2KSQA

The myristoylated yeast arf1 in a gtp and bicelle bound conformation
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
180
structure length
180
Chain Sequence
GLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVECVQYCNISFTVWDVGGQDRIRSLWRHYYCNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELCNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNCLKNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor 1
publication title Dynamic structure of membrane-anchored Arf*GTP.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 44
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2010-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2ksqA00
1EFRD 3CH5A 3HPRA 3HYRA 4Q5IA 4ZCLA 3CNLA 3AVWA 1GSIA 4OI0A 1FMJA 2XNSA 1N5JA 3NBZC 4LRWA 4HATA 1G8HA 4G5GA 4HDOB 1Q1EA 2C96A 3D31A 5JWRA 4X8HA 1KK3A 4IRUB 5FUVA 4C2UA 3K8YA 4F93B 1IN7A 1CR0A 1L8QA 3QKRA 5DE3A 2A2ZA 4G3XA 2JGNA 5HE8A 4G1UC 4CT4B 2Z6VA 2VQSA 5E7MA 4BEBA 5AUOB 2HLDD 1IY2A 1E9BA 3FTQA 3HDTA 1H8EA 3VTKA 4O2RA 1I4LD 2A5GA 3QG5A 2ZYTX 5IK2A 1P9WA 2IF2A 3R20A 4TTPA 1N6PA 3OEEA 3R8CA 3LLUA 2J0SA 4DSUA 4BLTA 2YC4C 4DLZA 1XCMA 1AK2A 2IYTA 2ASEA 5BYKA 2GTPA 1TNDA 4OL0A 2EWVA 4C0AC 3THWA 1PVOA 2H17A 5GVRA 4BFUA 4B44A 3KZ1E 2JJ8A 4HZUA 1O3YA 5FOSA 4DDTA 1FFHA 2JAQA 2CNWA 3G82C 3B78A 1UFQA 3UIEA 1R8QA 1D9XA 2QMOA 221PA 3A8TA 2V55B 3K0AA 5J4KA 4C0HA 5DGXA 3UXMA 1GOTA 2XSZA 3LY5A 2FFHA 4BE7B 2FGJA 1YHNA 2KBFA 5DNYB 3LQRA 1SXJD 4NHOA 3T1VA 3W3AA 2Z43A 1HUQA 4WW0A 4E22A 2FF7A 4PAOA 4QGAA 4NL4H 3PG5A 4NE2A 2OUKA 3OHMA 2YWFA 3CPEA 4EJSA 5D3MB 4C30A 2OLJA 1HURA 1SHZA 4EAQA 4EKDA 1Z6TA 2R6CA 2ZYWX 2OFOA 4JBXA 2GESA 3QEJA 5AUPB 3WHLA 4KXFB 5ANRB 4Q47A 3OIVA 2EU8A 2HXSA 2QMUA 3WP1B 3S1AA 3NWJA 2ZR7A 2X19A 2V6JA 3ZLJA 1I2MA 3SZRA 5L3SB 2PEZA 4D26A 2RGNC 5JSZB 2ZJ8A 2Z4SA 2LKCA 2ZXUA 2XZOA 3KUCA 3OFND 3K70D 1L4UA 4Q7MB 1Z47A 3ND9A 4GOJA 4TL9A 1BMFD 4FMCB 4NDZA 2YKGA 4UKDA 2VA8A 2ZIAA 3IEUA 1DARA 4HUQA 4DSNA 4D4LA 1KMHA 4AYWA 1R0WA 3GEHA 1N6LA 3QUSA 4D2IA 3BRWD 1T6NA 3NVAA 3QKRB 1G6HA 2FMXA 1XTRA 2BDTA 4QG7A 5FL7A 3U5ZB 3ASZA 5BN5A 2IHYA 4G5SA 3A1VA 3K0FB 3EARA 4C0LA 1KJYA 1TMKA 4CDGA 1NY6A 3WMEA 4Z1MD 5B57C 5F9FA 1E79D 1KKLA 4KSBA 2GF9A 3NH9A 3VX3A 2VF8A 1EX6A 3UG7A 3QXCA 1XD2B 4GZLA 2HF8A 1IQPA 1OIVA 4PSVA 1QVRA 1FQKA 4TTRA 1U9IA 2YOGA 1YR9A 3THWB 4OI4A 2BM0A 3QOFA 4HAYA 4BECA 1OXUA 1TL7C 1KO1A 2H7VA 3AF0A 3B13B 1X8LA 3LNCA 4HZUB 4JT4A 3ZZUA 1GL6A 4KU4A 3NH6A 2AWOA 2BVNA 4Q9JA 1JEDA 1YRAA 1EGAA 2EVWX 3TUJC 1UBCA 2V54A 3FKSA 3K0AB 2YJTD 5TV2A 5E7IA 3TW8B 2GF0A 4RSGA 1M1YE 2C95A 3K1JA 5FTKA 1CRPA 5CB6A 121PA 1HY3A 1SKYE 1TU4A 4NYMQ 4QXAA 1S4QA 4BRWA 3NXSA 3B1WA 1KI2A 2F9LA 2QL6A 4EJSB 4JBYA 2WWHA 3AM1A 1IN8A 1G3IA 1U8ZA 3PEVA 4MKIA 4PPNA 1FP6A 4A2WA 1I4DD 1JECA 3N2IA 3ZH9B 2ZROA 3FPAA 1IBRA 4BLRA 3L0SA 2ONJA 4JVNA 3H4MA 1UEIA 4A92A 3RDPA 1JPJA 2HJGA 1G8YA 2QPTA 4B75A 2OCBA 4HLUC 5HPYB 4WVFA 4FWTA 2PT5A 4Q9HA 5KU1A 4M22A 1XPUA 4RKFA 4RZ2A 3AP1A 4PTLA 5HR5A 1LS6A 4LCBA 2OZEA 1G16A 3GCGA 4O2LA 5JRJA 4MITA 1P72A 1AKEA 3EXAA 3FOZA 4HUQB 2PL3A 1KMHB 4LPSA 1N0WA 3T34A 1TU3A 3I32A 4B3DA 5EXTA 2VSXA 4HAUA 4KHZA 1G3UA 4URXR 2Q3MA 4ITRC 3MSXA 4MDFA 4Q7KA 1TADA 3VFDA 1AS0A 1N5KA 2EFEB 3SN6A 4LY6A 3I8XA 4OI2A 4LC0A 3THYA 1ZBDA 2AXPA 2BMFA 3GJXC 3LRPA 5EZ5A 2ZAOA 4FCVA 4PSAA 1AN0A 1KI7A 2ZITA 4TT3A 1OLOA 4A1FA 3VKGA 3E70C 3CPJB 4AG5A 1XJQA 2V7QA 3UWKA 1Q20A 2C9YA 5FUWA 2ZUCA 4Q1DA 2KJQA 2QP4A 3K9HA 4JSTA 5F2EA 2O8FA 4C0SA 1EXMA 3MWKA 3Q5EA 2OXCA 1JJVA 4B3GA 3W6PA 2ZJOA 3QXJA 4OK6A 2IS1A 3AKEA 3RS5A 1LFDB 1NG9A 1ZCAA 4AC9A 4QHSA 1NKTA 1NP6A 1NIPA 3QVUA 1Q22A 4QNMA 2DCUA 1YQTA 2OE2A 1GITA 1ETUA 3TSOA 1E98A 1NN1A 2PLRA 4TMWA 1E1RD 1S96A 2DY1A 4L5BA 3SDZA 3TIFA 2WMNB 1PV4A 2IK8A 1OFTA 2ZI3A 5JJKA 5FFMA 2Q6TA 3GJ0A 4XWAA 2P65A 2HT1A 1UKYA 2IYUA 2ZYVX 2J0UA 1U8YA 2RHMA 1YZQA 2G88A 3RHFA 4MUAA 1T3LA 3MJRA 1S9HA 5KO2A 1A2BA 1ZYUA 1G7SA 4RD3A 4UXIA 2QENA 4Q4AA 3ADDA 3KJIA 3ZVRA 4UQOA 4DCSA 2D2FA 1EWQA 4R2HA 2W0SA 1SXJE 2QMHA 2CK3D 3BH6A 3CF0A 1VCMA 4L9SA 1IONA 1N5IA 5J4HA 1F2UA 4A36A 1M7HA 2BJVA 4FMCF 3I5XA 4EQ6B 1W0JD 4DXAA 1BOFA 3WP0A 5BWMA 2JLYA 2ZRNA 5FH9A 3WNDA 1P2SA 2BBWA 1ZINA 2IYVA 3FHOA 5G3ZA 4G5QA 1KMQA 4E07A 1SVIA 1T5IA 4GL2A 4F4IA 2FSIA 5HKKD 1LB1B 1X1SA 3LAWA 2ZRCA 4PFSA 1W47A 1XCPA 2D74A 2WAXA 3QXXA 2B8TA 2JDIA 2QAGA 2ZVQX 2MSCB 3P27A 3A6PC 3THXB 1E4YA 4BFWA 2V3CC 4UXHA 3KQHA 4A2QA 3W6NA 4XD7A 2UZ3A 4TLCA 1G8FA 5TMPA 2VHCA 2BMJA 1CF4A 1DO0A 1S3GA 2ZRHA 1ODFA 4JMPA 5KNCA 2G6BA 1VCOA 2J5XA 2IS6A 4PZZA 3RWMB 2ZR0A 3X1YA 2O8FB 1ZM2A 1IY0A 1VMAA 3B8HA 4AWXA 3JVUA 4JIMA 4E5UA 1Z0KA 2GWHA 3TW4A 1VIAA 1E9SA 4ZCMA 3CRQA 3TBKA 2HUPA 4DLWA 2CLDX 3SJBA 3THOA 3CNNA 3ZVLA 3BD9A 1G17A 2DWOA 1NMYA 1P60A 4PC2A 1XTQA 3HU1A 3ZVMA 1WRBA 2FSGA 3GPLA 5FL3A 3KDSE 1KI8A 3DDCA 2D3WA 1UBFA 2IWRA 3UMFA 3PUYA 3AF1A 1U94A 4D0LB 2PH1A 4C9BA 5UKDA 3ZS8A 4B2LA 4P3YA 2W2XA 1Q57A 2J0UB 3IHWA 4CEHA 1GTVA 1F48A 1IN6A 2A5JA 3GLIE 1Z6GA 1G5TA 5K8LA 1GKIA 1Z5ZA 4BZXA 4B3CA 2AWNA 4TQAA 3C15C 4DZZA 1N5LA 1NRJB 1II8B 1EFRA 1JR3D 4NYMR 3NDBB 1Z22A 2WJJA 2KI5A 2QI9C 3EPKA 1P3JA 4PC7A 1MO3A 1AGPA 1KI9A 4R98A 1KZ7B 2ODNA 4LV5B 4BGDA 1U9IC 5FI0B 2WV9A 3O8CA 3D8BA 1B0UA 1F2UB 4XTCS 2IS2A 2PX3A 2OAQ1 3R9XA 1ZM7A 3DL0A 2ZRJA 2GCOA 2W0MA 3B1ZA 1T8UA 4J0QA 5TARA 4CIDA 1J7KA 3H1TA 2QM8A 1QHIA 3GLGE 2HCBA 3F3YA 1KNQA 3A4LA 2HLDA 3MRSA 4QGHA 621PA 1G7TA 4YMSA 4F38A 2BKEA 4X8OA 2DB3A 2C5LA 1W2HA 4PO8A 2HYDA 5FBLB 1R0XA 2FZLA 5JI3E 2Q0HA 4O3MA 2PZFA 5IHPA 1P9NA 2R62A 4DUGD 2PEYA 3B1VA 2R44A 2QY9A 5FPTA 4QC2A 3FHCB 1NBME 2GKSA 2OO7A 2ZJ5A 1OXTA 2Z5FA 3VR3A 3X2SA 1GNRA 3IQXA 3MGCA 5FOWA 3NC0C 5EP4A 3F5FA 1PLJA 5EZ6B 1JBKA 3PFIA 1D9ZA 4LGMA 3FE2A 1XEWY 5JLJA 5JHHB 2UVQA 4IEEA 4XSHA 3AVOA 4DLUA 2FFAA 4G5RA 5FTJA 3LXRA 5EP3A 1SXJA 4POAA 3CNOA 4CRWB 4BFZA 4KAXA 1XEXA 2JJ1D 4M9ZA 1E4VA 3PCRB 2CBZA 3X1DA 4GI7A 4ARZB 4TYNA 4DKXA 2CEAA 2YWGA 1Q1BA 2F3TA 2R8RA 1A7JA 2P6UA 3U60B 3QF7A 4U02A 3SJZA 5F3WB 4PAMA 3KFXA 3LLMA 3HU3A 2O8EB 5KDDA 2QTFA 2DHRA 1US8A 1RJ9A 1KO4A 2H57A 1DADA 4AYTA 1WMSA 3GJ3A 4MYTA 5L3QA 5JBQA 2EYUA 2ZRMA 5FR2A 3BFKA 4UXJA 3GLFB 1IN5A 3RRZA 2OILA 3BFXA 3OFNA 1PJRA 2FG5A 5J5CA 2QPAA 3HR8A 2LCFA 4PPQA 1XJ0A 2N1BA 4H9GA 4DCVA 4HLDA 4DDWA 3QI2A 4Q03A 1E6CA 4ZO4A 3WYFA 5LD2B 4TLAA 4JLAA 4CEIA 1UBEA 3U7FB 2GHIA 5GADl 1VG0B 2GCOB 4EPRA 4LJ6A 1C9KA 2YOFA 1KJWA 4FINA 1L4YA 4XWOA 2LKDA 3QY0A 4PHTA 1GRRA 1XX6A 2CCKA 1NG1A 2G0NA 4JVMA 4Z1MA 2L0XA 3ADBA 4GBMA 3X1XA 1E79A 2OLKA 2V6IA 3CM0A 1YRBA 3BORA 4JLMA 5EE9A 4FCTA 1HE1C 1BS1A 1G5PA 3U3JA 4DLRA 1FTNA 4Q1AA 5F98A 2NO0A 4ABYA 3BC1A 1E2NA 2WPDD 2CE7A 4OK5A 1HT2E 4KVGA 1Z83A 2MMGA 5EP2A 2OCAA 4RFVA 1SVOA 2AD1A 2OG2A 1OV4A 3GLIA 2WM9B 4KFSA 2ATXA 4B6FA 4IFEA 2QTVB 5J4LA 4HAXA 5KSOA 2GAOA 3T06B 1ONBA 2GZHA 3GLHE 2ZS9A 2EWWA 2CHGA 3OIUA 4QGGA 2D7DA 4C7OB 3B7GA 5SZKB 2QROA 4MGZR 4RKEA 3LBNA 1K6MA 3I4LA 1A4RA 3R9IA 5A0FA 4Q1BA 3WY9A 3ZZTA 1KZGB 3FDIA 5KSYA 5FPKA 3LBIA 1DOAA 4CGZA 4PANA 3OF5A 4JLOA 3P26A 4PHGA 3UMRA 1ZNWA 1AQYA 4XTRA 1RJ9B 1P62B 1HTWA 5HZKA 2GXAA 4ILEA 2QAGC 1VIYA 2FN4A 5L3QB 1M34E 5LPNA 1XWIA 2E9SA 3K53A 3QBTA 4KYUA 4M1OA 4P31A 4QRHA 1E2EA 4LHYA 1YU9A 2XX3A 4CW7A 1Y63A 1U90A 2AFIE 2ANCA 3LQQA 2GAAA 2KB0A 3QKTA 2VP6A 5HE9A 3NIBA 4LBVA 3C4JA 4FD2A 3RSOA 3TQFA 3OZXA 1OT3A 2AK2A 2XITA 4TLBA 3KB2A 2BWJA 4GOXA 3VQTA 3U3KA 4NYJQ 2F1RA 3VKHA 3KKMA 4URYR 2XXAB 2FSFA 3AVXA 1W44A 2QNRA 3BXZA 4PQFA 3MWLA 5J47A 1QDEA 4IKEA 3ZVNA 2WIBA 3QJYA 2N46A 3SJAA 4BFXA 1UDWA 4B33A 2XB4A 1W2GA 3D3QA 3FFBA 1OHHD 1FUKA 1KDTA 2VF7A 4LSGA 5AUNB 4ZPXA 3RWOA 1CULC 3GJ8A 4DC9A 2REBA 2WWXA 1Q0UA 3U3MA 2JLVA 1NLFA 2FU5C 3NBXX 3RS0A 2GCNA 1N6OA 4B35A 5BYJA 2HYIC 1RRGA 3BJIC 2WJGA 4AI6A 5JI2E 2BEKA 4FMBB 2JLWA 1P2TA 1TTTA 2P3SA 2XB2A 4KSCA 2VHUA 2NO9A 4NZYA 4ACBA 5JEDA 4W5JA 4ZKEA 2XTMA 5JJIA 1WE2A 1Z28A 1QHHB 2PBRA 4Q19A 4EIWA 2DBYA 3HWSA 3PQCA 4HDCA 3CKLA 2QRNA 3R8FA 1COWD 5EE1A 3EWSA 2O5VA 2PLFA 2QZ4A 5GJCA 1VG1A 1LV7A 1XDBA 5LD2C 2FE4A 4RD4A 3W3ZB 3GJ5A 5F9HA 2A5FA 2OHFA 3O8DA 1D2EA 1GVNB 2WJVA 2ZJAA 3ZQ6A 1XJCA 1JAHA 3DM9B 5LB4A 1NVWQ 2UKDA 4F4CA 2OBNA 4LJYA 2OM2A 3TSWA 1R0ZA 2BIFA 1U8AA 1J90A 1SVWA 1CJKC 4OJQA 2I3BA 2ZRPA 1YVDA 2F43A 3H0KA 1D2MA 1G8PA 2DWPA 1NI3A 3FMFA 4NONA 1DAMA 2J59A 2B92A 2VHQA 4HDQB 1E96A 2CJWA 3T5DA 4MGIR 2JLUA 2CK3A 1JXOA 4I99A 1UEJA 1QG2A 5FPHA 4O0MA 4GOKA 1HEIA 1OFIA 2G0TA 2FDCA 1ZIOA 1R4AA 1II0A 1W0JA 3O47A 4RD6A 5G40A 4KFTA 3EPJA 2ZE5A 3ZYCA 1NJFA 4TSFD 3FFAA 5FUXA 2ZU0C 3A1SA 2D7CA 4RCYA 1FP7A 2AKYA 1XZQA 2VTKA 4IVQA 3GJ4A 4Q02A 5CYPA 1EFTA 4Z54A 2A78A 2E1RA 2ZYUX 4IDPA 4TN1A 1TQ4A 2DFLA 5HKKA 1FW6A 4QHTA 3ICEA 1SXJC 1CR4A 4QBFA 1LVGA 4ZI3A 1MO6A 2XJ9A 3U7GA 4FIDA 4EFMA 2WVJA 1C1YA 3PIRA 4N1AA 5DYIA 4AD8A 3EPHA 4M1SA 3CF2A 3AVPA 4ESVA 1GIAA 1U81A 4JKYA 4DVGA 4JLPA 5BQ5A 1WP9A 4TZ6A 3I72A 4JVLA 3G0HA 3NEJA 3B1YA 4RY2A 4HI0E 3CF6R 1XB2A 3LX5A 3IEVA 1E9EA 1GKYA 2B7BA 4FW9A 2XTNA 1WBBA 2X8AA 3AB3A 4QFMA 4TLEA 2UZIR 1VG8A 4OHXA 5CITA 4NCIA 3T5GA 1A82A 2BCGY 3NEYA 3ZD7A 2QTHA 1S2MA 1S8FA 4LHVA 5SZHB 1WCV1 3EA5A 3W34A 1Z0DA 3CONA 3PUZA 4F7WA 4XWKA 4DDVA 1QHGA 1S0UA 2PX0A 4NH0A 3K70C 5KYKA 1OH7A 1N25A 1KIMA 3DM5A 5CIWA 3U3RA 1F3OA 4JLJA 3FWYA 4JS0A 2QAJA 1HE8B 2GETA 2C9CA 1VYTA 2ZI6A 3FB4A 3SOPA 1AS3A 4I1OA 3T35A 1ZRHA 4C0JA 2C77A 1SVLA 3I5YA 3HYTA 1FUUA 4GMXA 3W5JA 4UJ3A 3CX7A 1UJ2A 2IA5A 2YV5A 4KBGA 4R7ZA 3MMPA 2ZE7A 1A2KC 4NMMA 2WKPA 1DBSA 4FMDF 4MDEA 4OK3A 4JLVA 4LI0A 2BJWA 2F43B 2QORA 3SHFA 3DVLA 1Z6XA 1JR3A 3AQ4A 4A8JA 3CX8A 2J0QA 4KCGA 3TNFA 3D7MA 1FMLA 2RGAA 3IIMA 5KDLA 3VR2A 5CDFE 5KPJA 1SVSA 2P6RA 1QF9A 3TVDA 3SC3A 3JZAA 1BYIA 1G6OA 3IBYA 5H1YA 4DB2A 4HZIA 1XBTA 1G8GA 1T5LA 3W9YA 2P5TB 1GUAA 3M1IA 4LBWA 3PUXA 1W36D 4TMVA 5JHGB 2J87A 5FBWB 1E2GA 2XJ4A 3E5HA 2GILA 3HP1A 3LVRE 4R2IA 3IO3A 2DR3A 1W4AA 2JLRA 2FA9A 3LVQE 3VR4A 2ZRLA 1OPXA 4HB4A 1G18A 4P0TA 4Q1EA 3KUDA 5AJVB 3PUWA 1XMIA 4A0FA 1G20E 4DUGA 4QBGB 1KK2A 1D5CA 2Z4RA 1J99A 4KV9A 1TX4B 4AYXA 2G1KA 5DHFA 2RGGA 4B3BA 2GVZC 1KI4A 1KY3A 1Z8FA 4NCHA 2X2FA 3SQWA 1PUIA 1AQUA 1CR1A 1E0KA 1YR8A 3EIEA 4LC1A 2QQ0A 3IIKA 4UJ5A 2HV8A 2SHKA 3I1FA 4NYJR 4D82A 3L0IB 3QSYA 5H70A 2RGXA 1GWNA 1T8TA 4IDQA 3TH5A 3RRYA 4DSOA 1UKVY 2PCJA 2WJYA 4XIGS 1RKBA 3GEIA 4JT2A 5GJWC 3IPYA 1KY2A 4XH9B 4Y0AA 3CRW1 1GRQA 2JJ1A 4QM6A 1PLKA 2GZDA 1YZGA 1O87A 3DEFA 2FPMA 1T9HA 4N0EA 4JJZA 3A1WA 4TL7A 4B71A 3R9WA 3S1AB 3SQXA 2NPIA 1ZNYA 1UF9A 2VO1A 3BH7A 4OQLA 2ZETA 1KO7A 2KWIA 4PQYA 4Q9LA 1KTVA 3A4NA 1CTQA 2WWYA 3MLEA 1NBMD 1N6IA 2IEZA 2QT0A 1X86B 4IW3B 5BN4A 2NZ8A 4FI3C 4AKGA 3AGQA 3VR1A 3Q7QA 1H65A 1M7GA 4PR0A 2H16A 5DIFA 1ZCBA 3SEAA 2ZS7A 2AK3A 2ZANA 3A1TA 4LX0A 4Q01A 4OHZA 1P2VA 2GXUA 5AJZA 4KVAA 5E95A 2IXFA 4C2TA 3RLFA 4MGYR 1AA9A 1IOZA 2CVHA 2IYSA 1TPZA 3O8RA 3TR0A 1PLLA 4A4DA 1Q3HA 3DZDA 4M1MA 5FBQB 1CJMA 1X6VA 4OQNA 3UK6A 4OI1A 1P73A 5KOYA 4CVNA 4A9AA 3QPVA 2ZM5A 2XEXA 4B3FX 2XGJA 3L0OA 4US1R 1XMJA 3DO6A 1ZM4A 3ONWA 2ZRIA 3VMFA 1WB9A 1E0JA 4CZ2A 4WXRA 3TGPA 2WPDA 4CT5A 4P4UA 3KB1A 4I1SA 3KKOA 3MUFA 3TR5A 3PVSA 3AKYA 1XNJA 2EW1A 2IEYA 1G7CA 3TUIC 1L2TA 3QXHA 5HTKA 3U44A 3SFVA 1QHNA 1KDPA 3OIYA 2VH5R 2B6HA 2NOAA 3IILA 2P0EA 4Q48A 2AR7A 3ZD6A 2JA1A 1XPRA 1QHXA 1DAFA 1YKSA 5CDFA 3AP2A 3RS4A 2YWHA 1N0UA 4PAQA 4WA7A 3DOEA 3T12A 3KXIA 1EWRA 1KK0A 1B23P 4EPXA 1FPMA 3SYNA 3UWOA 1E9AA 1ZJ6A 4WAUA 5DN6D 4AIIA 4AKIA 4LJAA 2OEPA 2XZPA 4LJ7A 3I3SR 4MA4A 4PPFA 1AM4D 2R9VA 3I92A 5LB2A 4BQSA 4NYIR 3VHLB 1AGRA 1NF3A 2GEUA 4NCJA 5FBRB 3T61A 2GK6A 2P67A 4Q9IA 2HT6A 2NPFA 3K09A 2J3EA 1OJLA 2GK7A 3ADCA 2D2EA 2A3RA 3MFYA 1XRJA 5EE5B 2RGCA 2V1XA 2H18A 5JCPA 1E9RA 3MJHA 3ADKA 2WWIA 1N6RA 3CB4A 4US0R 1XCGB 2P5SA 4XJXA 1RRCA 4KFUA 3L82B 3BB4A 2D4HA 2WWGA 3QPUA 1XXHE 4MH0R 2WSSA 1IXRC 1T0JB 3OAAD 3Q72A 2YOHA 1FOEB 4K46A 4BEJA 2RGDA 2BHRA 1X1RA 1KDRA 2GJ8A 5CYOA 3GJ6A 2QEQA 2RKOA 5EE3A 2VEDA 2NO6A 1KI1A 1S1CA 3LD9A 3THYB 1U0JA 3EIQA 2FSHA 4AY2A 4M1KA 1HYQA 2EFHB 2P2LA 1R5NA 1OHHA 2C78A 4BFSA 4EFLA 2IC5A 1RYFA 1UM8A 3EC2A 2HEIA 4JYBA 3RS3A 1YZUA 2CL6X 1OKKD 2OV2A 3LDAA 4Q4JA 4WBSA 4YDSA 3BH0A 5DO9A 3U7HB 4M53A 1YE8A 2ZJYA 1ZUIA 4GP6A 2W58A 1ZIPA 4BLPA 5CB8A 2J9RA 1TQ6A 2ECKA 3TVTA 5HZHA 2WZQA 1VTKA 1ZUHA 1Z0AA 2FOLA 2PCLA 5EUQB 5FPSA 3RS7A 4B48A 1Z07A 4DHEA 3FGNA 2AXNA 1GG2A 3CO5A 4A8JC 4P4SA 1COWA 1NIJA 2FPKA 2ZE8A 2FX3A 4YQFA 2JJ2D 3U6BA 4D25A 2A5YB 2PJRA 1P75A 1KAGA 1WF3A 1NVXQ 1N6NA 2FGKA 3NDPA 4GZMA 4MQBA 8OHMA 4A0RA 2JIZD 1G19A 4W5HA 1WBDA 1FTSA 4DB4A 4DT1A 2JEOA 4PSKA 3QE0A 2CXXA 3TE6A 2NO7A 1XP8A 4Q4AB 1J8YF 1AKYA 2C99A 2FEOA 3PXGA 3QIAA 2LWIA 3W8NA 3ZGXA 2ZRAA 4BLQA 4H1UA 2R6DA 2GCPA 2DYKA 2J41A 1MV5A 2IYXA 4K8OA 4TL6A 3FYHA 4PZLA 1HQYE 4U00A 1EX7A 2WIAA 3PEYA 2VP4A 3CPHA 3F0TA 5CIQA 4W5WA 2D06A 5L8VA 4TSFA 1Q12A 4B2PA 3L0PA 1OH8A 3CW2A 1SKYB 1MRSA 3OIWA 3UKDA 3TMKA 2ZRDA 2C04A 3QKSA 1YZKA 3TUZC 2JLZA 2IUSA 2QAGB 4M4SA 3RRNA 4ERNA 4QKQA 1MO4A 3HR7A 1R10A 1NSTA 2JLXA 1EFCA 1TUEA 4ZDJA 5DI3A 2AL7A 2ERYA 4YLGA 3IDQA 4U5XA 3WNBA 3Q5DA 3SFZA 2FFQA 2C03A 1OYWA 1M2OB 2CMKA 2JLQA 3BB3A 5EXPA 2QP3A 4DCUA 3V4RA 4LYAA 3L8ZA 3B82A 3DKVA 4A2PA 4O25A 4Q4JB 4Y0VA 4X8LA 1Z08A 2QA5A 2GJSA 2VP0A 3A36A 1G291 5AR1A 3TAHA 4R71A 1AZSC 2PJZA 1KI3A 1E1QD 3MG9A 2W6JD 3K0EA 2CLSA 5IT5A 2G1JA 3VU9A 1NVVR 2QT1A 1AZTA 1QHYA 4DRZA 2ZI7A 1JJ7A 1GFIA 1RZ3A 1UADA 1DE0A 1OW3B 4IVRA 4RZXA 2ZAMA 3F8TA 3KXKA 3LW8A 4NCKA 1GNPA 4OYHA 3T1OA 5CK4A 3MD0A 1P7CA 6Q21A 4RZ3A 2OT3B 2BCJQ 3EWAA 1E32A 3KJGA 3T1QA 5HCNA 2ZRFA 3RNLA 3ZIAD 4Z51A 3FVQA 2ORIA 5EP1A 5H8WA 1L7VC 2CCGA 1LTQA 5CLLA 3U3OA 4AG6A 2PMDA 2B21A 4BUJA 4CEHB 1RYHA 3OESA 3QEOA 5B58C 4OHWA 4QBHA 1VECA 4LJ8A 4B3XA 1NNEA 1DTSA 4D0NA 5C18A 4HUTA 1DG1G 2N42A 1JNYA 2FH5B 2NGRA 1E99A 1QVAA 1BMFA 5DI9A 2X77A 2KSQA 4U7DA 2DFNA 2REXB 5JWHA 4B6EA 4ZIRA 1IAQA 1OIWA 3EZ7A 2ANBA 1OXXK 2F55A 1DAIA 1JQLB 1Q1QA 1TEXA 1F5NA 4IJMA 3ASYA 4MYHA 1E2LA 2BOVA 5FOTA 4ACAA 4QOSA 1LS1A 3SE0A 5CM9C 1E9DA 3QG1A 4HAWA 4L15A 1N6KA 2IYRA 3C41J 3B85A 4Q4HA 3Q3JB 4B2IA 4S35A 5KTYA 1SKQA 5DSZA 3OEHD 1Z29A 2CHVA 2J0VA 5JWOA 3AVTA 1E3MA 1OYYA 1GM5A 1E2IA 1XTJA 2ZR9A 1TQDA 5KDOA 2FPLA 3REGA 4DLXA 1WQ1R 3ZQJA 1TUIA 2XNDD 4YONB 4D4KA 5FTNA 1CXZA 5LBIA 3CUEF 4MUBA 2R6GA 1G64A 4WZ6A 4YXWD 1VPLA 3U7EB 2F1IA 2ZVPX 1OFHA 4ZDKA 3ICQB 1SXJB 2WHXA 3VU9B 3IO5A 1UDXA 4LV6A 3K09C 1FL9A 1XEXB 5CJPA 4F91B 2BMEA 1RE0A 1P61B 3L2OB 2CDNA 1MR3F 4N3NA 2WKRA 1V5WA 3GLGA 2F9MA 1VKJA 5SZJA 3C14C 3M6AA 2WTUA 2HF9A 4II7A 4LV8B 4C0KA 2HCJB 1UKZA 2RAPA 3EIHA 2WOOA 3MCAA 2F1HA 2Z83A 1US8B 4LZZA 4Q21A 2R2AA 2ZRBA 1KJZA 3GJ7A 1OIXA 5KNDA 1MABA 1E2KA 2QQEA 2ATVA 2O0HA 4QJ5A 1E9CA 1G1MA 1Z06A 3BK7A 3WBJA 1TQ2A 4MKHA 1NBMA 3K70B 1RRPA 5EE0A 4ZV4A 4B76A 4BZQA 2W6ID 2W83A 2J1LA 4PC1A 5JEEA 4JLKA 3TKLA 4ZIRB 5ELXA 1G4AE 4BLOA 4CEIB 3TQCA 2ZPTX 5G53C 3N70A 2IWHA 4OKSA 3AV0B 1NN5A 3RANA 4I1VA 2TMKA 5TDHA 4DEXA 4Q9KA 1KI6A 1P9RA 3DMNA 3KJEA 4DDUA 4M9XA 3VKWA 4KJZA 4N0DA 5FOUA 1W36B 4W7SA 3CX6A 4IOLA 4GPTA 4Q4HB 3K9NA 4KYIB 4LJ9A 5J40A 3AF2A 2WMOB 1YZLA 2ZI4A 3FMPB 3P1JA 2I1QA 2CVFA 3H2YA 2ZJBA 3U6KA 3E2IA 5AJYA 2OXRA 2IUUA 3GFPA 2A5DA 1DAEA 2ZREA 2C2HA 3GQBA 3B5JA 2VHJA 1Z3IX 1LF0A 2DFTA 2VBCA 3EPLA 3SNHA 3UMSA 4MRPA 3GLIB 2GA8A 1EFUA 2H8KA 3LX8A 5E7JA 1W4BA 2QGNA 3SBDA 1WDTA 4LYHA 3LBHA 1GP2A 1PZNA 1BKDR 4RFSA 3KQKA 1SGWA 3L8YA 4YMTA 4M1WA 4LUCA 3BE4A 3GFTA 3L43A 5L3VA 1Z0IA 4HLQB 1G4UR 3FHTA 3KJHA 2VP9A 2WWFA 4TMKA 4Z8YA 3IHLA 4DLTA 1X3SA 1T3HA 2YVUA 1MH1A 1W48A 1E1RA 3CZPA 3FMIA 5C4GB 3RC8A 2JLSA 3GLGB 4D81A 3CWQA 4JKIA 2Z0MA 1GNQA 2IF0A 3AUXA 3IKJA 4MRNA 4NCNA 4P32A 5D3MA 2QPOA 4M1TA 4URVR 1ZVQA 4RZUA 4G5OA 1JR6A 3A37A 5DN6A 2ZRGA 1W49A 2AN9A 3X1ZA 2ZI9A 3ZS9A 2OBMA 3W90A 4LHXA 4X8MA 2QRZA 4JBWA 3VX4A 1DPFA 1MRNA 3PJRA 1DAGA 5EQTA 421PA 2VPPA 3KTAA 4JLDA 3EC1A 2NTYC 2ZI5A 2OFXA 2Q9BA 2FFBA 2YYZA 2YWEA 3RAPR 4E09A 5JSZA 3QVVA 3SS8A 2OBLA 4B43A 1AIPA 1ZU4A 2YNMA 4V0LA 1ZM3A 1YZTA 2RGBA 3Q9LA 1Z63A 2CHQA 3TAUA 2OFWA 1SZPA 1DVRA 2Q3FA 3NHBA 1R2QA 4TMXA 4FXPA 3OAAA 4TZ0A 2QE7D 4P4TA 1T91A 2GXSA 3GLHA 4YMWA 2QSYA 1KI6B 1E0AA 2QSZA 3V4FA 3SR0A 3ND8A 4XSGA 2W2TA 3K0FA 1JQJC 2QBYA 3FMOB 1W0KD 2AD5A 5TB5A 1GKUB 4DEYA 4AK9A 4BWYA 2C98A 1LY1A 3AVVA 1DAKA 4AURA 4URUR 3ZZ0A 4LBZA 4EPTA 4Q1FA 5B64A 3FKQA 1XD2A 4Z8XA 5BN3A 4HSEA 2NO1A 2DFKB 3NHAA 4NYIQ 1OKKA 2VIIA 2X1VA 4ZDWA 4NTZA 1NMXA 1J8MF 4V0KA 1CR2A 4DIEA 1HQCA 2IYZA 3IGFA 4D80A 2IS4A 4C3ZA 2A9KA 4RVCA 3EW9A 2CCJA 3DMDA 2GJAA 1ZMXA 3P4YA 4YMUA 4LJ5A 4RFSB 3LFUA 2IXGA 2P6NA 5EJEA 1ZW6A 4RD0A 1OB5A 4HB0A 1OSNA 4TWZA 2GJKA 1YR6A 2GXQA 1G7RA 2ZS8A 4EPVA 4AKHA 3ZJYA 2NMVA 2VL7A 5GJVC 1IM2A 2EFCB 3BWDD 3CLVA 3AVYA 1Q1ZA 2JJ2A 3U61B 3Q7PA 2BM1A 2G3YA 5K8UA 1S3SA 3LV8A 2JIZA 4PO9A 4Q1CA 1W5TA 1UAAA 5JJLA 1XD9A 3KKNA 2ZU6A 4LDJA 1W36C 3C5HA 1G3QA 2GVDC 5AJWA 1JXMA 3K9LA 4ON9A 3BB1A 2EFGA 2CJWB 3X1WA 5L3RA 4GSYA 2VRWA 3WMFA 3KTAB 2V9PA 3RVBA 4DLSA 4MRSA 5EUMA 1IN4A 4OHYA 1TEVA 2FJUA 1Z6YA 4P33A 4ZI2A 3IQWA 5AWFC 2Q9AA 1KNXA 4MKFA 4V03A 1J2JA 1ZD9A 1RW4A 2ODEA 1Z2AA 3I73A 1CP2A 1FNMA 3PR1A 1XZPA 2RH5A 1CKEA 4QHYA 1V43A 2CL0X 3O8BA 2O0KA 3KL4A 4M9QA 3GLHB 1DELA 2WKQA 2J7KA 4PO1A 3DOFA 1I2DA 1GL9B 1QG4A 4PC3A 3CRRA 2GEVA 4ZCIA 2QBYB 4IXMA 3WYGA 1JPNA 4B74A 4WIAA 3QNUA 5J4YA 2IYYA 1T0HB 2WBLC 2O8BA 5FUYA 3VNVA 3BFVA 2EYQA 3RC3A 821PA 2GBLA 1RVDA 3B6EA 5C46F 4GRAA 4TYPA 1C4OA 1VHLA 3SYLA 1VYVA 2QGZA 1G9XA 1VG9B 2B7CA 2ZEJA 1E2QA 4YDHB 4LHWA 3KX2A 4ASUD 2MSDB 3AH8A 2ZSFA 4PC6A 3DZ8A 1CRQA 4AKEA 4TMZA 4GNKA 3GP8A 3RYTC 1E1QA 2W6JA 4XVQA 4LWZA 2PZGA 3NC1C 2BC9A 1T4GA 5FI1B 4NP6A 4IVPA 2CLCX 3ZDQA 2VP5A 1XFAA 1NN0A 2Y8EA 3VAAA 2EQBA 2O52A 1F2TA 2R65A 1Q3TA 3IPXA 1VHTA 1A5TA 3QXSA 3H86A 4KLNA 4UNPA 3N2EA 4V0ME 1PUJA 4RD1A 3ZIAA 3DPUA 3I62A 1HT1E 4OHVA 3HU2A 4E03A 1BO6A 1DS6A 4WZAE 1QRAA 5KNBA 1AJEA 5G41A 2G9NA 5G3YA 5JS7A 5K8TA 2J46A 4I81A 2GRJA 3IIJA 4H1VA 2ZJZA 3WMGA 1M6NA 1CJVC 1Q21A 1W46A 4HB3A 4A8JB 4KITB 3T15A 1JEEA 4JVSB 3W6OA 2OSBA 3UG6A 2WAYA 3U4QA 1W5SA 1MT0A 3QQ5A 2ZE6A 2IX3A 3WRYC 3KQUA 2ZSBA 1IXSB 3CBQA 3QENA 2ORVA 5GJBA 2HJVA 1R5OA 2ZRKA 5D3QA 1XTKA 4TLDA 5FBVB 4FCWA 3WXMA 2XOKD 1NLYA 1NVVQ 2JASA 4EQ6A 4RJLA 1ELOA 4CYMA 1CLUA 1KAOA 2CE2X 1N3BA 2ZSAA 3TJZA 3DHWC 2GNOA 1ZUNB 2W00A 3OE7D 3LO5A 5BW8A 2REOA 3DKPA 4TQ9A 3OEHA 2E87A 4L4UA 3KKPA 5SZIA 2OCYC 4DBLC 3HJNA 2O8BB 3PEWA 1CEEA 4MKGA 3AGPA 3QF4A 3PUVA 4LYFA 1NY5A 1SVMA 1SULA 2J7PD 3KFVA 1W1WA 4OJKA 2G83A 1SQ5A 4CF7A 3GLFE 5BXQC 2ZTSA 3THXA 1KSFX 2XNDA 3VR5A 2D62A 3Q85A 4M8NE 4PHHA 1XTSA 3M0EA 4G01B 1SHKA 1IXZA 1U0LA 1M74A 1A1VA 3AUYA 4YXWA 1D6JA 1GILA 5JCZA 3QPWA 1DG3A 2NQ2C 1H8HD 2VSFA 1IJEA 3BAFA 4QGFA 5JMTA 1K8RA 2Q3HA 4PHFA 4URWR 5GVSA 1DO2A 3LA6A 1II9A 4MYUA 3TRFA 4A15A 3WYAA 4PZYA 5A5GA 2WJIA 5DISB 1F2TB 1XF9A 1NKSA 5C2JB 3LW7A 5KPDA 2MSEB 1W4RA 521PA 4QJ4A 1QHSA 3RRMA 1ZC3A 5FPYA 2IUTA 3GEEA 5EXXA 4JYCA 4ZDIA 1GAJA 2BKUA 2BBTA 3C7KA 5AUQA 3SYKA 3NBFA 4B73A 4XVRA 3NBYC 4A82A 1FQJA 5FTMA 3PITA 4MRRA 1NN3A 1BYUA 2YC2C 2QMEA 3SBEA 1HV8A 1E94E 1W4CA 1KGDA 3B60A 3N5CA 3VR6A 5JECA 5KHOC 4KI0A 4WXPA 5DH9A 2IHBA 3REFA 4C4PA 5M04A 1R6BX 1XEWX 4HEJA 2YINC 3KXLA 1N2CE 5FOVA 4F92B 3U4QB 3ETLA 2W6IA 4BFVA 2C8VA 1II8A 4BFYA 2WICA 5TY0A 1Z6AA 1KSJA 4V0OA 4D0GA 3NG1A 3MAAC 4EFNA 4XVUA 1TAGA 1KYIA 4BRUA 4A0HA 3CRVA 1N0VC 1WA5A 1H8ED 1E2JA 4BFTA 1VCIA 4WOPA 3W8RA 2RMKA 4IDOA 1ESMA 3K0SA 5IK2D 4A6PA 3AKDA 3OEED 3M4YA 2F3RA 1S9DA 4JL8A 4JJKA 4L8GA 4K81B 1JALA 1CBUA 3EZ6A 3EZ2A 2QN6A 1M8PA 3LWNA 3Q8XB 1S1MA 1KSHA 1XMSA 1G21E 4IDHA 3RS2A 2RB4A 2BV3A 2NG1A 4QJ3A 4V0MA 1W7AA 3QF4B 1QBKC 1MOZA 2IXEA 4KFRA 2OESA 1ZD8A 4MYCA 1GL7A 4DLYA 3PEUA 4EJSC 1RFLA 4DJTA 1OH5A 2CNWD 2BBOA 2GZAA 2C9OA 1MO5A 4HYYA 1X8JA 2RGEA 5KSPA 1UPTA 2GDJA 5K8IA 4LPKA 1U99A 2XSZD 3B9QA 4C0BA 4GDFA 2DPXA 2IYQA 3GD7A 4JZKA 3U44B 2WJHA 5IDVA 1R8SA 2QUZA 3VHXA 3AVQA 2PZEA 4NBSA 1TF7A 3EAQA 5J4VA 3P20A 1Z2CA 1P6XA 4B32A 1EFHA 2QG6A 1VCNA 1E2DA 1F60A 2V1UA 1ANKA 3AKCA 1MKYA 3BIFA 4PPGA 2G77B 3LXXA 4YC7A 5CJ2A 4ARZA 4L16A 4IHQA 2OCPA 1D2NA 3PV0A 4ESHA 4TTQA 2QU8A 2A7QA 4C0QC 4F4JA 4V0NA 1CJTC 2EFDB 5JZVA 5JS8A 1ZP6A 4DLVA 1OB2A 1EK0A 4UNNA 1U2RA 2W2VA 1FZQA 4D4JA 2ZSDA 2O8EA 2H5EA 1OF1A 2H92A 3EA0A 2Q9CA 4BASA 2MMCA 5DHAA 1KOFA 4EDHA 1UKEA 1NJGA 1F6BA 4Q7LA 2IT1A 4MGKR 4Q18A 2GBLC 3GLFA 2ODWA 3BBPA 4D6PA 3KQNA 2IBMA 2BBSA 2F7SA 2NZJA 2RHDA 3J81k 2PT7A 3WBKA 4JL5A 3TK1A 1D8TA 3K0CA 5FL7D 4M0LA 4DCTA 1YR7A 4IOJA 3C8UA 5CM8B 3BERA 3KQLA 3UANA 2QE7A 4JSYA 5DLQC 3IBGA 4LHZA 4A0GA 4B34A 2KBEA 4XOIA 4KLZA 4US2R 1OH6A 1VDZA 1W0KA 2H1LA 2R6FA 3EZ9A 2K5UA 4HB2A 2JCSA 4IOMA 2GEDA 1R5BA 5E3HA 1E9FA 4QNRA 2CL7X 4M1YA 3B2EA 2AKAB 1ZU5A 3CIOA 2XZLA 2O8CA 2O0JA 4DWJA 4NU0A 2QM7A 1XEFA 1ZNZA 3AEZA 4LOAA 1FX0A 1TF2A 2ODBA 1JAIA 1E2HA 4ZKDA 1E2PA 5JRZA 2VSOA 1HH4A 4PX9A 3FKSD 3QKUA 1RC8A 2GJ9A 2ERXA 1BIFA 2FEMA 5P21A 4NPHA 1P5ZB 1E2MA 1P4SA 4P4SB 4BZPA 4IFBA 5JFGA 1XXHA 2VYFA 4LBYA 4PXAA 3V00A 4UNRA 3WNCA 4EPWA 1U98A 5EXSA 1NMZA 4OQFA 4B47A 4D4MA 2PMKA 3NTUA 1G3MA 4M2LA 4DT1B 4C7OA 1JI0A 1G5RA 2I4IA 3PENA 4Q66C 4QL3A 2Q21A 4ASUA 4RCZA 1BH2A 1XMVA 2XAUA 1ESNA 3T1TA 4TYWA 2XTZA 1HA3A 3EASA 4KBFA 1GZSA 1EG7A 5AK0A 4OBEA 4GT1A 4BLSA 4BPBA 3JVVA 2O8DA 4RD2A 2WOJA 4FN5A 4GMDA 4EPYA 2R6AA 5C4MA 1NSFA 5FOXA 5B2ZA 5IRCD 2AFHE 4KO8A 4OQXA 1T3SA 1RIFA 4FWIB 1XU4A 4TYQA 3C16C 1XD8A 2J45A 3QKSB 2ZQ5A 4M9SA 5FR1A 3EX7C 1NLZA 5AJXA 4GP7A 721PA 1Y3AA 4IEIA 2YZ2A 2JATA 4Q4LA 4JLNA 5LDDC 1KO8A 3B1XA 2YHSA 5DI3B 1XPOA 1ZD1A 4LK2A 1KSGA 2RGNA 1N6HA 1R0YA 4QM7A 2XXAA 2X2EA 4LYJA 4WZBE 4Q00A 1UBGA 1OFUX 1VYUA 4DCNA 3CR7A 4TT3D 2NIPA 2O8CB 2AHOA 4DSTA 2V7QD 1FX0B 3ECCA 4PQRA 4TL8A 2V4ZA 2ZUDA 4LJ4A 3RABA 2RCNA 3WHKA 5H68A 4EUNA 1KHTA 2DWQA 1IJFA 3JZMA 4NKRA 1M7BA 3UPUA 2FZ4A 4UNSA 1K5DA 3BGWA 1QHHA 1XXHB 2HXYA 3I61A 2KE5A 3NKVA 3QBVA 5DYGA 1E0SA 2IYLD 4UNQA 1ZNXA 5KSZA 5C1BA 3C5CA 3TSZA 3R7WA 3A4MA 4URZR 2ONKA 3MWYW 3K9GA 3SI7A 4Q7JB 2WWWA 5CK5A 1ZC4A 5A4JA 4CEJA 4V02A 5HCIA 3GMTA 4TMTA 3AVUA 1DAHA 4OQMA 2A30A 1E69A 2ORWA 1ZM9A 1SVKA 2FNAA 4FMDB 2IL1A 2O8DB 1G3RA 3LH5A 2B8WA 3WRXC 2F1JA 3MWJA 5B30A 5FTLA 3A1UA 3RSLA 1Z0FA 3AF3A 3B9PA 1Z0JA 3SJCA 1CIPA 2HDNB 4TYYA 2VLIA 1AS2A 5KUTA 1GDDA 2OAP1 1CS4C 3U2QA 2XOKA 1RRFA 1IY1A 1WXQA 3GFOA 4DIDA 4G0NA 1CJUC 2BEJA 2WSSD 3BS4A 1OE0A 3CR8A 5E4FA 4A6XA 5CLQA 1U0HC 1R7RA 1TF5A 3KKQA 2I1VB 2V8OA 3HPQA 1ZAKA 3OE7A 3P32A 2JDID 4HLUA 4S2EA 1P2UA 2VHTA 3E1SA 1KDOA 4HAVA 4JLBA 1CU1A 1RPZA 1NVUQ 3EG5A 3AP3A 3AF4A 1J70A 3D6TB 1E2FA 3P4XA 3CH4B 1QZXA 2WSMA 4I1UA 1KO5A 4JL6A 4MRVA 2FWRA 1K5GA 4R9UC 1OXVA 2J7PA 4QBIA 4XD7D 1IHUA 1JR3E 3CZQA 4HLCA 2IW3A 1KK1A 2ZSEA 1Q44A 3TLXA 1DEKA 3EZFA 1OXSC 4HAZA 3V9PA 1NL3A 3I8SA 4KODA 3BOSA 1KKMA 1X8KA 4W9MC 2FV8A 1H8HA 2F6RA 4I4LA 2ZUBA 2AX4A 5IF9A 1FNNA 1EESA 4YMVA 2VP2A 1G41A 2IYWA 1XTIA 4TQUS 4IOKA 3VNUA 1LW7A 2QP9X 4IDNA 1YZNA 4IXNA 3SHWA 3H84A 3K0CC 2BMDA 3W5IA 1MABB 3IUYA 3R7WB 3G5UA 3SU8A 1I4TD 4GFDA 1GRNA 3UATA 1LNZA 4L9WA 3CWZA 4CEJB 5TXGA 2ZJ2A 3CRMA 1YJ5A 4M21A 5TVKA 5L3SA 1LF5A 3A58B 1JB1A
chains in the Genus database with same CATH superfamily
4HWKA 3HPRA 3IVXA 3AVWA 1GSIA 1O6CA 3INGA 4XCXA 2VG8A 4X60A 5I9NA 1GPH1 1YL7A 2A8YA 4HATA 4I55F 4MVXA 2C96A 2PJDA 3D31A 1Q19A 1Y5NA 4TTAA 4X8HA 5JWRA 1XO1A 1E9VA 1UBUS 3I12A 1DKPA 1WXDA 3GA5A 3GRYA 4QAQA 3WJ2A 1CR0A 2RAVA 3MTIA 3QKRA 4O4HB 5DE3A 2A2ZA 3Q0EA 3T9BA 3UJHA 1VKNA 5JC1A 4BEBA 4PIPA 1UBMS 2YHIA 5AUOB 4UPDA 2DEUA 2ZFUA 1YJQA 3TOCA 3R20A 2IF2A 1G0OA 4V1CB 1BXKA 1Z5OA 3HFRA 3WIBA 1ULTA 3BJZA 5K3FB 2J0SA 3F7MA 4DSUA 1U1FA 2HSZA 2YC4C 1NWHA 2XCQA 3L0YA 4KDCA 4UBOA 1XCMA 5IAJA 1NQOA 2ASEA 1JZQA 2ID9A 3R9KA 1TCVA 1GDHA 2ONYA 2WHRA 2EWVA 3GQVA 5EIOA 3PDIB 3O31A 3QX9A 1X70A 3GT4A 4NNPA 5FEMA 5DF1A 4N6GA 1H85A 5LJLA 3VR3D 4JCCA 5K6TA 5JSFA 3GXBA 5FOSA 1WCIA 1NGSA 2DMRA 2OVBA 3DUWA 1FFHA 1RJEA 1YT5A 2JAQA 1TAHA 1FRZA 2YVQA 3E4CA 3GJYA 3K9QO 2QMOA 1XQYA 3IOMA 1I1HA 2W2QA 3K0AA 3CVJA 5J4KA 4MR7A 3L6UA 4OAQA 4WGGA 5K3BA 3QFRA 5TPWB 5I45A 2FFHA 5L7YA 5DNYB 3IDAA 2XPCA 3E7FA 4HDKA 4NHOA 1C0LA 1B3BA 2PAFA 3VXKA 5DVZA 3ONDA 4E22A 2EF1A 4FNAA 3F4LA 4NL4H 3K70D 4F3CA 1XDDA 3G8YA 4IWYA 4DBZA 1KYVA 4EJSA 5BV7A 1UCFA 4EKDA 1MDFA 4O08A 2ZM6B 4YAWA 4RHEA 1PFYA 4XQ0A 3T7SA 4YP5A 3U3ZA 3U62A 4DGSA 2OXEA 1OLUA 2OFOA 2WZCA 3DCNA 2H7YA 2ISSD 3LDUA 4JBXA 3G8BA 4R01A 1E7RA 4JP3A 4IMRA 4OHMA 4J07A 3G6KA 5ANRB 4COOA 5C7IO 4MPRA 3RVKA 1DQPA 5ALOA 3RV3A 1KZ4A 4XB1A 2ZTVA 3W3AH 2GLXA 3NWJA 4PNPA 4TKUB 1PS0A 4ENUA 1PX2A 2V6JA 1U7WA 3GMSA 4LDRA 2ZWPA 2R8OA 2XYRA 2PEZA 4UZFA 1LSOA 3ZWOA 2NXEA 4C4AA 3EVNA 4E2ZA 5JSZB 3AUTA 1YNSA 4GH5A 4DA0A 1USVA 2XZOA 3PGVA 2DLCX 1B1CA 2XW6A 3QX7A 4GOJA 3V8NA 2AS0A 2OP1A 3IEUA 1K66A 1T43A 1KMHA 4K9LA 5F7JA 1ID8A 2ZB4A 1R0WA 1ZZEA 2DBRA 3M9WA 5B7GA 3R75A 4D2IA 3R7BA 1CEEA 2M32A 2FMXA 4PLWA 2BY4A 3WJ7A 2B8JA 5IF3A 2XCIA 3LUGA 4M0UA 1FW8A 3SHTA 4K1LA 1AY0A 2NWQA 4W8GA 1N36B 1YC5A 3EARA 4IV0A 4ZVTA 3PXAA 4R6WA 1KJYA 1TMKA 3WWZA 1NY6A 3BXXA 3QLVC 3WMEA 3EXG1 3C3KA 2IXDA 3CXRA 3HBLA 2PU5A 1N2SA 2GF9A 1CJCA 3IX7A 5CDHA 2VF8A 2AJCA 2E4XA 3E3OA 2WHYA 4CDRA 1OIVA 3EYAA 2AG0A 4HQNA 4OQEA 2PU7A 4X92A 2FX5A 4DIFA 1R12A 1UWVA 1M6EX 2H2FA 1YR9A 2W6MA 2X4IA 4INJA 1F8FA 4RPGA 1ZGAA 4HAOA 3QOYA 4BECA 2JLYA 2ZWOA 3LNCA 3B13B 2FETA 1KR2A 4JT4A 1UMDA 3HKCB 4D9IA 4MVJF 3NH6A 5HXAA 2GN6A 3KIPA 3TLKA 1EGAA 2ZBRA 3IR5A 4NSNA 1B76A 2HLNA 3DZJA 4RFVA 4U7FA 2Z09A 2I6TA 3TPZA 3H75A 3AM4A 3ETEA 9ABPA 1UJBA 3Q3GE 1SQGA 2GF0A 1ODKA 4GEGA 3ON5A 4NVRA 5HIJA 4RSGA 5FTKA 1BCRB 2E5WA 1HY3A 2R5NA 1TU4A 4NYMQ 4HWTA 4H7PA 3VO1A 4E2FA 4NMWA 3JYNA 4BU1A 3JQAB 1E6EA 4RMGA 1C4XA 4DV4B 3U4CA 1JSZA 3HTXA 1G3IA 4M60A 3H9GA 4WPGA 4BB5A 1GYQA 4OATA 2CJXA 4I8XA 5D84A 4F85A 5IH7A 3Q3HA 2WF5A 3N2IA 3OPXA 5LU9A 5CYFA 5FD8A 3EGCA 5IFLA 2HGSA 1X7XB 1RI2A 2PMFA 1GTRA 2OGWA 1TKRA 2GYVA 1UEIA 3MWDA 2TSYB 4K6FA 4A92A 4TVBA 3ZCTA 3LCVB 1YUBA 2HJGA 2OCBA 3WKEA 5HPYB 2FP4A 4E1AA 3FBTA 3TX2A 4QUIA 4Q9HA 1S3IA 4HNAA 4M22A 1E61A 1Y6ZA 3GNTA 4ZZIA 5B1HA 3VVBA 3VM6A 1PO7A 4LCBA 1X1EA 4X54A 2TRSB 3SC2A 3P9PA 2W2KB 1G16A 3GCGA 2MYTA 3R3SA 4O2LA 5EIEA 1RPAA 4MITA 1VIMA 3Q3EA 5LQDA 2NUAA 3EXAA 2PL3A 2L82A 4PNHA 4V0QA 3M7IA 4XCQA 1MNAA 1XAJA 4TXLA 3GLGE 1D0VA 2P6OA 3L8HA 1BTOA 2C4KA 1TU3A 2R751 3TNLA 5CBPB 5EXTA 5G0UA 4KHZA 5ILGA 2JH3A 2BSXA 3N7UA 3RFTA 1IDN1 1RE1A 5BN5B 1WXXA 3SHOA 3V97A 3EH2A 1OXKB 4ITRC 4URXR 2BEUB 3RAGA 4BMDA 1JHDA 2X58A 3WX0A 4JLUA 3VFDA 4C88A 5KMGB 4MDFA 3S99A 1M6HA 5FB3A 1NPTO 3NVMB 4LY6A 4HYQA 1C4KA 1LPPA 2HMTA 2YDYA 4OI2A 3ZOKA 2D1TA 4IXWA 3PGMA 4KNWA 3IDZA 2WINI 3THYA 5FNVA 2AZMA 1Z8DA 2BMFA 1Q11A 1NVBA 3SR4A 4W82A 3Q40A 1CZLA 1IUKA 4ZU1X 3RRBA 4L7VA 4PX3A 1AN0A 1JHYA 1CUBA 2ZITA 3OO1A 4HD8A 4TT3A 4ZAZA 3HXMA 3E70C 3HXKA 1H6BA 1QOZA 1I4OA 2V7QA 3WIEA 2PVPA 4NIMA 4JOCA 1POXA 3BWXA 1PD1A 4GYWA 5JDCA 1O5OA 2BPOA 4QU5A 1T1RA 4XGQA 1EXMA 2O8NA 2O2ZA 3AR5A 3MWKA 4WLNA 1IBCA 3SSMA 1M2VA 4ZI7F 5KKCA 3KAQA 1O5TA 3F90A 1TU0A 1A27A 5A3RA 2IGBA 2ZJOA 4PZDA 3ABSB 3OA2A 3RS5A 1LFDB 2VRCA 1Y6RA 1JAZA 3SF8A 2ZPUA 1NG9A 3D4IA 1LI5A 1ZCAA 3I9KA 4F1WA 4RHCA 4AC9A 2CVQA 3CR3C 4G07A 2Z8ZA 3QVUA 1Q22A 2DCUA 3HN7A 4TMWA 1JPVA 2DY1A 3SDZA 4XRGA 5KWEA 1PSWA 2DQSA 2IK8A 4DDKA 4YRAA 1APBA 2ZI3A 5FFMA 3VUFA 3LK6A 2GBCA 1E59A 2NT4A 1WW3A 4JI1B 4PF1A 4XA8A 1Z26A 2ECOA 1YZQA 3A6HA 3LQ4A 1NTOA 4M3NA 4F06A 4MUAA 1T3LA 1S9HA 5BRJA 4KTTE 4J7UA 3FJOA 4UXIA 4CKXA 3K2IA 3RHZA 4NBKA 2CDCA 2D2FA 3EUEA 3N8HA 4R2HA 3ZIDA 1EGVB 2WEKA 2C82A 4DUGA 4P08A 4BLUA 1IONA 2D4AA 1I2AA 1UMCB 3OZAA 4KXMA 4NATA 5FI5A 3ELYA 5IKOA 3T3MB 4DIBA 4EQ6B 1BEZA 5HKLA 2I4MA 4XGNA 4ES6A 3IP9A 4DR6B 1UC4B 3AMVA 5JD3A 3WP0A 2HFKA 1FUYB 2NP6A 4XGKA 4AS2A 5FH9A 4KOEC 4H6XA 5A0VA 3E7WA 3O75A 5G3ZA 5A71A 2ID8A 1N1EA 1NXVA 2YXNA 5JNVA 1EQAA 2D1YA 3HCOA 4NR0A 4S12A 1A4IA 3ZEIA 4CE6A 1QJ4A 4HQFA 5D1HA 3G2NA 3TI9A 3U80A 3NGXA 2JD0A 2ZRCA 3FFTA 3HKBA 3LTEA 4PFSA 5KQSA 4KAFA 4G0QA 1MG0A 4LOIA 4ETMA 5A4AA 1DP4A 1QCZA 2ZUEA 1MJNA 2B8TA 3TM5A 4PY2A 3S5JA 3ZXUB 2M6SA 1IPHA 1E4YA 5GV8A 4IHJB 1U4NA 3ZJ5A 4CLHA 1WULS 2IZZA 3I9V1 1NPDA 5DK6A 2HCTA 3CQ9A 2VHEA 1ZXBA 2WJ3A 3RNOA 4TLCA 1J1IA 3NRBA 5TMPA 2CJPA 1QU3A 2Y2UA 2J3QA 3K6SB 5I9IA 4D4IA 2EJCA 2ZRHA 3S81A 1VCOA 5CFLA 2HHCA 3FYUA 2ZR0A 2O8FB 5KEIA 2X8JB 3B8HA 3FI0A 4LF6B 4YP0A 4AWXA 3F6SA 3T9FA 3KJZA 5J43A 2QSUA 3FJYA 2YHUA 5CVEA 5ALVA 5KX5B 1HXHA 1Z0KA 1TDJA 2ZAGA 4X1YA 3ZD8A 4YRBA 1JW9B 4PLZA 3I76A 2YX1A 1KWKA 3DTVB 1KP3A 1DCMA 2B3DA 2CLDX 1Q6ZA 2MINB 3CNNA 4ZVNA 3T3PB 1TYCA 3O9VA 1ZONA 3VO8A 1CDEA 2I6SA 2QD2A 3HU1A 1YBFA 4HC4A 2JC3A 2VDVE 1O6ZA 4L3OA 3FNEA 2IYAA 2G7ZA 2YMQA 3M3HA 3A6GA 4MVJI 1B1AA 2YIVX 4CM5A 1Q0RA 3BHIA 3AF1A 3ESCA 3RUDA 2JAUA 2DF8A 1H2FA 2I03A 2PH1A 2WRZA 3I9V6 3PJDA 1REQA 4O3FA 1G2QA 4QU8A 1QGUB 3CX4A 2QR2A 2RAUA 4PXYA 3UK7A 5JNWA 1HDZA 3GT7A 2M6LA 2Z9BA 1U2ZA 4JUDX 4I5IA 5JFOA 3GHYA 2RHRA 1G5TA 1J8FA 4YP6A 4Z49A 4BZXA 4EENA 4CETA 3C15C 1H94A 1NRJB 3U4AA 3NDBB 4MVJE 1SZJG 1Z22A 1MB4A 2KI5A 2QI9C 2PX5A 4JUIA 4OHPA 4XIJA 3RUHA 5ICGA 1AGPA 3JVIA 3W5AA 3VZBA 1JYFA 4LV5B 4J91A 3VR2D 4BGDA 3AXSA 4YN3A 2WF8A 1OWMA 1F2UB 4XTCS 4I4TA 3MUNA 1M0WA 1K9VF 2GZMA 4EHAA 3SM9A 1W29A 1YE5A 1DIAA 1JHVA 2BKVA 1JEYA 3DGFC 5TARA 3LLCA 4MP6A 5DBIA 5FHQA 2HCBA 1HK7A 3F3YA 4FGLA 4NJEB 4PTZA 3MRSA 1E58A 621PA 2FAXA 2B0JA 1TA9A 3DOJA 3EK2A 4YMSA 2BKEA 1JL3A 4C1NA 1AT1A 1W2HA 5HILA 4KKVA 2I67A 4R31A 5DP2A 2HK8A 3VR4D 1N9KA 4YRSA 5B2FA 1FIUA 2FZLA 4HXEB 2PZFA 1GUYA 5ICMA 1B0ZA 1O7JA 1U0RA 4CMIB 3USCS 2FDRA 2R62A 2LNDA 3RUPA 4L0MA 4LYGA 3B1VA 3K5HA 4CIWA 1KMMA 4ZODA 1L7XA 1THZA 2QY9A 2X6QA 3EQ9A 3I30X 5DNDA 2GKSA 4R16A 2FR0A 1EX1A 1NAIA 1VP9A 3IQXA 2Y67A 3V2IA 1DIBA 2KX7A 1V16A 1YU6A 1TA0A 5TNXA 1BDIA 2XWSA 2ZYDA 1YFLA 1G59A 3D3WA 3FE2A 3IT3A 4RS3A 1T24A 1XEWY 2A0FA 2CGEA 1LDGA 2H2DA 2WFAA 3RTGA 2AFRA 2QTVA 4F6LA 1C3LA 1U2GC 4G4IA 5IEBA 2G63A 5IAGA 1RHQA 1GUDA 2VYVA 3CE6A 3LXRA 4LVOA 4RQTA 5EP3A 1UZMA 3FUTA 2FXVA 5E6SA 1LDEA 1M83A 5IG2A 4G8CA 4Y2XA 5K4HA 3BIJA 4KAXA 4JUAA 1T1IA 4M9ZA 4YRLA 3L7KA 4GI7A 3JATB 1YVRA 1T9DA 3OQJA 3DEHA 2YWGA 3D6AA 2F3TA 2ZIUB 1FS5A 3WAJA 1A7JA 2P6UA 4FE4A 1RJWA 3GLUA 4IDCA 4AF6A 3PGKA 1GGKA 1D1SA 1BGXT 1U9ZA 1G6KA 3ZNQA 4DREA 2VT6A 5TF0A 3PWTA 1US8A 1GGHA 1O03A 3R3HA 4IQ0A 1WY7A 4DJ5X 4EYKA 5H82A 3M6UA 3WL8A 4CKWB 1WMSA 4MYTA 1GG9A 2QZSA 4RK5A 2VZ9A 5A5FA 1U2QA 2HA7A 1EA7A 2FQ1A 4EYQA 4P7FA 2PH3A 4K9KA 2QPAA 3GEBA 2KQUA 1VP3A 2RH9B 2N1BA 2ZIVB 4DCVA 4OHUA 1ZLYA 4NFSA 1CP3A 4ZO4A 5F9MA 4TLAA 4XR4A 2DAPA 3FCYA 3K2QA 4JLAA 1UBEA 1V4NA 3F47A 3CBGA 4YH1A 5T57A 5GADl 2CFCA 3F6BX 1T0PA 2QVBA 4QPPA 4EPRA 2D5BA 2AEFA 3ORHA 1KJWA 3BMQA 1F9AA 3G0IA 2VJYA 4S24A 3QY0A 3F74A 4L9RA 2BP7A 4KFCA 3ZI0A 1L4EA 2P9YA 2Z4TA 4OMCA 3OIFA 2ZBVA 1YRWA 5GMOA 2GPAA 4GBMA 3X1XA 4F84A 2PRSA 3DLPX 2P4SA 3DH0A 1ORHA 2WMDA 1L6RA 3BORA 2X0IA 4JLMA 3AWIA 1G5PA 4BP8A 3RASA 4Z7JA 1R4NA 3SVTA 1XCJA 5IASA 4Q1AA 4WFIA 2I0FA 5EQDA 3R0QA 3UWMA 4ADSG 1PV1A 3AR8A 3BC1A 4TMFA 4HDNA 2P8JA 4B79A 5H80A 1FJGB 1X9GA 1XKTA 3OFJA 1NM5C 2QM3A 3LPMA 4HEHA 4KE6A 2JFOA 1CY0A 3R6TA 1QE0A 2AD1A 1X94A 2NZUG 3OQHA 4GR9A 3INRA 1UFRA 3CWCA 2IHZA 1UFOA 4YJ2F 1Q1NA 1R27A 1N2CB 4MYSA 4OXIA 4YAOA 4IFEA 5AXBA 3C97A 4NE9A 4B6FA 5KSOA 1QTIA 4HAXA 3TRDA 2GAOA 4YXFA 1BHSA 2O2DA 4EELA 5B3KA 3GJTA 2ZBQA 3MGAA 3WK8A 4B85A 3DWEX 4RIEA 2D7DA 1J2UA 2CHGA 3L1VA 1XCOA 4KV7A 3NTRA 2L2QA 3B7GA 5JASA 2QROA 4ZMSA 3LCJA 2UXBB 4ZGGA 1C8LA 3VYRB 2R7KA 1Y6JA 3BKWA 1T9CA 4Q1BA 2FW8A 4YA6A 1DKLA 1SBHA 2RHCA 3CLRD 3GDWA 1M2JA 5CH5A 2RHTA 4YUAA 4BO0A 3UMRA 1EI9A 2PZJA 3QVLA 5IKPA 1QTQA 3U0VA 3QFTA 3NBAA 2NVUB 2FX2A 1G21B 3KZMA 2VN8A 3P2EA 4DFDA 2XD9A 1Y4DE 3MUEA 2X8WA 3HSKA 1DUVG 3NJRA 3NTOA 3IMFA 4ILEA 3RBVA 2CSXA 1VIYA 2I4TA 1Y4UA 1XWIA 2FUEA 3K53A 4D45A 2HD4A 5A06A 4KYUA 4CLOA 5FA5A 4P31A 4PCLA 1WAMA 3NM4A 4FFSA 3PUHA 1XN1A 2AFIE 2FEXA 3RSZA 2ANCA 2VFAA 1A77A 2KB0A 1EVIA 5HF5A 3AG5A 3F3MA 4CL2A 1BD4A 4I50B 4FD2A 2Z5VA 4MWGA 2PXHA 3RC7A 3RSOA 5DM0A 2AK2A 3PKZA 4C7MA 3GROA 2Q1TA 3A1FA 2SCUB 3IMGA 1TVEA 1BFDA 3ITKA 4GOXA 2H1RA 3U3KA 1GR1A 2F1RA 2VAPA 2B37A 2XXAB 4O4LF 5JD6A 1HNXB 2QNRA 1M10A 2Z3VA 4Z53A 5J47A 3VI4B 1H2ZA 3UQZA 4N76A 4IKEA 4UEWA 5BV1A 3QJYA 2N46A 4BFXA 3TOSA 4HXYA 1JQAA 1UDWA 3UOWA 2XB4A 3T7AA 2HA4A 2D5AA 1R9MA 1FS6A 1KDTA 1SOVA 3Q7SA 2W43A 5DNVA 2G1UA 4FDVA 5ABPA 2REBA 1T5DX 2O1XA 2WWXA 1TT5B 2HA2A 2RGUA 3DZCA 4H60A 5BR8B 3HA2A 3JQ8A 4ZGBA 4IO1A 1TFRA 3NBMA 1HYEA 3IXMA 4P1ZA 2BONA 1CVLA 5AP9A 2UZAA 3QP9A 4QLOA 2ZSJA 4AZVA 2GM9A 3KT8A 3G49A 2O50A 1P2TA 3MC1A 2FEKA 1IG0A 2GM3A 4X3CA 5J23A 4KSCA 3KYDB 5DHTA 5JEDA 5JBIA 3K8OE 4MUGA 1PU2A 4W5JA 4ZKEA 1E66A 4ZYWA 1QX3A 3D6HA 1CW2B 1YMVA 1Z28A 1F1JA 1QHHB 1QWOA 2QRGA 1XZJA 4RU1A 1KE2A 2V6MA 4EIWA 3PQCA 4U2GA 1X1QA 2DX7A 1AO3A 1BS2A 1COWD 2P6MA 2O5VA 3C85A 3NDJA 3LPDA 4RPLA 5HJEA 2QZ4A 3OVMA 4U6SA 1KDZA 1BDJA 3Q3IA 1VG1A 4BJ3A 3DV2A 3O4FA 5DW3A 5LD2C 5AW7A 3C6ZA 2FE4A 4HNUA 5JS1A 1IBSA 4RMJA 3GJ5A 3W3ZB 2WJPA 4IDBA 2B5OA 3AL2A 3PWZA 4UQLA 3O8DA 4YT8A 2NZWA 1SA0B 2WJVA 3ZQ6A 3JVDA 3OTWA 4YUZA 2CC2A 5LLSA 5LB4A 3ULKA 2UKDA 3ISVA 4G37A 1SIBE 3UFBA 2Z6AA 4P38A 3EYWA 2BIFA 5E2IA 2WU1A 4TWIA 1SVWA 2V9ZA 3VYWA 3S8YA 2I3BA 5KU7A 1AZLA 4QBKA 2F43A 2O9JA 4GRIA 1XA0A 2X9LA 5IXYA 4NONA 1OCEA 3TLZA 4B4UA 2YQ4A 1VMEA 1WF6A 3C5WP 2B61A 3BUSA 1T5HX 1X92A 2JLUA 1CCWA 1XVVA 2CK3A 4I99A 4DLNA 1C8VB 3FMVA 3FYDA 1QYWA 5T5QA 1WSAA 2VT2A 4OM8A 1H4TA 4O4JA 4WLEA 4DQVA 1ZI6A 1DX6A 2GUWA 2WUWE 2OO5C 2ZE5A 5G40A 3WNZA 1SBYA 1BWRA 3A1SA 1XV5A 4Y9TA 4RCYA 4Q02A 5K51A 2QG9A 1U8TA 3CS3A 5DT2A 2DWUA 3BL6A 3SQDA 4JC5A 2RBKA 2SKCA 1GCOA 4K03A 1FW6A 2E1RA 2J6CA 2YY7A 2ZJFA 1TQ4A 5J2UB 1JBEA 5EESA 4X44A 1CR4A 3VPAA 2XJ9A 4BVKA 4OJMX 1U0BB 1GPAA 2WVJA 3GI1A 5BMVF 4FS8A 3I1IA 4C14A 1GXSB 3AYXB 3UJNA 4GM0A 5F4ZA 4ISBA 1GIAA 1YJAA 1QC5A 1U81A 1W6UA 4KPGA 1KVRA 2BHNA 4BL5A 3DYVA 2HSJA 2CKMA 3A1DA 3MILA 5TRTA 2JGKA 4JVLA 2I55A 3FSJX 1X77A 1U8XX 1ACJA 1NV8A 1WXFA 4NBVA 4RY2A 5TQJA 1LX7A 1QBGA 2QN9A 5CD1A 4HGNA 5B6IA 2J3HA 2B7BA 3O7WA 4CLEA 1A7AA 3UENA 2XTNA 5DM60 1E2UA 4QTZA 4QFMA 4ZI5A 3REOA 4MI6A 3T5GA 1N8TA 5BQPA 4PGMA 4P4NA 2NPOA 1XTPA 1ISMA 3DR5A 3VYSB 2BGNA 3QIVA 1PYDA 2AFHB 5EIBD 4L75A 5SZHB 4EB6B 4ZK2A 3EA5A 1PAUA 1ISSA 2NAFA 4UEKA 2D1QA 2W2OA 3W7VA 1WMDA 1S0UA 1X3LA 5T67A 3R7DA 1OH7A 4E08A 1N25A 4Y7CA 2QGFA 2VOJA 3PB3A 2QL7A 3DM5A 3ABIA 3FPGA 3U3RA 1Y34E 4JS0A 1Y33E 3RQIA 3QVKA 4M87A 5B7NA 2VH2A 3DLTA 1VYTA 1XLVA 4JBLA 4WXHA 4BC0A 4I1OA 2YN4A 3OD5A 5CFNA 1KS2A 1SVLA 5TMEA 1P45A 4QFCA 1QKJA 1X1BA 3X2FA 1FUUA 2IH5A 4GMXA 1K1EA 5AICA 2I7TA 1UJ2A 2YV5A 3R3WA 4MUFA 3E9DA 3K31A 2XNJA 1DKUA 2WKPA 3JAKB 1O89A 1UP6A 5BW6B 5LP6A 1A9PA 1GZHB 3D6UA 3DNMA 4OK3A 5HS4A 5IJ0A 3DWFA 2LIVA 3DVLA 1X42A 1PGJA 2GPNA 1RXSA 1L1QA 4A8JA 2J0QA 3H5WA 2YS6A 3IIMA 1KH3A 1I3MA 1QMPA 1NPYA 4MIYA 2XMSA 5G2OA 1ZOIA 3PQDA 1QF9A 2P6RA 1SKUA 3DD5A 1S89A 3SC3A 4H15A 1QDLB 2GZ2A 4RKRA 3WTCA 4QZVA 4K3VA 4LRSB 3N0XA 4YLEA 2X2OA 1IUPA 3W9YA 5AHOA 3TZBA 1GUAA 1GPUA 1MTOA 2B0CA 4LBWA 4TMVA 5F2NA 1DIOB 2Q6LA 2GILA 3IO3A 1WETA 1YVEI 1ML3A 4DPKA 3HO6A 2DR3A 3WLJA 3ROTA 4L08A 1ISPA 2FA9A 1Y80A 2H1OA 3CZ4A 5ILQA 1YV9A 3VOAA 2WIKA 1OPXA 1G18A 4U2FA 4WV3A 4KIJA 4ZAVA 3PJEA 5AT1A 1F0NA 3T9AA 1G20E 2GN9A 2W8BA 2ZUUA 3NEPX 2Z4RA 3SYTA 1RT9A 3W1EA 1PBNA 1YS2X 1ADFA 1NQVA 2R4TA 1NQXA 3DAOA 3GWZA 3BRQA 1OOEA 4KV9A 4AYXA 1D5WA 3BA6A 3JQBA 3QMWA 3QHAA 4E32A 5KC8A 1ZH0A 2X2FA 4NNOA 3SMVA 3RHTA 3TLAA 3AIOA 3DEJA 3MOSA 2R3SA 1PUIA 1X9IA 2H5JA 3NPMA 3EIEA 2GN1A 2PKXA 1Z34A 4KOAA 4LC1A 1Z7BA 2R00C 2FSPA 3I1FA 4QXQA 2ZT5A 3GGPA 1UINA 4NYJR 3ZD9A 1BAPA 2OC9A 2I33A 3C6QA 3GRRA 3G2OA 3L0IB 1Z38A 4CV3A 1TLFA 2C31A 1UJCA 4HY3A 3H8SA 5K4AA 3TH5A 3U7RA 1G8JA 1EQUA 3QKWA 5CEJA 2WJYA 5JJ5A 3QLTA 2BELA 1RKBA 3GEIA 3PPIA 4HGYA 2E37A 4XH9B 2O7SA 3R6DA 3HN6A 1EE1A 1PLKA 3OX1A 5T6MA 2QRJA 2HA0A 1O87A 1F0PA 2VK1A 4N7BA 4DUZB 5JNTA 3UAXA 4N0EA 4JJZA 3A1WA 4HQKA 1ZSNA 3NANA 2DVMA 3QX8A 5ADUS 4L27A 4RTOA 1MAVA 4GKBA 2V0NA 1DL5A 3S6JA 5KNDD 2HNBA 3JRWA 4LECA 2VWQA 2ZETA 1VSTA 4BZZA 4MS3B 5FI3A 2G7MC 2KWIA 5K0TA 1EE9A 3A4NA 3HBJA 3PTAA 3K16A 3MJCA 3MLEA 2P2NA 4KR0A 1NBMD 2GI4A 3WDMA 5A62A 4RFLA 3PJGA 2DHQA 1QVVA 5HF8A 4XPZA 1Y3BE 1M7GA 2QYTA 3Q7QA 3MXTA 1HDCA 5CVVA 1W85A 5CA1B 3HACA 3TL3A 4ER5A 2XQVA 4RWZA 5I4CA 1Q77A 2ZS7A 3P96A 5KJFA 2PL5A 2WZBA 2ZANA 3A1TA 2HRBA 3JASA 3H9CA 3OSUA 4M54A 1FTGA 3SGLA 4PLCA 1JN0A 4MARA 2AG8A 1L4NA 1IOZA 2A1TR 4OJTA 4DIOA 3F1KA 1KERA 3EQ8A 1E64A 4IIHA 3UAGA 3CGGA 4A4DA 4WLFA 3DZDA 4AMBA 5JYCA 1EU1A 1HYBA 5D7NA 3C74A 4DMGA 2Y4NA 1CJMA 5JAUA 1X6VA 4ARBA 1FFDA 5AOCA 5TGTA 2PD3A 3Q5GA 2CHFA 4BIMA 3TR6A 3FTNA 5AI8A 4CVNA 1ZH2A 3OCUA 2XEXA 4B3FX 2ZM5A 2XE7A 3I6BA 4PXSA 1FFWA 4AB1A 1TQHA 2G4LA 3D1VA 1KBOA 3EQ2A 3AERA 4KVFA 3ZCUA 3OPYA 1ZM4A 4MIKA 2R8BA 1WMBA 3C3AA 5A0TA 4JBGA 4NZNA 3ZCRA 4G0MA 4O4IA 1Z7EA 2IQ5A 4WXRA 3FAZA 3PI6A 4CT5A 1ZGCA 3QWBA 2X0FA 2VTBB 2ZIWB 3WWOA 4DA8A 1I7SB 4OGGA 1UPBA 4G86A 5BR1A 1WTAA 3KKOA 5A05A 3PC2A 2NVWA 2J0EA 1PKXA 1T3GA 1G5FA 2WTMA 4ND8A 3AKYA 1XNJA 2C2MA 2EW1A 3EXHC 2G9VA 3N6XA 3TUIC 3B3QA 2VNKA 2GTHA 4TYMA 4DXHA 4QVIA 1R6UA 3KQMA 3SFVA 1GO2A 1VMDA 1USIA 1XWFA 2RHLA 3IILA 3MBIA 4R2XA 1P1KA 4GW3A 2AR7A 4R51A 3J80A 3ZD6A 4POOA 1QHXA 2Q5JA 4R9SA 4MVCA 4TZTA 2XWJI 2E4YA 2GNPA 2YWHA 1B41A 3H4TA 3IEKA 3IQDB 1LJLA 3M3PA 2FR8A 4DQXA 3GNSA 1JG2A 4A0SA 4XD2A 4HFJA 4TV9F 1KK0A 1YIAA 1B23P 4F6RB 2O2GA 4RY9A 2YWXA 3UWOA 1ZJ6A 2X4LA 4WAUA 4NMXB 5ALNA 3OUUA 5CVTA 4AKIA 1I4EB 1KARA 3AYZB 4PPFA 1VPWA 4OH7A 5LB2A 4BQSA 4BB6A 4F3KA 5IULC 3VHLB 2H07A 4OMDA 1D0IA 2B5WA 1DZ3A 3T61A 2IIPA 4AG3A 5IAAA 4P81A 2P67A 3L5OA 2HT6A 4LHEA 3M5PA 5F7XA 5JQGA 4WBNA 2NPFA 2JBAB 5DNEA 5KB3A 2J3EA 1OJLA 2D7JA 3MT7A 4TSRA 4FT2A 2WPNA 5ALEA 1BMTA 5EZQA 1XVLA 2QV0A 5BN4B 1N92A 1G20A 1RBMA 3MJHA 1YDMA 1DIHA 2WWIA 3ADKA 2NXNA 3AM3A 3N9IA 4IDFA 4US0R 1ZMTA 4BUCA 1CEYA 2YQZA 2YNMD 3QVMA 2RBGA 3IEPA 4XJXA 4HLNA 1N4DA 5JCJA 3L4JA 4TRMA 1XAGA 3BB4A 2D4HA 2G8LA 2WWGA 3DCYA 4LIPD 2FK8A 4DA7A 5K8CA 3O4GA 3A10A 3Q72A 1IXRC 3ESAA 1Z33A 2YY6A 3OAAD 1Y1QA 2Q4RA 2RHWA 3TNYA 1FOEB 2YFYA 4BEJA 1BGVA 2BHRA 1BG6A 2RGDA 4WY5A 3S2GA 2WE8A 1M2FA 2QEQA 3CW9A 3A4VA 3JD2A 1KI1A 2VCEA 3EIQA 3SHQA 4REQB 3ASUA 1ESDA 4M1KA 2I91A 3RKSA 3V80A 5BSVA 2HWYA 4KO1S 4QUHA 5KVVA 4BGUA 4D3ZA 4L0DA 1Q0SA 4AN1A 3MRVA 3WLOA 4RLHA 4N6OA 3EC2A 3AETB 3IDFA 2JLAA 3CMMA 4QQNA 3N8IA 3WQQA 2CL6X 4WCVA 1GA1A 4Q4JA 4YDSA 3BH0A 2C7OA 1ZNQO 1QGOA 2GB4A 3CNHA 4EHBA 3H2ZA 3ER8A 1H4SA 2HGZA 1IIBA 2XY4A 1B6TA 1QE5A 2WDPA 3MJ4A 3FLMA 3GRUA 4PBTA 4BLPA 4OLAA 1UJMA 4UPVA 3KP1A 3FF1A 1M5TA 1VTKA 3ET5A 4YJGA 1ZOSA 3IDSA 5JY1A 4UM8B 4DHEA 3CISA 2X23A 4PE5B 1WKVA 2LXNA 3AJ8A 3FGNA 3PE4A 2AXNA 1V0JA 4P7GA 5JZBA 5K0BA 3UBTA 4KREA 4RXTA 5HKAA 3FIJA 1YZYA 2O48X 2JVKA 2VK4A 4P4SA 3UV7A 2ZE8A 2Z8YM 3KTFA 4YQFA 3HU5A 4PAWA 4B83A 4JI0B 2PJRA 2ZBEA 1KAGA 2W2MA 3HKEB 4QJBA 5H9WA 2JKZA 4BO9A 1N6NA 4MAFA 1D4ZA 4PX5A 2BFEA 3BL5A 1I3KA 1M76A 4M7PA 4XPIA 1G19A 1HFWA 2QM0A 4E12A 2B6NA 3F5MA 3ZU2A 1CRLA 4PRKA 3QE0A 1VIVA 5IXSA 3PBKA 4OFBA 4P7KA 1QX4A 2VAWA 3CUKA 3TE6A 4BE4A 1OAOA 2HWKA 1J8YF 4UU8A 4I2NA 3SLRA 4M7OA 2FEOA 3PXGA 3VTFA 3BZBA 3QIAA 4L73A 3W8NA 4KQMA 1ESZA 3VZCA 3NWBA 4QUJA 4KX3A 5ECYA 1G2PA 4H1UA 1WNTA 4LSWA 3DE2X 1O95A 4RTKA 1CZRA 7ADHA 5TIIA 3A2MA 4QYSA 2XUJA 1U7XA 1V6AA 3BJEA 5DIZA 4CKBB 4PZLA 1LRKA 3JRXA 3LMKA 2IV3A 2ABWA 3IH5A 3QH4A 4GZ5A 3ZHQA 1RHRA 1M1YB 1N2GA 1IEQA 3FOAA 3ZZMA 3MMNA 4TSFA 4XX0B 2V96A 3FLBA 3FMGA 1DXYA 2BEWA 3RAJA 4ER3A 3VPXA 1JQKA 2WA2A 3QKSA 3B38A 5KYGA 4DG5A 5EIWA 1LQ2A 3EQ6A 3TUZC 1VC2A 4FILA 4D44A 2BMVA 2IEDA 5LXTF 2Q3DA 1H0SA 3NU1A 4WZZA 4ANFA 4CU2A 1JHXA 2C9BA 4S1TA 5T4BA 3WSTA 1I33A 1TUEA 4LTDA 4ZDJA 1CS0A 5DI3A 4YLGA 5BWBA 4JJEA 1Z8NA 5T41A 3KQSA 2P68A 4GX1A 3EBPA 2CVPA 4JYZA 3BTSA 1OYWA 1M2OB 1U02A 2JLQA 2QD4A 3D7KA 3O3NB 3U7JA 5K3DA 2QZPA 1C7RA 1GEEA 1IK6A 4O25A 1AMNA 1A9YA 4Y0VA 2GJSA 3ZHVA 2VP0A 2OGUA 3NTXA 4V1CI 5LCXA 4ENPA 2PJZA 4MW1A 3QNMA 4ENRA 2G1JA 1YZVA 3GZJA 3LNTA 3BWVA 1Q83A 4DRZA 2QT1A 4D3DA 3WB2A 3SX0A 1D2CA 1UADA 3CKMA 1V8ZA 3JD4A 1DE0A 4RZXA 2WFMA 3F8TA 5TEVA 1XT6A 3MJEA 3OO0A 3KDPA 5CK4A 4AMGA 2C94A 2LW7A 4LI3X 3HVJA 1XZMA 2OQRA 3QA3E 3KJGA 3EWAA 3T1QA 3PQ3A 1JIUA 1GNLA 4N82A 1BXGB 4RVDA 1OZ0A 3ZIAD 4Z51A 1V5IA 3FVQA 3VSDA 2ORIA 5LOVA 4GXRA 2REQB 4BNIA 3RODA 2CCGA 4J6EA 4YO8A 5CLLA 1EWVA 1FP4B 2B21A 2BFWA 1C7IA 2PMDA 4BUJA 1RYHA 1USKA 1X7ZA 5J2TB 2AJ8A 3QEOA 3IIEA 2CLOB 4QXRA 5DHPA 4QBHA 4D8TA 4D0NA 5LQMA 1DG1G 3B6KA 2FH5B 2O7NA 1E99A 2GSDA 3WGYA 1YCGA 5DI9A 1UBHS 1Q0ZA 2X77A 1ZXXA 4IM7A 2DFNA 1Q0TA 1P17A 1V9CA 2QB5A 3YASA 4AO7A 3T0FA 1G8SA 4DANA 1BW9B 1NI4A 2ZKLA 5AI6A 1OXXK 3G17A 3LZ6A 1LRJA 1MB2A 1RWMA 2XUQA 2SKDA 3DULA 1F5NA 1XZIA 4IJMA 4OXQA 1KPGA 4MYHA 3JQ7A 4HWRA 1RJGA 4ND6A 2NSLA 3EVDA 4QOSA 4C6HA 3A6LA 3HA3A 4N0MA 4AJ1A 1FU4A 2B1IA 2OYRA 2C9DA 3D3JA 5L6LB 5CDTA 3NW9A 4Z9AA 3V9AA 1DBPA 2ZDQA 2GZ3A 3DAFA 4L15A 5K0EA 1N6KA