2KSWA

Backbone 1h, 13c, and 15n chemical shift assignments for oryctin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
b'VPVGSDCEPKLCTMDLVPHCFLNPEKGIVVVHGGCALSKYKCQNPNHEKLGYTHECEEAIKNAPRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Oryctin
molecule tags Hydrolase inhibitor
source organism Oryctes rhinoceros
publication title Isolation, cDNA cloning, and structure-based functional characterization of oryctin, a hemolymph protein from the coconut rhinoceros beetle, Oryctes rhinoceros, as a novel serine protease inhibitor
pubmed doi rcsb
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2010-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.260 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2kswA01
2KSWA
chains in the Genus database with same CATH superfamily
2C2DA 2I80A 4M7EA 2WE6A 3JZIA 4MTDA 1TWAA 1S0MA 3FMAA 1IOWA 3KHRA 2ZJTA 3MR6A 2C2RA 2ZDHA 3GTLA 2FLLA 2AU0A 2HHHH 3C0FB 3GIPA 4EYIB 3RV3A 4O3QA 4EBDA 2C22A 2FJZA 2W9BB 3G6YA 2WB1E 2W6QA 4ECRA 2VQDA 1FJGH 4IZOA 3K5HA 5LP6F 3MFHA 4EBCA 1KJ8A 2E2HA 3SI8A 4BY7G 5D8DA 5KFFA 3TINA 4A3KG 3JSLA 5C8YF 4QW8A 1W93A 5L1JA 4JV1A 5DLFA 2VA2A 2R82A 3MR3A 3M9MB 4J9LA 3RJ0A 3GIJA 4DV2H 3MR2A 1Z2OX 2W57A 2VPQA 3OHAA 1IOVA 2V4QA 1N34H 3T5LA 1A0IA 4L1KA 5BPFA 1S0OA 2WAQE 3VPDA 1M6VA 2CQYA 4MTEA 4EGQA 4TV8F 4YB8B 4EEQA 5L1LA 2CKZB 1Z2PX 1K1QA 3G6XA 3RGXA 4F4ZA 3V6JA 5KFUA 4TQSA 1M0TA 4BY1G 1KJQA 2FPIB 4IWXA 4RB3C 1XMOH 2XD4A 5IYDG 4Q8EA 3BJYA 3GTJA 2JEIA 5FPRA 2IMWP 4ECSA 1SEIA 2DIKA 1ZHQA 5EZYF 4YY3H 2OLSA 4JI2H 5KFBA 3G8CA 5DLGA 3KXYT 5KFZA 1WR2A 2R7ZA 2W6OA 4ZQIA 3JAMW 4J9PA 4DUYH 4HYKA 2YS6A 2ZM6H 3PW5A 2Q2UA 4CC6A 3H4BA 5JQWA 1ULZA 1RYRA 3Q8PB 2PVPA 4UCRA 3TIGA 4HNUA 3H0GG 5CA0F 5LL6b 3GTKA 1JDEA 3GIMA 1S9FA 1IBMH 2B63G 3K3VA 4A3JG 5BPHA 2JA6A 2R7LA 4RAZA 3PW0A 4QIWA 5F9LA 5KFOA 1B04A 2XCLA 4M9UA 2VPSA 3PO3G 1JKJB 4J9KA 2YS7A 2GPSA 3HOXG 4DV4H 1ZETA 4AYBA 4QJFA 4RB0A 2OWOA 4ED0A 2AGPA 3J7AK 3KALA 3OTOH 4A93G 2BR0A 3ORRA 2Y0SE 5KFYA 5KFXA 5KT6A 4JI4H 4JI1H 1V51A 3PO2G 2DLNA 3BQ2A 4LF9H 4ECQA 1M7JA 5H80A 3EPIA 1W96A 2DWCA 1DV1A 4EG0A 5CAEB 1EUDB 1WH2A 2RF4A 3GTQA 5DGAA 2XGQA 2ATLA 4O4LF 4YBZB 3WO0A 4ZHQF 2XCPA 4HNVA 4BXXG 4IAJA 1A9XA 4ECUA 4ECWA 1B6SA 4Q43A 4J9MA 3K5IA 5KFRA 3BA8A 5KFEA 3QZ7A 4A2AA 5DG7A 4ECTA 4EEYA 2FPGB 1R9TA 3RB0A 1EHIA 2R92G 2FK2A 5L1IA 1S0NA 2IP4A 5KFAA 2HGSA 5KX5F 3RBEA 1VBGA 2GLTA 2UXBH 2NU8B 5KG5A 5JH7F 1CQJB 2X0SA 4Q45A 2F4VH 2C28A 2NU7B 3U9SA 4DR4H 3GQCA 5A2QW 4ECVA 4LF5H 2R7ZG 4JI3H 2C00A 4ED8A 3Q8SB 4DL4A 3I12A 1KEEA 2UVUA 4RUAA 2R8GA 5L1KA 1DV2A 1VAJA 3CQZA 2FK1A 3HBLA 1T36A 2W7OA 1VKZA 4O3SA 5KG4A 4A3BG 4XYMB 4DV0H 1GYFA 4X66H 3RB6A 1Y1WG 1TWFA 3BA9A 2HVRA 3I4MG 5BR8H 4J0MA 2YCHA 3PR4A 1MZBA 3UQ8A 4B3RH 2R92A 4YR0A 2YW2A 3L4JA 3I4NG 2WAQA 1C3OA 1XDNA 2V4RA 4F4YA 1E4FT 4R7RA 5KFDA 2W9AA 2FLNA 1O75A 1K1SA 4DUZH 3KAKA 4DV3H 4X64H 1I6UA 4GLXA 2DZDA 3GTGA 4O3OA 4JI5H 5T14A 2VQFH 4O3NA 4J9SA 2QYZA 5D1OB 5JVLA 2VR1A 5IP7G 2QK4A 3RBDA 4UCUA 3MWDA 4DV6H 3VMMA 5KFMA 4ETSA 5KFTA 3NGDA 5LYJF 4B3TH 1GGOA 3AYHB 4B3SH 2Y0SA 1IBLH 3M4IA 3RGZA 2UXDH 4MV3A 4J9QA 4DL2A 1XNRH 5HBRB 2Q2TA 4MV6A 3GTMA 2JA5A 2FK3A 4HNTA 1XNQH 3R5HA 2UVRA 3QFFA 2W70A 3GIQA 1E4EB 3N43B 2UUAH 1CE8A 2P0AA 5KFNA 3H20A 4LSAA 4LF6H 3RIZA 1VBHA 5JUMA 1SFOA 4F4XA 4G3IA 4IR9A 5DGBA 3MFIA 2ZDQA 2NVXA 1N33H 5FJ8G 1GLVA 4C5AA 4DL5A 2DPIA 5GONF 3HXLA 3HB9A 3RTXA 2AGQA 1BJTA 4A3EG 4DR2H 3MJFA 2ZDGA 2WB1A 1KBLA 5C1OA 1BNCA 4O4HF 2O03A 2V59A 4HQ6A 3SE7A 3J81W 2W9CB 3GLKA 3Q2OA 2R7NA 3TIIA 1GO3E 1HR0H 4OX9H 4Q8FA 5IYBG 2CW8A 2JEGA 4ECZA 1N36H 5C1PA 4JUZA 5J2UF 5KFKA 3GIKA 5KFJA 3PR5B 2UUCH 4UCOA 2W71A 2UU9H 3VPBA 1I7NA 3JRWA 5DG8A 4YR2A 3GV8B 4EBEA 2R85A 2W8LA 5FLMG 5EWGA 1L2ZA 2NU6B 1JXLA 3MWEA 2RDIA 4LMYA 2JEJA 4MA5A 3PN1A 3RAXA 1T3NA 3HOYG 3BG5A 3R5FA 4EYHB 1S68A 1EYZA 2JA6G 4C5BA 3PW4A 1IBKH 4WBNF 3N8DA 5KFCA 4GKJH 3PVXA 2C2EA 1HNZH 1P8LA 3PW7A 3ORQA 4IR1A 5C3EG 4A3FG 3PZPA 4RAYA 1X9NA 3HOVG 1TWGA 1V9PA 4EFBA 4YHHH 4DR3H 4DL6A 2HJWA 4JV5H 1RJPA 4YQWA 3VPCA 1M0WA 4J9NA 4WD3A 2JA5G 2BQUA 1FKAH 4NXNH 3HKZA 2WTFA 2UXCH 1I3QA 4QW9A 2R93A 1GSOA 4YAKB 1N32H 1I50A 4MV1A 2JA8G 5C5JA 2VOBA 4DR7H 2ALZA 2M05A 2JA7G 3H40A 1WCMA 3E5NA 3JRXA 1TA8A 3M9NB 1FVIA 2FPPB 5FPOA 1RK5A 5FLXW 1AUVA 4LFAH 5LA6F 4YAJB 4BBRG 3V6HA 3N40P 3OUZA 2PBZA 4DV7H 4ED6A 3GTPA 4XZ3B 3F8NA 3HOWG 1S10A 3RB3A 4Q0YA 1XMQH 3GV5B 4Y8VB 3MR5A 5K2MA 2KSWA 3RFCA 4F4WA 5DQGA 5LMUH 2YZNA 5KG1A 3BABA 5KG3A 2FLPA 4NLGA 4LF7H 2UVWA 2VUMA 1WCMG 2R7KA 5DG9A 1Y1WA 5IYZF 3L2PA 2W9BA 5KT5A 4DV1H 4QWAA 1ZHSA 5KT3A 3RB4A 4O4IF 1UC9A 4YJ3F 4TQRA 4RU9A 3KTMA 5KFQA 5KFIA 5IWAH 5KFGA 5F9NA 3M9OB 2HVSA 2I87A 4DLKA 1UC8A 3RAQA 1AUXA 4YR3A 1HNWH 1SYXB 4I7HA 3GIIA 5KT7A 3FKIA 4C5CA 1N56A 1CS0A 5KFLA 3LWBA 2W6NA 5D1PA 3TQ1A 1PX2A 4NXMH 3R5XA 1BGWA 4I55F 3Q8QB 3K3PA 2R8HA 2YU9A 4KHPH 4A3GG 2PMZE 2XIGA 3H0GA 3JSNA 5KFPA 5C44G 4DV5H 4DR1H 1E4EA 5KG2A 5IT9W 4JI7H 3R23A 1N48A 1ZQ7A 1JIHA 3H4DA 1SCUB 2HVQA 2WYOA 2V5AA 3T5HA 1HNXH 1VS0A 3IG0A 2MCTA 4LFBH 2RGRA 1Y1VA 1EZ1A 1E4GT 4LH7A 4I4TF 5FD5A 3V4SA 3KHLA 2VA3A 4BBSG 4A2BA 1KJJA 1Y14B 4LF4H 3FKIG 1V4YA 4A3DG 3ETHA 5EWEA 1UNNC 2R8JA 4K0KH 2AQ4A 1RJRA 3BAAA 2J6SA 2J9GA 4DR6H 2UVVA 4JI0H 5C4XG 2CW7A 2E5LH 4UCSA 4JV0A 1EUCB 4JI6H 2FKLA 1DIKA 3N44B 4J9OA 3Q8RB 4MA0A 5KFWA 4I50F 4UFZA 3RV4A 1S97A 4XX0B 2SCUB 3N41B 5EOYA 5KG6A 4RUCA 4FBUA 5KT2A 4J9RA 2FP4B 3KAJA 2R84A 3T1HH 3HKZE 4MV9A 4CC5A 4O3RA 3OSNA 4LF8H 1S03G 4LFCH 5KFSA 4YJ2F 5BMVF 5LMNH 1CQIB 5HV6A 4RNMA 4QWDA 3KHGA 3G6VA 5I47A 2R7MA 5FD6A 5KFHA 4RNOA 4R8UB 3Q1KA 5KG7A 3KHHA 4ME6A 5IP9G 3WNZA 4FM9A 4QWCA 1TWCA 1B33N 4O2AF 2FMAA 2W6PA 2WDTA 4MV4A 4XYLB 1J5EH 3LP8A 4O2BF 4HR7A 2AGOA 2XCAA 3RUPA 5KG0A 1JLLB 1RJQA 4IWYA 2FB9A 5CB4F 3T1YH 2NVYA 4MAMA 5J2TF 3OHBA 4ECYA 3ETJA 3MWMA 1AN7A 3N42B 3WO1A 3EPGA 2ASLA 5EWFA 3BQ0A 4AQYH 1C30A 2NUAB 1OWTA 4ED2A 2W6ZA 3J80W 2UUBH 2RGVA 2JA7A 4QWEA 3HOZG 5JVDF 1JDBB 4QIWE 3L4KA 1KC7A 2FE3A 3BQ1A 1RYSA 1GSAA 3V6KA 4TV9F 2I8CA 2PN1A 3FDSA 4MV7A 4DR5H 4C2MA 4ZI7F 2VUMG 2R93G 4E4TA 3GV7B 4LH6A 5EDWA 2YL2A 4ED1A 2IA6A 1BXRA 5D1OA 2YRWA 4IRKA 5LXTF 5DQIA 2GPWA 2YZGA 2XGPA 4UCTA 1TWHA 4GC7A 4GC6A 1DGSA 2JEFA 2YZMA 2YYAA 4RZRA 4PWQA 4DL7A 4A3MG 4FU0A 4X62H 2R8KA 4AYBE 4O3PA 4B3MH 4RB2C 1I7LA 5KFVA 2RDJA 3OUUA 2J6TA 1K83A 3RF2A 3IN5A 3CVZA 1KJ9A 3EYYA 4APMA 5IYCG 1RK6A 2CZGA 3LMLA 4F50A 4GKKH 3H3VH 4A3CG 2B63A 4ED7A 2R87A 5KT4A 3GILA 3T5KA 4PDBA 3GIDA 3TQTA 3N6XA 4EGJA 4FS2A 3PW2A 3U9TA 1GSHA 2DPJA 4EFEA 2YRXA 4LSXA 1KJIA 4MV8A 4BWSC 3HOUG 3DF7A 4IRDA 4DL3A 1Y1VG 4TUYF 4ED3A 2BQRA 2IBKA 4Q44A 2XC9A 2VQEH 4RB1A 2W8KA 1JX4A 5KKNB 2W9CA 4YP3A 2OH2A 2V58A 1B6RA 4U6PA 1PK8A 4A3LG 2PMZA 2R8IA 3T5JA 3QZ8A 4A3IG 4RZQA 4R8UA 4RNNA 4FS1A 1WSCA 2NU9B 3OSPA 2ASDA 1TAEA 2ASJA 4IRCA 4JV2A 2C35B 4JI8H 2J6UA 2R6FA 4IHJF 4ECXA 2V9WA 4UCVA 1Z2NX 5L9XA 4QWBA 2W6MA 3V4ZA 2BQ3A 2VUGA 4ZOLF 2E2IA 4X65H 1T94A 5CA1F 4JYAH 5DQHA 2W7PA 5LOVF 3GTOA 4U7CA 2R86A 4FBTA 1I94H 3UFXB
chains in the Genus database with same CATH topology
4M7EA 2HGSA 2WE6A 4MV9A 4MTDA 4RAYA 4CC5A 2UXBH 1X9NA 4LF8H 1S03G 3FMAA 1V9PA 4EFBA 4YHHH 4DR3H 4LFCH 2F4VH 4JV5H 5LMNH 2ZJTA 4DR4H 5FD6A 1M0WA 5A2QW 4LF5H 1FKAH 4NXNH 4JI3H 2HHHH 3C0FB 2UXCH 4FM9A 1N32H 1FJGH 2WDTA 2VOBA 4DV0H 4DR7H 1GYFA 4X66H 1J5EH 3BA9A 2HVRA 5BR8H 4J0MA 1TA8A 3JSLA 2YCHA 1FVIA 1MZBA 5FPOA 5FLXW 3UQ8A 4B3RH 3L4JA 3T1YH 4LFAH 3N40P 1XDNA 3MWMA 1AN7A 3N42B 1E4FT 4R7RA 3RJ0A 4DV2H 4DV7H 3F8NA 1Z2OX 2W57A 1O75A 4DUZH 3KAKA 4AQYH 4DV3H 4Q0YA 1XMQH 1N34H 4X64H 1I6UA 1A0IA 2KSWA 3J80W 4GLXA 2UUBH 2RGVA 5LMUH 4MTEA 4EEQA 3L4KA 3BABA 2FE3A 4JI5H 2VQFH 1Z2PX 3RGXA 4LF7H 5D1OB 4DR5H 4MV7A 1M0TA 4LH6A 4UCUA 4DV6H 1XMOH 4RB3C 3L2PA 4DV1H 4ETSA 5D1OA 1ZHSA 4B3TH 5FPRA 4B3SH 1SEIA 1IBLH 1ZHQA 3M4IA 3RGZA 4UCTA 4YY3H 2UXDH 1XNRH 1DGSA 4JI2H 5IWAH 2HVSA 3KXYT 2Q2TA 4X62H 3JAMW 4DUYH 2Q2UA 4B3MH 2ZM6H 4RB2C 1SYXB 4I7HA 4CC6A 1HNWH 1XNQH 3N43B 2UUAH 4UCRA 3RF2A 5D1PA 5LL6b 3H20A 4LSAA 3CVZA 1IBMH 3EYYA 3RIZA 4APMA 4LF6H 3K3VA 1BGWA 3LMLA 4NXMH 4GKKH 4KHPH 2XIGA 3JSNA 4DV5H 4DR1H 4PDBA 4RAZA 5IT9W 4JI7H 1B04A 1N33H 3N6XA 2VPSA 3HXLA 3RTXA 1BJTA 4DR2H 4EFEA 2HVQA 4LSXA 2WYOA 4BWSC 1VS0A 3IG0A 1HNXH 4DV4H 2MCTA 4LFBH 3DF7A 2O03A 4RB0A 3J81W 2RGRA 2OWOA 3J7AK 1E4GT 3KALA 4LH7A 5FD5A 3OTOH 2VQEH 4RB1A 1HR0H 4A2BA 4LF4H 4OX9H 4JI4H 2CW8A 4JI1H 1N36H 4LF9H 4K0KH 2UUCH 3BAAA 4UCOA 4DR6H 2UU9H 4RZQA 4JI0H 1WH2A 2CW7A 2E5LH 1TAEA 4UCSA 1L2ZA 4JI6H 4JI8H 3N44B 4LMYA 3PN1A 4IAJA 1Z2NX 4UCVA 4UFZA 2VUGA 5EOYA 1S68A 3N41B 4X65H 3BA8A 1IBKH 4A2AA 4GKJH 3KAJA 4JYAH 1HNZH 1P8LA 1I94H 3T1HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSW A; 
#chains in the Genus database with same CATH topology
 2C2D A;  2I80 A;  4M7E A;  2WE6 A;  3JZI A;  4MTD A;  1TWA A;  1S0M A;  3FMA A;  1IOW A;  3KHR A;  2ZJT A;  3MR6 A;  2C2R A;  2ZDH A;  3GTL A;  2FLL A;  2AU0 A;  2HHH H;  3C0F B;  3GIP A;  4EYI B;  3RV3 A;  4O3Q A;  4EBD A;  2C22 A;  2FJZ A;  2W9B B;  3G6Y A;  2WB1 E;  2W6Q A;  4ECR A;  2VQD A;  1FJG H;  4IZO A;  3K5H A;  5LP6 F;  3MFH A;  4EBC A;  1KJ8 A;  2E2H A;  3SI8 A;  4BY7 G;  5D8D A;  5KFF A;  3TIN A;  4A3K G;  3JSL A;  5C8Y F;  4QW8 A;  1W93 A;  5L1J A;  4JV1 A;  5DLF A;  2VA2 A;  2R82 A;  3MR3 A;  3M9M B;  4J9L A;  3RJ0 A;  3GIJ A;  4DV2 H;  3MR2 A;  1Z2O X;  2W57 A;  2VPQ A;  3OHA A;  1IOV A;  2V4Q A;  1N34 H;  3T5L A;  1A0I A;  4L1K A;  5BPF A;  1S0O A;  2WAQ E;  3VPD A;  1M6V A;  2CQY A;  4MTE A;  4EGQ A;  4TV8 F;  4YB8 B;  4EEQ A;  5L1L A;  2CKZ B;  1Z2P X;  1K1Q A;  3G6X A;  3RGX A;  4F4Z A;  3V6J A;  5KFU A;  4TQS A;  1M0T A;  4BY1 G;  1KJQ A;  2FPI B;  4IWX A;  4RB3 C;  1XMO H;  2XD4 A;  5IYD G;  4Q8E A;  3BJY A;  3GTJ A;  2JEI A;  5FPR A;  2IMW P;  4ECS A;  1SEI A;  2DIK A;  1ZHQ A;  5EZY F;  4YY3 H;  2OLS A;  4JI2 H;  5KFB A;  3G8C A;  5DLG A;  3KXY T;  5KFZ A;  1WR2 A;  2R7Z A;  2W6O A;  4ZQI A;  3JAM W;  4J9P A;  4DUY H;  4HYK A;  2YS6 A;  2ZM6 H;  3PW5 A;  2Q2U A;  4CC6 A;  3H4B A;  5JQW A;  1ULZ A;  1RYR A;  3Q8P B;  2PVP A;  4UCR A;  3TIG A;  4HNU A;  3H0G G;  5CA0 F;  5LL6 b;  3GTK A;  1JDE A;  3GIM A;  1S9F A;  1IBM H;  2B63 G;  3K3V A;  4A3J G;  5BPH A;  2JA6 A;  2R7L A;  4RAZ A;  3PW0 A;  4QIW A;  5F9L A;  5KFO A;  1B04 A;  2XCL A;  4M9U A;  2VPS A;  3PO3 G;  1JKJ B;  4J9K A;  2YS7 A;  2GPS A;  3HOX G;  4DV4 H;  1ZET A;  4AYB A;  4QJF A;  4RB0 A;  2OWO A;  4ED0 A;  2AGP A;  3J7A K;  3KAL A;  3OTO H;  4A93 G;  2BR0 A;  3ORR A;  2Y0S E;  5KFY A;  5KFX A;  5KT6 A;  4JI4 H;  4JI1 H;  1V51 A;  3PO2 G;  2DLN A;  3BQ2 A;  4LF9 H;  4ECQ A;  1M7J A;  5H80 A;  3EPI A;  1W96 A;  2DWC A;  1DV1 A;  4EG0 A;  5CAE B;  1EUD B;  1WH2 A;  2RF4 A;  3GTQ A;  5DGA A;  2XGQ A;  2ATL A;  4O4L F;  4YBZ B;  3WO0 A;  4ZHQ F;  2XCP A;  4HNV A;  4BXX G;  4IAJ A;  1A9X A;  4ECU A;  4ECW A;  1B6S A;  4Q43 A;  4J9M A;  3K5I A;  5KFR A;  3BA8 A;  5KFE A;  3QZ7 A;  4A2A A;  5DG7 A;  4ECT A;  4EEY A;  2FPG B;  1R9T A;  3RB0 A;  1EHI A;  2R92 G;  2FK2 A;  5L1I A;  1S0N A;  2IP4 A;  5KFA A;  2HGS A;  5KX5 F;  3RBE A;  1VBG A;  2GLT A;  2UXB H;  2NU8 B;  5KG5 A;  5JH7 F;  1CQJ B;  2X0S A;  4Q45 A;  2F4V H;  2C28 A;  2NU7 B;  3U9S A;  4DR4 H;  3GQC A;  5A2Q W;  4ECV A;  4LF5 H;  2R7Z G;  4JI3 H;  2C00 A;  4ED8 A;  3Q8S B;  4DL4 A;  3I12 A;  1KEE A;  2UVU A;  4RUA A;  2R8G A;  5L1K A;  1DV2 A;  1VAJ A;  3CQZ A;  2FK1 A;  3HBL A;  1T36 A;  2W7O A;  1VKZ A;  4O3S A;  5KG4 A;  4A3B G;  4XYM B;  4DV0 H;  1GYF A;  4X66 H;  3RB6 A;  1Y1W G;  1TWF A;  3BA9 A;  2HVR A;  3I4M G;  5BR8 H;  4J0M A;  2YCH A;  3PR4 A;  1MZB A;  3UQ8 A;  4B3R H;  2R92 A;  4YR0 A;  2YW2 A;  3L4J A;  3I4N G;  2WAQ A;  1C3O A;  1XDN A;  2V4R A;  4F4Y A;  1E4F T;  4R7R A;  5KFD A;  2W9A A;  2FLN A;  1O75 A;  1K1S A;  4DUZ H;  3KAK A;  4DV3 H;  4X64 H;  1I6U A;  4GLX A;  2DZD A;  3GTG A;  4O3O A;  4JI5 H;  5T14 A;  2VQF H;  4O3N A;  4J9S A;  2QYZ A;  5D1O B;  5JVL A;  2VR1 A;  5IP7 G;  2QK4 A;  3RBD A;  4UCU A;  3MWD A;  4DV6 H;  3VMM A;  5KFM A;  4ETS A;  5KFT A;  3NGD A;  5LYJ F;  4B3T H;  1GGO A;  3AYH B;  4B3S H;  2Y0S A;  1IBL H;  3M4I A;  3RGZ A;  2UXD H;  4MV3 A;  4J9Q A;  4DL2 A;  1XNR H;  5HBR B;  2Q2T A;  4MV6 A;  3GTM A;  2JA5 A;  2FK3 A;  4HNT A;  1XNQ H;  3R5H A;  2UVR A;  3QFF A;  2W70 A;  3GIQ A;  1E4E B;  3N43 B;  2UUA H;  1CE8 A;  2P0A A;  5KFN A;  3H20 A;  4LSA A;  4LF6 H;  3RIZ A;  1VBH A;  5JUM A;  1SFO A;  4F4X A;  4G3I A;  4IR9 A;  5DGB A;  3MFI A;  2ZDQ A;  2NVX A;  1N33 H;  5FJ8 G;  1GLV A;  4C5A A;  4DL5 A;  2DPI A;  5GON F;  3HXL A;  3HB9 A;  3RTX A;  2AGQ A;  1BJT A;  4A3E G;  4DR2 H;  3MJF A;  2ZDG A;  2WB1 A;  1KBL A;  5C1O A;  1BNC A;  4O4H F;  2O03 A;  2V59 A;  4HQ6 A;  3SE7 A;  3J81 W;  2W9C B;  3GLK A;  3Q2O A;  2R7N A;  3TII A;  1GO3 E;  1HR0 H;  4OX9 H;  4Q8F A;  5IYB G;  2CW8 A;  2JEG A;  4ECZ A;  1N36 H;  5C1P A;  4JUZ A;  5J2U F;  5KFK A;  3GIK A;  5KFJ A;  3PR5 B;  2UUC H;  4UCO A;  2W71 A;  2UU9 H;  3VPB A;  1I7N A;  3JRW A;  5DG8 A;  4YR2 A;  3GV8 B;  4EBE A;  2R85 A;  2W8L A;  5FLM G;  5EWG A;  1L2Z A;  2NU6 B;  1JXL A;  3MWE A;  2RDI A;  4LMY A;  2JEJ A;  4MA5 A;  3PN1 A;  3RAX A;  1T3N A;  3HOY G;  3BG5 A;  3R5F A;  4EYH B;  1S68 A;  1EYZ A;  2JA6 G;  4C5B A;  3PW4 A;  1IBK H;  4WBN F;  3N8D A;  5KFC A;  4GKJ H;  3PVX A;  2C2E A;  1HNZ H;  1P8L A;  3PW7 A;  3ORQ A;  4IR1 A;  5C3E G;  4A3F G;  3PZP A;  4RAY A;  1X9N A;  3HOV G;  1TWG A;  1V9P A;  4EFB A;  4YHH H;  4DR3 H;  4DL6 A;  2HJW A;  4JV5 H;  1RJP A;  4YQW A;  3VPC A;  1M0W A;  4J9N A;  4WD3 A;  2JA5 G;  2BQU A;  1FKA H;  4NXN H;  3HKZ A;  2WTF A;  2UXC H;  1I3Q A;  4QW9 A;  2R93 A;  1GSO A;  4YAK B;  1N32 H;  1I50 A;  4MV1 A;  2JA8 G;  5C5J A;  2VOB A;  4DR7 H;  2ALZ A;  2M05 A;  2JA7 G;  3H40 A;  1WCM A;  3E5N A;  3JRX A;  1TA8 A;  3M9N B;  1FVI A;  2FPP B;  5FPO A;  1RK5 A;  5FLX W;  1AUV A;  4LFA H;  5LA6 F;  4YAJ B;  4BBR G;  3V6H A;  3N40 P;  3OUZ A;  2PBZ A;  4DV7 H;  4ED6 A;  3GTP A;  4XZ3 B;  3F8N A;  3HOW G;  1S10 A;  3RB3 A;  4Q0Y A;  1XMQ H;  3GV5 B;  4Y8V B;  3MR5 A;  5K2M A;  2KSW A;  3RFC A;  4F4W A;  5DQG A;  5LMU H;  2YZN A;  5KG1 A;  3BAB A;  5KG3 A;  2FLP A;  4NLG A;  4LF7 H;  2UVW A;  2VUM A;  1WCM G;  2R7K A;  5DG9 A;  1Y1W A;  5IYZ F;  3L2P A;  2W9B A;  5KT5 A;  4DV1 H;  4QWA A;  1ZHS A;  5KT3 A;  3RB4 A;  4O4I F;  1UC9 A;  4YJ3 F;  4TQR A;  4RU9 A;  3KTM A;  5KFQ A;  5KFI A;  5IWA H;  5KFG A;  5F9N A;  3M9O B;  2HVS A;  2I87 A;  4DLK A;  1UC8 A;  3RAQ A;  1AUX A;  4YR3 A;  1HNW H;  1SYX B;  4I7H A;  3GII A;  5KT7 A;  3FKI A;  4C5C A;  1N56 A;  1CS0 A;  5KFL A;  3LWB A;  2W6N A;  5D1P A;  3TQ1 A;  1PX2 A;  4NXM H;  3R5X A;  1BGW A;  4I55 F;  3Q8Q B;  3K3P A;  2R8H A;  2YU9 A;  4KHP H;  4A3G G;  2PMZ E;  2XIG A;  3H0G A;  3JSN A;  5KFP A;  5C44 G;  4DV5 H;  4DR1 H;  1E4E A;  5KG2 A;  5IT9 W;  4JI7 H;  3R23 A;  1N48 A;  1ZQ7 A;  1JIH A;  3H4D A;  1SCU B;  2HVQ A;  2WYO A;  2V5A A;  3T5H A;  1HNX H;  1VS0 A;  3IG0 A;  2MCT A;  4LFB H;  2RGR A;  1Y1V A;  1EZ1 A;  1E4G T;  4LH7 A;  4I4T F;  5FD5 A;  3V4S A;  3KHL A;  2VA3 A;  4BBS G;  4A2B A;  1KJJ A;  1Y14 B;  4LF4 H;  3FKI G;  1V4Y A;  4A3D G;  3ETH A;  5EWE A;  1UNN C;  2R8J A;  4K0K H;  2AQ4 A;  1RJR A;  3BAA A;  2J6S A;  2J9G A;  4DR6 H;  2UVV A;  4JI0 H;  5C4X G;  2CW7 A;  2E5L H;  4UCS A;  4JV0 A;  1EUC B;  4JI6 H;  2FKL A;  1DIK A;  3N44 B;  4J9O A;  3Q8R B;  4MA0 A;  5KFW A;  4I50 F;  4UFZ A;  3RV4 A;  1S97 A;  4XX0 B;  2SCU B;  3N41 B;  5EOY A;  5KG6 A;  4RUC A;  4FBU A;  5KT2 A;  4J9R A;  2FP4 B;  3KAJ A;  2R84 A;  3T1H H;  3HKZ E;  4MV9 A;  4CC5 A;  4O3R A;  3OSN A;  4LF8 H;  1S03 G;  4LFC H;  5KFS A;  4YJ2 F;  5BMV F;  5LMN H;  1CQI B;  5HV6 A;  4RNM A;  4QWD A;  3KHG A;  3G6V A;  5I47 A;  2R7M A;  5FD6 A;  5KFH A;  4RNO A;  4R8U B;  3Q1K A;  5KG7 A;  3KHH A;  4ME6 A;  5IP9 G;  3WNZ A;  4FM9 A;  4QWC A;  1TWC A;  1B33 N;  4O2A F;  2FMA A;  2W6P A;  2WDT A;  4MV4 A;  4XYL B;  1J5E H;  3LP8 A;  4O2B F;  4HR7 A;  2AGO A;  2XCA A;  3RUP A;  5KG0 A;  1JLL B;  1RJQ A;  4IWY A;  2FB9 A;  5CB4 F;  3T1Y H;  2NVY A;  4MAM A;  5J2T F;  3OHB A;  4ECY A;  3ETJ A;  3MWM A;  1AN7 A;  3N42 B;  3WO1 A;  3EPG A;  2ASL A;  5EWF A;  3BQ0 A;  4AQY H;  1C30 A;  2NUA B;  1OWT A;  4ED2 A;  2W6Z A;  3J80 W;  2UUB H;  2RGV A;  2JA7 A;  4QWE A;  3HOZ G;  5JVD F;  1JDB B;  4QIW E;  3L4K A;  1KC7 A;  2FE3 A;  3BQ1 A;  1RYS A;  1GSA A;  3V6K A;  4TV9 F;  2I8C A;  2PN1 A;  3FDS A;  4MV7 A;  4DR5 H;  4C2M A;  4ZI7 F;  2VUM G;  2R93 G;  4E4T A;  3GV7 B;  4LH6 A;  5EDW A;  2YL2 A;  4ED1 A;  2IA6 A;  1BXR A;  5D1O A;  2YRW A;  4IRK A;  5LXT F;  5DQI A;  2GPW A;  2YZG A;  2XGP A;  4UCT A;  1TWH A;  4GC7 A;  4GC6 A;  1DGS A;  2JEF A;  2YZM A;  2YYA A;  4RZR A;  4PWQ A;  4DL7 A;  4A3M G;  4FU0 A;  4X62 H;  2R8K A;  4AYB E;  4O3P A;  4B3M H;  4RB2 C;  1I7L A;  5KFV A;  2RDJ A;  3OUU A;  2J6T A;  1K83 A;  3RF2 A;  3IN5 A;  3CVZ A;  1KJ9 A;  3EYY A;  4APM A;  5IYC G;  1RK6 A;  2CZG A;  3LML A;  4F50 A;  4GKK H;  3H3V H;  4A3C G;  2B63 A;  4ED7 A;  2R87 A;  5KT4 A;  3GIL A;  3T5K A;  4PDB A;  3GID A;  3TQT A;  3N6X A;  4EGJ A;  4FS2 A;  3PW2 A;  3U9T A;  1GSH A;  2DPJ A;  4EFE A;  2YRX A;  4LSX A;  1KJI A;  4MV8 A;  4BWS C;  3HOU G;  3DF7 A;  4IRD A;  4DL3 A;  1Y1V G;  4TUY F;  4ED3 A;  2BQR A;  2IBK A;  4Q44 A;  2XC9 A;  2VQE H;  4RB1 A;  2W8K A;  1JX4 A;  5KKN B;  2W9C A;  4YP3 A;  2OH2 A;  2V58 A;  1B6R A;  4U6P A;  1PK8 A;  4A3L G;  2PMZ A;  2R8I A;  3T5J A;  3QZ8 A;  4A3I G;  4RZQ A;  4R8U A;  4RNN A;  4FS1 A;  1WSC A;  2NU9 B;  3OSP A;  2ASD A;  1TAE A;  2ASJ A;  4IRC A;  4JV2 A;  2C35 B;  4JI8 H;  2J6U A;  2R6F A;  4IHJ F;  4ECX A;  2V9W A;  4UCV A;  1Z2N X;  5L9X A;  4QWB A;  2W6M A;  3V4Z A;  2BQ3 A;  2VUG A;  4ZOL F;  2E2I A;  4X65 H;  1T94 A;  5CA1 F;  4JYA H;  5DQH A;  2W7P A;  5LOV F;  3GTO A;  4U7C A;  2R86 A;  4FBT A;  1I94 H;  3UFX B; 
#chains in the Genus database with same CATH homology
 4M7E A;  2HGS A;  2WE6 A;  4MV9 A;  4MTD A;  4RAY A;  4CC5 A;  2UXB H;  1X9N A;  4LF8 H;  1S03 G;  3FMA A;  1V9P A;  4EFB A;  4YHH H;  4DR3 H;  4LFC H;  2F4V H;  4JV5 H;  5LMN H;  2ZJT A;  4DR4 H;  5FD6 A;  1M0W A;  5A2Q W;  4LF5 H;  1FKA H;  4NXN H;  4JI3 H;  2HHH H;  3C0F B;  2UXC H;  4FM9 A;  1N32 H;  1FJG H;  2WDT A;  2VOB A;  4DV0 H;  4DR7 H;  1GYF A;  4X66 H;  1J5E H;  3BA9 A;  2HVR A;  5BR8 H;  4J0M A;  1TA8 A;  3JSL A;  2YCH A;  1FVI A;  1MZB A;  5FPO A;  5FLX W;  3UQ8 A;  4B3R H;  3L4J A;  3T1Y H;  4LFA H;  3N40 P;  1XDN A;  3MWM A;  1AN7 A;  3N42 B;  1E4F T;  4R7R A;  3RJ0 A;  4DV2 H;  4DV7 H;  3F8N A;  1Z2O X;  2W57 A;  1O75 A;  4DUZ H;  3KAK A;  4AQY H;  4DV3 H;  4Q0Y A;  1XMQ H;  1N34 H;  4X64 H;  1I6U A;  1A0I A;  2KSW A;  3J80 W;  4GLX A;  2UUB H;  2RGV A;  5LMU H;  4MTE A;  4EEQ A;  3L4K A;  3BAB A;  2FE3 A;  4JI5 H;  2VQF H;  1Z2P X;  3RGX A;  4LF7 H;  5D1O B;  4DR5 H;  4MV7 A;  1M0T A;  4LH6 A;  4UCU A;  4DV6 H;  1XMO H;  4RB3 C;  3L2P A;  4DV1 H;  4ETS A;  5D1O A;  1ZHS A;  4B3T H;  5FPR A;  4B3S H;  1SEI A;  1IBL H;  1ZHQ A;  3M4I A;  3RGZ A;  4UCT A;  4YY3 H;  2UXD H;  1XNR H;  1DGS A;  4JI2 H;  5IWA H;  2HVS A;  3KXY T;  2Q2T A;  4X62 H;  3JAM W;  4DUY H;  2Q2U A;  4B3M H;  2ZM6 H;  4RB2 C;  1SYX B;  4I7H A;  4CC6 A;  1HNW H;  1XNQ H;  3N43 B;  2UUA H;  4UCR A;  3RF2 A;  5D1P A;  5LL6 b;  3H20 A;  4LSA A;  3CVZ A;  1IBM H;  3EYY A;  3RIZ A;  4APM A;  4LF6 H;  3K3V A;  1BGW A;  3LML A;  4NXM H;  4GKK H;  4KHP H;  2XIG A;  3JSN A;  4DV5 H;  4DR1 H;  4PDB A;  4RAZ A;  5IT9 W;  4JI7 H;  1B04 A;  1N33 H;  3N6X A;  2VPS A;  3HXL A;  3RTX A;  1BJT A;  4DR2 H;  4EFE A;  2HVQ A;  4LSX A;  2WYO A;  4BWS C;  1VS0 A;  3IG0 A;  1HNX H;  4DV4 H;  2MCT A;  4LFB H;  3DF7 A;  2O03 A;  4RB0 A;  3J81 W;  2RGR A;  2OWO A;  3J7A K;  1E4G T;  3KAL A;  4LH7 A;  5FD5 A;  3OTO H;  2VQE H;  4RB1 A;  1HR0 H;  4A2B A;  4LF4 H;  4OX9 H;  4JI4 H;  2CW8 A;  4JI1 H;  1N36 H;  4LF9 H;  4K0K H;  2UUC H;  3BAA A;  4UCO A;  4DR6 H;  2UU9 H;  4RZQ A;  4JI0 H;  1WH2 A;  2CW7 A;  2E5L H;  1TAE A;  4UCS A;  1L2Z A;  4JI6 H;  4JI8 H;  3N44 B;  4LMY A;  3PN1 A;  4IAJ A;  1Z2N X;  4UCV A;  4UFZ A;  2VUG A;  5EOY A;  1S68 A;  3N41 B;  4X65 H;  3BA8 A;  1IBK H;  4A2A A;  4GKJ H;  3KAJ A;  4JYA H;  1HNZ H;  1P8L A;  1I94 H;  3T1H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...