2KSWA

Backbone 1h, 13c, and 15n chemical shift assignments for oryctin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'VPVGSDCEPKLCTMDLVPHCFLNPEKGIVVVHGGCALSKYKCQNPNHEKLGYTHECEEAIKNAPRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oryctin
publication title Isolation, cDNA cloning, and structure-based functional characterization of oryctin, a hemolymph protein from the coconut rhinoceros beetle, Oryctes rhinoceros, as a novel serine protease inhibitor
pubmed doi rcsb
source organism Oryctes rhinoceros
molecule tags Hydrolase inhibitor
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.260 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2kswA01
2KSWA
chains in the Genus database with same CATH superfamily
5IP7G 2CKZB 1S03G 5BPFA 5CA1F 4J9SA 5HBRB 5JH7F 5KG1A 1VAJA 4Q0YA 4DV6H 4DL7A 5CA0F 2R7NA 3TQTA 1HR0H 2CW7A 2R8GA 5KT6A 3CVZA 1PK8A 1WR2A 4QIWA 1I3QA 1I50A 2PVPA 4BBSG 4J9RA 2W6QA 3I4NG 4QW8A 3N41B 4LMYA 2FLPA 1Y1VG 3GTPA 4NXMH 3UFXB 3KAJA 3EYYA 5DGAA 1UC9A 1K1SA 5J2UF 5KFCA 4ED0A 3K5HA 5KFFA 1KEEA 5DGBA 5BMVF 4TQRA 1VBHA 2IP4A 2CZGA 2XGPA 2XCPA 3GIIA 4I50F 1A0IA 5L9XA 2VR1A 3FDSA 4B3TH 2YS7A 1TWAA 4Q8EA 2ATLA 1CQIB 3H4DA 5C5JA 5EOYA 1I7NA 3BG5A 2UUAH 2FPPB 5K2MA 3SE7A 2WE6A 1AN7A 3ORRA 4EFBA 3V6JA 2XC9A 1JDBB 4TV9F 3HOZG 5KG6A 3MFIA 4UCVA 4FS1A 4O3PA 4JI1H 5FD6A 5C1OA 4UCUA 1RK6A 3BA9A 3Q8SB 2JA6A 4LF5H 4MV9A 3ETJA 1AUVA 5HV6A 4YP3A 4ED2A 4F4ZA 3PZPA 2FE3A 4O3RA 4LF6H 4ZI7F 4A2AA 2J9GA 2YZMA 4MAMA 2WTFA 1M6VA 2F4VH 4RAZA 5KT7A 4DR4H 3T5LA 2VQEH 3G6XA 4LFBH 1S97A 2OWOA 5KFNA 3BQ1A 4ZQIA 2DZDA 3H0GA 2R82A 4DV1H 2NU6B 2Y0SE 5FPOA 1M0WA 5D1OA 4ECTA 4DUYH 4EGQA 1KJ9A 5KFSA 1EYZA 3VPCA 3OSPA 2ASDA 2J6SA 3PW4A 2C35B 2JA6G 3BJYA 4J9PA 3M4IA 4MTEA 4BBRG 3MR5A 4F4XA 1VKZA 3HKZE 3M9MB 4O3NA 2HVRA 3QZ7A 5LXTF 3JSNA 4CC6A 3MFHA 4Q44A 2PMZA 2HHHH 3Q8RB 3UQ8A 1CQJB 3QFFA 3Q8PB 1UC8A 2BQRA 4GKJH 3LWBA 5KFRA 1T3NA 3PW0A 1RYRA 4IAJA 3M9NB 4DV5H 1SFOA 4A93G 2W9CA 4O2AF 4GC7A 4F4WA 2QK4A 4DLKA 4C5CA 3H0GG 3GIPA 4YJ2F 4IRKA 1W93A 2UXBH 3EPGA 1WH2A 4IR9A 3H3VH 2DWCA 2BR0A 4X62H 4A3MG 1J5EH 3DF7A 3HOXG 3GTGA 3IN5A 4QWBA 2UVWA 4JV5H 2YL2A 4IHJF 2W57A 2FK3A 2W9BA 1A9XA 2JEFA 5KFDA 3WNZA 3BQ2A 4O3SA 3BAAA 4A3CG 4NLGA 4ZOLF 3GV8B 3JZIA 1ZHSA 3MWDA 4O4IF 1I7LA 5DG7A 1BJTA 4FBUA 2FPIB 1GLVA 1JKJB 4WD3A 3GTJA 2R85A 4TUYF 5JUMA 5KFHA 2FB9A 1S0MA 3GTOA 2V59A 3T5HA 2ZDGA 2W6OA 2C22A 5KFGA 5JVLA 2ASLA 3K3PA 3N8DA 5KFEA 4C5BA 4XYLB 2HGSA 1E4GT 4YHHH 4DV0H 3FMAA 1HNWH 4FU0A 3EPIA 3MR6A 3RIZA 3PR4A 1N34H 2QYZA 3GIJA 3RB3A 2NVXA 2W7OA 1MZBA 4U6PA 4JI2H 3V6KA 4HQ6A 5IP9G 2DIKA 4E4TA 3RB0A 2YS6A 4R8UA 1AUXA 3J81W 4FM9A 5C4XG 4LFAH 3H20A 2E2IA 5KFAA 4MV3A 3L2PA 3HOVG 1DGSA 1S0NA 2JA5A 2J6TA 3G6YA 3RTXA 4ECYA 4J9LA 4EG0A 2R8JA 3RFCA 2UVUA 4LF9H 5KG7A 2VOBA 3OUUA 4PWQA 2E5LH 1FKAH 3V4ZA 2W9CB 2I80A 2FK2A 3VPDA 2PBZA 4WBNF 4RUAA 4RB0A 1Y14B 5LP6F 1KJQA 3FKIA 1TAEA 2HVSA 3GTMA 1GSAA 4Q8FA 3N40P 4GKKH 3ETHA 3JRWA 5GONF 4OX9H 2W9BB 4KHPH 4DV3H 4LF8H 4XYMB 2ZM6H 2R93A 1DV1A 4AQYH 4Q43A 4AYBE 1EZ1A 5DQGA 2R8HA 2VUMG 4DR3H 3QZ8A 4FBTA 2HJWA 4IZOA 3TIIA 3RUPA 4APMA 2RGRA 4RAYA 4RUCA 2JA5G 4O3OA 4YY3H 4HYKA 2R8KA 4O4HF 2VUMA 4DL2A 4A3FG 2YYAA 2WB1E 3Q2OA 2Y0SA 2C2DA 3U9TA 3PW2A 3I4MG 4J9OA 1DIKA 4BWSC 1I94H 5KFQA 3VPBA 3GIKA 4YR0A 2W6NA 2JA8G 3HOWG 2FMAA 5KFUA 5FPRA 3RJ0A 3FKIG 5J2TF 3HXLA 5KT4A 4IRCA 4QWDA 4RNMA 2BQ3A 3HKZA 1KC7A 2R7ZA 3L4KA 2FK1A 4UCRA 4HNTA 4JI8H 1SEIA 5F9LA 5KG3A 5H80A 2R93G 1P8LA 3JAMW 4B3SH 4ZHQF 4DR6H 3K3VA 4ECWA 4JYAH 2R8IA 3KHLA 2FJZA 1GSOA 2I8CA 2XD4A 3G6VA 4LF4H 4R8UB 2W70A 5LMUH 2AQ4A 3J7AK 1TWGA 5KFXA 4ECSA 3OUZA 3L4JA 5KFLA 5LOVF 4RNNA 3PR5B 3M9OB 2AGOA 1VBGA 3JSLA 4F50A 2NU8B 4MV7A 5KFZA 3GQCA 2MCTA 2V4RA 3T1YH 2UU9H 2JA7A 3WO0A 5KFPA 4JI5H 1PX2A 1VS0A 3LP8A 3RV4A 4A3BG 3K5IA 4A3GG 2V9WA 4J0MA 2V5AA 4UCTA 4A3LG 2C2RA 5LA6F 4DL6A 5KT2A 4MV1A 1GO3E 4O4LF 4YB8B 1M0TA 4C2MA 1M7JA 3GLKA 4RNOA 2AU0A 2R7ZG 3RGZA 5KT3A 4QWEA 1I6UA 2X0SA 2R86A 1W96A 2OH2A 5LMNH 1S0OA 2NU7B 4ED3A 3KHHA 4YJ3F 4J9MA 3N6XA 1IBMH 5L1LA 4ETSA 4GC6A 4B3MH 4A3IG 1EUCB 1E4EA 4BY1G 4DR1H 4ED6A 1Y1WG 3OHBA 4A3EG 1K83A 2RDJA 4C5AA 4X66H 5EWEA 3GIDA 2JA7G 3PO2G 1GGOA 3PN1A 2YRWA 5KG2A 4EFEA 4EYIB 5D1PA 4EGJA 2W8LA 3H40A 5IT9W 3HOUG 1V9PA 2KSWA 1V51A 1TWFA 4DL3A 3HBLA 1KBLA 4LSXA 1HNZH 1XMQH 3RB6A 4JV1A 4ME6A 4MV6A 5KT5A 2UUBH 2UXCH 2PN1A 2ZDQA 4RZQA 4B3RH 2C2EA 4A3JG 2UXDH 4FS2A 4QW9A 2W6MA 2YW2A 2IMWP 1L2ZA 2C00A 5A2QW 5BPHA 2R7LA 1ZETA 4A3KG 4UFZA 1RJQA 1BXRA 4UCOA 4BXXG 1GYFA 3RF2A 4QJFA 2NU9B 3MR3A 4UCSA 4DV2H 1T94A 4ECXA 3C0FB 5FLMG 4YQWA 1HNXH 2NVYA 1Y1WA 3GV5B 1RJRA 3RGXA 5KG5A 1FJGH 2WYOA 3VMMA 5F9NA 4O2BF 5D1OB 1KJ8A 1RK5A 3JRXA 2P0AA 2XGQA 3GILA 4DUZH 2ALZA 4AYBA 1IBKH 1Z2NX 3R5XA 1N32H 1RYSA 2AGQA 1B04A 3T1HH 4Y8VB 5DQIA 3GTQA 4A2BA 3GIMA 4MV4A 2W8KA 3I12A 5KFVA 5EWFA 3G8CA 4X64H 4RB1A 1N48A 4YAKB 2FKLA 2WB1A 4ED8A 4XX0B 4ED1A 4JUZA 3RBEA 4RZRA 5EWGA 4R7RA 4EEYA 1E4EB 2VPSA 5CAEB 2YZNA 5KFKA 1BNCA 2GLTA 1TA8A 5IYBG 4J9QA 1FVIA 1S10A 2Q2UA 1UNNC 4HNUA 3N43B 2R84A 3RBDA 1N36H 2IA6A 2DLNA 4MA5A 1X9NA 2RF4A 5DLGA 1Z2PX 4IWYA 3J80W 5KFJA 5DG9A 4QWAA 1IBLH 3U9SA 5KKNB 3ORQA 3V6HA 4HNVA 3GIQA 2W6ZA 1IOVA 1DV2A 4HR7A 2W71A 2UUCH 3R23A 3BQ0A 2RGVA 2IBKA 1CS0A 2FP4B 3R5FA 4MA0A 2JEGA 5DQHA 1OWTA 4I4TF 5KG0A 2YRXA 4LFCH 3HB9A 3GV7B 5IYCG 3H4BA 5KFWA 4ECUA 3MR2A 4O3QA 1XDNA 4NXNH 2CW8A 1WSCA 3MWMA 2FPGB 4YAJB 3HOYG 2WAQE 5DG8A 3IG0A 3KHGA 1RJPA 3LMLA 2C28A 5C3EG 1O75A 1JX4A 5IYZF 5EDWA 4I7HA 3OHAA 4JV0A 4F4YA 4RB3C 2W6PA 2J6UA 1BGWA 4IWXA 3KALA 1SCUB 4MV8A 5C44G 3RB4A 3RAXA 4MTDA 2FLNA 1TWCA 3CQZA 1XMOH 1ULZA 3PVXA 1XNRH 4YR2A 4GLXA 5D8DA 3R5HA 3PO3G 2VA2A 4QIWE 3F8NA 2YCHA 3MJFA 4EBCA 3N44B 2R92A 4RU9A 3NGDA 3GTLA 3TQ1A 1S68A 2ZDHA 4M9UA 3PW5A 1JIHA 1E4FT 2XCAA 5KFTA 5L1JA 2JEJA 1T36A 3KXYT 2VA3A 2VUGA 2B63A 2ZJTA 4XZ3B 4YBZB 5EZYF 3V4SA 4ED7A 1EHIA 4TV8F 2HVQA 4RB2C 2DPIA 1EUDB 1IOWA 5BR8H 2YU9A 2R7MA 4LH6A 5KFYA 2W7PA 2V58A 1N56A 4J9KA 2VQFH 3T5JA 1SYXB 5IWAH 3OSNA 2W9AA 4IRDA 1JLLB 5KFIA 4I55F 3KHRA 3AYHB 5KFMA 2O03A 1S9FA 2R92G 1TWHA 3T5KA 3OTOH 2FLLA 1ZHQA 5KFBA 4ECRA 5DLFA 2I87A 2SCUB 4DL4A 1B6SA 5I47A 3GTKA 1XNQH 3RV3A 1KJJA 4DV4H 2B63G 4G3IA 3E5NA 4TQSA 3Q1KA 4LH7A 2R6FA 4Q45A 5FLXW 4DR2H 1ZQ7A 1WCMA 2VPQA 4QWCA 5T14A 4EBEA 4A3DG 2YZGA 4JV2A 3BABA 5JVDF 4JI6H 2AGPA 1JXLA 5L1KA 4JI7H 3RAQA 4L1KA 5FJ8G 5LL6b 2UVVA 3Q8QB 2R7KA 5KX5F 1K1QA 2CQYA 1B6RA 4DL5A 4LF7H 1GSHA 2XCLA 3MWEA 5KG4A 5CB4F 2RDIA 5C8YF 4ECVA 1N33H 2R87A 4YR3A 3KTMA 5C1PA 1C30A 1JDEA 2E2HA 3SI8A 1Z2OX 2WDTA 2DPJA 4JI4H 4LSAA 3BA8A 4BY7G 1CE8A 3WO1A 4EBDA 2PMZE 1B33N 1KJIA 1WCMG 2Q2TA 2NUAB 2V4QA 3PW7A 2JEIA 1C3OA 1V4YA 2GPWA 2XIGA 4K0KH 5KFOA 4JI3H 1R9TA 4DR7H 2M05A 2ASJA 4U7CA 4ECQA 2BQUA 4J9NA 2GPSA 2WAQA 3TINA 2VQDA 4IR1A 5JQWA 4DV7H 2OLSA 4PDBA 4CC5A 5FD5A 2UVRA 4ECZA 1Y1VA 4DR5H 4EEQA 3KAKA 4X65H 4M7EA 5L1IA 4JI0H 3TIGA 4EYHB 5LYJF 5IYDG 3N42B
chains in the Genus database with same CATH topology
3N6XA 1IBMH 4RB3C 1BGWA 4ETSA 1S03G 4B3MH 3KALA 4DR1H 4Q0YA 4DV6H 4MTDA 1XMOH 1HR0H 4X66H 2CW7A 1XNRH 3CVZA 3PN1A 2HGSA 4GLXA 4EFEA 1E4GT 5D1PA 4YHHH 4DV0H 3F8NA 2YCHA 5IT9W 3FMAA 3N44B 1HNWH 1S68A 1V9PA 3N41B 3RIZA 2KSWA 4LMYA 1N34H 1E4FT 4LSXA 1HNZH 1MZBA 1XMQH 4NXMH 4JI2H 3KAJA 3EYYA 3KXYT 2VUGA 2ZJTA 2UUBH 2UXCH 4RZQA 3J81W 4FM9A 2HVQA 4RB2C 4LFAH 3H20A 4B3RH 2UXDH 5BR8H 3L2PA 4LH6A 1L2ZA 1DGSA 1A0IA 5A2QW 2VQFH 1SYXB 4B3TH 3RTXA 4UFZA 5IWAH 4UCOA 1GYFA 5EOYA 3RF2A 4LF9H 2VOBA 2UUAH 2O03A 2WE6A 1AN7A 4EFBA 2E5LH 1FKAH 4UCSA 4DV2H 3C0FB 4UCVA 1HNXH 4JI1H 5FD6A 4RB0A 3OTOH 1ZHQA 4UCUA 3BA9A 3RGXA 1TAEA 2WYOA 1FJGH 2HVSA 4LF5H 4MV9A 3N40P 4GKKH 5D1OB 1XNQH 4DV4H 4OX9H 4DUZH 2FE3A 4DV3H 4LF8H 4KHPH 2ZM6H 1IBKH 4LF6H 1Z2NX 4A2AA 4AQYH 1N32H 4LH7A 1B04A 3T1HH 2F4VH 4A2BA 4DR3H 4RAZA 5FLXW 4DR2H 4DR4H 4APMA 4X64H 4RB1A 4RAYA 2VQEH 2RGRA 4LFBH 4YY3H 2OWOA 3BABA 4JI6H 4JI7H 4R7RA 4DV1H 5LL6b 2VPSA 5FPOA 4BWSC 1I94H 1TA8A 1FVIA 1M0WA 5D1OA 2Q2UA 4DUYH 3N43B 4LF7H 1N36H 5FPRA 3RJ0A 1I6UA 1X9NA 3HXLA 1N33H 1Z2PX 3L4KA 3M4IA 4UCRA 4MTEA 3J80W 4JI8H 1SEIA 2HVRA 1IBLH 1Z2OX 2WDTA 4JI4H 3JSNA 1P8LA 4CC6A 3JAMW 2HHHH 4LSAA 3BA8A 4B3SH 3UQ8A 4DR6H 3K3VA 2Q2TA 2UUCH 4JYAH 4GKJH 2RGVA 4LF4H 5LMUH 4IAJA 4DV5H 3J7AK 3L4JA 2XIGA 4K0KH 3JSLA 4LFCH 2UXBH 4MV7A 4JI3H 2UU9H 2MCTA 1WH2A 3T1YH 4DR7H 4JI5H 1VS0A 1XDNA 4X62H 3DF7A 1J5EH 4NXNH 2CW8A 4J0MA 4UCTA 4JV5H 3MWMA 2W57A 4DV7H 3IG0A 4PDBA 4CC5A 1M0TA 3LMLA 5FD5A 3BAAA 3RGZA 4DR5H 1O75A 3KAKA 4EEQA 4M7EA 4X65H 4JI0H 4I7HA 1ZHSA 5LMNH 1BJTA 3N42B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSW A; 
#chains in the Genus database with same CATH topology
 5IP7 G;  2CKZ B;  1S03 G;  5BPF A;  5CA1 F;  4J9S A;  5HBR B;  5JH7 F;  5KG1 A;  1VAJ A;  4Q0Y A;  4DV6 H;  4DL7 A;  5CA0 F;  2R7N A;  3TQT A;  1HR0 H;  2CW7 A;  2R8G A;  5KT6 A;  3CVZ A;  1PK8 A;  1WR2 A;  4QIW A;  1I3Q A;  1I50 A;  2PVP A;  4BBS G;  4J9R A;  2W6Q A;  3I4N G;  4QW8 A;  3N41 B;  4LMY A;  2FLP A;  1Y1V G;  3GTP A;  4NXM H;  3UFX B;  3KAJ A;  3EYY A;  5DGA A;  1UC9 A;  1K1S A;  5J2U F;  5KFC A;  4ED0 A;  3K5H A;  5KFF A;  1KEE A;  5DGB A;  5BMV F;  4TQR A;  1VBH A;  2IP4 A;  2CZG A;  2XGP A;  2XCP A;  3GII A;  4I50 F;  1A0I A;  5L9X A;  2VR1 A;  3FDS A;  4B3T H;  2YS7 A;  1TWA A;  4Q8E A;  2ATL A;  1CQI B;  3H4D A;  5C5J A;  5EOY A;  1I7N A;  3BG5 A;  2UUA H;  2FPP B;  5K2M A;  3SE7 A;  2WE6 A;  1AN7 A;  3ORR A;  4EFB A;  3V6J A;  2XC9 A;  1JDB B;  4TV9 F;  3HOZ G;  5KG6 A;  3MFI A;  4UCV A;  4FS1 A;  4O3P A;  4JI1 H;  5FD6 A;  5C1O A;  4UCU A;  1RK6 A;  3BA9 A;  3Q8S B;  2JA6 A;  4LF5 H;  4MV9 A;  3ETJ A;  1AUV A;  5HV6 A;  4YP3 A;  4ED2 A;  4F4Z A;  3PZP A;  2FE3 A;  4O3R A;  4LF6 H;  4ZI7 F;  4A2A A;  2J9G A;  2YZM A;  4MAM A;  2WTF A;  1M6V A;  2F4V H;  4RAZ A;  5KT7 A;  4DR4 H;  3T5L A;  2VQE H;  3G6X A;  4LFB H;  1S97 A;  2OWO A;  5KFN A;  3BQ1 A;  4ZQI A;  2DZD A;  3H0G A;  2R82 A;  4DV1 H;  2NU6 B;  2Y0S E;  5FPO A;  1M0W A;  5D1O A;  4ECT A;  4DUY H;  4EGQ A;  1KJ9 A;  5KFS A;  1EYZ A;  3VPC A;  3OSP A;  2ASD A;  2J6S A;  3PW4 A;  2C35 B;  2JA6 G;  3BJY A;  4J9P A;  3M4I A;  4MTE A;  4BBR G;  3MR5 A;  4F4X A;  1VKZ A;  3HKZ E;  3M9M B;  4O3N A;  2HVR A;  3QZ7 A;  5LXT F;  3JSN A;  4CC6 A;  3MFH A;  4Q44 A;  2PMZ A;  2HHH H;  3Q8R B;  3UQ8 A;  1CQJ B;  3QFF A;  3Q8P B;  1UC8 A;  2BQR A;  4GKJ H;  3LWB A;  5KFR A;  1T3N A;  3PW0 A;  1RYR A;  4IAJ A;  3M9N B;  4DV5 H;  1SFO A;  4A93 G;  2W9C A;  4O2A F;  4GC7 A;  4F4W A;  2QK4 A;  4DLK A;  4C5C A;  3H0G G;  3GIP A;  4YJ2 F;  4IRK A;  1W93 A;  2UXB H;  3EPG A;  1WH2 A;  4IR9 A;  3H3V H;  2DWC A;  2BR0 A;  4X62 H;  4A3M G;  1J5E H;  3DF7 A;  3HOX G;  3GTG A;  3IN5 A;  4QWB A;  2UVW A;  4JV5 H;  2YL2 A;  4IHJ F;  2W57 A;  2FK3 A;  2W9B A;  1A9X A;  2JEF A;  5KFD A;  3WNZ A;  3BQ2 A;  4O3S A;  3BAA A;  4A3C G;  4NLG A;  4ZOL F;  3GV8 B;  3JZI A;  1ZHS A;  3MWD A;  4O4I F;  1I7L A;  5DG7 A;  1BJT A;  4FBU A;  2FPI B;  1GLV A;  1JKJ B;  4WD3 A;  3GTJ A;  2R85 A;  4TUY F;  5JUM A;  5KFH A;  2FB9 A;  1S0M A;  3GTO A;  2V59 A;  3T5H A;  2ZDG A;  2W6O A;  2C22 A;  5KFG A;  5JVL A;  2ASL A;  3K3P A;  3N8D A;  5KFE A;  4C5B A;  4XYL B;  2HGS A;  1E4G T;  4YHH H;  4DV0 H;  3FMA A;  1HNW H;  4FU0 A;  3EPI A;  3MR6 A;  3RIZ A;  3PR4 A;  1N34 H;  2QYZ A;  3GIJ A;  3RB3 A;  2NVX A;  2W7O A;  1MZB A;  4U6P A;  4JI2 H;  3V6K A;  4HQ6 A;  5IP9 G;  2DIK A;  4E4T A;  3RB0 A;  2YS6 A;  4R8U A;  1AUX A;  3J81 W;  4FM9 A;  5C4X G;  4LFA H;  3H20 A;  2E2I A;  5KFA A;  4MV3 A;  3L2P A;  3HOV G;  1DGS A;  1S0N A;  2JA5 A;  2J6T A;  3G6Y A;  3RTX A;  4ECY A;  4J9L A;  4EG0 A;  2R8J A;  3RFC A;  2UVU A;  4LF9 H;  5KG7 A;  2VOB A;  3OUU A;  4PWQ A;  2E5L H;  1FKA H;  3V4Z A;  2W9C B;  2I80 A;  2FK2 A;  3VPD A;  2PBZ A;  4WBN F;  4RUA A;  4RB0 A;  1Y14 B;  5LP6 F;  1KJQ A;  3FKI A;  1TAE A;  2HVS A;  3GTM A;  1GSA A;  4Q8F A;  3N40 P;  4GKK H;  3ETH A;  3JRW A;  5GON F;  4OX9 H;  2W9B B;  4KHP H;  4DV3 H;  4LF8 H;  4XYM B;  2ZM6 H;  2R93 A;  1DV1 A;  4AQY H;  4Q43 A;  4AYB E;  1EZ1 A;  5DQG A;  2R8H A;  2VUM G;  4DR3 H;  3QZ8 A;  4FBT A;  2HJW A;  4IZO A;  3TII A;  3RUP A;  4APM A;  2RGR A;  4RAY A;  4RUC A;  2JA5 G;  4O3O A;  4YY3 H;  4HYK A;  2R8K A;  4O4H F;  2VUM A;  4DL2 A;  4A3F G;  2YYA A;  2WB1 E;  3Q2O A;  2Y0S A;  2C2D A;  3U9T A;  3PW2 A;  3I4M G;  4J9O A;  1DIK A;  4BWS C;  1I94 H;  5KFQ A;  3VPB A;  3GIK A;  4YR0 A;  2W6N A;  2JA8 G;  3HOW G;  2FMA A;  5KFU A;  5FPR A;  3RJ0 A;  3FKI G;  5J2T F;  3HXL A;  5KT4 A;  4IRC A;  4QWD A;  4RNM A;  2BQ3 A;  3HKZ A;  1KC7 A;  2R7Z A;  3L4K A;  2FK1 A;  4UCR A;  4HNT A;  4JI8 H;  1SEI A;  5F9L A;  5KG3 A;  5H80 A;  2R93 G;  1P8L A;  3JAM W;  4B3S H;  4ZHQ F;  4DR6 H;  3K3V A;  4ECW A;  4JYA H;  2R8I A;  3KHL A;  2FJZ A;  1GSO A;  2I8C A;  2XD4 A;  3G6V A;  4LF4 H;  4R8U B;  2W70 A;  5LMU H;  2AQ4 A;  3J7A K;  1TWG A;  5KFX A;  4ECS A;  3OUZ A;  3L4J A;  5KFL A;  5LOV F;  4RNN A;  3PR5 B;  3M9O B;  2AGO A;  1VBG A;  3JSL A;  4F50 A;  2NU8 B;  4MV7 A;  5KFZ A;  3GQC A;  2MCT A;  2V4R A;  3T1Y H;  2UU9 H;  2JA7 A;  3WO0 A;  5KFP A;  4JI5 H;  1PX2 A;  1VS0 A;  3LP8 A;  3RV4 A;  4A3B G;  3K5I A;  4A3G G;  2V9W A;  4J0M A;  2V5A A;  4UCT A;  4A3L G;  2C2R A;  5LA6 F;  4DL6 A;  5KT2 A;  4MV1 A;  1GO3 E;  4O4L F;  4YB8 B;  1M0T A;  4C2M A;  1M7J A;  3GLK A;  4RNO A;  2AU0 A;  2R7Z G;  3RGZ A;  5KT3 A;  4QWE A;  1I6U A;  2X0S A;  2R86 A;  1W96 A;  2OH2 A;  5LMN H;  1S0O A;  2NU7 B;  4ED3 A;  3KHH A;  4YJ3 F;  4J9M A;  3N6X A;  1IBM H;  5L1L A;  4ETS A;  4GC6 A;  4B3M H;  4A3I G;  1EUC B;  1E4E A;  4BY1 G;  4DR1 H;  4ED6 A;  1Y1W G;  3OHB A;  4A3E G;  1K83 A;  2RDJ A;  4C5A A;  4X66 H;  5EWE A;  3GID A;  2JA7 G;  3PO2 G;  1GGO A;  3PN1 A;  2YRW A;  5KG2 A;  4EFE A;  4EYI B;  5D1P A;  4EGJ A;  2W8L A;  3H40 A;  5IT9 W;  3HOU G;  1V9P A;  2KSW A;  1V51 A;  1TWF A;  4DL3 A;  3HBL A;  1KBL A;  4LSX A;  1HNZ H;  1XMQ H;  3RB6 A;  4JV1 A;  4ME6 A;  4MV6 A;  5KT5 A;  2UUB H;  2UXC H;  2PN1 A;  2ZDQ A;  4RZQ A;  4B3R H;  2C2E A;  4A3J G;  2UXD H;  4FS2 A;  4QW9 A;  2W6M A;  2YW2 A;  2IMW P;  1L2Z A;  2C00 A;  5A2Q W;  5BPH A;  2R7L A;  1ZET A;  4A3K G;  4UFZ A;  1RJQ A;  1BXR A;  4UCO A;  4BXX G;  1GYF A;  3RF2 A;  4QJF A;  2NU9 B;  3MR3 A;  4UCS A;  4DV2 H;  1T94 A;  4ECX A;  3C0F B;  5FLM G;  4YQW A;  1HNX H;  2NVY A;  1Y1W A;  3GV5 B;  1RJR A;  3RGX A;  5KG5 A;  1FJG H;  2WYO A;  3VMM A;  5F9N A;  4O2B F;  5D1O B;  1KJ8 A;  1RK5 A;  3JRX A;  2P0A A;  2XGQ A;  3GIL A;  4DUZ H;  2ALZ A;  4AYB A;  1IBK H;  1Z2N X;  3R5X A;  1N32 H;  1RYS A;  2AGQ A;  1B04 A;  3T1H H;  4Y8V B;  5DQI A;  3GTQ A;  4A2B A;  3GIM A;  4MV4 A;  2W8K A;  3I12 A;  5KFV A;  5EWF A;  3G8C A;  4X64 H;  4RB1 A;  1N48 A;  4YAK B;  2FKL A;  2WB1 A;  4ED8 A;  4XX0 B;  4ED1 A;  4JUZ A;  3RBE A;  4RZR A;  5EWG A;  4R7R A;  4EEY A;  1E4E B;  2VPS A;  5CAE B;  2YZN A;  5KFK A;  1BNC A;  2GLT A;  1TA8 A;  5IYB G;  4J9Q A;  1FVI A;  1S10 A;  2Q2U A;  1UNN C;  4HNU A;  3N43 B;  2R84 A;  3RBD A;  1N36 H;  2IA6 A;  2DLN A;  4MA5 A;  1X9N A;  2RF4 A;  5DLG A;  1Z2P X;  4IWY A;  3J80 W;  5KFJ A;  5DG9 A;  4QWA A;  1IBL H;  3U9S A;  5KKN B;  3ORQ A;  3V6H A;  4HNV A;  3GIQ A;  2W6Z A;  1IOV A;  1DV2 A;  4HR7 A;  2W71 A;  2UUC H;  3R23 A;  3BQ0 A;  2RGV A;  2IBK A;  1CS0 A;  2FP4 B;  3R5F A;  4MA0 A;  2JEG A;  5DQH A;  1OWT A;  4I4T F;  5KG0 A;  2YRX A;  4LFC H;  3HB9 A;  3GV7 B;  5IYC G;  3H4B A;  5KFW A;  4ECU A;  3MR2 A;  4O3Q A;  1XDN A;  4NXN H;  2CW8 A;  1WSC A;  3MWM A;  2FPG B;  4YAJ B;  3HOY G;  2WAQ E;  5DG8 A;  3IG0 A;  3KHG A;  1RJP A;  3LML A;  2C28 A;  5C3E G;  1O75 A;  1JX4 A;  5IYZ F;  5EDW A;  4I7H A;  3OHA A;  4JV0 A;  4F4Y A;  4RB3 C;  2W6P A;  2J6U A;  1BGW A;  4IWX A;  3KAL A;  1SCU B;  4MV8 A;  5C44 G;  3RB4 A;  3RAX A;  4MTD A;  2FLN A;  1TWC A;  3CQZ A;  1XMO H;  1ULZ A;  3PVX A;  1XNR H;  4YR2 A;  4GLX A;  5D8D A;  3R5H A;  3PO3 G;  2VA2 A;  4QIW E;  3F8N A;  2YCH A;  3MJF A;  4EBC A;  3N44 B;  2R92 A;  4RU9 A;  3NGD A;  3GTL A;  3TQ1 A;  1S68 A;  2ZDH A;  4M9U A;  3PW5 A;  1JIH A;  1E4F T;  2XCA A;  5KFT A;  5L1J A;  2JEJ A;  1T36 A;  3KXY T;  2VA3 A;  2VUG A;  2B63 A;  2ZJT A;  4XZ3 B;  4YBZ B;  5EZY F;  3V4S A;  4ED7 A;  1EHI A;  4TV8 F;  2HVQ A;  4RB2 C;  2DPI A;  1EUD B;  1IOW A;  5BR8 H;  2YU9 A;  2R7M A;  4LH6 A;  5KFY A;  2W7P A;  2V58 A;  1N56 A;  4J9K A;  2VQF H;  3T5J A;  1SYX B;  5IWA H;  3OSN A;  2W9A A;  4IRD A;  1JLL B;  5KFI A;  4I55 F;  3KHR A;  3AYH B;  5KFM A;  2O03 A;  1S9F A;  2R92 G;  1TWH A;  3T5K A;  3OTO H;  2FLL A;  1ZHQ A;  5KFB A;  4ECR A;  5DLF A;  2I87 A;  2SCU B;  4DL4 A;  1B6S A;  5I47 A;  3GTK A;  1XNQ H;  3RV3 A;  1KJJ A;  4DV4 H;  2B63 G;  4G3I A;  3E5N A;  4TQS A;  3Q1K A;  4LH7 A;  2R6F A;  4Q45 A;  5FLX W;  4DR2 H;  1ZQ7 A;  1WCM A;  2VPQ A;  4QWC A;  5T14 A;  4EBE A;  4A3D G;  2YZG A;  4JV2 A;  3BAB A;  5JVD F;  4JI6 H;  2AGP A;  1JXL A;  5L1K A;  4JI7 H;  3RAQ A;  4L1K A;  5FJ8 G;  5LL6 b;  2UVV A;  3Q8Q B;  2R7K A;  5KX5 F;  1K1Q A;  2CQY A;  1B6R A;  4DL5 A;  4LF7 H;  1GSH A;  2XCL A;  3MWE A;  5KG4 A;  5CB4 F;  2RDI A;  5C8Y F;  4ECV A;  1N33 H;  2R87 A;  4YR3 A;  3KTM A;  5C1P A;  1C30 A;  1JDE A;  2E2H A;  3SI8 A;  1Z2O X;  2WDT A;  2DPJ A;  4JI4 H;  4LSA A;  3BA8 A;  4BY7 G;  1CE8 A;  3WO1 A;  4EBD A;  2PMZ E;  1B33 N;  1KJI A;  1WCM G;  2Q2T A;  2NUA B;  2V4Q A;  3PW7 A;  2JEI A;  1C3O A;  1V4Y A;  2GPW A;  2XIG A;  4K0K H;  5KFO A;  4JI3 H;  1R9T A;  4DR7 H;  2M05 A;  2ASJ A;  4U7C A;  4ECQ A;  2BQU A;  4J9N A;  2GPS A;  2WAQ A;  3TIN A;  2VQD A;  4IR1 A;  5JQW A;  4DV7 H;  2OLS A;  4PDB A;  4CC5 A;  5FD5 A;  2UVR A;  4ECZ A;  1Y1V A;  4DR5 H;  4EEQ A;  3KAK A;  4X65 H;  4M7E A;  5L1I A;  4JI0 H;  3TIG A;  4EYH B;  5LYJ F;  5IYD G;  3N42 B; 
#chains in the Genus database with same CATH homology
 3N6X A;  1IBM H;  4RB3 C;  1BGW A;  4ETS A;  1S03 G;  4B3M H;  3KAL A;  4DR1 H;  4Q0Y A;  4DV6 H;  4MTD A;  1XMO H;  1HR0 H;  4X66 H;  2CW7 A;  1XNR H;  3CVZ A;  3PN1 A;  2HGS A;  4GLX A;  4EFE A;  1E4G T;  5D1P A;  4YHH H;  4DV0 H;  3F8N A;  2YCH A;  5IT9 W;  3FMA A;  3N44 B;  1HNW H;  1S68 A;  1V9P A;  3N41 B;  3RIZ A;  2KSW A;  4LMY A;  1N34 H;  1E4F T;  4LSX A;  1HNZ H;  1MZB A;  1XMQ H;  4NXM H;  4JI2 H;  3KAJ A;  3EYY A;  3KXY T;  2VUG A;  2ZJT A;  2UUB H;  2UXC H;  4RZQ A;  3J81 W;  4FM9 A;  2HVQ A;  4RB2 C;  4LFA H;  3H20 A;  4B3R H;  2UXD H;  5BR8 H;  3L2P A;  4LH6 A;  1L2Z A;  1DGS A;  1A0I A;  5A2Q W;  2VQF H;  1SYX B;  4B3T H;  3RTX A;  4UFZ A;  5IWA H;  4UCO A;  1GYF A;  5EOY A;  3RF2 A;  4LF9 H;  2VOB A;  2UUA H;  2O03 A;  2WE6 A;  1AN7 A;  4EFB A;  2E5L H;  1FKA H;  4UCS A;  4DV2 H;  3C0F B;  4UCV A;  1HNX H;  4JI1 H;  5FD6 A;  4RB0 A;  3OTO H;  1ZHQ A;  4UCU A;  3BA9 A;  3RGX A;  1TAE A;  2WYO A;  1FJG H;  2HVS A;  4LF5 H;  4MV9 A;  3N40 P;  4GKK H;  5D1O B;  1XNQ H;  4DV4 H;  4OX9 H;  4DUZ H;  2FE3 A;  4DV3 H;  4LF8 H;  4KHP H;  2ZM6 H;  1IBK H;  4LF6 H;  1Z2N X;  4A2A A;  4AQY H;  1N32 H;  4LH7 A;  1B04 A;  3T1H H;  2F4V H;  4A2B A;  4DR3 H;  4RAZ A;  5FLX W;  4DR2 H;  4DR4 H;  4APM A;  4X64 H;  4RB1 A;  4RAY A;  2VQE H;  2RGR A;  4LFB H;  4YY3 H;  2OWO A;  3BAB A;  4JI6 H;  4JI7 H;  4R7R A;  4DV1 H;  5LL6 b;  2VPS A;  5FPO A;  4BWS C;  1I94 H;  1TA8 A;  1FVI A;  1M0W A;  5D1O A;  2Q2U A;  4DUY H;  3N43 B;  4LF7 H;  1N36 H;  5FPR A;  3RJ0 A;  1I6U A;  1X9N A;  3HXL A;  1N33 H;  1Z2P X;  3L4K A;  3M4I A;  4UCR A;  4MTE A;  3J80 W;  4JI8 H;  1SEI A;  2HVR A;  1IBL H;  1Z2O X;  2WDT A;  4JI4 H;  3JSN A;  1P8L A;  4CC6 A;  3JAM W;  2HHH H;  4LSA A;  3BA8 A;  4B3S H;  3UQ8 A;  4DR6 H;  3K3V A;  2Q2T A;  2UUC H;  4JYA H;  4GKJ H;  2RGV A;  4LF4 H;  5LMU H;  4IAJ A;  4DV5 H;  3J7A K;  3L4J A;  2XIG A;  4K0K H;  3JSL A;  4LFC H;  2UXB H;  4MV7 A;  4JI3 H;  2UU9 H;  2MCT A;  1WH2 A;  3T1Y H;  4DR7 H;  4JI5 H;  1VS0 A;  1XDN A;  4X62 H;  3DF7 A;  1J5E H;  4NXN H;  2CW8 A;  4J0M A;  4UCT A;  4JV5 H;  3MWM A;  2W57 A;  4DV7 H;  3IG0 A;  4PDB A;  4CC5 A;  1M0T A;  3LML A;  5FD5 A;  3BAA A;  3RGZ A;  4DR5 H;  1O75 A;  3KAK A;  4EEQ A;  4M7E A;  4X65 H;  4JI0 H;  4I7H A;  1ZHS A;  5LMN H;  1BJT A;  3N42 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...