2KSWA

Backbone 1h, 13c, and 15n chemical shift assignments for oryctin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
VPVGSDCEPKLCTMDLVPHCFLNPEKGIVVVHGGCALSKYKCQNPNHEKLGYTHECEEAIKNAPRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oryctin
publication title Isolation, cDNA cloning, and structure-based functional characterization of oryctin, a hemolymph protein from the coconut rhinoceros beetle, Oryctes rhinoceros, as a novel serine protease inhibitor
pubmed doi rcsb
source organism Oryctes rhinoceros
molecule tags Hydrolase inhibitor
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.260 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2kswA01
2KSWA
chains in the Genus database with same CATH superfamily
5KT2A 3BJYA 3KHGA 4A3KG 2VA3A 3SI8A 2GLTA 1OWTA 3ORQA 4WD3A 1WCMA 3R5FA 4IZOA 3TQTA 4J9QA 3SE7A 3K5IA 4AQYH 2J6TA 2UU9H 2FK1A 3Q8RB 3PW5A 2R87A 4I55F 2YU9A 3F8NA 1JDBB 4HNVA 1KEEA 3BA8A 3GLKA 2VOBA 2WYOA 3MWEA 4G3IA 4EEYA 1B6RA 2V58A 1N56A 3RV3A 3FKIG 2W9AA 5KT6A 1IBMH 5KKNB 1V4YA 1Y1WG 4Q8FA 4ED1A 4QW8A 3JRWA 4BXXG 4FBUA 2FJZA 5LL6b 1Z2NX 4A2BA 2DIKA 1I50A 2R84A 2IMWP 4RZQA 5CAEB 5KFYA 4Q45A 2FE3A 1DV2A 3H4DA 4O3RA 3L4KA 1GYFA 4IRCA 4MV7A 4LF8H 3PO3G 2E2IA 4MV8A 2UVRA 1B6SA 4UCRA 3OHBA 2WB1A 4A3JG 2JA6G 1TWCA 2FP4B 1TWHA 3V6JA 2YZGA 4A2AA 5KFCA 2ZJTA 2C2DA 1RJRA 2B63A 4PWQA 3T1YH 1XMQH 4K0KH 5FPOA 3GTMA 2HVQA 2E5LH 2J6UA 2PBZA 4MV6A 3K3VA 2R8KA 5IT9W 3J80W 3FMAA 3RGZA 5KFOA 1M0TA 2C00A 2W7PA 1VS0A 2M05A 2DWCA 3G6XA 4DV5H 3G6YA 4J9LA 1S0NA 1SEIA 1KJ9A 2YCHA 5KG1A 2AGQA 5H80A 1JLLB 5FLXW 4ED6A 1GSOA 4MAMA 4C5CA 2SCUB 5EWEA 2R92A 2W71A 2VPQA 4ECUA 2OWOA 2PVPA 4LF9H 5T14A 5KFXA 4EFEA 3N8DA 3KALA 1DV1A 1FVIA 4UCVA 3ETHA 5BMVF 5DG9A 1GGOA 3RF2A 2XCPA 3Q1KA 3RTXA 4DV2H 4B3TH 1VAJA 5EWGA 4A3CG 2C28A 3EYYA 3GIDA 2HHHH 4RB2C 1S0MA 1EZ1A 1HNZH 2GPSA 4JI8H 4DL5A 1J5EH 5KG6A 1VBGA 5DG8A 4RUAA 3I4MG 1K83A 3N40P 3PO2G 4DL3A 4IRDA 3NGDA 3RGXA 1Y1VG 2YRWA 2C2EA 2J6SA 1HR0H 5C44G 3R5HA 2KSWA 1UC9A 1S68A 2NU7B 3N43B 5KFHA 4QWDA 2HVSA 4U6PA 1KC7A 4ZQIA 3BABA 2AQ4A 2JA5G 3RBDA 4GKJH 5A2QW 2HGSA 5KFGA 1JDEA 3HOVG 4EFBA 4LMYA 2R82A 2UVVA 1IOWA 2YW2A 3R23A 3GV8B 1WSCA 4XX0B 1XNRH 2DLNA 4B3MH 5D1PA 1N33H 1ZQ7A 3G6VA 3MR5A 4O3NA 4R8UB 2R6FA 1RJQA 1X9NA 2QK4A 4QWCA 2UVWA 1JKJB 2NU9B 2IP4A 3EPIA 1Z2OX 1W93A 3KAKA 5HBRB 2XIGA 4O3QA 3JRXA 4QWEA 5LMUH 2UUBH 3E5NA 5LA6F 2Y0SA 3N42B 3M9OB 4A3MG 2R86A 2RDIA 3IG0A 2W6NA 4DL2A 3DF7A 5KX5F 1BNCA 3BQ2A 4LFCH 1I7NA 4ED7A 4JUZA 4YAKB 2FKLA 5LMNH 2NVXA 4ME6A 4FU0A 4LF5H 3GTGA 4ED3A 5KG7A 2IA6A 4DV0H 3KTMA 1B04A 2ATLA 2ZM6H 4DV3H 1S10A 2W8KA 5L9XA 4Q8EA 1KBLA 1JX4A 1M0WA 3HOUG 1AUVA 3GV5B 5C5JA 3GIQA 4BBRG 3EPGA 3I4NG 4DV1H 4C5AA 1CQJB 4XZ3B 1XMOH 1PK8A 2UXBH 2R8GA 5KFEA 1DIKA 3UFXB 5CB4F 5JQWA 4YR0A 4EGJA 1CE8A 3HBLA 4IWXA 2W8LA 2W6OA 3KHLA 3H0GA 1S03G 4ECXA 4AYBA 5L1LA 3GIIA 2JEFA 1SCUB 4A3FG 5BPHA 4JI6H 4EYHB 4OX9H 4EYIB 4A3LG 4M9UA 3PN1A 5C8YF 2V59A 3PVXA 1IOVA 1DGSA 2QYZA 1EUDB 4R8UA 3BQ0A 2DPIA 2CW7A 2I87A 2I8CA 3K3PA 3MR6A 3GIKA 3H40A 1KJQA 3WNZA 4R7RA 3GIPA 4DUYH 3V6HA 1R9TA 2ASDA 3J81W 1RK5A 3LP8A 2ALZA 5KT4A 4YJ2F 5C4XG 5JVLA 4ZHQF 3T5KA 1WR2A 2PMZA 1GSAA 2O03A 1KJIA 2RGVA 3JSNA 1K1SA 1ZHQA 2WTFA 2Q2TA 3H20A 2NUAB 4J0MA 1WCMG 3WO0A 1CS0A 3RAQA 2VUMA 5KFUA 2YZNA 5KG2A 3IN5A 5KFTA 1XDNA 4U7CA 2YS6A 3HKZE 3T5JA 2R7ZA 3TQ1A 4JI0H 3GIMA 2R7NA 1E4EA 3MWDA 3N41B 2XGQA 3HOXG 5LXTF 4RNOA 5KFWA 4GC6A 2FK3A 5IYDG 4JI1H 3OUUA 4JV1A 2RF4A 4TQRA 4L1KA 4PDBA 1O75A 4GLXA 4DR6H 3V4ZA 1MZBA 1E4FT 2J9GA 2WAQE 5DLFA 4LFBH 3PR4A 4F4XA 4B3RH 5FLMG 4O3OA 3LWBA 3H4BA 4UCSA 5IP9G 2CQYA 3PW7A 3KHHA 3GTQA 4YR3A 4MA0A 5JVDF 2UXCH 4BY1G 4LFAH 3RV4A 4DL6A 4A3GG 4MV4A 1P8LA 4E4TA 2FLPA 5J2UF 4EBCA 2UVUA 4QIWA 4YHHH 4TV8F 4IRKA 2V9WA 1M7JA 3JZIA 1AN7A 2C2RA 4O3PA 5KFJA 5D8DA 5KFAA 4HR7A 3PW0A 4JV5H 1N36H 4X62H 2B63G 1TAEA 3M9MB 1ZETA 2C35B 2XCLA 4MTEA 4DR3H 4HQ6A 2NU6B 3OUZA 5LYJF 2NU8B 5L1JA 4RB1A 3M9NB 2JEGA 4HNUA 3K5HA 3U9SA 5EWFA 2R7ZG 3HOZG 1GLVA 5KFIA 4O2AF 2HJWA 3BAAA 2DZDA 3HOYG 4FS1A 5DGAA 2V4RA 5D1OB 2XGPA 5IWAH 2W7OA 2FLLA 2R93A 1I7LA 1V51A 4RAYA 3L4JA 4J9SA 4HNTA 4MV9A 5F9LA 3MFHA 2R92G 2HVRA 5C3EG 1GSHA 2V5AA 3JSLA 1B33N 2WB1E 5KG4A 1A0IA 1RK6A 5EZYF 5KFDA 5F9NA 2E2HA 1W96A 3PR5B 1HNWH 4ECZA 5KFVA 4LF6H 4DLKA 4X65H 4IR9A 4DR4H 4CC5A 5DQIA 2Q2UA 2R85A 2ASJA 1I94H 5IP7G 3Q8PB 3Q2OA 4YAJB 2W6PA 4JI2H 3U9TA 3OSPA 4RNMA 3RB4A 3Q8QB 5KG0A 4JV2A 5FPRA 2WDTA 4DR2H 2R8IA 4QWAA 4IWYA 4DV4H 5DG7A 5KFLA 5FD5A 2R8JA 4DR7H 2OLSA 2VQFH 2F4VH 4UFZA 4Q43A 1GO3E 2RGRA 4Q44A 4F4YA 5KFKA 2W9CB 3L2PA 4RAZA 4XYMB 2FLNA 4J9OA 5HV6A 5DLGA 2FMAA 3QZ8A 5K2MA 3H3VH 2V4QA 4LH7A 4RB3C 3MWMA 2NVYA 5KFBA 3GQCA 4NXNH 2R93G 4X64H 4DL4A 1K1QA 4DR5H 1HNXH 4EGQA 5DQGA 1SFOA 1IBKH 4DR1H 4ECWA 5KT7A 4KHPH 4ZI7F 4ECRA 4BY7G 3QFFA 4YY3H 4RB0A 5C1PA 4TQSA 1BJTA 1Z2PX 1A9XA 3M4IA 3T5LA 2X0SA 3PW4A 2ASLA 1VBHA 4EBEA 3MJFA 5LOVF 4I4TF 3FDSA 3KAJA 3MR2A 1BGWA 3WO1A 2P0AA 1C3OA 4MA5A 2JA6A 2R8HA 2MCTA 2W6ZA 3GIJA 4CC6A 4RZRA 4NXMH 2GPWA 3I12A 4BWSC 2AGPA 3MR3A 4DV7H 5KFRA 3BQ1A 4ED0A 4JI3H 2W9BB 4DL7A 4ED8A 4MV1A 2BQRA 3HB9A 4J9KA 1UNNC 4UCUA 5KFPA 4RUCA 2XC9A 4J9NA 4LF4H 3KXYT 4A93G 1WH2A 2W9CA 4EG0A 4C5BA 3RIZA 4F4WA 4YQWA 4F50A 2DPJA 3CQZA 1KJ8A 5KFNA 2FB9A 5FJ8G 3PW2A 4RNNA 2BQ3A 4Y8VB 4ZOLF 1RJPA 3C0FB 3GTOA 3CVZA 2Y0SE 3RB3A 1T36A 2W6QA 2VQEH 4JI7H 3GTPA 3OSNA 4JYAH 3H0GG 3T1HH 4RU9A 1AUXA 3KHRA 3PZPA 3QZ7A 1S9FA 4Q0YA 5CA1F 3HOWG 3TINA 4YB8B 1N34H 1XNQH 1JIHA 4C2MA 5KFFA 4DUZH 2C22A 1FKAH 2ZDGA 2UUCH 2VUGA 3RAXA 5KFMA 1Y1VA 1L2ZA 1CQIB 3N44B 4TUYF 5KT5A 4EBDA 2AGOA 3MFIA 1ZHSA 5J2TF 2IBKA 4FBTA 2BR0A 1Y14B 4HYKA 2FPIB 3ETJA 1TA8A 4IAJA 4XYLB 2JA5A 2FK2A 2VQDA 3GTLA 4O2BF 4QWBA 2YZMA 4IR1A 5C1OA 5KG3A 5JH7F 4J9PA 4A3EG 4O3SA 3AYHB 3ORRA 2FPGB 5KFSA 4AYBE 4J9RA 4YBZB 2W9BA 2UUAH 3LMLA 2VUMG 1S0OA 1ULZA 1TWFA 4A3IG 3GTKA 5KFQA 4FS2A 3N6XA 4YJ3F 2OH2A 4BBSG 5BR8H 5IYBG 4DV6H 1T94A 3T5HA 2RDJA 2CKZB 3TIIA 2R7KA 4I7HA 2R7MA 2W70A 3V6KA 5L1KA 2ZDHA 2WE6A 5EOYA 3VMMA 1RYRA 4WBNF 4ECQA 2CW8A 2PN1A 2FPPB 2XD4A 2YRXA 3TIGA 4TV9F 2W57A 4YP3A 1C30A 4O4LF 1JXLA 2PMZE 1SYXB 2JA7A 2AU0A 3OTOH 4J9MA 4GC7A 4ED2A 3OHAA 1TWAA 1TWGA 5FD6A 4F4ZA 3RJ0A 3Q8SB 3RBEA 1I6UA 4MTDA 3UQ8A 4LSAA 1N32H 4B3SH 3RB6A 4QJFA 5L1IA 4ETSA 4JI4H 4NLGA 1FJGH 4ECSA 2W6MA 4JV0A 2I80A 5LP6F 4QW9A 4YR2A 5CA0F 5JUMA 1EHIA 3GILA 5KFZA 1M6VA 3HXLA 3RFCA 3VPCA 3VPBA 1EYZA 4I50F 2VR1A 2YL2A 1E4GT 5DGBA 5I47A 1KJJA 3JAMW 4O4IF 4LSXA 3J7AK 2JA8G 1RYSA 4APMA 1BXRA 3GV7B 4GKKH 4A3DG 1N48A 2ZDQA 3BG5A 3FKIA 5IYCG 1V9PA 4LF7H 3G8CA 4M7EA 5DQHA 1Y1WA 4EEQA 1VKZA 4QIWE 1S97A 4LH6A 5IYZF 3RB0A 3HKZA 5GONF 4ECVA 2BQUA 3R5XA 3V4SA 2JA7G 4O4HF 2XCAA 3GTJA 5KG5A 2YYAA 4ECYA 1PX2A 3BA9A 5KT3A 5D1OA 4X66H 2YS7A 4UCOA 2UXDH 1UC8A 5BPFA 2VA2A 1I3QA 3VPDA 1T3NA 2VPSA 4UCTA 4A3BG 5EDWA 2CZGA 3RUPA 2R7LA 2WAQA 4IHJF 4MV3A 2JEIA 4JI5H 4FM9A 1IBLH 4ECTA 1E4EB 2JEJA 1EUCB
chains in the Genus database with same CATH topology
1N36H 4X62H 4JI7H 2VQEH 1TAEA 4MTEA 4DR3H 1X9NA 4JYAH 3T1HH 4RB1A 4AQYH 1Z2OX 4Q0YA 3KAKA 5LMUH 2XIGA 2UUBH 2UU9H 1N34H 3N42B 1XNQH 3BAAA 3F8NA 3IG0A 3BA8A 2VOBA 4DUZH 2WYOA 1FKAH 5D1OB 3DF7A 2UUCH 2VUGA 5IWAH 4LFCH 1IBMH 1L2ZA 3N44B 4RAYA 3L4JA 1ZHSA 4MV9A 2HVRA 5LMNH 3JSLA 5LL6b 4LF5H 1Z2NX 4A2BA 1A0IA 4DV0H 1TA8A 1B04A 2ZM6H 4DV3H 4IAJA 1HNWH 4LF6H 4RZQA 1M0WA 2FE3A 4X65H 3L4KA 4DR4H 4CC5A 2Q2UA 1GYFA 4MV7A 1I94H 4LF8H 4DV1H 4JI2H 2UUAH 3LMLA 4UCRA 5FPRA 1XMOH 2WDTA 4DR2H 2UXBH 4A2AA 3N6XA 5BR8H 4DV4H 4DV6H 2ZJTA 5FD5A 4DR7H 1XMQH 3T1YH 4K0KH 5FPOA 2VQFH 2F4VH 4I7HA 2HVQA 4UFZA 2E5LH 2RGRA 1S03G 2WE6A 5EOYA 3K3VA 3L2PA 5IT9W 3J80W 4RAZA 2CW8A 4JI6H 3FMAA 4OX9H 3RGZA 1M0TA 3PN1A 1VS0A 2W57A 4DV5H 1SEIA 1SYXB 1DGSA 2YCHA 4LH7A 4RB3C 3MWMA 3OTOH 5FLXW 2CW7A 4NXNH 5FD6A 3RJ0A 4X64H 1HNXH 4DR5H 4R7RA 4DUYH 1I6UA 1IBKH 4MTDA 3J81W 3UQ8A 2OWOA 4DR1H 4LSAA 1N32H 4B3SH 4LF9H 4ETSA 4EFEA 4JI4H 4KHPH 1FJGH 3KALA 4UCVA 1FVIA 4YY3H 4RB0A 2O03A 2RGVA 3RF2A 3JSNA 1ZHQA 3RTXA 4DV2H 2Q2TA 1BJTA 1Z2PX 3H20A 3HXLA 3M4IA 4J0MA 4B3TH 3EYYA 3KAJA 4RB2C 2HHHH 1E4GT 1BGWA 1HNZH 4JI8H 3JAMW 1XDNA 1J5EH 2MCTA 4LSXA 4JI0H 3J7AK 4CC6A 4NXMH 3N41B 3N40P 4APMA 4GKKH 4JI1H 4BWSC 3RGXA 4DV7H 1V9PA 1HR0H 4PDBA 1O75A 4JI3H 4LF7H 4GLXA 2KSWA 4M7EA 4DR6H 1S68A 3N43B 1MZBA 4EEQA 1E4FT 2HVSA 4LH6A 4LFBH 4B3RH 4UCSA 3BABA 3BA9A 4UCUA 2UXCH 4GKJH 5D1OA 5A2QW 2HGSA 4UCOA 4X66H 4LFAH 4EFBA 4LF4H 2UXDH 4LMYA 3KXYT 1WH2A 1P8LA 3RIZA 2VPSA 4UCTA 4YHHH 1XNRH 4B3MH 4JI5H 3C0FB 5D1PA 4FM9A 1IBLH 3CVZA 1AN7A 1N33H 4JV5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSW A; 
#chains in the Genus database with same CATH topology
 5KT2 A;  3BJY A;  3KHG A;  4A3K G;  2VA3 A;  3SI8 A;  2GLT A;  1OWT A;  3ORQ A;  4WD3 A;  1WCM A;  3R5F A;  4IZO A;  3TQT A;  4J9Q A;  3SE7 A;  3K5I A;  4AQY H;  2J6T A;  2UU9 H;  2FK1 A;  3Q8R B;  3PW5 A;  2R87 A;  4I55 F;  2YU9 A;  3F8N A;  1JDB B;  4HNV A;  1KEE A;  3BA8 A;  3GLK A;  2VOB A;  2WYO A;  3MWE A;  4G3I A;  4EEY A;  1B6R A;  2V58 A;  1N56 A;  3RV3 A;  3FKI G;  2W9A A;  5KT6 A;  1IBM H;  5KKN B;  1V4Y A;  1Y1W G;  4Q8F A;  4ED1 A;  4QW8 A;  3JRW A;  4BXX G;  4FBU A;  2FJZ A;  5LL6 b;  1Z2N X;  4A2B A;  2DIK A;  1I50 A;  2R84 A;  2IMW P;  4RZQ A;  5CAE B;  5KFY A;  4Q45 A;  2FE3 A;  1DV2 A;  3H4D A;  4O3R A;  3L4K A;  1GYF A;  4IRC A;  4MV7 A;  4LF8 H;  3PO3 G;  2E2I A;  4MV8 A;  2UVR A;  1B6S A;  4UCR A;  3OHB A;  2WB1 A;  4A3J G;  2JA6 G;  1TWC A;  2FP4 B;  1TWH A;  3V6J A;  2YZG A;  4A2A A;  5KFC A;  2ZJT A;  2C2D A;  1RJR A;  2B63 A;  4PWQ A;  3T1Y H;  1XMQ H;  4K0K H;  5FPO A;  3GTM A;  2HVQ A;  2E5L H;  2J6U A;  2PBZ A;  4MV6 A;  3K3V A;  2R8K A;  5IT9 W;  3J80 W;  3FMA A;  3RGZ A;  5KFO A;  1M0T A;  2C00 A;  2W7P A;  1VS0 A;  2M05 A;  2DWC A;  3G6X A;  4DV5 H;  3G6Y A;  4J9L A;  1S0N A;  1SEI A;  1KJ9 A;  2YCH A;  5KG1 A;  2AGQ A;  5H80 A;  1JLL B;  5FLX W;  4ED6 A;  1GSO A;  4MAM A;  4C5C A;  2SCU B;  5EWE A;  2R92 A;  2W71 A;  2VPQ A;  4ECU A;  2OWO A;  2PVP A;  4LF9 H;  5T14 A;  5KFX A;  4EFE A;  3N8D A;  3KAL A;  1DV1 A;  1FVI A;  4UCV A;  3ETH A;  5BMV F;  5DG9 A;  1GGO A;  3RF2 A;  2XCP A;  3Q1K A;  3RTX A;  4DV2 H;  4B3T H;  1VAJ A;  5EWG A;  4A3C G;  2C28 A;  3EYY A;  3GID A;  2HHH H;  4RB2 C;  1S0M A;  1EZ1 A;  1HNZ H;  2GPS A;  4JI8 H;  4DL5 A;  1J5E H;  5KG6 A;  1VBG A;  5DG8 A;  4RUA A;  3I4M G;  1K83 A;  3N40 P;  3PO2 G;  4DL3 A;  4IRD A;  3NGD A;  3RGX A;  1Y1V G;  2YRW A;  2C2E A;  2J6S A;  1HR0 H;  5C44 G;  3R5H A;  2KSW A;  1UC9 A;  1S68 A;  2NU7 B;  3N43 B;  5KFH A;  4QWD A;  2HVS A;  4U6P A;  1KC7 A;  4ZQI A;  3BAB A;  2AQ4 A;  2JA5 G;  3RBD A;  4GKJ H;  5A2Q W;  2HGS A;  5KFG A;  1JDE A;  3HOV G;  4EFB A;  4LMY A;  2R82 A;  2UVV A;  1IOW A;  2YW2 A;  3R23 A;  3GV8 B;  1WSC A;  4XX0 B;  1XNR H;  2DLN A;  4B3M H;  5D1P A;  1N33 H;  1ZQ7 A;  3G6V A;  3MR5 A;  4O3N A;  4R8U B;  2R6F A;  1RJQ A;  1X9N A;  2QK4 A;  4QWC A;  2UVW A;  1JKJ B;  2NU9 B;  2IP4 A;  3EPI A;  1Z2O X;  1W93 A;  3KAK A;  5HBR B;  2XIG A;  4O3Q A;  3JRX A;  4QWE A;  5LMU H;  2UUB H;  3E5N A;  5LA6 F;  2Y0S A;  3N42 B;  3M9O B;  4A3M G;  2R86 A;  2RDI A;  3IG0 A;  2W6N A;  4DL2 A;  3DF7 A;  5KX5 F;  1BNC A;  3BQ2 A;  4LFC H;  1I7N A;  4ED7 A;  4JUZ A;  4YAK B;  2FKL A;  5LMN H;  2NVX A;  4ME6 A;  4FU0 A;  4LF5 H;  3GTG A;  4ED3 A;  5KG7 A;  2IA6 A;  4DV0 H;  3KTM A;  1B04 A;  2ATL A;  2ZM6 H;  4DV3 H;  1S10 A;  2W8K A;  5L9X A;  4Q8E A;  1KBL A;  1JX4 A;  1M0W A;  3HOU G;  1AUV A;  3GV5 B;  5C5J A;  3GIQ A;  4BBR G;  3EPG A;  3I4N G;  4DV1 H;  4C5A A;  1CQJ B;  4XZ3 B;  1XMO H;  1PK8 A;  2UXB H;  2R8G A;  5KFE A;  1DIK A;  3UFX B;  5CB4 F;  5JQW A;  4YR0 A;  4EGJ A;  1CE8 A;  3HBL A;  4IWX A;  2W8L A;  2W6O A;  3KHL A;  3H0G A;  1S03 G;  4ECX A;  4AYB A;  5L1L A;  3GII A;  2JEF A;  1SCU B;  4A3F G;  5BPH A;  4JI6 H;  4EYH B;  4OX9 H;  4EYI B;  4A3L G;  4M9U A;  3PN1 A;  5C8Y F;  2V59 A;  3PVX A;  1IOV A;  1DGS A;  2QYZ A;  1EUD B;  4R8U A;  3BQ0 A;  2DPI A;  2CW7 A;  2I87 A;  2I8C A;  3K3P A;  3MR6 A;  3GIK A;  3H40 A;  1KJQ A;  3WNZ A;  4R7R A;  3GIP A;  4DUY H;  3V6H A;  1R9T A;  2ASD A;  3J81 W;  1RK5 A;  3LP8 A;  2ALZ A;  5KT4 A;  4YJ2 F;  5C4X G;  5JVL A;  4ZHQ F;  3T5K A;  1WR2 A;  2PMZ A;  1GSA A;  2O03 A;  1KJI A;  2RGV A;  3JSN A;  1K1S A;  1ZHQ A;  2WTF A;  2Q2T A;  3H20 A;  2NUA B;  4J0M A;  1WCM G;  3WO0 A;  1CS0 A;  3RAQ A;  2VUM A;  5KFU A;  2YZN A;  5KG2 A;  3IN5 A;  5KFT A;  1XDN A;  4U7C A;  2YS6 A;  3HKZ E;  3T5J A;  2R7Z A;  3TQ1 A;  4JI0 H;  3GIM A;  2R7N A;  1E4E A;  3MWD A;  3N41 B;  2XGQ A;  3HOX G;  5LXT F;  4RNO A;  5KFW A;  4GC6 A;  2FK3 A;  5IYD G;  4JI1 H;  3OUU A;  4JV1 A;  2RF4 A;  4TQR A;  4L1K A;  4PDB A;  1O75 A;  4GLX A;  4DR6 H;  3V4Z A;  1MZB A;  1E4F T;  2J9G A;  2WAQ E;  5DLF A;  4LFB H;  3PR4 A;  4F4X A;  4B3R H;  5FLM G;  4O3O A;  3LWB A;  3H4B A;  4UCS A;  5IP9 G;  2CQY A;  3PW7 A;  3KHH A;  3GTQ A;  4YR3 A;  4MA0 A;  5JVD F;  2UXC H;  4BY1 G;  4LFA H;  3RV4 A;  4DL6 A;  4A3G G;  4MV4 A;  1P8L A;  4E4T A;  2FLP A;  5J2U F;  4EBC A;  2UVU A;  4QIW A;  4YHH H;  4TV8 F;  4IRK A;  2V9W A;  1M7J A;  3JZI A;  1AN7 A;  2C2R A;  4O3P A;  5KFJ A;  5D8D A;  5KFA A;  4HR7 A;  3PW0 A;  4JV5 H;  1N36 H;  4X62 H;  2B63 G;  1TAE A;  3M9M B;  1ZET A;  2C35 B;  2XCL A;  4MTE A;  4DR3 H;  4HQ6 A;  2NU6 B;  3OUZ A;  5LYJ F;  2NU8 B;  5L1J A;  4RB1 A;  3M9N B;  2JEG A;  4HNU A;  3K5H A;  3U9S A;  5EWF A;  2R7Z G;  3HOZ G;  1GLV A;  5KFI A;  4O2A F;  2HJW A;  3BAA A;  2DZD A;  3HOY G;  4FS1 A;  5DGA A;  2V4R A;  5D1O B;  2XGP A;  5IWA H;  2W7O A;  2FLL A;  2R93 A;  1I7L A;  1V51 A;  4RAY A;  3L4J A;  4J9S A;  4HNT A;  4MV9 A;  5F9L A;  3MFH A;  2R92 G;  2HVR A;  5C3E G;  1GSH A;  2V5A A;  3JSL A;  1B33 N;  2WB1 E;  5KG4 A;  1A0I A;  1RK6 A;  5EZY F;  5KFD A;  5F9N A;  2E2H A;  1W96 A;  3PR5 B;  1HNW H;  4ECZ A;  5KFV A;  4LF6 H;  4DLK A;  4X65 H;  4IR9 A;  4DR4 H;  4CC5 A;  5DQI A;  2Q2U A;  2R85 A;  2ASJ A;  1I94 H;  5IP7 G;  3Q8P B;  3Q2O A;  4YAJ B;  2W6P A;  4JI2 H;  3U9T A;  3OSP A;  4RNM A;  3RB4 A;  3Q8Q B;  5KG0 A;  4JV2 A;  5FPR A;  2WDT A;  4DR2 H;  2R8I A;  4QWA A;  4IWY A;  4DV4 H;  5DG7 A;  5KFL A;  5FD5 A;  2R8J A;  4DR7 H;  2OLS A;  2VQF H;  2F4V H;  4UFZ A;  4Q43 A;  1GO3 E;  2RGR A;  4Q44 A;  4F4Y A;  5KFK A;  2W9C B;  3L2P A;  4RAZ A;  4XYM B;  2FLN A;  4J9O A;  5HV6 A;  5DLG A;  2FMA A;  3QZ8 A;  5K2M A;  3H3V H;  2V4Q A;  4LH7 A;  4RB3 C;  3MWM A;  2NVY A;  5KFB A;  3GQC A;  4NXN H;  2R93 G;  4X64 H;  4DL4 A;  1K1Q A;  4DR5 H;  1HNX H;  4EGQ A;  5DQG A;  1SFO A;  1IBK H;  4DR1 H;  4ECW A;  5KT7 A;  4KHP H;  4ZI7 F;  4ECR A;  4BY7 G;  3QFF A;  4YY3 H;  4RB0 A;  5C1P A;  4TQS A;  1BJT A;  1Z2P X;  1A9X A;  3M4I A;  3T5L A;  2X0S A;  3PW4 A;  2ASL A;  1VBH A;  4EBE A;  3MJF A;  5LOV F;  4I4T F;  3FDS A;  3KAJ A;  3MR2 A;  1BGW A;  3WO1 A;  2P0A A;  1C3O A;  4MA5 A;  2JA6 A;  2R8H A;  2MCT A;  2W6Z A;  3GIJ A;  4CC6 A;  4RZR A;  4NXM H;  2GPW A;  3I12 A;  4BWS C;  2AGP A;  3MR3 A;  4DV7 H;  5KFR A;  3BQ1 A;  4ED0 A;  4JI3 H;  2W9B B;  4DL7 A;  4ED8 A;  4MV1 A;  2BQR A;  3HB9 A;  4J9K A;  1UNN C;  4UCU A;  5KFP A;  4RUC A;  2XC9 A;  4J9N A;  4LF4 H;  3KXY T;  4A93 G;  1WH2 A;  2W9C A;  4EG0 A;  4C5B A;  3RIZ A;  4F4W A;  4YQW A;  4F50 A;  2DPJ A;  3CQZ A;  1KJ8 A;  5KFN A;  2FB9 A;  5FJ8 G;  3PW2 A;  4RNN A;  2BQ3 A;  4Y8V B;  4ZOL F;  1RJP A;  3C0F B;  3GTO A;  3CVZ A;  2Y0S E;  3RB3 A;  1T36 A;  2W6Q A;  2VQE H;  4JI7 H;  3GTP A;  3OSN A;  4JYA H;  3H0G G;  3T1H H;  4RU9 A;  1AUX A;  3KHR A;  3PZP A;  3QZ7 A;  1S9F A;  4Q0Y A;  5CA1 F;  3HOW G;  3TIN A;  4YB8 B;  1N34 H;  1XNQ H;  1JIH A;  4C2M A;  5KFF A;  4DUZ H;  2C22 A;  1FKA H;  2ZDG A;  2UUC H;  2VUG A;  3RAX A;  5KFM A;  1Y1V A;  1L2Z A;  1CQI B;  3N44 B;  4TUY F;  5KT5 A;  4EBD A;  2AGO A;  3MFI A;  1ZHS A;  5J2T F;  2IBK A;  4FBT A;  2BR0 A;  1Y14 B;  4HYK A;  2FPI B;  3ETJ A;  1TA8 A;  4IAJ A;  4XYL B;  2JA5 A;  2FK2 A;  2VQD A;  3GTL A;  4O2B F;  4QWB A;  2YZM A;  4IR1 A;  5C1O A;  5KG3 A;  5JH7 F;  4J9P A;  4A3E G;  4O3S A;  3AYH B;  3ORR A;  2FPG B;  5KFS A;  4AYB E;  4J9R A;  4YBZ B;  2W9B A;  2UUA H;  3LML A;  2VUM G;  1S0O A;  1ULZ A;  1TWF A;  4A3I G;  3GTK A;  5KFQ A;  4FS2 A;  3N6X A;  4YJ3 F;  2OH2 A;  4BBS G;  5BR8 H;  5IYB G;  4DV6 H;  1T94 A;  3T5H A;  2RDJ A;  2CKZ B;  3TII A;  2R7K A;  4I7H A;  2R7M A;  2W70 A;  3V6K A;  5L1K A;  2ZDH A;  2WE6 A;  5EOY A;  3VMM A;  1RYR A;  4WBN F;  4ECQ A;  2CW8 A;  2PN1 A;  2FPP B;  2XD4 A;  2YRX A;  3TIG A;  4TV9 F;  2W57 A;  4YP3 A;  1C30 A;  4O4L F;  1JXL A;  2PMZ E;  1SYX B;  2JA7 A;  2AU0 A;  3OTO H;  4J9M A;  4GC7 A;  4ED2 A;  3OHA A;  1TWA A;  1TWG A;  5FD6 A;  4F4Z A;  3RJ0 A;  3Q8S B;  3RBE A;  1I6U A;  4MTD A;  3UQ8 A;  4LSA A;  1N32 H;  4B3S H;  3RB6 A;  4QJF A;  5L1I A;  4ETS A;  4JI4 H;  4NLG A;  1FJG H;  4ECS A;  2W6M A;  4JV0 A;  2I80 A;  5LP6 F;  4QW9 A;  4YR2 A;  5CA0 F;  5JUM A;  1EHI A;  3GIL A;  5KFZ A;  1M6V A;  3HXL A;  3RFC A;  3VPC A;  3VPB A;  1EYZ A;  4I50 F;  2VR1 A;  2YL2 A;  1E4G T;  5DGB A;  5I47 A;  1KJJ A;  3JAM W;  4O4I F;  4LSX A;  3J7A K;  2JA8 G;  1RYS A;  4APM A;  1BXR A;  3GV7 B;  4GKK H;  4A3D G;  1N48 A;  2ZDQ A;  3BG5 A;  3FKI A;  5IYC G;  1V9P A;  4LF7 H;  3G8C A;  4M7E A;  5DQH A;  1Y1W A;  4EEQ A;  1VKZ A;  4QIW E;  1S97 A;  4LH6 A;  5IYZ F;  3RB0 A;  3HKZ A;  5GON F;  4ECV A;  2BQU A;  3R5X A;  3V4S A;  2JA7 G;  4O4H F;  2XCA A;  3GTJ A;  5KG5 A;  2YYA A;  4ECY A;  1PX2 A;  3BA9 A;  5KT3 A;  5D1O A;  4X66 H;  2YS7 A;  4UCO A;  2UXD H;  1UC8 A;  5BPF A;  2VA2 A;  1I3Q A;  3VPD A;  1T3N A;  2VPS A;  4UCT A;  4A3B G;  5EDW A;  2CZG A;  3RUP A;  2R7L A;  2WAQ A;  4IHJ F;  4MV3 A;  2JEI A;  4JI5 H;  4FM9 A;  1IBL H;  4ECT A;  1E4E B;  2JEJ A;  1EUC B; 
#chains in the Genus database with same CATH homology
 1N36 H;  4X62 H;  4JI7 H;  2VQE H;  1TAE A;  4MTE A;  4DR3 H;  1X9N A;  4JYA H;  3T1H H;  4RB1 A;  4AQY H;  1Z2O X;  4Q0Y A;  3KAK A;  5LMU H;  2XIG A;  2UUB H;  2UU9 H;  1N34 H;  3N42 B;  1XNQ H;  3BAA A;  3F8N A;  3IG0 A;  3BA8 A;  2VOB A;  4DUZ H;  2WYO A;  1FKA H;  5D1O B;  3DF7 A;  2UUC H;  2VUG A;  5IWA H;  4LFC H;  1IBM H;  1L2Z A;  3N44 B;  4RAY A;  3L4J A;  1ZHS A;  4MV9 A;  2HVR A;  5LMN H;  3JSL A;  5LL6 b;  4LF5 H;  1Z2N X;  4A2B A;  1A0I A;  4DV0 H;  1TA8 A;  1B04 A;  2ZM6 H;  4DV3 H;  4IAJ A;  1HNW H;  4LF6 H;  4RZQ A;  1M0W A;  2FE3 A;  4X65 H;  3L4K A;  4DR4 H;  4CC5 A;  2Q2U A;  1GYF A;  4MV7 A;  1I94 H;  4LF8 H;  4DV1 H;  4JI2 H;  2UUA H;  3LML A;  4UCR A;  5FPR A;  1XMO H;  2WDT A;  4DR2 H;  2UXB H;  4A2A A;  3N6X A;  5BR8 H;  4DV4 H;  4DV6 H;  2ZJT A;  5FD5 A;  4DR7 H;  1XMQ H;  3T1Y H;  4K0K H;  5FPO A;  2VQF H;  2F4V H;  4I7H A;  2HVQ A;  4UFZ A;  2E5L H;  2RGR A;  1S03 G;  2WE6 A;  5EOY A;  3K3V A;  3L2P A;  5IT9 W;  3J80 W;  4RAZ A;  2CW8 A;  4JI6 H;  3FMA A;  4OX9 H;  3RGZ A;  1M0T A;  3PN1 A;  1VS0 A;  2W57 A;  4DV5 H;  1SEI A;  1SYX B;  1DGS A;  2YCH A;  4LH7 A;  4RB3 C;  3MWM A;  3OTO H;  5FLX W;  2CW7 A;  4NXN H;  5FD6 A;  3RJ0 A;  4X64 H;  1HNX H;  4DR5 H;  4R7R A;  4DUY H;  1I6U A;  1IBK H;  4MTD A;  3J81 W;  3UQ8 A;  2OWO A;  4DR1 H;  4LSA A;  1N32 H;  4B3S H;  4LF9 H;  4ETS A;  4EFE A;  4JI4 H;  4KHP H;  1FJG H;  3KAL A;  4UCV A;  1FVI A;  4YY3 H;  4RB0 A;  2O03 A;  2RGV A;  3RF2 A;  3JSN A;  1ZHQ A;  3RTX A;  4DV2 H;  2Q2T A;  1BJT A;  1Z2P X;  3H20 A;  3HXL A;  3M4I A;  4J0M A;  4B3T H;  3EYY A;  3KAJ A;  4RB2 C;  2HHH H;  1E4G T;  1BGW A;  1HNZ H;  4JI8 H;  3JAM W;  1XDN A;  1J5E H;  2MCT A;  4LSX A;  4JI0 H;  3J7A K;  4CC6 A;  4NXM H;  3N41 B;  3N40 P;  4APM A;  4GKK H;  4JI1 H;  4BWS C;  3RGX A;  4DV7 H;  1V9P A;  1HR0 H;  4PDB A;  1O75 A;  4JI3 H;  4LF7 H;  4GLX A;  2KSW A;  4M7E A;  4DR6 H;  1S68 A;  3N43 B;  1MZB A;  4EEQ A;  1E4F T;  2HVS A;  4LH6 A;  4LFB H;  4B3R H;  4UCS A;  3BAB A;  3BA9 A;  4UCU A;  2UXC H;  4GKJ H;  5D1O A;  5A2Q W;  2HGS A;  4UCO A;  4X66 H;  4LFA H;  4EFB A;  4LF4 H;  2UXD H;  4LMY A;  3KXY T;  1WH2 A;  1P8L A;  3RIZ A;  2VPS A;  4UCT A;  4YHH H;  1XNR H;  4B3M H;  4JI5 H;  3C0F B;  5D1P A;  4FM9 A;  1IBL H;  3CVZ A;  1AN7 A;  1N33 H;  4JV5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...