2KSWA

Backbone 1h, 13c, and 15n chemical shift assignments for oryctin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
VPVGSDCEPKLCTMDLVPHCFLNPEKGIVVVHGGCALSKYKCQNPNHEKLGYTHECEEAIKNAPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isolation, cDNA cloning, and structure-based functional characterization of oryctin, a hemolymph protein from the coconut rhinoceros beetle, Oryctes rhinoceros, as a novel serine protease inhibitor
pubmed doi rcsb
source organism Oryctes rhinoceros
molecule tags Hydrolase inhibitor
molecule keywords Oryctin
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.260 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2kswA01
2KSWA
chains in the Genus database with same CATH superfamily
2ZDQA 3KAKA 1N36H 2I80A 2XCPA 4RB3C 4YQWA 1I6UA 4J9QA 1VBHA 4TQRA 3IG0A 1B04A 1RYSA 1TWAA 4YBZB 1B6RA 5F9NA 4JI4H 1CE8A 4HR7A 4O3QA 2YCHA 4EFEA 5FLMG 4Y8VB 4JV1A 4HQ6A 2FJZA 2C2RA 3HOZG 2BQRA 3H4DA 4F4YA 4EBEA 4IRCA 2W9AA 2HGSA 2NU6B 5FPOA 1HNZH 2VA2A 3ORRA 1JDEA 3H4BA 3BABA 2VQFH 2Q2UA 2WAQE 1PX2A 2C22A 1S9FA 4LFAH 2R8GA 4JI2H 4MV4A 4DR1H 2JA5G 5IYDG 4J0MA 2ATLA 4Q8EA 5KG3A 4DL3A 1B6SA 4I7HA 4GKJH 4RB0A 3H40A 4A3CG 3J80W 3M4IA 4RNMA 5KFBA 3LMLA 4IRDA 1UC8A 4RNOA 4ED0A 5IYZF 4ZQIA 2C35B 4ED1A 4GC7A 4JI1H 3RFCA 1S10A 3AYHB 3T5HA 4FBTA 4R7RA 4A2BA 4HYKA 4DL4A 1J5EH 5D1PA 4LSXA 2NU9B 1UC9A 4ME6A 4FS1A 4ECUA 5KT7A 3JSNA 4B3MH 5KG2A 4DUZH 1GGOA 2JA6G 5KFRA 2UVRA 4EYIB 5K2MA 3TIGA 2YW2A 2CKZB 5FD6A 1KEEA 5FD5A 2WE6A 4UFZA 1X9NA 3HOUG 2NVXA 1Y1VG 1Y14B 4XYLB 3BG5A 3GTKA 3GV7B 3T5KA 1S0OA 4MV7A 1S0NA 2V9WA 3MR3A 1VBGA 4LF5H 5KT4A 2RGVA 5KG1A 1EHIA 2PVPA 1DV1A 3R5FA 2AGPA 3HOXG 4CC6A 4EBCA 3OUUA 3GIKA 2R7LA 4DR5H 2YL2A 5KFSA 5HV6A 3L4JA 4MAMA 3OHBA 1B33N 3GTLA 2GPSA 4IZOA 4BXXG 2YRXA 1DV2A 4MTDA 3H3VH 1VS0A 3RB6A 4LF4H 5FLXW 2W6MA 2DZDA 2W7OA 1M6VA 1WCMA 2YS7A 3GIPA 5KFGA 1IOVA 1RK6A 2C28A 4A93G 2IMWP 3PZPA 4YJ3F 4RNNA 2R7ZG 2R93G 1VKZA 4QIWA 4A3IG 1EYZA 4QWEA 2UUBH 2FE3A 4O3NA 3H0GA 2R92A 2NUAB 1V51A 3KALA 2JEIA 1HNXH 5I47A 3V6HA 2GLTA 1XNQH 3Q8QB 2PMZE 3WO1A 2W9CA 1WR2A 2R7KA 2W6PA 5BPHA 4A2AA 1MZBA 4I50F 4JI5H 5LP6F 1K1QA 2UVWA 2J6UA 1E4GT 2FLPA 1ULZA 4O4HF 3GQCA 4I55F 5C4XG 5KFTA 3JSLA 4X62H 2YZMA 4WBNF 2VA3A 4QWCA 4QW8A 1N48A 2JA7A 3OSNA 4ED3A 1DGSA 2FKLA 1RYRA 2VUMA 1XNRH 1UNNC 4UCRA 5KX5F 4GC6A 4Q44A 2OLSA 1K83A 3GTOA 4A3EG 5BMVF 4X66H 2FPGB 1Y1WG 5EWFA 2JEGA 2R87A 3H0GG 4ED2A 1TWCA 2IBKA 3HKZE 2W6OA 3KHRA 3VPCA 1GO3E 3HKZA 2OWOA 3RTXA 4RB2C 5JVLA 3ORQA 5IWAH 4TV8F 3FMAA 5L1LA 2J6TA 2FPPB 4AYBA 3RV3A 3Q8SB 2ASDA 4J9SA 4MTEA 2YRWA 5KFQA 3MFHA 1TAEA 2V5AA 3FKIG 3N6XA 3BQ0A 1BGWA 3OSPA 3KTMA 1JXLA 3I12A 4QWAA 4QJFA 5LYJF 5C8YF 5IP9G 1E4FT 4FBUA 5L9XA 2DIKA 3T1HH 1KJ8A 5KFIA 5LL6b 4PDBA 3GTPA 1JLLB 1T3NA 3RB0A 3MWMA 3MWDA 5D1OB 3RF2A 2HVRA 2C2EA 1S0MA 2DPIA 1W96A 3BQ1A 4A3GG 2XIGA 1FKAH 4DV1H 1Y1VA 3Q2OA 5LMUH 2NU8B 4LSAA 4HNVA 5C1PA 4I4TF 4EEQA 4RZRA 2BR0A 2R8JA 3N43B 4DR4H 5DLGA 4RAYA 5DGAA 5LMNH 4ZOLF 5KFHA 1BJTA 2W71A 3K3VA 4C5BA 5DLFA 4YAKB 2YYAA 5F9LA 4DV0H 5HBRB 3MJFA 3RBEA 1IBLH 4NLGA 2VUMG 4DV3H 3PO3G 5C3EG 2X0SA 2XC9A 1FVIA 1IOWA 5L1JA 2PBZA 2F4VH 4MA0A 2R6FA 3K5IA 3J7AK 4RZQA 5KFJA 4YHHH 1Y1WA 4DV5H 3GIMA 4R8UA 3G6VA 2NVYA 5KFUA 1N56A 2R86A 2JA8G 3V6KA 5KFPA 1N33H 1IBKH 3TINA 3NGDA 4JI0H 4MV1A 5KT5A 4O3SA 4EEYA 1JX4A 2XD4A 1AUXA 3U9TA 2W9BB 3PR4A 4O3PA 1E4EB 4EGJA 4B3TH 1I94H 5LOVF 1VAJA 3HXLA 3EPGA 4IR1A 2WDTA 1JIHA 5KT2A 4APMA 5DQGA 3Q8RB 1ZETA 2W6ZA 5FPRA 3SI8A 4UCSA 1RJRA 4HNUA 5KFWA 1XMQH 3V6JA 2CW8A 2V58A 2VOBA 2Y0SE 5KT6A 3TQTA 4X65H 2AGQA 4LFBH 4O4LF 3VPBA 4M9UA 4EFBA 4J9KA 2R92G 4GKKH 4QWBA 3JRWA 5C44G 4IRKA 2R93A 1SYXB 2V59A 2BQ3A 2AQ4A 3T1YH 4X64H 1V4YA 1JDBB 5KFDA 1N32H 3ETJA 4IWXA 4O3RA 5KG0A 2WYOA 2FK2A 3PW7A 2C2DA 5CA0F 1C3OA 5CB4F 4YR2A 1ZHQA 3GTMA 5EDWA 2WTFA 2DPJA 5KFXA 5CA1F 1IBMH 3BA8A 4ECSA 3RIZA 4MV6A 4JI3H 2DWCA 3FKIA 4LF9H 4QWDA 3VMMA 5IYCG 2CW7A 2UXBH 2E2HA 5BPFA 2AU0A 2IP4A 4ZHQF 1I3QA 4EGQA 2HJWA 2MCTA 3GIDA 5KFZA 4J9MA 1S68A 3QFFA 2R82A 2FB9A 2VPQA 1M0WA 4K0KH 5KFFA 3KHLA 4YR3A 1ZQ7A 1GSOA 3MR5A 3MR6A 4DV4H 2BQUA 3CVZA 4WD3A 1A9XA 1I50A 5DQHA 4DL6A 4TUYF 1M0TA 1RJPA 3C0FB 4YJ2F 2R7MA 2WB1A 3PVXA 2JA6A 1CQIB 5KFNA 3OHAA 4F4ZA 2WAQA 1KC7A 5KFCA 4U7CA 3BA9A 2ZDGA 5BR8H 3GILA 4DV6H 2JA7G 1KJ9A 3TQ1A 5LXTF 4BY1G 5KFOA 4TV9F 4UCOA 5KG5A 3FDSA 2UXCH 1CQJB 4F50A 1EZ1A 2JEFA 2PMZA 2R84A 5IP7G 3QZ8A 5KG4A 4ED7A 1A0IA 2W70A 1FJGH 2Y0SA 2V4RA 4A3BG 5D1OA 3JAMW 1E4EA 1TWHA 3M9OB 1M7JA 4DL2A 1GYFA 1WH2A 5H80A 1KBLA 5KFLA 3RGZA 4DR3H 4A3LG 4BWSC 2UVUA 2JA5A 2CQYA 2DLNA 4JI8H 4O3OA 4Q43A 4BY7G 5J2UF 4J9PA 5KFEA 2VQDA 5T14A 4ECYA 3R23A 2R8IA 2YS6A 2XGQA 3N42B 5DG7A 2R7ZA 4MV9A 2JEJA 1GSAA 2RF4A 4IHJF 1WCMG 4MV3A 3RGXA 4A3JG 4LFCH 4CC5A 5KFYA 4DR6H 3GLKA 3N41B 4LMYA 2XGPA 1P8LA 4FS2A 4ECVA 4EYHB 2ZM6H 3DF7A 4ECZA 5JH7F 3SE7A 2ZDHA 2B63G 4FU0A 5CAEB 4DL7A 2W9BA 1PK8A 4DR7H 2OH2A 3LP8A 3J81W 4IWYA 1BNCA 3JRXA 3RAQA 2AGOA 4B3SH 4A3MG 3PN1A 1KJIA 1SEIA 4M7EA 4YP3A 1CS0A 3RB4A 4KHPH 2ZJTA 4IR9A 4C5AA 3JZIA 4JV0A 5DG9A 3L4KA 3MFIA 4JV5H 1V9PA 3N8DA 3WNZA 2YZGA 5KKNB 3U9SA 4HNTA 1C30A 2O03A 3KAJA 3KHHA 1R9TA 2ASJA 1SCUB 4DLKA 1OWTA 4O4IF 3BQ2A 1RK5A 1L2ZA 1EUDB 3LWBA 2FK3A 4BBSG 3I4MG 1Z2NX 5C5JA 4PWQA 2E5LH 3EYYA 1TA8A 3GIIA 3KHGA 2W9CB 3GIJA 4JYAH 3RBDA 4ED8A 2UUAH 4JI6H 3HOVG 4YB8B 3HB9A 3RUPA 2RGRA 4Q8FA 2SCUB 2XCLA 4LH7A 2P0AA 4XX0B 2HVSA 2YU9A 4LF8H 3E5NA 4J9OA 3GV5B 2J9GA 3K5HA 2V4QA 1AN7A 4Q0YA 5KFKA 5JUMA 4DV7H 3UQ8A 2CZGA 5KT3A 4DV2H 4F4XA 2FK1A 3EPIA 3V4ZA 4AYBE 3RV4A 4ZI7F 2RDIA 4F4WA 5J2TF 2UVVA 4LH6A 2W7PA 2YZNA 4OX9H 4XZ3B 5KFMA 3L2PA 3V4SA 4EBDA 2R85A 4O2BF 4YY3H 4G3IA 2M05A 1KJQA 5KG7A 4YR0A 5EZYF 1TWGA 5KFVA 3PR5B 2HHHH 2VR1A 4E4TA 5GONF 3CQZA 1GSHA 4ECXA 3GTGA 2ASLA 3HOWG 2ALZA 1DIKA 3M9MB 1GLVA 3MR2A 4J9LA 3GTJA 5C1OA 3F8NA 2FLNA 2UUCH 1O75A 4LF6H 2VQEH 4QIWE 1XMOH 4B3RH 2QYZA 4ETSA 4ECTA 3I4NG 4LF7H 2RDJA 2VPSA 3H20A 2PN1A 2B63A 5DGBA 5EWGA 4A3KG 4DR2H 4IAJA 2I87A 4XYMB 5L1KA 3T5LA 3ETHA 5L1IA 1I7NA 5EWEA 3M9NB 4UCVA 4MA5A 1T36A 3Q8PB 4BBRG 2E2IA 5D8DA 3T5JA 2FPIB 4L1KA 3PW4A 4DL5A 3N44B 5DQIA 5IYBG 1TWFA 5A2QW 4ECQA 4ED6A 3Q1KA 2Q2TA 1N34H 3PW0A 4ECRA 2R7NA 4RUCA 2VUGA 3BJYA 4Q45A 4NXMH 2QK4A 4TQSA 3QZ7A 5IT9W 3R5XA 2FLLA 1S03G 1SFOA 4EG0A 2R8HA 3G6XA 3PW2A 3MWEA 3WO0A 4C2MA 5FJ8G 5EOYA 2I8CA 4GLXA 4J9NA 3BAAA 3KXYT 3GIQA 3PW5A 2R8KA 2KSWA 2FMAA 2UXDH 2W6QA 1RJQA 1ZHSA 1HR0H 3UFXB 3RB3A 1AUVA 3TIIA 3G8CA 4FM9A 3OTOH 4J9RA 2W8KA 2GPWA 3VPDA 4RB1A 1T94A 1EUCB 4AQYH 4A3DG 1KJJA 3K3PA 3GTQA 2XCAA 2WB1E 5KFAA 3HOYG 3R5HA 1I7LA 3RJ0A 3N40P 1WSCA 3PO2G 4YAJB 4UCUA 4DUYH 5JVDF 2FP4B 4C5CA 2W57A 3IN5A 1K1SA 2W6NA 4RAZA 2UU9H 4O2AF 1HNWH 1Z2PX 2IA6A 4U6PA 5KG6A 4ECWA 2C00A 3OUZA 3GV8B 4QW9A 1Z2OX 4JV2A 4JUZA 1XDNA 4RU9A 4A3FG 2W8LA 3G6YA 1W93A 4R8UB 1JKJB 4RUAA 4MV8A 1BXRA 2J6SA 3HBLA 4UCTA 5JQWA 1S97A 2NU7B 4NXNH 4JI7H 5DG8A 5LA6F 2HVQA 3RAXA
chains in the Genus database with same CATH topology
4X64H 3JSLA 3KAKA 1N36H 4X62H 1N32H 1AN7A 4Q0YA 4RB3C 4DV7H 2WYOA 3UQ8A 1DGSA 4DV2H 1I6UA 1XNRH 1ZHQA 3IG0A 4UCRA 1B04A 1IBMH 4LH6A 3BA8A 4JI4H 3RIZA 4LF9H 4OX9H 2YCHA 4EFEA 4X66H 3L2PA 2CW7A 2UXBH 4YY3H 2MCTA 2HHHH 2HGSA 2OWOA 5FPOA 3RTXA 1S68A 4RB2C 1HNZH 5IWAH 3BABA 2VQFH 3FMAA 2Q2UA 1M0WA 4K0KH 4LFAH 4MTEA 4JI2H 3N6XA 1TAEA 4DV4H 3CVZA 3F8NA 1BGWA 4DR1H 4J0MA 1M0TA 3C0FB 2UUCH 1O75A 4LF6H 2VQEH 1XMOH 4B3RH 4ETSA 4I7HA 4LF7H 4GKJH 1E4FT 5BR8H 4RB0A 3BA9A 2VPSA 3H20A 4DV6H 3J80W 3M4IA 3T1HH 3LMLA 4UCOA 5LL6b 4PDBA 2UXCH 4DR2H 4IAJA 3MWMA 5D1OB 3RF2A 2HVRA 4JI1H 1A0IA 4R7RA 4A2BA 2XIGA 1FJGH 1J5EH 5D1PA 4LSXA 1FKAH 4DV1H 4UCVA 5D1OA 3JAMW 5LMUH 3JSNA 4B3MH 1GYFA 4LSAA 4DUZH 1WH2A 3RGZA 4DR3H 4EEQA 4BWSC 3N44B 3N43B 2Q2TA 5A2QW 4DR4H 4RAYA 4JI8H 5LMNH 1N34H 1BJTA 3K3VA 5FD6A 5FD5A 2VUGA 4DV0H 5IT9W 4NXMH 2WE6A 4UFZA 1X9NA 1IBLH 3N42B 1S03G 4DV3H 4MV9A 1FVIA 2F4VH 4LF5H 4LFCH 4MV7A 3RGXA 4CC5A 3J7AK 4DR6H 2RGVA 3N41B 4LMYA 4RZQA 1P8LA 5EOYA 4YHHH 4DV5H 4GLXA 3BAAA 3KXYT 2KSWA 4CC6A 2ZM6H 2UXDH 1HR0H 1ZHSA 3DF7A 4DR5H 1N33H 3L4JA 4FM9A 1IBKH 4JI0H 3OTOH 4DR7H 3J81W 4RB1A 4AQYH 4B3SH 4MTDA 3PN1A 1SEIA 4M7EA 1VS0A 4B3TH 4LF4H 2ZJTA 5FLXW 4KHPH 1I94H 3RJ0A 3L4KA 3HXLA 3N40P 2WDTA 4JV5H 1V9PA 4UCUA 4APMA 4DUYH 5FPRA 4UCSA 3KAJA 2O03A 2W57A 4RAZA 2UU9H 2UUBH 1HNWH 1XMQH 1Z2PX 2FE3A 1L2ZA 2CW8A 2VOBA 4X65H 3KALA 4LFBH 1Z2NX 1HNXH 1Z2OX 2E5LH 1XNQH 1XDNA 3EYYA 4EFBA 1TA8A 4GKKH 4JYAH 2UUAH 4JI6H 4A2AA 1MZBA 1SYXB 4JI5H 2RGRA 4UCTA 4NXNH 1E4GT 4LH7A 2HVSA 4JI7H 3T1YH 4LF8H 2HVQA 4JI3H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSW A; 
#chains in the Genus database with same CATH topology
 2ZDQ A;  3KAK A;  1N36 H;  2I80 A;  2XCP A;  4RB3 C;  4YQW A;  1I6U A;  4J9Q A;  1VBH A;  4TQR A;  3IG0 A;  1B04 A;  1RYS A;  1TWA A;  4YBZ B;  1B6R A;  5F9N A;  4JI4 H;  1CE8 A;  4HR7 A;  4O3Q A;  2YCH A;  4EFE A;  5FLM G;  4Y8V B;  4JV1 A;  4HQ6 A;  2FJZ A;  2C2R A;  3HOZ G;  2BQR A;  3H4D A;  4F4Y A;  4EBE A;  4IRC A;  2W9A A;  2HGS A;  2NU6 B;  5FPO A;  1HNZ H;  2VA2 A;  3ORR A;  1JDE A;  3H4B A;  3BAB A;  2VQF H;  2Q2U A;  2WAQ E;  1PX2 A;  2C22 A;  1S9F A;  4LFA H;  2R8G A;  4JI2 H;  4MV4 A;  4DR1 H;  2JA5 G;  5IYD G;  4J0M A;  2ATL A;  4Q8E A;  5KG3 A;  4DL3 A;  1B6S A;  4I7H A;  4GKJ H;  4RB0 A;  3H40 A;  4A3C G;  3J80 W;  3M4I A;  4RNM A;  5KFB A;  3LML A;  4IRD A;  1UC8 A;  4RNO A;  4ED0 A;  5IYZ F;  4ZQI A;  2C35 B;  4ED1 A;  4GC7 A;  4JI1 H;  3RFC A;  1S10 A;  3AYH B;  3T5H A;  4FBT A;  4R7R A;  4A2B A;  4HYK A;  4DL4 A;  1J5E H;  5D1P A;  4LSX A;  2NU9 B;  1UC9 A;  4ME6 A;  4FS1 A;  4ECU A;  5KT7 A;  3JSN A;  4B3M H;  5KG2 A;  4DUZ H;  1GGO A;  2JA6 G;  5KFR A;  2UVR A;  4EYI B;  5K2M A;  3TIG A;  2YW2 A;  2CKZ B;  5FD6 A;  1KEE A;  5FD5 A;  2WE6 A;  4UFZ A;  1X9N A;  3HOU G;  2NVX A;  1Y1V G;  1Y14 B;  4XYL B;  3BG5 A;  3GTK A;  3GV7 B;  3T5K A;  1S0O A;  4MV7 A;  1S0N A;  2V9W A;  3MR3 A;  1VBG A;  4LF5 H;  5KT4 A;  2RGV A;  5KG1 A;  1EHI A;  2PVP A;  1DV1 A;  3R5F A;  2AGP A;  3HOX G;  4CC6 A;  4EBC A;  3OUU A;  3GIK A;  2R7L A;  4DR5 H;  2YL2 A;  5KFS A;  5HV6 A;  3L4J A;  4MAM A;  3OHB A;  1B33 N;  3GTL A;  2GPS A;  4IZO A;  4BXX G;  2YRX A;  1DV2 A;  4MTD A;  3H3V H;  1VS0 A;  3RB6 A;  4LF4 H;  5FLX W;  2W6M A;  2DZD A;  2W7O A;  1M6V A;  1WCM A;  2YS7 A;  3GIP A;  5KFG A;  1IOV A;  1RK6 A;  2C28 A;  4A93 G;  2IMW P;  3PZP A;  4YJ3 F;  4RNN A;  2R7Z G;  2R93 G;  1VKZ A;  4QIW A;  4A3I G;  1EYZ A;  4QWE A;  2UUB H;  2FE3 A;  4O3N A;  3H0G A;  2R92 A;  2NUA B;  1V51 A;  3KAL A;  2JEI A;  1HNX H;  5I47 A;  3V6H A;  2GLT A;  1XNQ H;  3Q8Q B;  2PMZ E;  3WO1 A;  2W9C A;  1WR2 A;  2R7K A;  2W6P A;  5BPH A;  4A2A A;  1MZB A;  4I50 F;  4JI5 H;  5LP6 F;  1K1Q A;  2UVW A;  2J6U A;  1E4G T;  2FLP A;  1ULZ A;  4O4H F;  3GQC A;  4I55 F;  5C4X G;  5KFT A;  3JSL A;  4X62 H;  2YZM A;  4WBN F;  2VA3 A;  4QWC A;  4QW8 A;  1N48 A;  2JA7 A;  3OSN A;  4ED3 A;  1DGS A;  2FKL A;  1RYR A;  2VUM A;  1XNR H;  1UNN C;  4UCR A;  5KX5 F;  4GC6 A;  4Q44 A;  2OLS A;  1K83 A;  3GTO A;  4A3E G;  5BMV F;  4X66 H;  2FPG B;  1Y1W G;  5EWF A;  2JEG A;  2R87 A;  3H0G G;  4ED2 A;  1TWC A;  2IBK A;  3HKZ E;  2W6O A;  3KHR A;  3VPC A;  1GO3 E;  3HKZ A;  2OWO A;  3RTX A;  4RB2 C;  5JVL A;  3ORQ A;  5IWA H;  4TV8 F;  3FMA A;  5L1L A;  2J6T A;  2FPP B;  4AYB A;  3RV3 A;  3Q8S B;  2ASD A;  4J9S A;  4MTE A;  2YRW A;  5KFQ A;  3MFH A;  1TAE A;  2V5A A;  3FKI G;  3N6X A;  3BQ0 A;  1BGW A;  3OSP A;  3KTM A;  1JXL A;  3I12 A;  4QWA A;  4QJF A;  5LYJ F;  5C8Y F;  5IP9 G;  1E4F T;  4FBU A;  5L9X A;  2DIK A;  3T1H H;  1KJ8 A;  5KFI A;  5LL6 b;  4PDB A;  3GTP A;  1JLL B;  1T3N A;  3RB0 A;  3MWM A;  3MWD A;  5D1O B;  3RF2 A;  2HVR A;  2C2E A;  1S0M A;  2DPI A;  1W96 A;  3BQ1 A;  4A3G G;  2XIG A;  1FKA H;  4DV1 H;  1Y1V A;  3Q2O A;  5LMU H;  2NU8 B;  4LSA A;  4HNV A;  5C1P A;  4I4T F;  4EEQ A;  4RZR A;  2BR0 A;  2R8J A;  3N43 B;  4DR4 H;  5DLG A;  4RAY A;  5DGA A;  5LMN H;  4ZOL F;  5KFH A;  1BJT A;  2W71 A;  3K3V A;  4C5B A;  5DLF A;  4YAK B;  2YYA A;  5F9L A;  4DV0 H;  5HBR B;  3MJF A;  3RBE A;  1IBL H;  4NLG A;  2VUM G;  4DV3 H;  3PO3 G;  5C3E G;  2X0S A;  2XC9 A;  1FVI A;  1IOW A;  5L1J A;  2PBZ A;  2F4V H;  4MA0 A;  2R6F A;  3K5I A;  3J7A K;  4RZQ A;  5KFJ A;  4YHH H;  1Y1W A;  4DV5 H;  3GIM A;  4R8U A;  3G6V A;  2NVY A;  5KFU A;  1N56 A;  2R86 A;  2JA8 G;  3V6K A;  5KFP A;  1N33 H;  1IBK H;  3TIN A;  3NGD A;  4JI0 H;  4MV1 A;  5KT5 A;  4O3S A;  4EEY A;  1JX4 A;  2XD4 A;  1AUX A;  3U9T A;  2W9B B;  3PR4 A;  4O3P A;  1E4E B;  4EGJ A;  4B3T H;  1I94 H;  5LOV F;  1VAJ A;  3HXL A;  3EPG A;  4IR1 A;  2WDT A;  1JIH A;  5KT2 A;  4APM A;  5DQG A;  3Q8R B;  1ZET A;  2W6Z A;  5FPR A;  3SI8 A;  4UCS A;  1RJR A;  4HNU A;  5KFW A;  1XMQ H;  3V6J A;  2CW8 A;  2V58 A;  2VOB A;  2Y0S E;  5KT6 A;  3TQT A;  4X65 H;  2AGQ A;  4LFB H;  4O4L F;  3VPB A;  4M9U A;  4EFB A;  4J9K A;  2R92 G;  4GKK H;  4QWB A;  3JRW A;  5C44 G;  4IRK A;  2R93 A;  1SYX B;  2V59 A;  2BQ3 A;  2AQ4 A;  3T1Y H;  4X64 H;  1V4Y A;  1JDB B;  5KFD A;  1N32 H;  3ETJ A;  4IWX A;  4O3R A;  5KG0 A;  2WYO A;  2FK2 A;  3PW7 A;  2C2D A;  5CA0 F;  1C3O A;  5CB4 F;  4YR2 A;  1ZHQ A;  3GTM A;  5EDW A;  2WTF A;  2DPJ A;  5KFX A;  5CA1 F;  1IBM H;  3BA8 A;  4ECS A;  3RIZ A;  4MV6 A;  4JI3 H;  2DWC A;  3FKI A;  4LF9 H;  4QWD A;  3VMM A;  5IYC G;  2CW7 A;  2UXB H;  2E2H A;  5BPF A;  2AU0 A;  2IP4 A;  4ZHQ F;  1I3Q A;  4EGQ A;  2HJW A;  2MCT A;  3GID A;  5KFZ A;  4J9M A;  1S68 A;  3QFF A;  2R82 A;  2FB9 A;  2VPQ A;  1M0W A;  4K0K H;  5KFF A;  3KHL A;  4YR3 A;  1ZQ7 A;  1GSO A;  3MR5 A;  3MR6 A;  4DV4 H;  2BQU A;  3CVZ A;  4WD3 A;  1A9X A;  1I50 A;  5DQH A;  4DL6 A;  4TUY F;  1M0T A;  1RJP A;  3C0F B;  4YJ2 F;  2R7M A;  2WB1 A;  3PVX A;  2JA6 A;  1CQI B;  5KFN A;  3OHA A;  4F4Z A;  2WAQ A;  1KC7 A;  5KFC A;  4U7C A;  3BA9 A;  2ZDG A;  5BR8 H;  3GIL A;  4DV6 H;  2JA7 G;  1KJ9 A;  3TQ1 A;  5LXT F;  4BY1 G;  5KFO A;  4TV9 F;  4UCO A;  5KG5 A;  3FDS A;  2UXC H;  1CQJ B;  4F50 A;  1EZ1 A;  2JEF A;  2PMZ A;  2R84 A;  5IP7 G;  3QZ8 A;  5KG4 A;  4ED7 A;  1A0I A;  2W70 A;  1FJG H;  2Y0S A;  2V4R A;  4A3B G;  5D1O A;  3JAM W;  1E4E A;  1TWH A;  3M9O B;  1M7J A;  4DL2 A;  1GYF A;  1WH2 A;  5H80 A;  1KBL A;  5KFL A;  3RGZ A;  4DR3 H;  4A3L G;  4BWS C;  2UVU A;  2JA5 A;  2CQY A;  2DLN A;  4JI8 H;  4O3O A;  4Q43 A;  4BY7 G;  5J2U F;  4J9P A;  5KFE A;  2VQD A;  5T14 A;  4ECY A;  3R23 A;  2R8I A;  2YS6 A;  2XGQ A;  3N42 B;  5DG7 A;  2R7Z A;  4MV9 A;  2JEJ A;  1GSA A;  2RF4 A;  4IHJ F;  1WCM G;  4MV3 A;  3RGX A;  4A3J G;  4LFC H;  4CC5 A;  5KFY A;  4DR6 H;  3GLK A;  3N41 B;  4LMY A;  2XGP A;  1P8L A;  4FS2 A;  4ECV A;  4EYH B;  2ZM6 H;  3DF7 A;  4ECZ A;  5JH7 F;  3SE7 A;  2ZDH A;  2B63 G;  4FU0 A;  5CAE B;  4DL7 A;  2W9B A;  1PK8 A;  4DR7 H;  2OH2 A;  3LP8 A;  3J81 W;  4IWY A;  1BNC A;  3JRX A;  3RAQ A;  2AGO A;  4B3S H;  4A3M G;  3PN1 A;  1KJI A;  1SEI A;  4M7E A;  4YP3 A;  1CS0 A;  3RB4 A;  4KHP H;  2ZJT A;  4IR9 A;  4C5A A;  3JZI A;  4JV0 A;  5DG9 A;  3L4K A;  3MFI A;  4JV5 H;  1V9P A;  3N8D A;  3WNZ A;  2YZG A;  5KKN B;  3U9S A;  4HNT A;  1C30 A;  2O03 A;  3KAJ A;  3KHH A;  1R9T A;  2ASJ A;  1SCU B;  4DLK A;  1OWT A;  4O4I F;  3BQ2 A;  1RK5 A;  1L2Z A;  1EUD B;  3LWB A;  2FK3 A;  4BBS G;  3I4M G;  1Z2N X;  5C5J A;  4PWQ A;  2E5L H;  3EYY A;  1TA8 A;  3GII A;  3KHG A;  2W9C B;  3GIJ A;  4JYA H;  3RBD A;  4ED8 A;  2UUA H;  4JI6 H;  3HOV G;  4YB8 B;  3HB9 A;  3RUP A;  2RGR A;  4Q8F A;  2SCU B;  2XCL A;  4LH7 A;  2P0A A;  4XX0 B;  2HVS A;  2YU9 A;  4LF8 H;  3E5N A;  4J9O A;  3GV5 B;  2J9G A;  3K5H A;  2V4Q A;  1AN7 A;  4Q0Y A;  5KFK A;  5JUM A;  4DV7 H;  3UQ8 A;  2CZG A;  5KT3 A;  4DV2 H;  4F4X A;  2FK1 A;  3EPI A;  3V4Z A;  4AYB E;  3RV4 A;  4ZI7 F;  2RDI A;  4F4W A;  5J2T F;  2UVV A;  4LH6 A;  2W7P A;  2YZN A;  4OX9 H;  4XZ3 B;  5KFM A;  3L2P A;  3V4S A;  4EBD A;  2R85 A;  4O2B F;  4YY3 H;  4G3I A;  2M05 A;  1KJQ A;  5KG7 A;  4YR0 A;  5EZY F;  1TWG A;  5KFV A;  3PR5 B;  2HHH H;  2VR1 A;  4E4T A;  5GON F;  3CQZ A;  1GSH A;  4ECX A;  3GTG A;  2ASL A;  3HOW G;  2ALZ A;  1DIK A;  3M9M B;  1GLV A;  3MR2 A;  4J9L A;  3GTJ A;  5C1O A;  3F8N A;  2FLN A;  2UUC H;  1O75 A;  4LF6 H;  2VQE H;  4QIW E;  1XMO H;  4B3R H;  2QYZ A;  4ETS A;  4ECT A;  3I4N G;  4LF7 H;  2RDJ A;  2VPS A;  3H20 A;  2PN1 A;  2B63 A;  5DGB A;  5EWG A;  4A3K G;  4DR2 H;  4IAJ A;  2I87 A;  4XYM B;  5L1K A;  3T5L A;  3ETH A;  5L1I A;  1I7N A;  5EWE A;  3M9N B;  4UCV A;  4MA5 A;  1T36 A;  3Q8P B;  4BBR G;  2E2I A;  5D8D A;  3T5J A;  2FPI B;  4L1K A;  3PW4 A;  4DL5 A;  3N44 B;  5DQI A;  5IYB G;  1TWF A;  5A2Q W;  4ECQ A;  4ED6 A;  3Q1K A;  2Q2T A;  1N34 H;  3PW0 A;  4ECR A;  2R7N A;  4RUC A;  2VUG A;  3BJY A;  4Q45 A;  4NXM H;  2QK4 A;  4TQS A;  3QZ7 A;  5IT9 W;  3R5X A;  2FLL A;  1S03 G;  1SFO A;  4EG0 A;  2R8H A;  3G6X A;  3PW2 A;  3MWE A;  3WO0 A;  4C2M A;  5FJ8 G;  5EOY A;  2I8C A;  4GLX A;  4J9N A;  3BAA A;  3KXY T;  3GIQ A;  3PW5 A;  2R8K A;  2KSW A;  2FMA A;  2UXD H;  2W6Q A;  1RJQ A;  1ZHS A;  1HR0 H;  3UFX B;  3RB3 A;  1AUV A;  3TII A;  3G8C A;  4FM9 A;  3OTO H;  4J9R A;  2W8K A;  2GPW A;  3VPD A;  4RB1 A;  1T94 A;  1EUC B;  4AQY H;  4A3D G;  1KJJ A;  3K3P A;  3GTQ A;  2XCA A;  2WB1 E;  5KFA A;  3HOY G;  3R5H A;  1I7L A;  3RJ0 A;  3N40 P;  1WSC A;  3PO2 G;  4YAJ B;  4UCU A;  4DUY H;  5JVD F;  2FP4 B;  4C5C A;  2W57 A;  3IN5 A;  1K1S A;  2W6N A;  4RAZ A;  2UU9 H;  4O2A F;  1HNW H;  1Z2P X;  2IA6 A;  4U6P A;  5KG6 A;  4ECW A;  2C00 A;  3OUZ A;  3GV8 B;  4QW9 A;  1Z2O X;  4JV2 A;  4JUZ A;  1XDN A;  4RU9 A;  4A3F G;  2W8L A;  3G6Y A;  1W93 A;  4R8U B;  1JKJ B;  4RUA A;  4MV8 A;  1BXR A;  2J6S A;  3HBL A;  4UCT A;  5JQW A;  1S97 A;  2NU7 B;  4NXN H;  4JI7 H;  5DG8 A;  5LA6 F;  2HVQ A;  3RAX A; 
#chains in the Genus database with same CATH homology
 4X64 H;  3JSL A;  3KAK A;  1N36 H;  4X62 H;  1N32 H;  1AN7 A;  4Q0Y A;  4RB3 C;  4DV7 H;  2WYO A;  3UQ8 A;  1DGS A;  4DV2 H;  1I6U A;  1XNR H;  1ZHQ A;  3IG0 A;  4UCR A;  1B04 A;  1IBM H;  4LH6 A;  3BA8 A;  4JI4 H;  3RIZ A;  4LF9 H;  4OX9 H;  2YCH A;  4EFE A;  4X66 H;  3L2P A;  2CW7 A;  2UXB H;  4YY3 H;  2MCT A;  2HHH H;  2HGS A;  2OWO A;  5FPO A;  3RTX A;  1S68 A;  4RB2 C;  1HNZ H;  5IWA H;  3BAB A;  2VQF H;  3FMA A;  2Q2U A;  1M0W A;  4K0K H;  4LFA H;  4MTE A;  4JI2 H;  3N6X A;  1TAE A;  4DV4 H;  3CVZ A;  3F8N A;  1BGW A;  4DR1 H;  4J0M A;  1M0T A;  3C0F B;  2UUC H;  1O75 A;  4LF6 H;  2VQE H;  1XMO H;  4B3R H;  4ETS A;  4I7H A;  4LF7 H;  4GKJ H;  1E4F T;  5BR8 H;  4RB0 A;  3BA9 A;  2VPS A;  3H20 A;  4DV6 H;  3J80 W;  3M4I A;  3T1H H;  3LML A;  4UCO A;  5LL6 b;  4PDB A;  2UXC H;  4DR2 H;  4IAJ A;  3MWM A;  5D1O B;  3RF2 A;  2HVR A;  4JI1 H;  1A0I A;  4R7R A;  4A2B A;  2XIG A;  1FJG H;  1J5E H;  5D1P A;  4LSX A;  1FKA H;  4DV1 H;  4UCV A;  5D1O A;  3JAM W;  5LMU H;  3JSN A;  4B3M H;  1GYF A;  4LSA A;  4DUZ H;  1WH2 A;  3RGZ A;  4DR3 H;  4EEQ A;  4BWS C;  3N44 B;  3N43 B;  2Q2T A;  5A2Q W;  4DR4 H;  4RAY A;  4JI8 H;  5LMN H;  1N34 H;  1BJT A;  3K3V A;  5FD6 A;  5FD5 A;  2VUG A;  4DV0 H;  5IT9 W;  4NXM H;  2WE6 A;  4UFZ A;  1X9N A;  1IBL H;  3N42 B;  1S03 G;  4DV3 H;  4MV9 A;  1FVI A;  2F4V H;  4LF5 H;  4LFC H;  4MV7 A;  3RGX A;  4CC5 A;  3J7A K;  4DR6 H;  2RGV A;  3N41 B;  4LMY A;  4RZQ A;  1P8L A;  5EOY A;  4YHH H;  4DV5 H;  4GLX A;  3BAA A;  3KXY T;  2KSW A;  4CC6 A;  2ZM6 H;  2UXD H;  1HR0 H;  1ZHS A;  3DF7 A;  4DR5 H;  1N33 H;  3L4J A;  4FM9 A;  1IBK H;  4JI0 H;  3OTO H;  4DR7 H;  3J81 W;  4RB1 A;  4AQY H;  4B3S H;  4MTD A;  3PN1 A;  1SEI A;  4M7E A;  1VS0 A;  4B3T H;  4LF4 H;  2ZJT A;  5FLX W;  4KHP H;  1I94 H;  3RJ0 A;  3L4K A;  3HXL A;  3N40 P;  2WDT A;  4JV5 H;  1V9P A;  4UCU A;  4APM A;  4DUY H;  5FPR A;  4UCS A;  3KAJ A;  2O03 A;  2W57 A;  4RAZ A;  2UU9 H;  2UUB H;  1HNW H;  1XMQ H;  1Z2P X;  2FE3 A;  1L2Z A;  2CW8 A;  2VOB A;  4X65 H;  3KAL A;  4LFB H;  1Z2N X;  1HNX H;  1Z2O X;  2E5L H;  1XNQ H;  1XDN A;  3EYY A;  4EFB A;  1TA8 A;  4GKK H;  4JYA H;  2UUA H;  4JI6 H;  4A2A A;  1MZB A;  1SYX B;  4JI5 H;  2RGR A;  4UCT A;  4NXN H;  1E4G T;  4LH7 A;  2HVS A;  4JI7 H;  3T1Y H;  4LF8 H;  2HVQ A;  4JI3 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...