1NMZA 1SVOA 5KDDA 4YQFA 5DGXA 3NDPA 4RD0A 2O8CB 3K0EA 4LHXA 1Z06A 2ORWA 2QAGC 2RHDA 2W00A 3RANA 1XU4A 2XOKD 4FMBB 5CITA 4Z1MA 1NLZA 1UEJA 2X77A 1ZUHA 3A1WA 621PA 3U6KA 4DT1B 2WJGA 5IK2A 2BDTA 1J8YF 2QSYA 3RC3A 4C0HA 2PX3A 5JRJA 3WHLA 4YLGA 5JS8A 4XSGA 2D2EA 2ATVA 4PZLA 4LY6A 3I62A 1XWIA 2OFOA 3GJXC 4K8OA 2ONKA 4TMKA 1G18A 1WA5A 1G1MA 3EA0A 2W6IA 1HE1C 4NYJQ 3PITA 4CEJB 2CVHA 2ZIAA 4Q9IA 3WNBA 2WWYA 1KMHB 3OIWA 1N0VC 1GKYA 1XXHA 4V03A 2WKQA 3H4MA 3DMDA 1AKEA 3KKNA 2V54A 1IQPA 3PFIA 2QORA 3CZQA 2AWOA 2GBLA 3Q3JB 5L8VA 1DAKA 3LO5A 3TUZC 4GOKA 1AM4D 3PUYA 2CCJA 4I4LA 1RJ9A 1XP8A 3DEFA 2CLDX 1PJRA 4FXPA 3MSXA 3QEJA 5AUOB 3GD7A 3GJ7A 1YJ5A 2CL0X 3CF2A 1Z0AA 2L0XA 4RCYA 2D7DA 4BRUA 3GLIB 2FSHA 4I1SA 1JAIA 1RKBA 1CJUC 3H84A 2QQEA 3ZH9B 1T8TA 1XD9A 2YOHA 4MITA 4AKHA 3ECCA 3EWAA 3QXCA 4TL8A 1FUUA 3I61A 4DLXA 4HAXA 1KDRA 5P21A 1F48A 3ZDQA 2BMFA 2ZETA 4XTRA 2O8EA 2GJ9A 3R9WA 2FF7A 3UK6A 1AKYA 4PHTA 1CULC 2OHFA 3AM1A 4MKGA 3LH5A 1SULA 2CLCX 2GRJA 3CBQA 3EC1A 5CK4A 5JCPA 2BCGY 1KO1A 4AYTA 4E5UA 5FBWB 2VHCA 4BLQA 1Z6YA 2YOFA 2V6IA 1JJVA 5LBIA 5M04A 5KU1A 2R6DA 4ZDIA 1SVSA 1ZD9A 2I1QA 4TMWA 1GZSA 3QI2A 2FPMA 2LWIA 4Q00A 1E3MA 1N6KA 3MCAA 1EESA 3L0SA 1VCIA 4TQUS 3WMEA 4LUCA 1SXJA 1XPUA 2CCGA 1E98A 4LSGA 3PUZA 2W58A 3TNFA 4HDCA 4WXPA 2ZM5A 3MWJA 1ZU5A 4A15A 2FFBA 4HEJA 1XEFA 4TQAA 1TADA 4ZDWA 5B64A 4BFZA 5JJLA 2MMGA 5L3VA 3OFND 1GKIA 4FI3C 5KUTA 2QA5A 3FKSD 1QHSA 5L3RA 2ZR9A 2BMDA 3VKWA 4JVSB 3AF4A 1QBKC 3PV0A 3QKRB 4TL6A 5GJBA 3SJAA 4QOSA 2VPPA 1N3BA 1ZU4A 2ASEA 1TUIA 2CJWA 3RDPA 2GEUA 1KKLA 3T35A 4EPYA 4Q1FA 3KKQA 1GUAA 2GETA 1LY1A 4ZCMA 5FBVB 2RMKA 4LJ9A 1XTJA 1Z08A 5FPKA 3QQ5A 1OKKA 5AUPB 3SHFA 2XTZA 1FX0B 1LB1B 1FTNA 2XNDA 1CXZA 1JNYA 4AKGA 1KK1A 1U94A 1NG1A 3B7GA 4QKQA 3SI7A 4JL5A 5CM8B 2ZU0C 3AP1A 2JCSA 4YXWA 4B2LA 3LV8A 2NMVA 3NBFA 3GLHA 2N1BA 3UKDA 1VCMA 1W36D 3DOFA 1EX7A 2O8FB 2IEYA 4Q18A 3O8DA 4IDHA 4PC3A 3ADKA 4KFRA 3NTUA 4KFSA 2B8WA 4Z51A 2EYUA 4B43A 3R9IA 3WNCA 3I92A 2QROA 1UBCA 3R7WB 3UWKA 4B74A 4NDZA 3T61A 4JJZA 4M1SA 2IYZA 3TBKA 1PLLA 4ZI2A 2E9SA 2OLKA 4X8OA 1P73A 1Z0FA 3CF0A 3KKOA 3MG9A 2ZI3A 1ZNWA 1G64A 2OBLA 3ZIAD 1ZC4A 1L2TA 4P4SB 5JSZB 1D9XA 1R8SA 3WP1B 4DIDA 3KJIA 1QHXA 1RC8A 2OM2A 2XXAB 3KUCA 1H8HD 3GPLA 1YU9A 4TT3A 3P4XA 1X6VA 5DHAA 2HF9A 1WCV1 5HPYB 3ADCA 1IN6A 2ZXUA 1PVOA 2ZI7A 2YJTD 1OXXK 4N0DA 2QSZA 2ZRHA 1ETUA 3KXLA 4NYJR 1G6OA 4KU4A 2QPAA 4C0JA 2YWGA 1NNEA 4RZUA 4QGFA 2G0TA 5HTKA 3CX8A 3QF4A 3N2IA 1RRGA 1NY6A 3WY9A 1ZM9A 3AF2A 4QNRA 4Q9LA 4HI0E 1G41A 1KAOA 1TF7A 3IILA 1RPZA 4V0LA 2QMEA 3W90A 3GFPA 1MO6A 3ZYCA 4ASUD 3EZFA 3FMOB 1SKYB 1CJKC 2BV3A 1E79A 1JQLB 3RNLA 1NLYA 2FSIA 1DVRA 3O47A 2EFCB 4PC6A 2KE5A 1QDEA 3MMPA 5FR2A 2V7QA 5TVKA 2WKPA 5JCZA 4A0RA 2N42A 2P5TB 1OJLA 3CLVA 4A6PA 4DLZA 1BOFA 4KI0A 5D3MA 1OXSC 4O2LA 1R6BX 3EARA 4M1MA 2HXSA 2YWEA 1IXSB 1TX4B 4M9ZA 5TV2A 3WMFA 1VG8A 4TLDA 1MO5A 2ZJAA 3W8RA 3GJ4A 4AC9A 3K0FB 2FFQA 2GILA 4HLUA 1E2MA 2FSFA 5G41A 3CUEF 2FG5A 2WPDD 2OO7A 4KXFB 3E5HA 1E1QD 1ZCBA 2AL7A 4N3NA 3TJZA 1LVGA 4A92A 1UKYA 4OJKA 1FMJA 5TB5A 2ZJYA 2AFIE 3QPUA 5BN5A 1NLFA 2WKRA 1HQCA 2R65A 1BO6A 4KYUA 5EXSA 3WYFA 2ZROA 2GDJA 3NHBA 4BEBA 1ZRHA 4MUAA 1D9ZA 1V43A 2QU8A 3A37A 2DFTA 3IBGA 4WAUA 5E3HA 3PEWA 1M34E 4D82A 2QM7A 1N5IA 2HJGA 3HWSA 2FE4A 2FV8A 1OPXA 1JALA 3CM0A 3X1WA 1UFQA 1D8TA 1SVMA 1ZNZA 4BLOA 4B34A 2EVWX 4Q7KA 4A82A 4EPXA 1X1RA 2JGNA 1XTSA 1E2PA 1SHKA 4GNKA 4WXRA 3SJZA 1VTKA 421PA 4ZDKA 3M1IA 1E96A 2V1UA 1VCNA 4JBYA 4LC0A 3QKSB 2BKEA 4TQ9A 1FQJA 2HLDA 2QE7A 3GEIA 1SVLA 1A1VA 2MMCA 821PA 2R6CA 1MR3F 8OHMA 5DI3B 5DYIA 3QF7A 4NYMR 4TWZA 4GL2A 2GCPA 2ZE6A 5EE1A 4DLSA 3U60B 2VSXA 4KODA 1Q1QA 2ERXA 5JRZA 4TMVA 2H17A 4C3ZA 1ZC3A 3WBJA 3DDCA 4DCVA 4HAVA 5FUXA 2N46A 3WNDA 2FA9A 1Z5ZA 4NCNA 1T3HA 2B92A 3W6PA 4MUBA 2Z6VA 4AG6A 1II8A 2ECKA 4UQOA 2RGGA 1KSFX 2WMNB 3KDSE 3LXXA 3SJCA 1CRQA 2O8BB 2RKOA 4NCKA 1QHHB 4F92B 3SBDA 5EE3A 3BAFA 3O8CA 3TW8B 2XSZA 3BH0A 2QGNA 5FTNA 4GZLA 4W9MC 2ZI4A 1J70A 1TL7C 2IWHA 4CYMA 4PC7A 1VECA 3KQKA 1EK0A 2HJVA 4RFVA 4NPHA 5F9FA 2JIZD 1XEWY 3GLFB 2WJIA 1AIPA 2X2FA 2REBA 3B8HA 3Q72A 3PXGA 1XCMA 1DAHA 1X86B 2OEPA 2WOJA 3A8TA 4IOLA 3GLGE 4I1VA 1YQTA 4IHQA 1N5JA 4GFDA 4GRAA 1E32A 1E2KA 4FINA 4AK9A 1COWA 4MGKR 2NZ8A 4LWZA 5CK5A 1IXZA 4LDJA 4LV8B 4CT5A 1IM2A 4KHZA 2EFHB 2CNWA 2NO6A 3SQXA 4OHXA 2HCJB 4LJ8A 3GCGA 5AJVB 1WBDA 1Z6AA 4FWTA 1J7KA 4H1VA 1Z2AA 1T3LA 3K9LA 3MRSA 2IBMA 4QXAA 2WHXA 2KWIA 1VHTA 4U7DA 1JXMA 3OEED 2LCFA 1IY0A 3ZQ6A 2FN4A 2Z4SA 1BH2A 4XTCS 5FUWA 2W0SA 2IW3A 4S2EA 2JLQA 4MRPA 4TYYA 3K0CC 2VQSA 4BGDA 3RS5A 5HKKA 5KPDA 3ZVNA 2F43A 4WZAE 4D4MA 1U2RA 3CPHA 5JS7A 4DXAA 3SFZA 3AGPA 4HUQA 3NBYC 1TPZA 3A1UA 1U8ZA 2RGNA 2VF8A 4LI0A 3TE6A 2OFXA 4DLWA 2NO9A 2Q9BA 4TYWA 2BEJA 4QBGB 1W36C 2FZ4A 5L3SB 2DHRA 1CJTC 4EFNA 2ZI9A 4MYHA 2WWHA 4Q4AB 1ZIOA 2SHKA 1W5SA 2BIFA 5JLJA 2AWNA 5BW8A 2DCUA 2ZVPX 4CVNA 1W4RA 2ZUCA 2B8TA 3Q7QA 1Q3HA 2NPFA 1M7BA 1UADA 3WRYC 2J7PD 1ZYUA 4ZO4A 2QAGA 2UZIR 3FB4A 4IDQA 4IFEA 5EXXA 2H8KA 3TVDA 1NVUQ 1NVVQ 2AFHE 3PENA 3ND9A 3GEEA 4NP6A 3VKHA 1XBTA 1GAJA 1KMQA 1Z6GA 4QHYA 4U02A 2P3SA 2W83A 3LQRA 4Q4HB 1GILA 2V8OA 1KDTA 3CRQA 1EFUA 2B6HA 1HT2E 2WWGA 3OIUA 4BFTA 3CNNA 4L15A 5EP4A 2CL6X 4IDOA 1TEXA 1QHYA 5E95A 2G1JA 3B5JA 3RLFA 2QRNA 1NMXA 1HA3A 5DI9A 3K9HA 4A8JB 2PZFA 1NRJB 1M1YE 4KAXA 1GRQA 2YZ2A 1ODFA 1W0JA 4C0QC 1NJFA 2QENA 4PAMA 121PA 5H70A 4HAZA 3HR7A 2BCJQ 1MO4A 3B9PA 1T9HA 1XJ0A 2GF9A 3KUDA 1YR8A 1RRCA 2I4IA 4PPFA 3BK7A 3EA5A 3GJ6A 2E1RA 4RCZA 2WSSD 2PBRA 4PC2A 4MYCA 4CGZA 2FDCA 3GLGA 2I1VB 1XJQA 1C4OA 1E9CA 2EW1A 1N6NA 2QQ0A 2XB2A 4A4DA 2QTHA 3P1JA 5JEEA 4OQFA 3QVUA 1TMKA 5E7JA 2J0SA 4TZ0A 4R7ZA 2JDID 4D0LB 4F4JA 2ZITA 3U4QB 4JLPA 1H8EA 4C2TA 1II0A 4HZIA 4UJ5A 3ASYA 2ZVQX 3BBPA 4Q1AA 4BFUA 1UEIA 1J2JA 3IO3A 1OFTA 1XB2A 1ESNA 2FFAA 3UWOA 4B47A 4YONB 4AKEA 1NBMA 2G88A 1U0JA 4IOKA 2AXNA 2O8DB 1JR3E 2PH1A 2F1RA 4M1WA 4YMWA 1LF0A 2GF0A 4DLTA 1TNDA 4TYPA 3CIOA 2OUKA 4BFYA 1CJVC 1E9EA 4A36A 3THYA 4UNQA 1TQ6A 3OAAA 4XH9B 1B0UA 1NKTA 4M21A 4TMXA 5FL7A 2V3CC 1TU3A 4FWIB 4LHZA 1P75A 4LJAA 2IX3A 1VIYA 2LKCA 2C98A 2GCNA 1T5IA 4R2IA 3LA6A 1S1MA 2QI9C 3TK1A 3B1YA 4Q4JA 2ERYA 4MYTA 2Y8EA 5HCIA 4IOJA 2NTYC 2R8RA 3LQQA 2IS4A 4Z8XA 3BD9A 1Z8FA 4WA7A 4QJ3A 2IEZA 3MJHA 4PQYA 4KSBA 1DPFA 4OK3A 4MKIA 3AVYA 1GL7A 4P32A 1KZGB 2ATXA 3P4YA 2PL3A 2ZE8A 3SFVA 4Q7LA 5DNYB 4O3MA 1TQ2A 2MSEB 1QF9A 3JZAA 1DEKA 2IUSA 3QOFA 1Q1BA 4UJ3A 1N2CE 3FDIA 3QBVA 5KDOA 2IS2A 3SC3A 2ZRFA 3KXKA 2OAQ1 4B6FA 3RS3A 3PEUA 2VP9A 5J4HA 1XD2B 1P2VA 3NEYA 1EFCA 1EX6A 4LBYA 2AKAB 1IY1A 1XCPA 1ZBDA 4GOXA 4Q1DA 2EFGA 1QVAA 3K8YA 4DCTA 3PR1A 2F7SA 2VEDA 1CJMA 3O8BA 2GA8A 2OZEA 4UNSA 3W5IA 4QM6A 2HV8A 3BB1A 1KSGA 3AVQA 3EPLA 5KSZA 1VMAA 1H65A 4A0GA 2BBTA 2WJHA 4ZCIA 1JEEA 1P3JA 3ZVMA 1IY2A 1X8LA 1BMFD 4L9WA 2GCOB 1JPNA 1N6PA 2CXXA 3K1JA 4CW7A 1AQUA 3CR7A 1Z22A 3KJGA 2UKDA 3U7GA 1O87A 4WBSA 3KQUA 3W6NA 3WRXC 5EZ5A 2JJ2D 1WB9A 2VHJA 4NTZA 2Z5FA 4URVR 1NF3A 2OCPA 1U9IC 4H9GA 3G0HA 1E2JA 2GVZC 2BKUA 1LTQA 3RRNA 3UMRA 4GDFA 2XGJA 4HUTA 4R9UC 2VLIA 2D06A 1BYIA 1XMVA 2PLFA 5FOXA 1WQ1R 2JATA 2ODNA 4WZ6A 3D3QA 4ZDJA 1GOTA 1UJ2A 4C9BA 2BWJA 1QHGA 1UPTA 5EJEA 4XJXA 2ZAOA 1MV5A 4C0KA 4W7SA 1JR3A 5EUMA 1W0KD 3TQCA 5FR1A 4W5JA 1SZPA 2WIBA 3HYRA 1E0SA 4OI1A 5DHFA 4OJQA 2QL6A 3RS7A 4C4PA 3CRRA 1E2LA 1R4AA 2QP4A 2WBLC 3SZRA 2PT5A 1KI6B 4CEHA 1E4VA 1NVVR 4V0NA 3BJIC 3T5DA 4BFWA 1OH5A 3TKLA 3W34A 3GLIE 3LD9A 1KNQA 4FIDA 5K8UA 2GJSA 1LFDB 3EZ2A 3TH5A 1KI3A 2P6UA 3BB4A 4X8MA 1ZMXA 3AGQA 2ZANA 2IUTA 2YWFA 1JAHA 3AKDA 1YKSA 1KO7A 3G82C 4RD6A 1KI1A 2OFWA 1ZUIA 4B44A 1ANKA 2D62A 4US0R 5EXTA 2R62A 1W49A 3HDTA 4FMDB 4CRWB 4JSTA 2ZAMA 2GAOA 3RHFA 1GDDA 5CJPA 5CIQA 5FH9A 4MGIR 1ESMA 1I4DD 2GJAA 2XNSA 1T0HB 1E69A 2WJJA 4W5WA 3V9PA 4KO8A 1Z6TA 4DC9A 1ZD8A 3SS8A 2RGBA 4OQLA 1GM5A 3OEHD 4LJ5A 2A2ZA 4UKDA 2WIAA 2G3YA 1LS1A 4MKFA 4TLCA 4URZR 4C0BA 1E0JA 4YC7A 1FOEB 1KI4A 4HB3A 1K5DA 4OHVA 2J0VA 2XOKA 3I4LA 3LFUA 2W2VA 5IHPA 1ZM4A 4OK6A 3QBTA 4PR0A 3U44B 1ZCAA 4KV9A 2GK7A 1E9FA 2VH5R 1PLJA 2C9OA 2IYRA 3Q7PA 1NY5A 4TTQA 4M2LA 4MGZR 5CB6A 1W2HA 5TARA 3BE4A 4HB2A 4Z54A 2V1XA 5ELXA 2JLYA 4RVCA 4NZYA 2WWXA 1D2MA 3AKYA 3PUXA 3SHWA 5FOSA 4DT1A 1P2UA 2HCBA 3B1ZA 5JWRA 2GESA 2VHUA 1G8HA 1X8JA 1EFRD 2PCJA 4BUJA 1ZUNB 4P3YA 1E1RD 5E4FA 3IBYA 5JWHA 5HR5A 2REOA 3X1DA 4WZBE 2ZS7A 1OT3A 2OT3B 4DLVA 3L2OB 5KPJA 5GADl 1HH4A 4PSAA 5KYKA 3B9QA 1GL9B 4A8JC 3AVTA 5KNBA 1G3UA 3HYTA 3PUWA 4PZYA 2GNOA 3SYLA 1FZQA 4M9SA 2R44A 3I5YA 3AVWA 4CEJA 1YR6A 3LDAA 3EZ9A 4F7WA 5K8LA 3T1TA 2ZI6A 5B58C 4QM7A 2G0NA 3EAQA 3VR2A 3TGPA 2A9KA 4AIIA 2J0UB 4JYBA 3THOA 3VX3A 4DZZA 1W48A 3WYAA 4TZ6A 3W9YA 3KL4A 1NSFA 4FCTA 4IVRA 4TSFD 1M7HA 3ZQJA 1K6MA 1KDOA 1Z0JA 3AH8A 3DKPA 4IDNA 4NCIA 4WOPA 5CYOA 4DIEA 4E03A 5DIFA 3C8UA 1TTTA 1AGPA 1E2NA 1OIVA 4YMSA 3J81k 3B82A 3K9GA 1JB1A 5BQ5A 4NYMQ 2BBSA 4EPWA 3I72A 4GSYA 521PA 1XEXA 3QIAA 4MRNA 3DM9B 4P4UA 3UATA 5LD2B 1R0YA 1P5ZB 1HEIA 1VG0B 3NG1A 2AD1A 3HPQA 2PLRA 3QKTA 1CTQA 1KDPA 1SKQA 3GJ3A 1Z29A 3HR8A 1C1YA 1TU4A 3RS4A 1VDZA 5BXQC 1P60A 4DSUA 2IF2A 2VRWA 4A2WA 3LVQE 4U00A 1KHTA 1W4BA 5L3QB 2W2XA 3SYNA 2DFKB 3F0TA 5C4GB 2R9VA 1XPRA 3U3RA 4UXHA 1RVDA 3K09C 2ZS8A 4MYUA 3LBNA 2YKGA 2VP4A 1IN5A 4B75A 1KTVA 2JLZA 4E07A 1Q1EA 4M8NE 1B23P 4LBVA 4NCJA 3C7KA 4V0KA 1LV7A 1KK3A 1YE8A 4ARZA 2GXAA 4B3GA 3BFKA 3O8RA 3TLXA 2RHMA 4F38A 2GAAA 1ZM7A 2C03A 2AX4A 3P32A 3C4JA 4MGYR 3THXB 6Q21A 2F1IA 2QPTA 3K0AB 5F9HA 1L7VC 4M1YA 4DEXA 1QHIA 1MO3A 2HUPA 3P20A 4PAQA 1CKEA 1Z63A 2EWVA 4QGAA 3LX8A 1IOZA 3T1OA 3SEAA 2ZSBA 3Q5DA 1UKVY 4CEIA 3OFNA 4BQSA 2GXQA 2YV5A 4GT1A 4V0ME 3DHWC 3FKSA 3TRFA 4DSOA 3CNLA 2D3WA 4PANA 1QG4A 5HCNA 3QY0A 2ZSEA 3AVPA 2FNAA 1CRPA 1NVWQ 4OQMA 1SKYE 2YNMA 3U5ZB 2ORIA 4JLAA 2OCBA 1YZTA 3IGFA 5C2JB 1F5NA 1T4GA 3C5HA 2RGCA 2FZLA 5FBQB 3B13B 4I81A 1C9KA 3LXRA 1MABB 5KSPA 1XEWX 3BORA 3BWDD 4JVNA 3RS0A 2CVFA 4FW9A 4LK2A 1X3SA 2DBYA 3K0CA 1GL6A 3A1SA 3FHCB 1E9BA 4PO9A 4JLOA 3S1AB 2O8DA 2GZAA 4B35A 4ITRC 1JEDA 2NOAA 3REGA 4AD8A 4HZUB 3ICQB 5SZKB 2DWQA 1FX0A 4PAOA 4XVRA 1EWQA 1IAQA 1T6NA 4ACAA 2X1VA 3IIMA 2RGEA 1NL3A 5EXPA 5F2EA 4AI6A 4LV6A 1P6XA 1BS1A 3CB4A 1IJEA 3EX7C 2OE2A 4PPGA 4WW0A 3CPJB 4G5GA 1HTWA 3UPUA 5LB4A 5LPNA 2VYFA 1OLOA 2O8FA 4TTPA 3VHXA 1AS3A 2VO1A 2ZJ5A 4IXMA 1OFHA 4CT4B 4PHGA 4MDEA 2EQBA 3WXMA 2GEVA 5G40A 1US8B 1DTSA 3ZIAA 2EWWA 4LV5B 3CWZA 3R7WA 4TLAA 3RABA 1VHLA 2Z83A 4RFSB 3OZXA 2ZRLA 4G5QA 1H8HA 1P9RA 1JXOA 1UDXA 3NVAA 1A4RA 4V0OA 1WP9A 5EE5B 5DISB 3SQWA 1OB5A 1FPMA 3BFXA 2CHVA 5JECA 2GTPA 4P4SA 2WAXA 1T91A 4OI2A 5JSZA 5DN6D 2D4HA 3TSOA 4TYNA 2XXAA 2QBYB 1G9XA 1GKUB 2QTFA 3A58B 3GJ5A 5GJVC 2BM1A 2GWHA 4KBFA 2H57A 4A9AA 3UXMA 3ADDA 1F2UB 4BASA 3E70C 1DOAA 1VG1A 1Z47A 5H68A 3TAHA 2HYIC 3ASZA 2PMDA 1MOZA 1CU1A 4KCGA 3T1QA 3HU1A 1P7CA 4EIWA 2IT1A 3QNUA 1W7AA 2BHRA 4ASUA 5IRCD 1XZQA 2W6JD 2AXPA 4JT2A 2CL7X 1G8PA 2G77B 4D80A 2GJ8A 1U81A 3LWNA 4US1R 3L43A 1M74A 4LYAA 4Q7JB 3DMNA 1W1WA 1E9SA 2DB3A 4X8HA 3FMFA 1ZIPA 4Q21A 2GZHA 4C0SA 3KQHA 1G21E 1Q57A 1E0AA 3FHTA 4DLUA 1FW6A 3VNUA 4HLDA 4QRHA 3MD0A 3RS2A 4D26A 3F5FA 2DWOA 2J5XA 3BOSA 3NH9A 3GP8A 1TQ4A 4M4SA 3QSYA 3JZMA 1EFTA 4KVAA 1UDWA 3KTAB 1IJFA 4PX9A 3P27A 3GLFE 1RZ3A 4U5XA 2WPDA 1HQYE 1E1QA 4RZ3A 2AK3A 3G5UA 1DAIA 1ZJ6A 3H1TA 1M2OB 1YZNA 2JLRA 2FSGA 4QL3A 4D0GA 3KX2A 3K0FA 3IIKA 3OIYA 3TSWA 2RGAA 3RWMB 1DG3A 4RKFA 4AURA 2AD5A 1KO8A 1YRBA 2RGXA 3W5JA 2AHOA 4TMTA 1IHUA 2FPKA 2PMKA 4G5SA 4PPQA 1HT1E 4YMVA 2ZRJA 4OQNA 4QBFA 4URYR 1FNMA 4RJLA 2IUUA 3A1TA 3T15A 4D4KA 4XVQA 1U0LA 4XVUA 3C41J 4OHWA 3EZ6A 4Q4LA 4NL4H 3MWYW 3A4LA 4GZMA 1OIWA 1X1SA 1OHHD 3BIFA 2F43B 3E1SA 4HAYA 4XWAA 2TMKA 1NKSA 3IUYA 4J0QA 1ZNYA 3C15C 5LDDC 4DDVA 1ONBA 3I8SA 3VKGA 1DAGA 4PZZA 3SR0A 2AK2A 4F93B 3QKSA 2J1LA 4HLCA 4DCUA 1R5NA 4QC2A 4A0HA 1I2MA 1DO2A 1IBRA 3VR4A 2B21A 3NIBA 1OXTA 4IJMA 5HZKA 1N0WA 1HE8B 3N70A 5DI3A 2G1KA 1L4YA 1S1CA 5IT5A 1KNXA 5LD2C 2MSCB 3AEZA 3AKEA 2IYQA 1XCGB 3KB1A 3L8YA 1W44A 2ODEA 3T12A 1VKJA 1CEEA 1W4CA 4G01B 1KI9A 4QFMA 1PLKA 4MH0R 5B30A 4OI0A 2YHSA 5DYGA 2C96A 1R5OA 4RKEA 3SN6A 3JVUA 1G3RA 4GPTA 2CE2X 4DB4A 3L0OA 1GNRA 4LJYA 3BXZA 2X19A 2WWFA 1U9IA 5AUQA 4JJKA 1DS6A 4ZIRB 3IQXA 4TLEA 5DE3A 2NO0A 2O8BA 2D7CA 1QHHA 4IFBA 2VF7A 1OF1A 1S2MA 3NBZC 1QG2A 1AZTA 2JIZA 2QTVB 1P9WA 2RGDA 1T5LA 2FFHA 4JKIA 1SGWA 1VYTA 1P2SA 3FKQA 4KJZA 2Q9CA 3TUIC 721PA 2XZLA 3H86A 4JVLA 2H16A 1NN1A 2CHGA 2GJKA 2JA1A 3RVBA 2J9RA 5AWFC 1ZM3A 1I4TD 2VBCA 4GI7A 2XZPA 4RD3A 3EXAA 2VP6A 4XWOA 3GLFA 2NG1A 1KAGA 3R20A 1GVNB 1EFHA 1W2GA 3RRZA 4E22A 1KK0A 4LYFA 1XRJA 3I32A 3EW9A 3FOZA 1G7TA 3LY5A 1G8FA 3Q8XB 2W0MA 2ZRMA 3WBKA 2ZJ2A 3T34A 1Z0DA 4M22A 2QAJA 4RD2A 3OEEA 4ZCLA 3LX5A 2CDNA 1HY3A 2IYTA 3THWB 1MH1A 2A5FA 4KVGA 1SVWA 5JEDA 1YZLA 1L4UA 1G20E 2P5SA 1G5RA 4I1OA 2WTUA 2DYKA 2G9NA 1F2TB 2BM0A 2QUZA 1SQ5A 1WF3A 4RY2A 2J0QA 4HDOB 4MQBA 1ZAKA 3AF0A 4NKRA 4B48A 3SE0A 5FPTA 4LHYA 3EPJA 2GVDC 3LRPA 2QT1A 5J5CA 2VHQA 2R6FA 3UG6A 3X2SA 2IYWA 1DE0A 3GJ0A 2VHTA 3I3SR 1AN0A 3MGCA 3B2EA 4F4CA 1MRNA 3SNHA 4Q1CA 5LB2A 2FX3A 3QE0A 1VCOA 1I2DA 3I8XA 2F6RA 221PA 3M6AA 5CIWA 3B78A 1IONA 5JJKA 1Y3AA 3TIFA 1AQYA 1AK2A 1S4QA 4KLNA 2GHIA 2VP5A 2FPLA 1KY3A 3RAPR 3SBEA 5EUQB 2F55A 4BZPA 5L3SA 4JLVA 4CDGA 4Q1EA 1AJEA 2J7PA 4NONA 1NG9A 2OBMA 4Q4AA 5GVRA 1KIMA 2Q0HA 4LC1A 1D5CA 4EJSB 1OXUA 1YZUA 4CZ2A 4EUNA 5JHGB 4KITB 4LZZA 5KSOA 3LLMA 4B33A 2QN6A 5FBLB 2IYSA 3ZD7A 2VIIA 1N6RA 1Z83A 2ZUBA 1A2BA 3FWYA 3L0IB 5JHHB 2DWPA 3AF3A 3V4RA 3B1WA 4FMCB 2CLSA 2IA5A 1PV4A 5EP1A 1S96A 4LYHA 2ZRGA 4AG5A 5DO9A 5CDFE 2IS1A 4Q4HA 5JBQA 1Z0KA 1EGAA 3VNVA 3FMIA 2FGKA 3WP0A 1XMJA 2Q6TA 2FH5B 1U98A 3MFYA 4C7OB 2ZRKA 1RW4A 4PPNA 4FD2A 1DELA 1A5TA 2C9YA 2OSBA 3DZDA 3FHOA 4N0EA 3EIHA 4P4TA 4A8JA 3CNOA 1KK2A 4MRRA 2BC9A 4KYIB 5EZ6B 2JASA 1HYQA 4O0MA 2WSSA 3QPVA 4G3XA 4JLKA 4Q9JA 4QGHA 1KJZA 2XX3A 5G3ZA 4M53A 4XD7D 4LJ7A 3FYHA 1E9AA 2QMHA 5JJIA 2QMOA 3CPEA 2JDIA 1LF5A 1DAMA 4JBWA 2K5UA 1UKZA 2DFLA 3CWQA 1P62B 3VTKA 1S9HA 4PHFA 1GNPA 3T1VA 4A1FA 4DRZA 2ZSAA 3OE7D 2BBOA 3F3YA 5BYKA 4ON9A 1E2HA 2HEIA 5DH9A 2HDNB 3CF6R 1QHNA 3CX7A 2F9LA 2BVNA 1T0JB 1G291 2Q9AA 1U90A 2V55B 3FTQA 1S3GA 2IHYA 4QJ4A 2IXEA 1NN0A 1NVXQ 2CK3D 3IHWA 4G5OA 4DUGD 5JZVA 3U6BA 5AJWA 3W3ZB 3QG5A 4D4LA 1G19A 2RB4A 3AF1A 1GNQA 2O0HA 2X8AA 2OG2A 5TMPA 1NJGA 3QENA 1XXHE 2ODBA 1QRAA 4EPVA 4O25A 1FUKA 3VU9B 1YZQA 3SYKA 3TUJC 3U7EB 3RC8A 2P67A 1TEVA 5K8TA 1EWRA 4BLPA 1YR9A 4PSKA 2RCNA 5FL3A 4JKYA 2IYUA 3BRWD 3SDZA 3X1ZA 3EIEA 3FFAA 4NE2A 4OBEA 2JJ1D 2ZR0A 5KOYA 3K09A 5SZJA 2IF0A 4BECA 1R5BA 1RRPA 3DM5A 2VP0A 3FMPB 1KO5A 3VFDA 4Z1MD 1U8AA 5G3YA 2OXRA 3DL0A 4DLRA 1JBKA 5IK2D 1P9NA 5G53C 3HJNA 2CEAA 3VMFA 4Q7MB 4BFVA 4G1UC 2C2HA 2DFNA 4US2R 4LPKA 4WIAA 3U3OA 4LYJA 4BWYA 2O0KA 3VR1A 1KI8A 1G8GA 5FTJA 2WVJA 2WJYA 1XXHB 4DBLC 2XZOA 4POAA 5EP3A 1P4SA 1YHNA 1DO0A 1GG2A 1TQDA 2W6ID 2ZI5A 1SVIA 1Z0IA 3U3MA 1QVRA 1RJ9B 4KFUA 2YC4C 1OE0A 4JIMA 1AA9A 2NZJA 5CDFA 2ZRBA 1XD2A 1XF9A 2ZRCA 4M9QA 4DDUA 4RSGA 4YDHB 5UKDA 3Q9LA 1ZW6A 2P6RA 1ZINA 2A78A 3L8ZA 1BMFA 4QNMA 1WMSA 2PJZA 3SJBA 3CZPA 4B6EA 4Q66C 1AZSC 2DPXA 1P2TA 3CW2A 1AGRA 3PVSA 3EASA 2QM8A 2F3RA 5EE9A 1TUEA 3EWSA 4ERNA 4UNPA 2JJ2A 3VAAA 4JLBA 3IHLA 2GCOA 2WAYA 1SXJE 1II9A 1G7CA 1BIFA 2O8EB 3CRMA 2BOVA 2I3BA 3SU8A 1KI2A 2JJ8A 4L16A 1N5LA 1E2FA 3A1VA 1BKDR 3OF5A 5AK0A 3QJYA 4DSNA 3AUYA 2OLJA 1E2IA 2FJUA 1KSHA 4EQ6A 3ZZ0A 4FMDF 1NIPA 1XDBA 4C0LA 1VG9B 3VHLB 1G7RA 1W0KA 2AKYA 4OHYA 4KLZA 4S35A 1R10A 2PEZA 2Z43A 2IXFA 4BZQA 5FPYA 4DSTA 2C8VA 5FOVA 2R6AA 1CR0A 1YVDA 4B71A 1UAAA 4C2UA 3IIJA 5H1YA 1N5KA 3PUVA 5E7IA 1Q0UA 2YWHA 1F60A 1RFLA 4ESHA 4Q5IA 4JMPA 4NYIQ 1SXJB 1NN3A 1S9DA 2Z0MA 2C95A 1KO4A 2O8CA 3BH7A 3VR6A 1EXMA 1JI0A 2ZSFA 4O2RA 3ZD6A 2DY1A 4URUR 1KI6A 3F8TA 3NXSA 2ORVA 2YC2C 1UBGA 2VL7A 3QEOA 4D4JA 3MJRA 3GLHE 3RRMA 1N6LA 1XEXB 2PZGA 4B3FX 1SXJD 3N2EA 2REXB 1XMSA 4II7A 4Q47A 4LPSA 2WICA 3HPRA 2KJQA 1G4UR 2A7QA 1Q12A 3WMGA 3GFTA 4LJ4A 4YMTA 1Q22A 1R0WA 5BN4A 2WSMA 1R0ZA 1VYVA 1XZPA 2FWRA 4OKSA 1G3IA 4YDSA 5JFGA 1IN4A 3W6OA 2CJWB 1N6OA 3D8BA 4LBWA 2ZRDA 1S0UA 3QXXA 3CRW1 3CR8A 3QPWA 1KMHA 2HXYA 3U7FB 3QXHA 5B2ZA 2OCYC 1D6JA 1F6BA 1QZXA 4P31A 1TF5A 3OEHA 3QG1A 1M6NA 1TAGA 4LHWA 1DG1G 3RSLA 3IQWA 1E4YA 1UF9A 1KJWA 2WM9B 5AJXA 1CP2A 3KFXA 4MRVA 4M1KA 3I5XA 2KBEA 4OYHA 1OKKD 4L9SA 3BGWA 4ARZB 5C1BA 4IEEA 3AVUA 3GLHB 4HYYA 4B2IA 2XNDD 1ZD1A 4JYCA 5FOTA 3H0KA 3C16C 1CIPA 3GLIA 3LBHA 1RYHA 2QEQA 1ZVQA 1HURA 2OBNA 2ZS9A 4EJSC 3RRYA 3FE2A 2FOLA 5DSZA 1UM8A 1XX6A 4YXWD 5C18A 5TDHA 3U44A 5JI3E 4ABYA 5CLLA 2B7CA 1SHZA 1XNJA 4ZKDA 3U3KA 4CEIB 1EFRA 3LAWA 1J90A 3LW7A 2BJWA 5CM9C 1E1RA 3RYTC 2H92A 5FUVA 4JZKA 3KJEA 2KI5A 3QXJA 4Y0AA 4QBIA 1A2KC 5H8WA 2ZPTX 5SZIA 4TN1A 4DWJA 1XTQA 3ADBA 3Q5EA 1WRBA 4P0TA 4JBXA 4K81B 4HSEA 4EFLA 5HE8A 3K9NA 4D25A 1NIJA 2J7KA 5EP2A 1SVKA 2ZYVX 3GQBA 1OIXA 4R71A 4TSFA 2J41A 1GSIA 2KSQA 3TVTA 1Q3TA 2JEOA 2NO7A 5K8IA 2YOGA 2IS6A 4DB2A 4BZXA 5HZHA 3L82B 3SOPA 5IF9A 5TY0A 4TT3D 3NDBB 5CLQA 2J0UA 2ODWA 3QF4B 1Z6XA 3VR3A 1W36B 3DPUA 4OK5A 2A5GA 4KSCA 1KYIA 4QHSA 4EAQA 4OHZA 2H7VA 2ZRPA 4DCNA 2ZEJA 2D2FA 4TYQA 1OH6A 5GJWC 5GJCA 2AR7A 4NU0A 2B7BA 3VR5A 3R8FA 3U3JA 4PQFA 3TMKA 1YRAA 2H18A 3KQNA 4ZKEA 1JJ7A 3X1XA 5D3MB 3M0EA 3OIVA 1E79D 4F91B 3QKRA 1GRRA 5AR1A 3U2QA 2HF8A 1NMYA 2ZYTX 5A5GA 3ETLA 1Z2CA 3FFBA 4B76A 5F98A 3PQCA 2V7QD 3Q85A 3VQTA 3IEUA 1P61B 5SZHB 4KBGA 4PO1A 4PHHA 5L3QA 1R8QA 2IHBA 4MKHA 5AUNB 3A6PC 4B3CA 4YMUA 2ZUDA 5D3QA 2GZDA 2R2AA 1J99A 1FFHA 2ZJ8A 1GTVA 1KOFA 4ILEA 2ANBA 1CS4C 4JL8A 4TMZA 1GP2A 4LBZA 2F9MA 2CBZA 5E7MA 5F3WB 4DDTA 3R8CA 1IXRC 1JECA 1N0UA 2ZSDA 1G3QA 3ZZUA 4BLTA 1W46A 3PCRB 4IEIA 3V4FA 2HYDA 3THXA 2QZ4A 1PZNA 3K0AA 1HUQA 4L8GA 2IWRA 4MRSA 4RD4A 1E9DA 4NBSA 3NC1C 1E2QA 4DCSA 4L5BA 4Q9HA 4Q1BA 1X8KA 2Q3MA 3PG5A 4FN5A 4HAUA 4XSHA 3CX6A 5FUYA 5FOWA 3EPKA 2ZTSA 4HB0A 4JT4A 2GBLC 4XWKA 4NYIR 1R7RA 2YVUA 1FMLA 4EFMA 2XB4A 4BLRA 1NI3A 3A36A 1Q21A 1XD8A 1M7GA 5AJZA 3IEVA 4NHOA 1FP7A 4BEJA 5C4MA 2ZJBA 1E94E 1PUJA 1YR7A 3TR5A 3GFOA 1MABA 4Z8YA 4LRWA 1F3OA 2FEOA 2G83A 2HLDD 2EFDB 3MWLA 2QE7D 2QT0A 4IKEA 1Q20A 1G5TA 1LNZA 5HE9A 3HU2A 4Q02A 5ANRB 2A5JA 3BS4A 4ESVA 3S1AA 3HP1A 2WWWA 1IN7A 1WDTA 3CONA 4HZUA 1A82A 3IDQA 3KJHA 4I1UA 1MT0A 1WXQA 2H1LA 4FCVA 2PEYA 1II8B 4HLQB 2KBFA 2EFEB 5KNCA 2PZEA 4PQRA 2A5YB 1DAFA 4HDQB 2E87A 4V0MA 2YYZA 3BH6A 5GVSA 2O5VA 2RAPA 3ZJYA 1OW3B 2WOOA 3D6TB 3ZZTA 2QMUA 4JLJA 4LHVA 4DKXA 4JSYA 3W3AA 1CLUA 2OCAA 3CO5A 4TL7A 3CH4B 1JPJA 2YINC 5FI0B 4AYWA 4IVQA 3ZLJA 3LBIA 2XSZD 4Q19A 3NEJA 3MAAC 1RIFA 1NP6A 3NC0C 1O3YA 1W5TA 1US8A 2F3TA 4PO8A 4CF7A 4RFSA 3LVRE 2XTNA 1OYWA 5DN6A 1OB2A 4MDFA 4ZPXA 2IYVA 1VIAA 1SXJC 1Z3IX 2D74A 4QBHA 1NN5A 4DLYA 1RYFA 4X8LA 3ICEA 2EU8A 4V02A 2QP9X 3EZ7A 4EPTA 1XTIA 2QBYA 1COWD 3FPAA 4HAWA 2J46A 1KGDA 3M4YA 1TF2A 4C0AC 3GJ8A 2PCLA 3NHAA 3C14C 5FPHA 2ZYUX 2CNWD 3LNCA 2QGZA 2W6JA 1F2UA 2J87A 1D2NA 4DHEA 1I4LD 1CR2A 2C9CA 3MLEA 2J59A 5J4KA 2NGRA 2HT6A 3N5CA 2P6NA 4QHTA 1A7JA 3BB3A 1J8MF 1OSNA 1YZKA 3IKJA 4DJTA 5JI2E 1UKEA 3VX4A 2ZJOA 1DAEA 2O0JA 4HUQB 5A0FA 1KI7A 4PC1A 2KB0A 2AN9A 4UNNA 1CR4A 5HKKD 5JMTA 4R2HA 1XTRA 4Q01A 5KTYA 1GIAA 2C77A 2PT7A 1G4AE 3BFVA 4D6PA 3K70B 5CYPA 1E9RA 3AB3A 2IXGA 4BFXA 3EG5A 5J40A 3UIEA 2ZREA 4IRUB 2ONJA 2MSDB 3A4NA 1T8UA 2WWIA 3AP2A 4A2QA 3PIRA 1EG7A 2WMOB 3KTAA 3K70D 1JQJC 5FPSA 2H5EA 4BE7B 1N6HA 1ZM2A 4XIGS 1E0KA 2Z4RA 3LW8A 4QG7A 4EDHA 2QAGB 1U8YA 3KKPA 1S3SA 2ZYWX 3RWOA 3PJRA 1W47A 3BERA 4N1AA 2CHQA 2WV9A 2EYQA 1ELOA 5J4LA 4LX0A 4K46A 4GBMA 2PX0A 2JLWA 5J4YA 4A6XA 2BMJA 1U99A 3NKVA 2PJRA 2NIPA 1KKMA 4Q9KA 1NSTA 2BMEA 1DBSA 3HU3A 1OHHA 2W2TA 3ND8A 4EKDA 2QY9A 3QVVA 4I99A 4BFSA 1NBME 1WE2A 4QJ5A 4BLSA 2FMXA 2XEXA 2ZJZA 3L0PA 3TQFA 4JVMA 3ONWA 4IW3B 4TTRA 4B32A 2OXCA 2UZ3A 1OFIA 4A2PA 4B3BA 1CF4A 4AY2A 3NBXX 5FTKA 5FOUA 2V9PA 2QNRA 1E2GA 2NO1A 2OESA 3PEVA 1W0JD 2IYLD 2ZE7A 3KKMA 4JS0A 1MKYA 1ZNXA 4AYXA 4M0LA 3GLGB 1KZ7B 2ZQ5A 2ANCA 4PXAA 4C30A 4ZI3A 1OYYA 4D0NA 1KY2A 2VTKA 3E2IA 1OH8A 2VP2A 1JR6A 2Q3HA 1WBBA 3X1YA 2GK6A 3CRVA 5A4JA 2QPOA 1T3SA 1YZGA 2IC5A 3B60A 4ZV4A 3DKVA 2BEKA 3PEYA 2NPIA 3MWKA 1E2DA 1UBEA 4LOAA 4HATA 2GXSA 4MA4A 1DADA 1G6HA 1H8ED 4G0NA 4UNRA 3FVQA 4JL6A 4R98A 1Y63A 4ACBA 2Q3FA 4M9XA 1MRSA 3THYB 4BPBA 1K8RA 5FFMA 1G7SA 1NBMD 4NCHA 4GMDA 1N25A 3AV0B 3ZVRA 2XITA 4ZIRA 2JAQA 4HLUC
chains in the Genus database with same CATH superfamily
1IQUA 2J3EA 4ZQFA 5TJ9A 3U7HB 4FXOA 4RHUA 3L8HA 5A03A 4Q4JB 4HK4A 3OAAD 1L5ZA 1RACA 4QLOA 1J5PA 5HGJA 1L8QA 3PNKA 3TW4A 4AWXA 4C4ZA 2C1EA 4EHHA 3RYCA 4NJOA 4B3DA 2FEMA 4GP7A 3RE1A 3E82A 2FP4A 3MPOA 1Q50A 1HDZA 2QVZX 3FIUA 1C2TA 3IUEA 2FG7C 4HWSA 5MGBA 4JXXA 4CNBA 4G8CA 1ZVKA 2FMUA 1TZKA 1G17A 3NFRA 4PO3X 5E1OA 2RE8A 1EA7A 3QUBA 1M2VA 1NI4B 1DFHA 2G4CA 3B1VA 3VO2A 1ECGA 3O4HA 5CB8A 4DNXA 1LW7A 2NZWA 3HJUA 1K8ZB 3A14A 3ONDA 4RH0A 2X4IA 1OXKB 2JBHA 2P3LA 4L3OA 5TXGA 4D2IA 3AUXA 4WCFA 3BE8A 3DOEA 1EM8B 3DYBA 4IBOA 2IL1A 4Q9DA 4V0QA 1Q44A 1EMDA 1U8XX 1RXYA 2GKSA 2O0MA 3N07A 5IDWA 4FNAA 2J09A 4W8OA 5M2QA 1BKYA 3BGSA 3ZXIA 4F06A 5J47A 4BKQA 3VYRB 1YH3A 4CLOB 1K5HA 1U8CB 1L5FA 1IBMB 2FE1A 3CCBA 4C21A 3TCXB 1ZW1A 3GIDA 1EA5A 3CCCA 4COOA 2X1LA 4IDBA 3ZS8A 1QB7A 1RI1A 1NXXA 2KLHA 5B1EA 5I8PA 1Q7BA 3O26A 4M1TA 1N3IA 1SBZA 5FP0A 2XJ4A 4E3ZA 3TSZA 3MWEB 3K9FC 3MILA 3PRKE 4NEHB 5AT1A 5U4QA 1W5AA 3KB2A 9GPBA 3N3BC 2VDJA 1A5ZA 2X40A 2P9YA 3BMOB 4F56A 5JWOA 2HWXA 1T3TA 1V41E 4OP3A 4EY7A 3G6WA 2ENUA 2ZRIA 1XIVA 2BFOA 2D8AA 3AP3A 4RHXA 3D7MA 4RORA 5HG0A 4D46A 4E08A 3KP1A 3W1VA 3E2MA 5ALRA 1XHEA 4NMXB 1OFUX 2PRJA 1F8YA 3OOYA 1KSJA 3EIQA 1V6SA 2B69A 2EDAA 4WECA 1G3MA 1JLHA 2WK1A 5EQTA 3JWEA 5DHUA 3DNMA 1SA0B 3EGXA 1XWWA 2YWCA 1VE1A 2AQIA 2WJPA 1OXVA 1SKUA 3EEIA 2FMTA 1PEKE 3EGEA 1KOGA 3H7IA 1VSQA 3EDQA 1OLSB 4HDAA 2OILA 5K3CA 4C1NA 4IH9A 4F9FA 1H2YA 3LXUX 4NICA 5JNSA 4BMDA 1OH7A 1OX4B 2G6BA 2XDYA 4CCAA 1RWKA 2XMGA 3EXHA 1R0BA 2RG1A 1EU1A 3HCWA 4IDPA 1R27A 3IPYA 5LA6F 1NYTA 4KNWA 2VSOA 1FVHA 3DVLA 3VPBA 1FSZA 2JLSA 4YRIA 4MHOA 1S2GA 5HFNA 4EEKA 4Q1VA 3CHYA 3DJYA 3KFVA 3WYGA 2HSJA 4JUAA 4EFKA 4ZCTA 2YYYA 4ETWA 4ENQA 2VA8A 1C14A 1EK2A 3D8RA 3GL9A 2OMEA 3IUMA 4R1UA 2ZJ7A 2BJVA 1K98A 4RVSA 4UCQA 4D81A 5KO2A 4CEHB 1XI2A 4UBMA 1I6MA 5ILQA 4AZ3A 2AC2A 4RSRA 3I2KA 1A9PA 1W88A 2YN4A 3IDSA 3E1KA 3IVRA 3CBGA 1F14A 3PXEA 3E35A 1IN8A 1JHVA 1XTTA 1XTKA 2C5EA 2CMKA 2ZRNA 3AKCA 1RQNA 4IVPA 5K3FB 5KBYA 1GUBA 4TTVA 2YUTA 3FGPA 4GAEA 2I91A 3PRYA 4J16A 2PM8A 2W37A 2WTAA 1CZUA 2QX4A 2OHXA 2WHQA 1D2EA 4ZVSA 2OYRA 3TCNA 4RZXA 3W4JA 4C7JA 2GEDA 4YRNA 3AVXA 4URXR 4E7OA 1DWUA 5IT9A 1GITA 1VZ3A 4OH1A 3PB3A 3VBCA 3VPFA 3WLFA 1LI5A 2B0JA 4I4NA 2PQ2A 3KXIA 4FX5A 2CE7A 2Y4OA 3JQFC 4FFVA 4EJMA 2BP7A 3EPRA 1ORIA 1U3WA 1QCCA 1QLJA 3E84A 4K5QA 4UDXX 3X2EA 4DUGA 3I73A 4XB6B 4B2YA 1VRVA 4ZAGA 1U28A 3NLLA 1FNNA 1W1IA 2LUOA 3Q11A 1IY8A 4GX2A 2Q21A 1FDUA 4M1OA 1FTSA 2VKTA 3K70C 1KZ1A 1QJCA 3QX7A 1MA3A 1YBAA 3KAQA 3RKUA 3SVLA 4ETNA 1I3CA 1FJ2A 1RRFA 4BWFB 2ZP1A 3EZXA 4GPZA 3ER6A 4K05A 3UENA 5TJHA 1HX7A 4YDQA 4B84A 1VMIA 3C8MA 5CJ2A 4IOMA 1W29A 3VU9A 4BNKA 1GQRA 1SVOA 4YQFA 1Z2EA 4MVCA 3IS3A 1V48A 2O8CB 2V74B 1Z06A 2QAGC 3PNQA 3Q8LA 1JHRA 4YJ2B 4Z1MA 2OP1A 3WIEA 1UEJA 4TTAA 4AMUA 1K6IA 1ZUHA 1COZA 2P2CA 3A1WA 2WJGA 4DT1B 2QSYA 3AWDA 2R60A 4QQ8A 2VCYA 1MW8X 2XCOA 2CMGA 3DD1A 3F2VA 4YN3A 3L1KA 3ZE7A 2I0FA 3QEBZ 5ICEA 1FFDA 1ND5A 1H0RA 1P0FA 2HCRA 5AW5A 1WA5A 1JXAA 2FQ1A 1U7OA 4DWWA 1UK9A 2XKJE 3CJTA 5AH0A 4CEJB 1NW8A 3H9EO 1QM5A 4JI3B 3TL6A 1KMHB 4WOKA 1INLA 3LYHA 1FDOA 5JAHA 1FP2A 3IAS6 1Y42X 5IARA 2DT5A 4CL3A 1XXHA 3GGPA 2ZT8A 5KNBD 3DMDA 2NU8A 3KKNA 4L85A 3X1KA 2R87A 3GO4A 3LO5A 4G0MA 3EUWA 2C2OA 3PUYA 4OYRA 2OO3A 3HG7A 7REQA 1BCRB 4FXPA 2NVBA 2OUIA 1RRVA 3MSXA 3QEJA 4LWQA 3GD7A 3QU7A 1XDZA 4C22A 3VR2D 2AJDA 1Y1TA 5T4HA 3WB1A 4O08A 1LD3A 3BWCA 4RVNA 4ABTA 4FJ2A 1DC3A 5EIOA 2L0XA 2M6LA 4BRUA 3U13A 5B7GA 3JQ9A 2HF2A 5DV9A 3ER8A 4I1SA 4N03A 1JAIA 3GF4A 1GQYA 5HUQA 4GC9A 5I7HA 1VLHA 2Y1DA 4MITA 4AKHA 2XPCA 1GCGA 1IL0A 2Z2JA 3EWAA 1E8NA 2QD1A 3LQFA 4RPKA 4XR9A 4IWNA 2F17A 2Q62A 1FUUA 5KCMA 3VKUA 3I61A 2NPOA 1KDRA 1F48A 2VRCA 2ES4A 2ZG6A 2JGRA 4MLZA 2ZETA 4Z49A 1B74A 1HDRA 1E1KA 2GJ9A 3R9WA 3MMZA 3NYIA 3MWFA 2OCLA 1IHDA 2AQ8A 3GCDA 1R9NA 4BBPA 1ODIA 4J1TC 4BJ1A 1E2UA 2WIJA 1SULA 3AO0B 1B93A 2ACWA 1JSXA 1U1EA 3CBQA 1K0FA 3EC1A 1UMKA 3EPPA 3H97A 3M5PA 4MQMA 2CFCA 1KO1A 3GP3A 5SYNA 3DEIA 4J4TA 5JCPA 3E58A 2PU7A 4LWPA 4M0MA 1LBIA 4UATA 5JQWA 3FFXA 4I6EA 4JOSA 4E5UA 5FBWB 2UZ1A 1WHSA 3EG9B 1RWNA 1RAHA 3MMXA 4FC6A 2YOFA 4MUYA 4BLQA 4YRGA 5HIAA 5KHAA 2ZSJA 1LVUA 3LOPA 4J0IA 1L7EA 2VNKA 4TSRA 5M5BA 3MCTA 1GGEA 1RXIA 1VL0A 1NBHA 2QRHA 2Z3VA 3A4YA 3OZRA 2EX1A 4F2DA 3QFCA 1M6VA 2PFSA 1T8WA 3DOIA 2H11A 3KEMA 4YRPA 1QS0B 1IE3A 1YJQA 1LU9A 3QTTA 1A5AB 4BKMA 2UYYA 4XIFA 3MCAA 1E3MA 4O3FA 4PLCA 2B25A 4XGIA 3G9ZA 1JR4A 5AOBA 3UICA 3UWPA 2W58A 3C43A 4R41A 3TNFA 1VBFA 4HDCA 4P1ZA 1C41A 4X61A 1V4NA 2ZM5A 4I3FA 1NNUA 3RVJA 1AE1A 4OJYA 2G04A 1XEFA 4TQAA 3SICE 2J08A 3PE4A 2C5GA 3FZNA 2AOXA 5L3VA 3OFND 1RWXA 1N1GA 4K2HA 1GGFA 1GKIA 2PGAA 1WY7A 4WZBB 3SYRA 4F84A 4V39A 4URWR 5A7FA 1JX6A 3BKWA 1HTTA 5C51B 4GR4A 4OGKA 2NTEA 3LYLA 3FPEA 2G8NA 4IQ8A 3UUWA 3H99A 3ILXA 4I55F 4WH0A 5BQOA 3RSHA 1L4EA 4EVIA 1LTKA 3K2EA 1MJHA 2GUWA 4D9JA 1LY1A 1T6BY 2ZYRA 1ONNA 2NACA 4ZCMA 2P2NA 5FBVB 1YHZA 1T15A 3IESA 1N7JA 2FOIA 3PLNA 5AUPB 3O91A 1V39A 4PHCA 4AS3A 3ABQB 1C0PA 2EERA 2QTTA 3MRXA 3O9VA 2EJBA 3OJOA 4QRDA 4ZEMA 4AKGA 2NZ2A 3MT7A 3STXA 5E8JA 3MQ2A 4NZMA 1VBNA 4EVSA 2P3QA 3CXRA 4QE3A 3IX7A 1NG1A 3ZXYA 4QKQA 5CFMA 1T1SA 4JL5A 1NA5A 3U16A 1QQTA 2JCSA 1EHIA 3DVAB 3H1FA 1VE5A 1YVPA 4MIOA 2Z6QA 5DNWA 2DT8A 3GB9A 4LVOA 1L4FA 4L6CA 5IMBA 3WWYA 3TPZA 5ILOA 3HSKA 1H5UA 4GWGA 2GNPA 3QVGB 1P91A 3U7QA 3VHXB 5AW6A 1PK9A 5EVCA 4MR9A 4PC3A 1MJNA 1CV2A 1UAGA 1OWNA 5BSUA 2Y0EA 4EHNA 1BCSB 4NNPA 3R9IA 3I92A 3WNCA 1UBCA 4ALJA 4CQMB 3AEUB 3R5XA 4DG9A 3T61A 1W581 2WE8A 1BROA 2HJHA 1PFUA 4M1SA 3GZNB 4UUAA 4ZI2A 1YR1A 1S2OA 4CIAA 5ALPA 2JFYA 1Q74A 1QCDA 3VV3A 3DE2X 5BUZA 4PGAA 1QYRA 4MWSA 4IMPA 1ZNWA 3OQVA 1KEUA 1ZC4A 1L2TA 3V1TC 1D9XA 4TTJA 1QHXA 1R6XA 1PV1A 5EMMA 1RC8A 3QLJA 4LJRA 2XXAB 2XUOA 1H8HD 3HCRA 4BLUA 1VI2A 2VNSA 4FFMA 3KBBA 2Q4OA 5JANA 1WG8A 2RAFA 1JV2B 4O2BA 2ZXUA 1PVOA 1VJTA 4NX2A 4N0DA 4Y2QA 3ZZ1A 5KQGA 1QO0A 3OE5A 1ETUA 1U3UA 2GK3A 4FLMA 3JQPA 2AOUB 4K9LA 1L5LA 1XMOB 3VNRA 3AESB 4QGFA 5HTKA 3QF4A 3UGTA 2HNBA 3N2IA 1YNSA 3RF7A 1P7PA 4EMTA 4MUHA 2G09A 1ZM9A 4Q9LA 1JF8A 1W96A 2FPGA 4IHJA 3DFUA 1EUZA 4JH0A 4L73A 1RPZA 2HW8A 3EQ7A 4UCFA 1XTPA 2QMEA 3MF4A 2B99A 2IW1A 5FUBA 2G40A 3BQMB 2H29A 3EZFA 1ADBA 1XDGA 2KQUA 2BTOA 2GFQA 4DNOA 2AYXA 3DMFA 3P9ZA 4IF6A 4BCCA 4YPOA 2JCBA 3RNLA 5ICSA 4DA0A 2Z6AA 3O47A 4PC6A 1MJ5A 2YL2A 3BD8A 3MMPA 1NI5A 2V7QA 3PNLA 5FR2A 4Z7NB 3KKKA 2N42A 2P5TB 2JKYA 3S2ZA 5DW0A 1OJLA 4A6PA 2BRUA 4DLZA 4BNNA 1OXSC 2C94A 1YAHA 5D87A 1RHUA 1I5RA 1L8AA 3BHIA 2HXSA 3EARA 1IXSB 2VP3A 5JMPA 2IEDA 4J2TA 3WMFA 2I4NA 2IJGX 4BNDA 4KR7A 1VG8A 2O1WA 1WPQA 1VHDA 3AJ8A 3AUKA 4AC9A 3CKYA 3FNFA 4UPEA 4YR9A 4XUEA 5BW4A 1Y82A 2GILA 2DP4E 5A7GA 4NBWA 4OA8A 3OQMA 1DXYA 3OFJA 2I99A 4KXFB 1Q7EA 1CZOA 1RCFA 2XMPA 3GNSA 3K3PA 3NTOA 4PSUA 1PTJA 1ZCBA 3DPSA 1JSCA 3SZOA 4ENVA 4X1OA 3CVOA 5TB5A 1TD1A 3K1AA 4MS1B 4HV4A 2ZJYA 3UMGA 4F45A 3O92A 3ROKA 1BO6A 1NDUA 3JTMA 4E2WA 2O48X 5EXSA 3WYFA 1UPCA 2JJYA 2YMLA 4ZCPA 1U0GA 2AMLA 1YQGA 4YQYA 1TMGE 1V43A 2XCQA 2DWCA 3IBGA 4WAUA 3BCUA 3PEWA 4QT0A 5E1MA 2C0CA 1N5IA 3GNQA 2FV8A 2UYQA 4CTNA 3RD5A 1KR5A 1B3BA 4UBLA 3G9TA 3PUKA 3GT3A 3PNBA 4JFRA 5BWOA 1DKRA 4R8SA 2AZMA 1XTSA 2YJ4A 4ZJZA 5B7QA 3ZWDA 3KNZA 421PA 5JS7A 7MHTA 5ECDA 2C83A 4H7KA 1E96A 1NE7A 4WK4B 1IMOA 3GYGA 4JBYA 2QUKA 5DYWA 5KVQA 3MFQA 4JA2A 3V33A 4RHTA 1YS4A 3KSUA 4OBWA 2Z9BA 2BGIA 1JT9A 1EDEA 1NV9A 5ERYA 1DKNA 5I5EA 4BY9E 1E7YA 5KS2A 5FCDA 1HQKA 3CIFA 4Z5XA 5DI3B 2TMGA 3OLCX 4F7DA 4JOQA 5DBFA 3GRPA 4E5DA 1O94D 2VC2B 4FEAA 1EVIA 4PG8A 1XZJA 4N5IX 4R0MA 4CCYB 4EY5A 2ZXEA 1ZJJA 5ALTA 4TMVA 4DNQA 3UHJA 3KYIB 4ER0A 1MIOB 2GJ4A 2WYUA 1C3JA 4JP3A 2PNJA 3WNDA 2FA9A 3TOXA 5GY7A 2WTXA 2RAUA 1GFZA 4UU8A 4D3SA 3IEXA 2Z6VA 2FRDC 3EXIB 1II8A 2J4FA 2RGGA 3FNHA 3LXXA 4FYYA 4MWBA 3R7SA 2Q8PA 1CRQA 2ET6A 1QIHA 2ZT5A 3IDAA 3SJCA 3TVYA 5CDSA 2RKOA 3H42B 1TAHA 4KPYA 3MNFA 2GDZA 1YRHA 1F38A 3PEFA 2XSZA 4LN1A 4GZLA 4W9MC 1ZH2A 1QQAA 3K0KA 1B6TA 2C1XA 3DAGA 3LUJA 4YJGA 3ZWQA 4P58A 4RMNA 3AZQA 4CYMA 3UYLA 4EYKA 4B5LA 5KWVA 4MPRA 1O96B 4RFVA 3HC7A 3KDAA 4ZTUB 3M6IA 4J07A 4DCJA 2ETXA 3W9UA 1IBLB 4AY3A 3A25A 1XEWY 5CBKA 2C4NA 3K2BA 3PXGA 4DR4B 3PWSA 2XADA 4MA0A 5AK3A 4C43A 4AY4A 2FAXA 1JHQA 2X6RA 4BDSA 2FY8A 4NOJA 3GLGE 1GZDA 1YQTA 2EQAA 1TEZA 4UEKA 2IIBA 4GRAA 2HREA 5CGZA 1AQLA 1DEXA 4C03A 5SY4A 2CDRA 1GGKA 1IM2A 2JGKA 4KHZA 2WF6A 2CNWA 3T5MA 5KQRA 4OHXA 2EW8A 2HCJB 1WTAA 3RHSA 1WBDA 1SUPA 1Z2AA 3FR7A 2HO4A 1T3LA 4Z0NA 3ZHBA 3MRSA 4QXAA 3SBXA 3VDQA 4J29A 2WHXA 1EB8A 2V58A 4U7DA 3AK4A 4RPLA 4PYLA 2Z2IA 3WTCA 3ZJVA 1Q92A 2NSJA 4I5GA 2FX2A 4NH4A 4XTCS 3F7OA 5FUWA 2VXYA 1A5SB 1EJ0A 2Q5EA 2VS1A 2ZIFA 4MRPA 5EINA 5TQJA 3K0CC 3T7SA 4OXNA 4BGDA 1Z8NA 4ATNA 1S8OA 2OHVA 5HKKA 2DSTA 5JLAA 4TVSA 1NUQA 2F43A 4HRAA 3UAXA 5GIOE 3ZJ4A 3RG8A 1GT91 4FHFA 3UCXA 5LOVF 4HAOA 4KNYA 3CPHA 1JDPA 2CXSA 2RH4A 3IAM6 2UXDB 4G1MB 2RGNA 1H0SA 3GNTA 5B3AA 5JPDA 2EBFX 3CSUA 3TE6A 1JTVA 2J3KA 1JEJA 3HL0A 4RZQA 2BEJA 1W36C 2FZ4A 4RK5A 3KZMA 1RYZA 4BIMA 2EQ5A 2ZI9A 4MYHA 3EODA 5LZ8A 1O03A 1UP7A 2PZBA 4MQFB 4CVNA 1NZDA 1U3GA 2VT6A 5FFFA 3Q7QA 2QKYA 4YRSA 1Q3HA 3HDVA 1JILA 3FYDA 3G49A 4BJHB 1NM5A 3N2KA 2HJRA 2O1XA 2RC6A 4GH5A 5T57A 1BE1A 3R7DA 3WK5A 4CHTA 5JDCA 3AUFA 1NW7A 1VJ1A 2OAGA 3PGKA 5E6UB 5BV0A 4L8LA 5EXXA 1I6KA 2AFHE 3ND9A 1XZBA 2PUTA 3NX4A 3DE3X 3MQFA 4G37A 1XBTA 1Z6GA 3U9SA 4AQDA 3MPUA 2W83A 3LQRA 1UPFA 3RJZA 4KJXA 5K01A 3VU3A 1KVTA 1EFUA 1AG9A 2R86A 2WWGA 4RA9A 5JSYA 2ZB7A 3THSA 4BNLA 6REQB 2B4KA 2CL6X 1TEXA 5E95A 5BPHA 2G1JA 1U11A 1AXGA 2G9UA 1ST3A 2IHUA 1NMXA 3AR7A 3RJ9A 2CLOB 3K92A 2BYTA 1IC6A 3F47A 3I5AA 3K0BA 4BO5A 4FFBA 1ISPA 2J5QA 2N47A 1KMNA 2ADOA 1NVBA 2YHAA 1EUYA 3BL6A 3ZE8A 2GK4A 3IEKA 1NJFA 2RGYA 2VJCA 1KYVA 3HA5A 4PAMA 1YWGO 2H8GA 121PA 1EX1A 3WGYA 1CF2O 1IEVA 4HT3B 4B45A 1V7ZA 1XJ0A 3FBTA 3A6LA 3V1MA 3HCBA 1RRCA 3F73A 3BK7A 3EA5A 3OBIA 3ZCUA 2GD0A 5C8YB 2WSSD 2GVNA 3JQQA 1WPXA 3D6JA 3FCCA 3QFHA 4JWTA 1V7CA 4L0QA 2JLBA 4L57A 4IQFA 2I1VB 1XJQA 4MYCA 1E9CA 1YJAA 3GHHA 4OATA 4XCXA 3E22B 5F78A 4GXRA 2QXUA 1PGPA 1G2QA 5E9AA 3TI7A 4DMGA 3AY0A 3L4SO 5F33A 5E7JA 1XCLA 3QVUA 5CDHA 5GP1A 2J0SA 4NSNA 4R7ZA 1V8ZA 4OU4A 2XQIA 5K05A 3SF8B 1WVIA 1MQ9A 4D0LB 2FMKA 1T5DX 4JY7A 3W04A 4NAHA 2PVSA 4UJ5A 2YZGA 3F7NA 4RA6A 4HYTA 2FWNA 1USGA 3WLAA 1IPHA 1HT3A 1DC5A 3IO3A 6GPBA 2IY8A 1ESNA 5MN4A 4YONB 3A2KA 1G8KA 2X3UA 3U56A 1NMEA 3G0OA 1U0JA 2VWGA 4I8IA 4KRYA 4EY3A 1AQJA 4X20B 2PH1A 2XMRA 2F1RA 4FBMA 3I76A 4LNUB 1P3Y1 1YS7A 2GF0A 4RV5A 1TNDA 4WINA 5DFAA 2FK7A 5EUBA 4DLTA 4B3MB 2OUKA 4BO4A 1F20A 3LBAA 1E9EA 3IEPA 3RVPA 1PGJA 1Q19A 2FOXA 3PRJA 3DFKA 4HP8A 3OAAA 5T4FA 1XELA 1NKTA 1VL6A 3C3YA 4KOAA 1JFVA 4M21A 3RUAA 2FR8A 5MN6A 4W9RA 4LHZA 5FV4A 1VIYA 2LKCA 2COEA 4Q3CA 4MVYA 4R1PA 3NCHA 1CC1S 1T5IA 2PHZA 4LF8B 4R2IA 1JZTA 1G5QA 2QI9C 3B1YA 1R4NA 1PNTA 2GBFA 3PZBA 3Q7EA 4NNJA 3S2IA 4MYTA 1XQ6A 3ETDA 5AM5A 4HQRA 4WFQA 5KYYA 1AQNA 2VSYA 4LF9B 3SFTA 4W5NA 3CZ9A 1Z8FA 5FI3A 3RU2A 1B41A 3AVYA 1XVLA 3DZKA 5IHXA 5ALKA 2NXNA 3MTDA 4ALKA 1HZZC 1KZGB 1MT3A 1WDLA 1XYVA 2AF4C 2ATXA 2BM9A 2H9IA 2A92A 3REQB 3ZC3A 4YCLA 4Q7LA 1A4IA 1T2FA 2DBZA 1TQ2A 3KQSA 1DOZA 2ZUSA 1DEKA 3Q4GA 4HGNA 3HJTA 1E1CB 1U7DA 3DLAA 1UJCA 1W85B 3F4KA 2GRUA 4M6WB 4Y67A 5DHSA 1ZWKA 2EBHX 2XA9A 4UOZA 5IFKA 2ACEA 3KXKA 4B6FA 4DVJA 3U1BA 2DTXA 4O4JB 3U37A 4HH0A 1E5VA 4IJWA 5J4HA 5TGDA 1XD2B 1P2VA 2C8LA 3JQCA 3QPCA 3QP9A 4MVJE 4S1NA 4LBYA 2AKAB 1ZBDA 1GY8A 1VB3A 2NNLD 2YZKA 4MHTA 3LK6A 2F7SA 2FRVA 2VEDA 4P5DA 1TVMA 2QL5A 3IKMB 1E1DA 1RYBA 1WXFA 2H85A 2CMHA 5EEHA 2XV1A 3ZJ5A 1Q0LA 3RBXA 1KH1A 2VJPA 3VDNB 5BV1A 4E1BA 3V2GA 1P9LA 4LSZA 4O5OA 4WLNA 1IY2A 1X8LA 1ZUWA 4L9WA 3ZWOA 1O89A 1AQUA 2XYHA 3OLWA 4UC0A 2GEBA 4Y7DA 3UWMA 5E2AA 3MXTA 2OR3A 5ALDA 3KQUA 1Z35A 4D96A 1C8BA 5KOJB 2NO4A 4M89A 3ETJA 5EZ5A 1ZLYA 1EQ2A 3DYVA 3BIOA 1Z0ZA 2RB5A 4DA6A 5BSFA 2JJ2D 3JS5A 1QIGA 3PCXA 2XKKA 1WB9A 2BEUA 2FZ5A 4S24A 2R5WA 2Z5FA 3LGXA 2CLHB 3HA3A 3DAHA 4EHIA 1ECPA 1U9IC 2PUBA 4MO9A 4YP7A 2GCGA 3G0HA 1RHQA 5LA6A 2GVZC 5CVCA 2O8VA 5DTIA 1CDDA 3RRNA 3UMRA 2XGJA 3FDZB 4HUTA 3B3QA 5KYTA 3IB3A 5KKAA 4LXQA 1AH2A 3QWAA 4YO8A 1M2HA 2PLFA 4FC7A 1NONA 1YVRA 3ESQA 2ODNA 3D3QA 3OTHA 3FYSA 3JSXA 4FR2A 3PA6A 4FZVA 4MVJF 3WZ2A 2QAIA 1QHGA 3QLUC 2JIQA 2WD9A 1UBLS 3R3SA 4C0KA 4C04A 3I5UA 4LGCA 1W0KD 1RZUA 2HJ9A 2O7VA 4JUCA 4W5JA 1I7NA 1ZQ9A 1ESZA 3HYRA 4RU1A 4ZOLA 5DHFA 4OJQA 7REQB 3H2SA 3CRRA 3VYTB 5J2TA 1SMKA 3VOTA 1IB6A 2WBLC 3DZCA 2CWWA 3PDWA 1WS6A 1M8KA 2G9ZA 2NYAA 1E4VA 3O1HB 4TKUB 5TF0A 5JXGA 3EDMA 5BWCA 2GD2A 3RARA 3AHJA 3DFIA 2BR3A 3SK0A 4BP3A 1HLDA 1PT7A 3G7NA 2IX9A 3MB5A 4JBLA 3VR6D 3QEMB 5AFSA 3NTQA 4TZKA 5KCZA 3TH5A 2P6UA 3BB4A 5CD9A 2YWFA 3AXTA 3AKDA 2W2LD 4WOJA 4Q39A 3G82C 3UA3A 4HVCA 2GFHA 1KI1A 1H93A 4KL8S 2OFWA 3UK0A 3ROXA 1F1BA 5I9IA 1XZLA 2BISA 2CFOA 3H9BA 1WEHA 3GT7A 1QUEA 3LHDA 3UN1A 1W49A 4RK1A 1R18A 4E5KA 4JSTA 2ZAMA 3DXZA 1PJTA 3RHFA 1EXDA 5CJPA 1N2CA 1QO9A 4WY5A 4ZEWA 2XUPA 1SK8A 2F1KA 2WJ4A 3JYPA 5LBTA 1XROA 1T0PA 2GJAA 2ASVA 1T0HB 1AUOA 1EE9A 5I45A 2J31A 1W8DA 1QF7A 3QU9A 1ZD5A 1XLTA 2M2IA 4KO8A 4PX2A 4YT4A 3MB8A 3PDIA 1OA0A 5I7AA 3F4LA 1PQPA 4BV3A 3I9MA 4DDMA 2ZZNA 3KZXA 3C87A 1HT0A 5KNBH 3LT4A 3TTYA 1M6YA 2LGJA 3WGTA 1KI4A 4H59A 4WUVA 4CIYA 4YMGA 4EP1A 2W2VA 3SXUA 1M6VB 4I6GA 4MX8A 4UREA 1ZM4A 4WBXC 2QXYA 3FSJX 3N8DA 2H4HA 3K30A 4PR0A 4KV9A 3RAGA 4BNGA 1E9FA 3HJHA 1PLJA 2C9OA 3WDLA 1KEZA 2O7SA 5K0EA 4BCDA 5LC1A 3OWOA 3S27A 1HEYA 3W4KA 3W5AA 2PRSA 3N87A 4GE3A 1QOPB 3PQEA 2EGUA 2Q0XA 4TUYF 4QOGA 4JYMA 1LBEA 4Y6QA 1N3LA 1FTWA 1ZD4A 3BFJA 3FSGD 3HDYA 3HUEA 3VZRA 1JIUA 3U0VA 3PUXA 1DV2A 1P2UA 2HCBA 3B1ZA 2FUKA 4HKTA 4BRSA 3NNNA 1Z25A 3GLTA 3PFHA 2X8BA 3TPCA 5JWHA 4JEHA 4C4TA 3INNA 1ILEA 1IB0A 5U4XA 4K9OA 4DLVA 4HDNB 1J33A 3L2OB 5BW6B 5KPJA 4EM6A 1JH9A 3HTXA 5IEJA 4OLBA 5KYKA 1GL9B 2BF4A 3LC2O 5KNBA 3AVTA 3RV4A 4PZYA 1YASA 3VPGA 4X71A 3N75A 1GZHB 3PCTA 2IV2X 3EFOB 2ZJ3A 3JQ8A 4K9PA 3I5YA 3KFLA 2PUCA 1M2EA 2EKZA 2PG3A 1YRLA 2VDNB 4K9SA 4LXUA 5K8LA 3NATA 2VK8A 3T1TA 3OH8A 4OGFA 2WV7A 3EGVA 3I37X 5A6VA 4NZPA 2G0NA 2Y1KA 3KEGA 3GAZA 1C1XA 3VHQA 3VR2A 4AIIA 4JYBA 3CXUA 3N8KA 3T3DA 9LDBA 4FHZA 1LZLA 1W48A 4NFYA 2D1RA 1XFDA 3P94A 3VH3A 3WYAA 1NRXA 4E5YA 1PQWA 5CB4F 1K6MA 4FDAA 5CYOA 4WOPA 3Q3IA 5DIFA 3LGSA 6AT1A 2P4UA 4YPVA 1E2NA 1O8CA 3J81k 3OX3A 4YP1A 1SC4A 3HWRA 1E3QA 2HRBA 3FF4A 2R79A 3WQQA 2OENG 4L5CA 1Z0SA 1Z38A 3C1UA 1GLGA 2JFVA 2I8LA 4WERA 4EL0A 2AD1A 1A8SA 2CFTA 4ZT4A 1X70A 3LM8A 3M83A 1AV7A 1CTQA 2CYBA 3RUPA 4LJLA 2O50A 4GBGA 2O2JA 2PO5A 5CLFA 5IXSA 1U1CA 3IBCA 2C9BA 4DCMA 2AG6A 1TU4A 5AKGA 3L0DA 2FSVC 5AW2A 4I9UA 3RS4A 5JXJA 2G36A 4WLFA 3QNMA 3N2GA 4Y18A 1KHTA 3CE9A 2DOKA 3K9QO 2VDOB 4D57A 2NM0A 4JOCA 3SYNA 4F71A 4MUGA 2VT7A 2R9VA 1TJ4A 4UXHA 4XW2A 3QVTA 4ZHQA 1L7XA 1B43A 1NPTO 3LBNA 3CS3A 4X54A 2YKGA 2NVUA 2OCKA 3C6QA 1JDVA 3H5WA 3A26A 2JLZA 1TLLA 1Q1EA 4MV8A 3DDWA 4EA8A 3DR3A 4LBVA 4UD2A 3W2EA 5BORA 2GXAA 1YE8A 4ARZA 5CW2A 4UZSA 3OZDA 3TLXA 2RHMA 2ZBFA 5FQOA 3WRVA 5TS2A 1ZH4A 2F1IA 3M4NA 5F9HA 2ORYA 4JOBA 4YR7A 3AM3A 5CDGA 1MO3A 1P7YA 2HUPA 3P20A 4J0FA 4QICA 4EB6B 3EDRA 7GPBA 3TGLA 3LTNC 3UHFA 4YUXA 2PUDA 3DYIA 3H4VA 3O83A 4IWYA 4IHJB 4CEIA 1EWKA 2JS7A 3OFNA 3N6RA 2GXQA 2R7MA 3QBJA 3G7SA 2N9UA 2FUNB 4BQSA 4EEZA 5AVJA 1WCIB 3DHWC 3LC7O 4X92A 5JNTA 1U65A 1XK7A 3EJ6A 1YBHA 3CNLA 5A3VA 3PX7A 1QG4A 1GG9A 2VF2A 2ZSEA 2Y2VA 4CKEA 2FNAA 2APJA 1SKYE 3H13A 4MUJA 3ZEIA 2C88A 1K7CA 1G63A 3MA0A 4JLAA 4Y9RA 2XUQA 5C2JB 2IPAB 4RTLA 2EZ4A 1C9KA 2DRIA 3D64A 5AVTA 1ML4A 1Z5VA 2H9YA 1TYEB 4IMIB 4QPPA 5EJIA 3VVCA 1JL3A 2QMYA 2JHFA 2CVFA 2YXBA 1EEHA 4FW9A 1WB5A 4TV9F 5I7WA 3FGOA 1VZ2A 1S8NA 4BB5A 1JJFA 1S01A 4ZVPA 4AG3A 4BNDB 3DE5X 1U5AA 4OL9A 4LZLA 4B35A 1P5HA 4ETMA 2BSQA 2OGZA 2Q5FA 4HD8A 3H5NA 2YJ5A 1CNEA 4M54A 1FEZA 5DBOA 3ZQ4A 3TLKA 4AD8A 4I1IA 4D6YA 2E37A 3WLNA 3LFHA 4GSKA 2W2KA 4IINA 1JDUA 5ICGA 2JHCA 5SZKB 1USUA 3H6KA 4M0DA 3VOSA 2J32A 1NYRA 3H65A 1HE4A 2X1VA 3IIMA 1CT9A 2PYZA 3TBHA 2DWUA 4PV7A 4O4IF 5F2EA 4JN6B 4AI6A 2WMDA 1CY4A 4PR3A 3SZMA 2OE2A 3QE9Y 3IOEA 1SVNA 3WWDA 3CPJB 4AKSA 1QRDA 1UXIA 1NX6A 2H2IA 5J5VA 2D0OB 1JVBA 3R23A 4E30A 1LDBA 1OLOA 1YI8A 4TTPA 1O6FA 4KYVA 1AS3A 1OILA 2QYTA 2X0EA 3JARA 4IXMA 1OFHA 3ZV5A 4PHGA 1NFQA 1SQSA 2EQBA 4DG8A 1B8OA 3D6AA 3LUHA 5G40A 4WNIA 3EBPA 2BCEA 5HMMA 3I2YX 4TLAA 5HCUA 2R00A 3U49A 3WXBA 1PGOA 1FNBA 4L6IA 2J5KA 4CBVA 3I23A 1TW3A 1Z73A 2IQ5A 1SQFA 4G5QA 1H8HA 4H3KB 1A2OA 3S1SA 1BQEA 4RLFA 2H0QA 1A4RA 3NVAA 1VP9A 2VUIB 4IICA 3NHKA 4V0OA 4EF5A 1J8QA 5DISB 4EYSA 4YT8A 2BKXA 3VVMA 1H22A 1ODCA 2GTPA 1FLAA 4P4SA 1T91A 5KNDD 5JD6A 2D4HA 3TSOA 1RADA 1G9XA 1V9CA 1VI6A 4FBLA 2XBUA 3OMLA 3OU2A 3FTEA 1JIVA 2ZDGA 2BM1A 3IULA 4KACA 2H57A 3A0UA 3HYLA 3ILVA 1MHTA 3GN1A 1NQTA 2W42A 3UJ7A 2C2GA 1XRRA 5BT9A 2QI9F 3ZHQA 2XUGA 2J9FA 1IEQA 5H68A 3TAHA 2PZAA 3ASZA 1B6GA 3FWNA 4ZYLA 2HPHA 3VZCA 1N2IA 2ZB3A 3EFHA 2P75A 3E7XA 5KOHB 1VL8A 2DSNA 1Q15A 3QELA 2Y4NA 3BCSA 2ZWPA 3JQAB 4ZFNA 2H4WA 4GXNA 4JT2A 1N8TA 4D8XA 4W1SA 1SBTA 5KIAA 4K28A 1UMDB 3LWNA 3F9CA 4US1R 1RZVA 3F6YA 4QOHA 1B14A 5K6TA 1XVAA 1W1WA 2DB3A 3ICWA 4YAOA 1TTPB 1UQRA 3L8EA 4J4HA 4Q21A 4YJGB 3TTUA 4C0SA 4C4SA 1G21E 3ORQA 3KQHA 4YAJA 1AURA 1VIMA 1PTKA 3P5SA 3PT9A 3VNUA 2PSEA 4D74A 1JUDA 3RS2A 1TZJA 1DKUA 3F5FA 1JAXA 3BOSA 5E6SA 1WMEA 3LMKA 2ZYHA 4D26A 4RYLA 1QVWA 1PS0A 4RIGA 4X6YA 1EFTA 1K4KA 3D7NA 4MWEA 4UE3S 4DXHA 4BC0A 2BD0A 3P27A 4PX9A 3DKIA 3I0MA 2PMFA 3GLFE 3OUUA 4KFCA 1RZ3A 3BXEA 4U5XA 4PN3A 5EJ5A 1X7WA 1HQYE 3F6EX 4MULA 4RZ3A 4HS4A 4N3AA 4M0PA 4O4HA 2ZQYA 1P2BA 2BKAA 2HFJA 2VOEA 4PC2A 3HS3A 3H1TA 3A9WA 2JLRA 3WGZA 1GZ6A 3SD7A 4S0ZA 1L4HA 4CI0B 3K0FA 4YV0A 1LEHA 2QL9A 3IIKA 3OIYA 3TSWA 2VKQA 4YJKA 4B82A 1DG3A 4BZZA 1IWPB 1QMPA 4XB1A 1X7GA 3CTPA 2X86A 1G1AA 4AURA 2J5BA 2AHOA 3QJGA 4AXXA 3V6MA 1E3WB 5HZMA 4L4YA