2KT7A

Solution nmr structure of mucin-binding domain of protein lmo0835 from listeria monocytogenes, northeast structural genomics consortium target lmr64a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
b'MDTNNFTVKVEYVDADGAEIAPSDTLTDYHYVSTPKDIPGYKLREIPHNATGNITDTGIIVRYIYDKIIDVSYVDETGKDLLPVVEIINSEAAVLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peptidoglycan bound protein (LPXTG motif)
publication title Solution NMR structure of mucin-binding domain of protein lmo0835 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion, membrane protein
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kt7A01
2KT7A 2KVZA 4M02A 2KYWA 4M01A 4M00A
chains in the Genus database with same CATH superfamily
4I6PA 4US9A 3W1SC 3P2BA 3W1SA 4PK1A 3R66C 2J0MA 4RF0A 4G3XB 4XWTA 1YQBA 3N30A 4FULA 1GJZA 1P9DU 1ZXIA 1RRBA 2JZPA 2L3ZA 4BFRA 1XD3B 2K8HA 1T0RC 4DHZE 1EWCA 2V4LA 2Z8LA 4RGOS 3CSFA 3IBEA 2NR2A 3N3KB 2JT4B 3V3XA 2WXKA 1NI2A 1YJJA 2N9XA 1HQRD 2MQJA 1EU3A 2V0GA 4DHJB 2ZVNA 3Q2AC 2BB6A 5E6NA 1E9MA 1T3QA 1EU4A 3P4QB 3LB8C 4ARIA 3P1MA 4IM3A 2K6QA 3ALBA 1E90A 2LVQA 4W9HA 3IFWB 5BYQA 1WMHA 4HPLB 1Q1OA 4CQNA 3M95A 5AZGA 4AWJA 1FCCC 3EC8A 1ESFA 4YL8A 4YTNB 3SU8X 2BS4B 4ARCA 1CK1A 2M17A 3WAPA 1V2YA 3HIZA 1XEEA 2DLBA 2JU6X 3AEDB 4ZRJA 1IBXA 1GC6A 3NZ3A 1TYGB 2WDVB 1ENFA 1ZE3D 2FNJB 1EWYC 3SEBA 3BZDB 3NOBA 3OWEB 3PS6A 3JSVA 2L0TA 2KFJA 4NAMA 1NENB 1V1OA 1RYJA 1WXVA 4W9LA 3RYTA 4YTMB 1UD7A 2IO2B 2K0PA 4W9FA 3N20C 3QX1A 2NBUA 2WDTB 1VCBA 5HI1A 2JQRB 4RGNA 2DZJA 2WNMA 1L0XB 2FCSA 3IAM1 1WM2A 2UYZB 2I38A 5AZHA 3HM6X 4WJOA 1KLGD 1YN3A 3H7PA 4M01A 1L4ZB 2JYEA 3I3TB 3KQ4A 4PS3A 4J6IA 3DVNU 2D2QA 3VVWB 3A9KA 1WYWB 1RLFA 2NTSA 1PGAA 2NTTA 3GZNB 3KWLA 3AE1B 4LK0M 2CHXA 1A5RA 2RDGA 1WR6E 1JWSD 4ITKA 3X23A 4JIOU 2INNE 2RDBC 2C5LC 4N6EB 3RMKC 2KJ6A 1PDXA 4LNKA 2KC1A 4FBJB 1M94A 3PO0A 2MJEA 2V9HA 1KM7A 2DBYA 3LYYA 1CJEA 2LXCA 2JYTA 4USAA 4RM8A 1FPYA 4HLEA 2KNBA 4FLHA 4DWFA 1E8ZA 1QOBA 1E7PB 1SIJA 2V4IB 2JSVX 1FCLA 5LXHA 1YQ4B 2BS2B 4MJSA 3AE4B 4LNOA 3ZW3A 1CZPA 1L0VB 2GBNA 4BKSD 2Q5WD 1ZDXA 2W3RA 2N9EB 3L4PA 4K7SA 3ZUNA 1WJNA 2WXMA 4XDDA 2M8SA 4HJKA 4NAWB 2KANA 2CU3A 2KFKB 2K25A 2XNAC 2K9XA 3PZDA 1V97A 2CHWA 3UI3A 1V81A 1OGWA 1FO4A 2GRIA 3V05A 1JROA 4ANVA 4C4VA 1SJED 4E3CA 1UBQA 2R61A 3GS2A 2N4FA 2BPSA 1V49A 2WGSA 1K52A 3SR6A 1AYFA 2MJ3A 4W9CA 2BYFA 1PYWD 2D07B 1BUIC 1BT0A 3EUB2 3RNCC 3WAOA 3KUCB 4P1BC 3NHEB 2KMAA 1WX8A 3R2TA 3MHZA 4EKUA 5HFYA 2D11A 4AJWA 2R2OA 1KJTA 2KKCA 1E7UA 5H92C 2WU2B 1V9JA 3I9V1 2V3NA 3Q14C 2LUEA 4K81A 3QCAA 1C3TA 3IXSA 3TL5A 1GNUA 2M1MA 4C7ZA 2X38A 2JPHA 2KTFA 2JWZA 2XK5A 1I4PA 1JALA 5LLIA 3SFEB 1SXTA 2KMMA 3AU4A 3VUYA 4DBGA 5HKHA 2OJWA 2OHFA 1F0ZA 1Z2MA 3MHSD 3P42A 4KIKB 4RMAA 2JZZA 2IBIB 1WMHB 1BMLC 4Q2JA 4EZJA 1FXAA 2LMCA 1SE2A 1EM7A 2N7EA 1JRUA 1YMHE 4GXBA 3BVZA 2LHEA 3MC9A 4ZYSA 1D6EC 2WWZA 4GN1A 2FIDA 1ZUD2 5BO4B 4DHJD 1IBXB 4PT5A 3EFUA 1FXIA 4ASWC 1QQRA 4PYUA 4EEWA 3JSVB 2GBKA 1UBIA 2ZEQA 3UGBB 2W9NA 4RGMA 1TT5B 4B9KA 5JHBA 2C7NB 3T3OA 3H9DA 1KOTA 1GC7A 1M4VA 2KWDA 3AH7A 1FIQA 3DQVA 3P63A 2CHZA 2N7JA 4NJ6A 5D2MB 3WCQA 3AMZA 1WXMA 2REXA 3B9JA 4LLGM 3VHTC 1ZP0B 4OW0A 2ZPNA 3H7PB 2MP2A 3A33B 3VH3B 1JMLA 4HCNB 1MHXA 2KDBA 1KLUD 2MA9B 1V5OA 5CHWA 4ZDVA 2KTRA 2DZIA 2ZNVC 3PRPB 1FM0D 3BYTB 4IWQA 1TKGA 2EKIA 2J53A 1C4PA 3RNBC 4BAXA 3RULA 3SHQA 1VZ7A 2HE7A 2KX3A 4A3OA 1VZ8A 5IA7A 3ZNHB 1YOVB 4BBNC 3FILB 5EE0A 2HTHA 3V60A 4FA6A 3N32A 4MGIE 2MJDA 2JUOA 3RNAC 4EZKA 4N58A 5CTRC 3CIRB 3DPDA 1N63A 1FEHA 2BF8B 3L54A 4DQOC 4GGQA 4HDQA 1OQYA 1STEA 1TS2A 1ROEA 4AQ7A 1D5MC 2WLBA 4MJSB 3Q3NC 1F2RC 2M19A 4ZOHC 1SBBB 4BKTA 4OZCA 4XYCA 1VZ6A 2RPQA 2XEWA 4LNFA 2K6DB 3U52E 4F7ZA 2N9LA 3ETRA 1JQ4A 2R2QA 1MI0A 4B0EA 4C00A 2RD0A 3HVDA 3NRZA 5IO9A 3Q6BA 4MH0E 4C4VB 2L52A 2AX5A 1WJ6A 5JHAA 2CKHB 1PQSA 3UF8A 1FRRA 1H4RA 4HCPB 4ICVA 4KKJA 1KF6B 4HVBA 3KUDB 3P4PB 3WANA 4ACFA 2GI9A 1YN4A 4DDGD 2W3SA 1Q5WB 5C3JB 3AE5B 3CF6E 2J0JA 1DOXA 1P0RA 1D4BA 5EE3A 2KN5A 2K39A 2IDYA 4L2YA 1WXSA 3CSTA 1UWMA 1HTQA 2KQSA 3ECIA 1MG8A 2LJIA 2ASQA 3URYA 1R4NB 3ZJTA 4JGHB 4K1RB 4TQ1A 3WAMA 4RM9A 3DHIC 1SB3C 5FK9C 1IGCA 2ZCBA 3GZNI 1ET6A 5G2NA 4S17A 4CO7A 4MM3A 2KWVB 2LGYA 1JW9D 2QHOA 3MC0B 4AP4C 2KVZA 2MRPA 5DCNA 2O2VB 3FKYA 1RWSA 1TZ1A 3BK2A 4NJ7A 2KN4A 4KDIC 4UDUC 1WXQA 4YSXB 1C4CA 1E8XA 3V62A 3OAWA 3WA0A 2JXXA 3NS8A 2LVPA 1WGKA 4ANUA 2CJOA 4WURA 1DOIA 4DDID 2BYTA 3RNEC 3MP9A 4OZAA 1PGBA 4RGTA 2NS5A 1VDVA 1EF1A 1WYGA 1XQQA 4ZRPA 1E5WA 2WXJA 3AE8B 5JZEB 4F8CB 2OJRA 4B6WA 1DYQA 1AN8A 1WX9A 3VUWA 5CHVC 5D7GA 1L6VA 3A4SC 3S2AA 2K22A 2W54A 3PLUA 1R4MB 3GE8C 4WWNA 3R7QA 1NVID 4YSZB 2G4DB 2MWSB 2NCNA 5AUKA 2MP2B 4J3OD 1P1AA 1ZDVA 3BWUD 5FR3A 4FXCA 2DYOA 2PE9A 3TSSA 4E74A 1LXDA 3Q3OC 4A9AA 1ACCA 4FN2A 1C77A 2L0FA 5HG2A 5L95C 2KLCA 1LO5D 2KTRB 1KFYB 1C79A 4NQLB 2LVOA 3QWZB 5IN7A 1T0QC 2ZNVB 3ZGZA 2AQ2B 1J7AA 2EMSA 1WRDB 3DHHC 1EO6A 2YLMA 3NZUA 1K51A 1QZEA 3ZNID 2L1AA 2PE6B 1MG4A 2NBWB 5I4DA 3AN1A 1NYRA 3NVZA 1QOFA 4OZBA 2A4ZA 3PHXB 4ZHPA 2KDIA 3ABVB 3TEZA 2WXIA 4KX6B 2KDMA 1QT9A 1RFAA 2I1KA 3U30A 5MPOA 2LRWA 3AU5A 2N0SB 1WF9A 2J4XA 4GDLB 1IYFA 1GB4A 2K3UA 2SEBD 3TBLD 1B1ZA 1SE9A 2KK8A 4XDCA 5G5HA 2QEJC 1N5XA 2JRIB 1EF5A 1A70A 3TIXA 2GMIC 4OHJA 4ZYNA 4WJPA 1TBEA 2JX5A 2IY1B 2WX1A 1NDDA 1XT9B 4D2KA 2XN9C 3NVYA 4NNJB 4A8XC 4WWPA 4HWIB 3Q3JA 4RNAA 1FMAD 3NS1A 3N9YC 3TUOA 4DXFA 5AUIA 5JXVA 2AQ3B 1DOYA 4R3DA 4C80A 3A1QA 2CJNA 4TQ0A 2MW5A 3IT4B 4EUTA 1G6JA 3J9CA 4F1SA 2WX0A 4G0NB 1V1PA 2K1FA 2K8CA 1ISNA 3AEFB 4YWGG 3AE9B 2LFIA 1P7EA 1YNTE 1WGHA 3DOWA 1UGMA 3WIMA 2EKEC 3P4SB 4TUUA 1C4AA 4YSYB 4MSMB 2KOXA 3MC8A 2SAKA 1QLBB 1K50A 4KZCA 1WJ4A 3R2IA 3UINB 1J7BA 5FKAC 4PS7A 4M8MA 3U2SC 1GG3A 3KH0A 4HJGE 4MEMA 3BINA 4ZRIA 2V3SA 3VAWA 2JXTA 1OQRA 3H1UA 4HROA 2BWFA 1F52A 3B0AA 3N1YC 2D3GA 4EZLA 2WXGA 4KVGB 3PT2B 1D5XC 4DXAB 2C7HA 3Q8CA 3MFGA 1T0SC 2C7MB 2LGSA 2LXAA 3N1XC 3APFA 3AI5A 3PRZA 4FJYA 1E8WA 2KD0A 2M0AA 3PZ8A 1SJHD 4KGTA 4REZA 4YT0B 2N7DA 1AARA 3HRDD 1IPGA 4O1NA 3A9JA 2KLGA 1I35A 3GB1A 1WXAA 2JY6A 2AWTA 4A20A 1Y56A 1V8CA 4KDLB 3VRAB 4M8NA 1R7SA 4HPPA 3V6EB 4EE2A 3AE7B 1FD6A 4S0RA 4JE3B 1I4XA 5D94A 3QC8B 1FFUA 1KRHA 3AE3B 4RH6A 3APDA 2Z0EB 1F1HA 1VR9A 4BZAA 1PGXA 5L83A 1WWTA 5GMVA 3MTNB 1T0YA 1OEYA 4BVUC 1S3SG 3TJPA 1YX6B 3ZDMC 2ZW1A 3QAQA 3W5UB 2BVCA 4LNNA 1WJUA 1TZOA 1FNWA 3AEGB 4A55A 2X8XX 4GLSC 2WYQA 4NZLB 2KZRA 2NPTA 3DBLI 4XX5A 1YQ3B 2UU7A 2Y3AA 1TGZB 5IKCM 1WGRA 5J2RA 1CMXB 3AE6B 2QC8A 4RFBA 1SGHA 2WS3B 1E10A 3CMMB 4KSKC 1ZW7A 2CS4A 2KVRA 4GU2A 4LNIA 1C78A 1WI0A 3DVGY 5EE9A 2KDFB 1MPEA 2EMTA 1V6EA 1WRIA 5KHOA 2AYOB 3ZVVA 2Y5PA 3VXWA 1V86A 1GOZA 3M62B 2LGIA 4BKGA 5J17A 4ZRQA 4WAFA 3ZQ4A 3IG3A 4HKZE 2ZCCA 2FAZA 2W82A 3T3NA 1N60A 2ICIA 1TY0A 3FAHA 4GIVA 4OVZA 2BYEA 1L6UA 2FIFA 1WZ0A 4JLCA 2BGFA 4IKGA 5D3DA 2WDQB 3TEXA 1NEKB 2GBRA 3D32A 3AM9A 2NBVB 2NVUI 3VFKA 1SIFA 4LTUA 3K9PB 5D6JB 4AUQC 4WQMA 2PEAA 4M0WA 1YJIA 3RNGC 2JRHA 3GE3C 1YJ1A 2B76B 3A1QB 2N1VA 3KUZA 3M3JA 1BXTA 3A9KB 4C56C 2PPHA 3OG5A 3GOEA 1V1PB 4W9GA 2BS3B 1YIWA 3W9CB 2XBBC 2WXQA 4XE0A 2GBJA 3R3MA 1L2NA 1FFVA 3KWVA 1GB1A 3CWIA 3ZTCA 4BOSC 3Q8AA 1HZ5A 4A90A 3DVGX 4KV2A 2MBBB 4MGKE 3KLSX 2KAJA 1WX7A 3VR9B 1Z5SB 4K3CA 4EOYA 2E3TA 4JQWC 3V61A 3PTFC 2MSED 3RZWC 1E0ZA 1ZXHA 2EELA 1GAQB 2GOWA 2KYWA 3KVFB 2BB5A 3ENEA 1GUAB 2J7QB 1JRPA 2AL3A 1WY8A 2N9KA 2WXNA 4YXDB 1SSNA 4IM0A 3DBRB 1C9FA 5GXGB 1UH6A 3JVZX 2QDFA 3NZSA 1FNUA 3AE2B 3ONSA 4H2AA 3NVWA 5IOIA 1TS3A 1IGDA 5E6OA 1UGJA 2ON8A 2RR9A 4WIPA 4RF1A 1OEYJ 1N61A 2M4NA 2LHDA 2DX5B 1Q10A 2IGHA 2H88B 4N9F4 2J52A 1JWBD 2JVCA 4IWOA 1VJKA 3PZ7A 3RD2A 3AB5A 4MGYE 1OFFA 5E6PA 3BVGA 3BVMA 3VTWA 5D3IB 4B95A 5BMGA 4CYEA 2LI5A 3TMPB 4JL9A 2BYVE 2WXLA 3ZNZB 3JYUA 4IG7B 4WQOB 2OEDA 3SDLC 2NMQA 3HK0A 3PSEB 3NY5A 3L10B 3EGRA 1WH3A 3L16A 1QOGA 3PLVA 2IJ0A 1QF6A 2XK5B 2K8BA 4AJYB 2LD9A 3DBSA 5LNK1 1HA5A 2W55A 4HEA1 1S1QB 2M56B 2B3AA 4MACA 4IOIE 1I4RA 1N62A 3AULA 2WXPA 4MGZE 2D3BA 4I6NB 5AEKB 1WE7A 2M0XA 3DWGC 3UIOB 2H89B 2IYDB 2C60A 4MSQB 3ZLZA 3C0RB 3VTUA 1SEBD 3W2DA 4FJZA 2AEHA 4BOZB 4E71A 1F9JA 2L76A 3HM3A 3HHMA 1V5TA 4OVVA 1L7YA 2DHZA 5LXIB 1HXYD 4HXDA 2KJRA 2DZKA 3N1ZC 1HTOA 2KQ4X 3AEEB 3RN9C 3DVNV 2MBOA 4RCOA 4TSSA 4ANXA 1T5XD 2DAFA 1WZ3A 4HKQA 2PTLA 3T8MA 3NJTA 3RNFC 1WR1A 3P4RB 4GOCA 2CR5A 2V3PA 2DYBA 3Q3FA 3H8HA 4II3B 4P6VF 3B2GA 2LEKA 2VRRB 2MBHA 2D3CA 2IPKD 3SD5A 1WSPA 4GMVA 3ML8A 4A3PA 3I57A 3IT6B 1JWUD 2IGDA 5KHQA 2Z0DB 1P3QU 3ZYYX 3KW5B 2PW9A 3VH4B 3Q3MC 3L08A 1X1MA 4M0WB 4IDIA 1TKYA 1L0YB 5JH5C 1LGRA 3L0WB 4MT5A 2FBWB 2HTME 2BKRB 1VRAB 1C1YB 3RUIB 4W9IA 4PS8A 2ZW0A 3TCAA 4W9JA 3ZRFA 1WM3A 3W5VB 3Q69A 4XGAB 3NUHB 2DZMA 4KIKA 2LASA 2QSDA 3NVVA 1JWMD 2RDHA 2RPVA 4TKNA 1PUTA 1SF0A 2Z59B 3DBHB 3OJ3A 4AOFA 5E6JA 3EA6A 4PYZA 4YTPB 2MEKA 4HK2A 2MHJA 4K3BA 1ZOYB 1TS5A 2KMCA 4NPNA 1QKZA 2INCC 2WDRB 2LUMA 3QIJA 2ACZB 4WJQA 3ZDTA 2O6VD 3B08A 2GLSA 2LGXA 3Q8FA 4KGRA 2I2YA 3MJ5A 1E7VA 1QOAA 5T8IA 4FADA 1XF5L 2JWUA 2KQ7A 1KLVA 5DPWA 1RAXA 2D3AA 4XC2A 1J7CA 1MFWA 1WFYA 1WGGA 2DYMA 1MJDA 1TY2A 2KWCA 3AECB 3DWMA 4ZHOA 3C8YA 1FRDA 2O6VA 3ZO5B 1Y8RC 3RZFA 2WXFA 4OVUA 2E6XA 5IAAC 2FUHB 3OJ4B 3O13A 3EHVA 2ONQA 4IWPA 4W9KA 3AV8A 1NYQA 2HDEA 5HHDG 4US8A 2MLBA 3ZKJC 2V1YA 3ZJVA 2L7RA 3VQIA 2KO3A 1LM8B 2YVCA 3MJWA 4LDTD 4W9DA 3RCZA 1GPXA 5EDSA 4GB9A 1MHHE 2WXHA 2K5PA 2PMVA 4FHJA 2QILA 1XLNA 2LGDA 1UUPA 2PLPA 4G50A 1YN5A 1KTKA 3FILA 2PKOA 3L13A 1QILA 3TEYA 4LJOB 2FE8A 1UELA 2PVGC 4G11A 1DGJA 4NQKE 3U4EG 3EFCA 4XZ4A 2MH7A 3RI7C 4MM3B 2KJHB 1E6EB 3AEBB 5DPRA 2MX2A 3Q8BA 1WE6A 2G3QB 2HJ8A 1XXGA 1J8CA 3ZTDA 4NY0A 3RPFC 2L05A 4IW0A 1U4AA 1WGDA 4L1BA 1JWAD 3T9LA 4WWMA 1EUVB 4MELA 2WQYB 1MVKA 2N9PC 1CQVA 2INDC 2PIAA 1UNSA 2Y5BB 5J18A 2KC2A 3HVZA 1L4DB 1XCQL 1FNVA 3V6CB 4MH8A 1C76A 5BMIA 5CX3A 4NJCA 5G5GA 5C2TB 5BMHA 4WJNA 1WIAA 4BKSA 3DBRI 4ZRKA 2RSUA 4TV3A 1SE3A 2VH2A 2VZKB 3VRBB 2HD5B 3DDCB 3PHWB 4ICUA 4N59A 1H8CA 3VTVA 4JX1C 5DPTA 4EFOA 4AS1A 2L83A 2QMTA 4DHZB 3BK1A 3NG0A 2G9HD 2MBQA 1D3ZA 3LXFA 2VH1A 1VLBA 1KH0A 4A6QA 2Y5CA 4JPSA 3U7DA 2PJHA 2ZVOA 2N1WA 1HE8A 2C9WB 2FCNA 2KXJA 1UZXB 2KACA 1F77A 3PREA 2HJ1A 4JWSC 1IUEA 4MDKE 3E56A 4B0MA 3QK0A 3E9SA 3PGEA 2YEPF 1HEZE 1XLOA 1J0GA 1NI3A 1VD2A 3ZXVA 2D10A 4GDKA 1P98A 2AL6A 2O2VA 5G55A 1TS4A 1Q0WB 1D5ZC 4P16A 1I42A 2L00B 4L23A 2DNFA 3BY4B 2QIEB 2WXOA 1TTNA 5IP4D 1RM6C 1R4NI 3IVFA 2LWPA 2BTEA 4CHKA 2CU1A 1N6ZA 1B9RA 4DK5A 1P7FA 2ZPYA 3B1LX 1I4GA 3I63C 4ANWA 2BW2A 1N5WA 2FCQA 5AZFA 2UWQA 3Q8EA 1HZ6A 5TR5A 3KYCD 3U7ZA 2BWES 3APCA 3R8BA 2WU5B 1AWDA 3AEAB 1ET9A 4II2B 3B2FA 1ZPSA 3LJ3A 2L32A 2KWUB 1J19A 3BIID 2O6VB 3LDZE 2BT6A 2QJLA 3C19A 5H8YE 2DWQA 5TSSA 3SFDB 3W1YA 3ZRCA 3JW0X 3X0WA 1OQQA 4DXGA 3I5JC 4C7YA 2MBEA 1RFKA 2JF5A 2L8JA 2ZZPB 3FC4A 3OLMD 5EE1A 3UQAA 2IGGA 2IO1B 3HUIA 1TJEA 1R4MI 1XLPA 1UF0A 3PV1A 4M02A 1V80A 1YD8U 5FR6A 3VUXA 3UIPB 2GBMA 3A4RA 3M63B 3RT3B 4GDLA 3KYDD 3PRMB 2DENB 4LDTB 5C1ZA 4KSLC 3ZNGC 2WP9B 4LCDE 4K7WA 3K9OB 4FHKA 2FCMA 2BQQA 4WH4A 2RGFA 3IHPC 3IAS1 4GSWA 3L17A 1E8YA 2IY0B 1IP9A 1OTRB 2A5UA 5CHFA 2IO0B 4HDOA 5DPSA 1XCTL 2WXRA 3EECA 2INPE 2MCNB 2G1EA 1FXTB 3DBHI 2LJ5A 2JZ3B 3DHGC 3ZXRA 2J0KA 3QQ8B 1AW7A 3BYYB 3QJZA 4KZ0A 2YEPB 2BBCA 4P7IA 1I4QA 3VR8B 2ZJDA 1LFDA 4WWOA 1K8RB 3ML9A 2KDEB 5BYRA 3A9JB 2QCZA 2TSSA 2KHWB 5C23A 1PFDA 4QAYA 4P1CC 4K7UA 1ZKHA 1F2RI 4XWWA 3DBLB 3O65B 4BBNF 2OOBB 3PVLA 2IZVB 4X57B 4LJPB 2DAJA 3VDZA 2G45B 3QHTA 4IM2A 4TMAB 1SE4A 2BKFA 2IO3B 1TKEA 3H7SA 4IUMB 2I1JA 1ZGUB 2FUG1 1YX5B 4IC7B 4HPMB 2G4SA 4URKA 4M00A 4FJVB 1WGYA 1TIFA 3QA8A 3QARA 2RMMA 1K53A 1NBFC 2NPTB 3ZJUA 3ZIMA 3PPAA 3WALA 3UQBA 4HRSA 4WAAA 2WHIA 2D5GA 2AQ1B 1LQBA 4KGSA 2PVOD 1T6BX 1XO3A 4W9EA 4KKIA 2LZ6A 1L5PA 2VZKD 3DCGA 1I7HA 1JCKB 4NAWA 2LRUA 2GB1A 2KFKA 3RFZB 3GP7A 3TEWA 1I4HA 3AXCA 2KX0A 4JWUC 3H6NA 2KT7A 1XLQA 2J42A 4I6LB 4GDKB 5BYSA 3U8ZA 1UWXA 3R7RA
chains in the Genus database with same CATH topology
2KT7A 2KVZA 4M02A 2KYWA 4M01A 4M00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT7 A;  2KVZ A;  4M02 A;  2KYW A;  4M01 A;  4M00 A; 
#chains in the Genus database with same CATH topology
 4I6P A;  4US9 A;  3W1S C;  3P2B A;  3W1S A;  4PK1 A;  3R66 C;  2J0M A;  4RF0 A;  4G3X B;  4XWT A;  1YQB A;  3N30 A;  4FUL A;  1GJZ A;  1P9D U;  1ZXI A;  1RRB A;  2JZP A;  2L3Z A;  4BFR A;  1XD3 B;  2K8H A;  1T0R C;  4DHZ E;  1EWC A;  2V4L A;  2Z8L A;  4RGO S;  3CSF A;  3IBE A;  2NR2 A;  3N3K B;  2JT4 B;  3V3X A;  2WXK A;  1NI2 A;  1YJJ A;  2N9X A;  1HQR D;  2MQJ A;  1EU3 A;  2V0G A;  4DHJ B;  2ZVN A;  3Q2A C;  2BB6 A;  5E6N A;  1E9M A;  1T3Q A;  1EU4 A;  3P4Q B;  3LB8 C;  4ARI A;  3P1M A;  4IM3 A;  2K6Q A;  3ALB A;  1E90 A;  2LVQ A;  4W9H A;  3IFW B;  5BYQ A;  1WMH A;  4HPL B;  1Q1O A;  4CQN A;  3M95 A;  5AZG A;  4AWJ A;  1FCC C;  3EC8 A;  1ESF A;  4YL8 A;  4YTN B;  3SU8 X;  2BS4 B;  4ARC A;  1CK1 A;  2M17 A;  3WAP A;  1V2Y A;  3HIZ A;  1XEE A;  2DLB A;  2JU6 X;  3AED B;  4ZRJ A;  1IBX A;  1GC6 A;  3NZ3 A;  1TYG B;  2WDV B;  1ENF A;  1ZE3 D;  2FNJ B;  1EWY C;  3SEB A;  3BZD B;  3NOB A;  3OWE B;  3PS6 A;  3JSV A;  2L0T A;  2KFJ A;  4NAM A;  1NEN B;  1V1O A;  1RYJ A;  1WXV A;  4W9L A;  3RYT A;  4YTM B;  1UD7 A;  2IO2 B;  2K0P A;  4W9F A;  3N20 C;  3QX1 A;  2NBU A;  2WDT B;  1VCB A;  5HI1 A;  2JQR B;  4RGN A;  2DZJ A;  2WNM A;  1L0X B;  2FCS A;  3IAM 1;  1WM2 A;  2UYZ B;  2I38 A;  5AZH A;  3HM6 X;  4WJO A;  1KLG D;  1YN3 A;  3H7P A;  4M01 A;  1L4Z B;  2JYE A;  3I3T B;  3KQ4 A;  4PS3 A;  4J6I A;  3DVN U;  2D2Q A;  3VVW B;  3A9K A;  1WYW B;  1RLF A;  2NTS A;  1PGA A;  2NTT A;  3GZN B;  3KWL A;  3AE1 B;  4LK0 M;  2CHX A;  1A5R A;  2RDG A;  1WR6 E;  1JWS D;  4ITK A;  3X23 A;  4JIO U;  2INN E;  2RDB C;  2C5L C;  4N6E B;  3RMK C;  2KJ6 A;  1PDX A;  4LNK A;  2KC1 A;  4FBJ B;  1M94 A;  3PO0 A;  2MJE A;  2V9H A;  1KM7 A;  2DBY A;  3LYY A;  1CJE A;  2LXC A;  2JYT A;  4USA A;  4RM8 A;  1FPY A;  4HLE A;  2KNB A;  4FLH A;  4DWF A;  1E8Z A;  1QOB A;  1E7P B;  1SIJ A;  2V4I B;  2JSV X;  1FCL A;  5LXH A;  1YQ4 B;  2BS2 B;  4MJS A;  3AE4 B;  4LNO A;  3ZW3 A;  1CZP A;  1L0V B;  2GBN A;  4BKS D;  2Q5W D;  1ZDX A;  2W3R A;  2N9E B;  3L4P A;  4K7S A;  3ZUN A;  1WJN A;  2WXM A;  4XDD A;  2M8S A;  4HJK A;  4NAW B;  2KAN A;  2CU3 A;  2KFK B;  2K25 A;  2XNA C;  2K9X A;  3PZD A;  1V97 A;  2CHW A;  3UI3 A;  1V81 A;  1OGW A;  1FO4 A;  2GRI A;  3V05 A;  1JRO A;  4ANV A;  4C4V A;  1SJE D;  4E3C A;  1UBQ A;  2R61 A;  3GS2 A;  2N4F A;  2BPS A;  1V49 A;  2WGS A;  1K52 A;  3SR6 A;  1AYF A;  2MJ3 A;  4W9C A;  2BYF A;  1PYW D;  2D07 B;  1BUI C;  1BT0 A;  3EUB 2;  3RNC C;  3WAO A;  3KUC B;  4P1B C;  3NHE B;  2KMA A;  1WX8 A;  3R2T A;  3MHZ A;  4EKU A;  5HFY A;  2D11 A;  4AJW A;  2R2O A;  1KJT A;  2KKC A;  1E7U A;  5H92 C;  2WU2 B;  1V9J A;  3I9V 1;  2V3N A;  3Q14 C;  2LUE A;  4K81 A;  3QCA A;  1C3T A;  3IXS A;  3TL5 A;  1GNU A;  2M1M A;  4C7Z A;  2X38 A;  2JPH A;  2KTF A;  2JWZ A;  2XK5 A;  1I4P A;  1JAL A;  5LLI A;  3SFE B;  1SXT A;  2KMM A;  3AU4 A;  3VUY A;  4DBG A;  5HKH A;  2OJW A;  2OHF A;  1F0Z A;  1Z2M A;  3MHS D;  3P42 A;  4KIK B;  4RMA A;  2JZZ A;  2IBI B;  1WMH B;  1BML C;  4Q2J A;  4EZJ A;  1FXA A;  2LMC A;  1SE2 A;  1EM7 A;  2N7E A;  1JRU A;  1YMH E;  4GXB A;  3BVZ A;  2LHE A;  3MC9 A;  4ZYS A;  1D6E C;  2WWZ A;  4GN1 A;  2FID A;  1ZUD 2;  5BO4 B;  4DHJ D;  1IBX B;  4PT5 A;  3EFU A;  1FXI A;  4ASW C;  1QQR A;  4PYU A;  4EEW A;  3JSV B;  2GBK A;  1UBI A;  2ZEQ A;  3UGB B;  2W9N A;  4RGM A;  1TT5 B;  4B9K A;  5JHB A;  2C7N B;  3T3O A;  3H9D A;  1KOT A;  1GC7 A;  1M4V A;  2KWD A;  3AH7 A;  1FIQ A;  3DQV A;  3P63 A;  2CHZ A;  2N7J A;  4NJ6 A;  5D2M B;  3WCQ A;  3AMZ A;  1WXM A;  2REX A;  3B9J A;  4LLG M;  3VHT C;  1ZP0 B;  4OW0 A;  2ZPN A;  3H7P B;  2MP2 A;  3A33 B;  3VH3 B;  1JML A;  4HCN B;  1MHX A;  2KDB A;  1KLU D;  2MA9 B;  1V5O A;  5CHW A;  4ZDV A;  2KTR A;  2DZI A;  2ZNV C;  3PRP B;  1FM0 D;  3BYT B;  4IWQ A;  1TKG A;  2EKI A;  2J53 A;  1C4P A;  3RNB C;  4BAX A;  3RUL A;  3SHQ A;  1VZ7 A;  2HE7 A;  2KX3 A;  4A3O A;  1VZ8 A;  5IA7 A;  3ZNH B;  1YOV B;  4BBN C;  3FIL B;  5EE0 A;  2HTH A;  3V60 A;  4FA6 A;  3N32 A;  4MGI E;  2MJD A;  2JUO A;  3RNA C;  4EZK A;  4N58 A;  5CTR C;  3CIR B;  3DPD A;  1N63 A;  1FEH A;  2BF8 B;  3L54 A;  4DQO C;  4GGQ A;  4HDQ A;  1OQY A;  1STE A;  1TS2 A;  1ROE A;  4AQ7 A;  1D5M C;  2WLB A;  4MJS B;  3Q3N C;  1F2R C;  2M19 A;  4ZOH C;  1SBB B;  4BKT A;  4OZC A;  4XYC A;  1VZ6 A;  2RPQ A;  2XEW A;  4LNF A;  2K6D B;  3U52 E;  4F7Z A;  2N9L A;  3ETR A;  1JQ4 A;  2R2Q A;  1MI0 A;  4B0E A;  4C00 A;  2RD0 A;  3HVD A;  3NRZ A;  5IO9 A;  3Q6B A;  4MH0 E;  4C4V B;  2L52 A;  2AX5 A;  1WJ6 A;  5JHA A;  2CKH B;  1PQS A;  3UF8 A;  1FRR A;  1H4R A;  4HCP B;  4ICV A;  4KKJ A;  1KF6 B;  4HVB A;  3KUD B;  3P4P B;  3WAN A;  4ACF A;  2GI9 A;  1YN4 A;  4DDG D;  2W3S A;  1Q5W B;  5C3J B;  3AE5 B;  3CF6 E;  2J0J A;  1DOX A;  1P0R A;  1D4B A;  5EE3 A;  2KN5 A;  2K39 A;  2IDY A;  4L2Y A;  1WXS A;  3CST A;  1UWM A;  1HTQ A;  2KQS A;  3ECI A;  1MG8 A;  2LJI A;  2ASQ A;  3URY A;  1R4N B;  3ZJT A;  4JGH B;  4K1R B;  4TQ1 A;  3WAM A;  4RM9 A;  3DHI C;  1SB3 C;  5FK9 C;  1IGC A;  2ZCB A;  3GZN I;  1ET6 A;  5G2N A;  4S17 A;  4CO7 A;  4MM3 A;  2KWV B;  2LGY A;  1JW9 D;  2QHO A;  3MC0 B;  4AP4 C;  2KVZ A;  2MRP A;  5DCN A;  2O2V B;  3FKY A;  1RWS A;  1TZ1 A;  3BK2 A;  4NJ7 A;  2KN4 A;  4KDI C;  4UDU C;  1WXQ A;  4YSX B;  1C4C A;  1E8X A;  3V62 A;  3OAW A;  3WA0 A;  2JXX A;  3NS8 A;  2LVP A;  1WGK A;  4ANU A;  2CJO A;  4WUR A;  1DOI A;  4DDI D;  2BYT A;  3RNE C;  3MP9 A;  4OZA A;  1PGB A;  4RGT A;  2NS5 A;  1VDV A;  1EF1 A;  1WYG A;  1XQQ A;  4ZRP A;  1E5W A;  2WXJ A;  3AE8 B;  5JZE B;  4F8C B;  2OJR A;  4B6W A;  1DYQ A;  1AN8 A;  1WX9 A;  3VUW A;  5CHV C;  5D7G A;  1L6V A;  3A4S C;  3S2A A;  2K22 A;  2W54 A;  3PLU A;  1R4M B;  3GE8 C;  4WWN A;  3R7Q A;  1NVI D;  4YSZ B;  2G4D B;  2MWS B;  2NCN A;  5AUK A;  2MP2 B;  4J3O D;  1P1A A;  1ZDV A;  3BWU D;  5FR3 A;  4FXC A;  2DYO A;  2PE9 A;  3TSS A;  4E74 A;  1LXD A;  3Q3O C;  4A9A A;  1ACC A;  4FN2 A;  1C77 A;  2L0F A;  5HG2 A;  5L95 C;  2KLC A;  1LO5 D;  2KTR B;  1KFY B;  1C79 A;  4NQL B;  2LVO A;  3QWZ B;  5IN7 A;  1T0Q C;  2ZNV B;  3ZGZ A;  2AQ2 B;  1J7A A;  2EMS A;  1WRD B;  3DHH C;  1EO6 A;  2YLM A;  3NZU A;  1K51 A;  1QZE A;  3ZNI D;  2L1A A;  2PE6 B;  1MG4 A;  2NBW B;  5I4D A;  3AN1 A;  1NYR A;  3NVZ A;  1QOF A;  4OZB A;  2A4Z A;  3PHX B;  4ZHP A;  2KDI A;  3ABV B;  3TEZ A;  2WXI A;  4KX6 B;  2KDM A;  1QT9 A;  1RFA A;  2I1K A;  3U30 A;  5MPO A;  2LRW A;  3AU5 A;  2N0S B;  1WF9 A;  2J4X A;  4GDL B;  1IYF A;  1GB4 A;  2K3U A;  2SEB D;  3TBL D;  1B1Z A;  1SE9 A;  2KK8 A;  4XDC A;  5G5H A;  2QEJ C;  1N5X A;  2JRI B;  1EF5 A;  1A70 A;  3TIX A;  2GMI C;  4OHJ A;  4ZYN A;  4WJP A;  1TBE A;  2JX5 A;  2IY1 B;  2WX1 A;  1NDD A;  1XT9 B;  4D2K A;  2XN9 C;  3NVY A;  4NNJ B;  4A8X C;  4WWP A;  4HWI B;  3Q3J A;  4RNA A;  1FMA D;  3NS1 A;  3N9Y C;  3TUO A;  4DXF A;  5AUI A;  5JXV A;  2AQ3 B;  1DOY A;  4R3D A;  4C80 A;  3A1Q A;  2CJN A;  4TQ0 A;  2MW5 A;  3IT4 B;  4EUT A;  1G6J A;  3J9C A;  4F1S A;  2WX0 A;  4G0N B;  1V1P A;  2K1F A;  2K8C A;  1ISN A;  3AEF B;  4YWG G;  3AE9 B;  2LFI A;  1P7E A;  1YNT E;  1WGH A;  3DOW A;  1UGM A;  3WIM A;  2EKE C;  3P4S B;  4TUU A;  1C4A A;  4YSY B;  4MSM B;  2KOX A;  3MC8 A;  2SAK A;  1QLB B;  1K50 A;  4KZC A;  1WJ4 A;  3R2I A;  3UIN B;  1J7B A;  5FKA C;  4PS7 A;  4M8M A;  3U2S C;  1GG3 A;  3KH0 A;  4HJG E;  4MEM A;  3BIN A;  4ZRI A;  2V3S A;  3VAW A;  2JXT A;  1OQR A;  3H1U A;  4HRO A;  2BWF A;  1F52 A;  3B0A A;  3N1Y C;  2D3G A;  4EZL A;  2WXG A;  4KVG B;  3PT2 B;  1D5X C;  4DXA B;  2C7H A;  3Q8C A;  3MFG A;  1T0S C;  2C7M B;  2LGS A;  2LXA A;  3N1X C;  3APF A;  3AI5 A;  3PRZ A;  4FJY A;  1E8W A;  2KD0 A;  2M0A A;  3PZ8 A;  1SJH D;  4KGT A;  4REZ A;  4YT0 B;  2N7D A;  1AAR A;  3HRD D;  1IPG A;  4O1N A;  3A9J A;  2KLG A;  1I35 A;  3GB1 A;  1WXA A;  2JY6 A;  2AWT A;  4A20 A;  1Y56 A;  1V8C A;  4KDL B;  3VRA B;  4M8N A;  1R7S A;  4HPP A;  3V6E B;  4EE2 A;  3AE7 B;  1FD6 A;  4S0R A;  4JE3 B;  1I4X A;  5D94 A;  3QC8 B;  1FFU A;  1KRH A;  3AE3 B;  4RH6 A;  3APD A;  2Z0E B;  1F1H A;  1VR9 A;  4BZA A;  1PGX A;  5L83 A;  1WWT A;  5GMV A;  3MTN B;  1T0Y A;  1OEY A;  4BVU C;  1S3S G;  3TJP A;  1YX6 B;  3ZDM C;  2ZW1 A;  3QAQ A;  3W5U B;  2BVC A;  4LNN A;  1WJU A;  1TZO A;  1FNW A;  3AEG B;  4A55 A;  2X8X X;  4GLS C;  2WYQ A;  4NZL B;  2KZR A;  2NPT A;  3DBL I;  4XX5 A;  1YQ3 B;  2UU7 A;  2Y3A A;  1TGZ B;  5IKC M;  1WGR A;  5J2R A;  1CMX B;  3AE6 B;  2QC8 A;  4RFB A;  1SGH A;  2WS3 B;  1E10 A;  3CMM B;  4KSK C;  1ZW7 A;  2CS4 A;  2KVR A;  4GU2 A;  4LNI A;  1C78 A;  1WI0 A;  3DVG Y;  5EE9 A;  2KDF B;  1MPE A;  2EMT A;  1V6E A;  1WRI A;  5KHO A;  2AYO B;  3ZVV A;  2Y5P A;  3VXW A;  1V86 A;  1GOZ A;  3M62 B;  2LGI A;  4BKG A;  5J17 A;  4ZRQ A;  4WAF A;  3ZQ4 A;  3IG3 A;  4HKZ E;  2ZCC A;  2FAZ A;  2W82 A;  3T3N A;  1N60 A;  2ICI A;  1TY0 A;  3FAH A;  4GIV A;  4OVZ A;  2BYE A;  1L6U A;  2FIF A;  1WZ0 A;  4JLC A;  2BGF A;  4IKG A;  5D3D A;  2WDQ B;  3TEX A;  1NEK B;  2GBR A;  3D32 A;  3AM9 A;  2NBV B;  2NVU I;  3VFK A;  1SIF A;  4LTU A;  3K9P B;  5D6J B;  4AUQ C;  4WQM A;  2PEA A;  4M0W A;  1YJI A;  3RNG C;  2JRH A;  3GE3 C;  1YJ1 A;  2B76 B;  3A1Q B;  2N1V A;  3KUZ A;  3M3J A;  1BXT A;  3A9K B;  4C56 C;  2PPH A;  3OG5 A;  3GOE A;  1V1P B;  4W9G A;  2BS3 B;  1YIW A;  3W9C B;  2XBB C;  2WXQ A;  4XE0 A;  2GBJ A;  3R3M A;  1L2N A;  1FFV A;  3KWV A;  1GB1 A;  3CWI A;  3ZTC A;  4BOS C;  3Q8A A;  1HZ5 A;  4A90 A;  3DVG X;  4KV2 A;  2MBB B;  4MGK E;  3KLS X;  2KAJ A;  1WX7 A;  3VR9 B;  1Z5S B;  4K3C A;  4EOY A;  2E3T A;  4JQW C;  3V61 A;  3PTF C;  2MSE D;  3RZW C;  1E0Z A;  1ZXH A;  2EEL A;  1GAQ B;  2GOW A;  2KYW A;  3KVF B;  2BB5 A;  3ENE A;  1GUA B;  2J7Q B;  1JRP A;  2AL3 A;  1WY8 A;  2N9K A;  2WXN A;  4YXD B;  1SSN A;  4IM0 A;  3DBR B;  1C9F A;  5GXG B;  1UH6 A;  3JVZ X;  2QDF A;  3NZS A;  1FNU A;  3AE2 B;  3ONS A;  4H2A A;  3NVW A;  5IOI A;  1TS3 A;  1IGD A;  5E6O A;  1UGJ A;  2ON8 A;  2RR9 A;  4WIP A;  4RF1 A;  1OEY J;  1N61 A;  2M4N A;  2LHD A;  2DX5 B;  1Q10 A;  2IGH A;  2H88 B;  4N9F 4;  2J52 A;  1JWB D;  2JVC A;  4IWO A;  1VJK A;  3PZ7 A;  3RD2 A;  3AB5 A;  4MGY E;  1OFF A;  5E6P A;  3BVG A;  3BVM A;  3VTW A;  5D3I B;  4B95 A;  5BMG A;  4CYE A;  2LI5 A;  3TMP B;  4JL9 A;  2BYV E;  2WXL A;  3ZNZ B;  3JYU A;  4IG7 B;  4WQO B;  2OED A;  3SDL C;  2NMQ A;  3HK0 A;  3PSE B;  3NY5 A;  3L10 B;  3EGR A;  1WH3 A;  3L16 A;  1QOG A;  3PLV A;  2IJ0 A;  1QF6 A;  2XK5 B;  2K8B A;  4AJY B;  2LD9 A;  3DBS A;  5LNK 1;  1HA5 A;  2W55 A;  4HEA 1;  1S1Q B;  2M56 B;  2B3A A;  4MAC A;  4IOI E;  1I4R A;  1N62 A;  3AUL A;  2WXP A;  4MGZ E;  2D3B A;  4I6N B;  5AEK B;  1WE7 A;  2M0X A;  3DWG C;  3UIO B;  2H89 B;  2IYD B;  2C60 A;  4MSQ B;  3ZLZ A;  3C0R B;  3VTU A;  1SEB D;  3W2D A;  4FJZ A;  2AEH A;  4BOZ B;  4E71 A;  1F9J A;  2L76 A;  3HM3 A;  3HHM A;  1V5T A;  4OVV A;  1L7Y A;  2DHZ A;  5LXI B;  1HXY D;  4HXD A;  2KJR A;  2DZK A;  3N1Z C;  1HTO A;  2KQ4 X;  3AEE B;  3RN9 C;  3DVN V;  2MBO A;  4RCO A;  4TSS A;  4ANX A;  1T5X D;  2DAF A;  1WZ3 A;  4HKQ A;  2PTL A;  3T8M A;  3NJT A;  3RNF C;  1WR1 A;  3P4R B;  4GOC A;  2CR5 A;  2V3P A;  2DYB A;  3Q3F A;  3H8H A;  4II3 B;  4P6V F;  3B2G A;  2LEK A;  2VRR B;  2MBH A;  2D3C A;  2IPK D;  3SD5 A;  1WSP A;  4GMV A;  3ML8 A;  4A3P A;  3I57 A;  3IT6 B;  1JWU D;  2IGD A;  5KHQ A;  2Z0D B;  1P3Q U;  3ZYY X;  3KW5 B;  2PW9 A;  3VH4 B;  3Q3M C;  3L08 A;  1X1M A;  4M0W B;  4IDI A;  1TKY A;  1L0Y B;  5JH5 C;  1LGR A;  3L0W B;  4MT5 A;  2FBW B;  2HTM E;  2BKR B;  1VRA B;  1C1Y B;  3RUI B;  4W9I A;  4PS8 A;  2ZW0 A;  3TCA A;  4W9J A;  3ZRF A;  1WM3 A;  3W5V B;  3Q69 A;  4XGA B;  3NUH B;  2DZM A;  4KIK A;  2LAS A;  2QSD A;  3NVV A;  1JWM D;  2RDH A;  2RPV A;  4TKN A;  1PUT A;  1SF0 A;  2Z59 B;  3DBH B;  3OJ3 A;  4AOF A;  5E6J A;  3EA6 A;  4PYZ A;  4YTP B;  2MEK A;  4HK2 A;  2MHJ A;  4K3B A;  1ZOY B;  1TS5 A;  2KMC A;  4NPN A;  1QKZ A;  2INC C;  2WDR B;  2LUM A;  3QIJ A;  2ACZ B;  4WJQ A;  3ZDT A;  2O6V D;  3B08 A;  2GLS A;  2LGX A;  3Q8F A;  4KGR A;  2I2Y A;  3MJ5 A;  1E7V A;  1QOA A;  5T8I A;  4FAD A;  1XF5 L;  2JWU A;  2KQ7 A;  1KLV A;  5DPW A;  1RAX A;  2D3A A;  4XC2 A;  1J7C A;  1MFW A;  1WFY A;  1WGG A;  2DYM A;  1MJD A;  1TY2 A;  2KWC A;  3AEC B;  3DWM A;  4ZHO A;  3C8Y A;  1FRD A;  2O6V A;  3ZO5 B;  1Y8R C;  3RZF A;  2WXF A;  4OVU A;  2E6X A;  5IAA C;  2FUH B;  3OJ4 B;  3O13 A;  3EHV A;  2ONQ A;  4IWP A;  4W9K A;  3AV8 A;  1NYQ A;  2HDE A;  5HHD G;  4US8 A;  2MLB A;  3ZKJ C;  2V1Y A;  3ZJV A;  2L7R A;  3VQI A;  2KO3 A;  1LM8 B;  2YVC A;  3MJW A;  4LDT D;  4W9D A;  3RCZ A;  1GPX A;  5EDS A;  4GB9 A;  1MHH E;  2WXH A;  2K5P A;  2PMV A;  4FHJ A;  2QIL A;  1XLN A;  2LGD A;  1UUP A;  2PLP A;  4G50 A;  1YN5 A;  1KTK A;  3FIL A;  2PKO A;  3L13 A;  1QIL A;  3TEY A;  4LJO B;  2FE8 A;  1UEL A;  2PVG C;  4G11 A;  1DGJ A;  4NQK E;  3U4E G;  3EFC A;  4XZ4 A;  2MH7 A;  3RI7 C;  4MM3 B;  2KJH B;  1E6E B;  3AEB B;  5DPR A;  2MX2 A;  3Q8B A;  1WE6 A;  2G3Q B;  2HJ8 A;  1XXG A;  1J8C A;  3ZTD A;  4NY0 A;  3RPF C;  2L05 A;  4IW0 A;  1U4A A;  1WGD A;  4L1B A;  1JWA D;  3T9L A;  4WWM A;  1EUV B;  4MEL A;  2WQY B;  1MVK A;  2N9P C;  1CQV A;  2IND C;  2PIA A;  1UNS A;  2Y5B B;  5J18 A;  2KC2 A;  3HVZ A;  1L4D B;  1XCQ L;  1FNV A;  3V6C B;  4MH8 A;  1C76 A;  5BMI A;  5CX3 A;  4NJC A;  5G5G A;  5C2T B;  5BMH A;  4WJN A;  1WIA A;  4BKS A;  3DBR I;  4ZRK A;  2RSU A;  4TV3 A;  1SE3 A;  2VH2 A;  2VZK B;  3VRB B;  2HD5 B;  3DDC B;  3PHW B;  4ICU A;  4N59 A;  1H8C A;  3VTV A;  4JX1 C;  5DPT A;  4EFO A;  4AS1 A;  2L83 A;  2QMT A;  4DHZ B;  3BK1 A;  3NG0 A;  2G9H D;  2MBQ A;  1D3Z A;  3LXF A;  2VH1 A;  1VLB A;  1KH0 A;  4A6Q A;  2Y5C A;  4JPS A;  3U7D A;  2PJH A;  2ZVO A;  2N1W A;  1HE8 A;  2C9W B;  2FCN A;  2KXJ A;  1UZX B;  2KAC A;  1F77 A;  3PRE A;  2HJ1 A;  4JWS C;  1IUE A;  4MDK E;  3E56 A;  4B0M A;  3QK0 A;  3E9S A;  3PGE A;  2YEP F;  1HEZ E;  1XLO A;  1J0G A;  1NI3 A;  1VD2 A;  3ZXV A;  2D10 A;  4GDK A;  1P98 A;  2AL6 A;  2O2V A;  5G55 A;  1TS4 A;  1Q0W B;  1D5Z C;  4P16 A;  1I42 A;  2L00 B;  4L23 A;  2DNF A;  3BY4 B;  2QIE B;  2WXO A;  1TTN A;  5IP4 D;  1RM6 C;  1R4N I;  3IVF A;  2LWP A;  2BTE A;  4CHK A;  2CU1 A;  1N6Z A;  1B9R A;  4DK5 A;  1P7F A;  2ZPY A;  3B1L X;  1I4G A;  3I63 C;  4ANW A;  2BW2 A;  1N5W A;  2FCQ A;  5AZF A;  2UWQ A;  3Q8E A;  1HZ6 A;  5TR5 A;  3KYC D;  3U7Z A;  2BWE S;  3APC A;  3R8B A;  2WU5 B;  1AWD A;  3AEA B;  1ET9 A;  4II2 B;  3B2F A;  1ZPS A;  3LJ3 A;  2L32 A;  2KWU B;  1J19 A;  3BII D;  2O6V B;  3LDZ E;  2BT6 A;  2QJL A;  3C19 A;  5H8Y E;  2DWQ A;  5TSS A;  3SFD B;  3W1Y A;  3ZRC A;  3JW0 X;  3X0W A;  1OQQ A;  4DXG A;  3I5J C;  4C7Y A;  2MBE A;  1RFK A;  2JF5 A;  2L8J A;  2ZZP B;  3FC4 A;  3OLM D;  5EE1 A;  3UQA A;  2IGG A;  2IO1 B;  3HUI A;  1TJE A;  1R4M I;  1XLP A;  1UF0 A;  3PV1 A;  4M02 A;  1V80 A;  1YD8 U;  5FR6 A;  3VUX A;  3UIP B;  2GBM A;  3A4R A;  3M63 B;  3RT3 B;  4GDL A;  3KYD D;  3PRM B;  2DEN B;  4LDT B;  5C1Z A;  4KSL C;  3ZNG C;  2WP9 B;  4LCD E;  4K7W A;  3K9O B;  4FHK A;  2FCM A;  2BQQ A;  4WH4 A;  2RGF A;  3IHP C;  3IAS 1;  4GSW A;  3L17 A;  1E8Y A;  2IY0 B;  1IP9 A;  1OTR B;  2A5U A;  5CHF A;  2IO0 B;  4HDO A;  5DPS A;  1XCT L;  2WXR A;  3EEC A;  2INP E;  2MCN B;  2G1E A;  1FXT B;  3DBH I;  2LJ5 A;  2JZ3 B;  3DHG C;  3ZXR A;  2J0K A;  3QQ8 B;  1AW7 A;  3BYY B;  3QJZ A;  4KZ0 A;  2YEP B;  2BBC A;  4P7I A;  1I4Q A;  3VR8 B;  2ZJD A;  1LFD A;  4WWO A;  1K8R B;  3ML9 A;  2KDE B;  5BYR A;  3A9J B;  2QCZ A;  2TSS A;  2KHW B;  5C23 A;  1PFD A;  4QAY A;  4P1C C;  4K7U A;  1ZKH A;  1F2R I;  4XWW A;  3DBL B;  3O65 B;  4BBN F;  2OOB B;  3PVL A;  2IZV B;  4X57 B;  4LJP B;  2DAJ A;  3VDZ A;  2G45 B;  3QHT A;  4IM2 A;  4TMA B;  1SE4 A;  2BKF A;  2IO3 B;  1TKE A;  3H7S A;  4IUM B;  2I1J A;  1ZGU B;  2FUG 1;  1YX5 B;  4IC7 B;  4HPM B;  2G4S A;  4URK A;  4M00 A;  4FJV B;  1WGY A;  1TIF A;  3QA8 A;  3QAR A;  2RMM A;  1K53 A;  1NBF C;  2NPT B;  3ZJU A;  3ZIM A;  3PPA A;  3WAL A;  3UQB A;  4HRS A;  4WAA A;  2WHI A;  2D5G A;  2AQ1 B;  1LQB A;  4KGS A;  2PVO D;  1T6B X;  1XO3 A;  4W9E A;  4KKI A;  2LZ6 A;  1L5P A;  2VZK D;  3DCG A;  1I7H A;  1JCK B;  4NAW A;  2LRU A;  2GB1 A;  2KFK A;  3RFZ B;  3GP7 A;  3TEW A;  1I4H A;  3AXC A;  2KX0 A;  4JWU C;  3H6N A;  2KT7 A;  1XLQ A;  2J42 A;  4I6L B;  4GDK B;  5BYS A;  3U8Z A;  1UWX A;  3R7R A; 
#chains in the Genus database with same CATH homology
 2KT7 A;  2KVZ A;  4M02 A;  2KYW A;  4M01 A;  4M00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...