2KT7A

Solution nmr structure of mucin-binding domain of protein lmo0835 from listeria monocytogenes, northeast structural genomics consortium target lmr64a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
MDTNNFTVKVEYVDADGAEIAPSDTLTDYHYVSTPKDIPGYKLREIPHNATGNITDTGIIVRYIYDKIIDVSYVDETGKDLLPVVEIINSEAAVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of mucin-binding domain of protein lmo0835 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion, membrane protein
molecule keywords Putative peptidoglycan bound protein (LPXTG motif)
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kt7A01
4M02A 2KT7A 4M00A 4M01A 2KVZA 2KYWA
chains in the Genus database with same CATH superfamily
2KDIA 3DPDA 1YOVB 2K39A 2PE9A 1DOYA 3C8YA 2DZKA 3GB1A 4HDQA 1UWXA 2EMSA 2SAKA 1T0YA 1GPXA 2G3QB 2PPHA 1BXTA 2KWUB 4MACA 1GB4A 1V80A 4IUMB 3DVGX 3PHXB 3VH3B 1BUIC 4MGKE 4LCDE 3PRZA 1ENFA 2K0PA 3SR6A 1WJUA 3P4PB 2WGSA 4C4VB 2I38A 3H1UA 3ZLZA 1I4PA 3DBRB 1UBQA 4CYEA 2JSVX 2IO0B 2HJ1A 1SIFA 2WXIA 2IBIB 3VH4B 2K22A 2C7HA 2FCSA 4YSZB 2CJOA 4KSKC 3DOWA 2DLBA 2MSED 3PZDA 5BYRA 1TS2A 1P98A 1E6EB 3MHSD 3WALA 1ET9A 3VUWA 5KHOA 2YLMA 2L0FA 4M0WB 4YTPB 5IA7A 5J17A 4ZRQA 2G9HD 4KX6B 1J19A 2AQ3B 2PLPA 1T0SC 1XD3B 4GIVA 2DBYA 2KDFB 2L8JA 1WX8A 3R66C 2MLBA 1NI3A 3L0WB 4HRSA 3MC0B 5IKCM 3Q2AC 1ZGUB 3W5VB 4RH6A 1UUPA 4PS7A 4A9AA 3ML8A 2X8XX 2INDC 1QILA 1WXSA 4WWOA 2IO3B 3M95A 1WGDA 2LRWA 4AOFA 1HE8A 2BW2A 2GBMA 1XF5L 1YJ1A 1FXTB 3BVMA 2BF8B 2KFKB 4RCOA 1WMHA 2JRHA 4OW0A 3KUCB 2KZRA 2WS3B 3Q3MC 2PIAA 2KMMA 3PV1A 3B2FA 2SEBD 4B0EA 3I5JC 1MPEA 4G50A 2EKIA 3PLUA 3HVZA 3ZVVA 4OHJA 4KGRA 3VR9B 1I4HA 2N7EA 3CSFA 4IM0A 2LHEA 4RGMA 3I9V1 3R8BA 1FO4A 1L6VA 2J4XA 3LXFA 2JRIB 4W9LA 1FM0D 1SE3A 2E6XA 3AE5B 3ZYYX 3UI3A 2MBEA 3IAS1 2D10A 4AJYB 1N62A 4TKNA 1E7UA 2A4ZA 1PGAA 1K53A 3TEZA 5FK9C 1ZW7A 4I6NB 3ZDTA 3GP7A 3AMZA 4W9CA 3AM9A 2G1EA 2N1VA 1NYRA 2AWTA 5TSSA 2PTLA 1S1QB 3TEXA 4P1BC 1UH6A 3V62A 2C5LC 3RNBC 4A6QA 4S17A 1V8CA 2R2QA 3Q6BA 2L7RA 3U30A 1EM7A 1SE2A 1HTOA 3JSVA 5EE9A 4B9KA 1ZE3D 3B1LX 1WX9A 3TIXA 2AQ2B 2XK5A 2FIFA 2BB5A 1KRHA 2NBWB 1X1MA 3APCA 2K9XA 3GZNB 3QIJA 3NJTA 3QQ8B 3BK2A 1EO6A 3E9SA 2BS4B 2K6QA 3N1XC 3B9JA 1P7FA 5DPTA 1FD6A 4ARCA 4DDID 1NYQA 1STEA 1BMLC 3AV8A 2MX2A 3AE4B 1QT9A 5CHWA 2N7DA 2LXAA 4BKSD 1VLBA 1M94A 2KDBA 4EFOA 3RN9C 2BYTA 3RD2A 3V60A 3ONSA 3MFGA 3RNAC 1JALA 4XDCA 3AXCA 1XLNA 2CU1A 3A9JA 3OWEB 3KWVA 3V05A 4C80A 4JL9A 2DYBA 4C7YA 2I1JA 1XXGA 4N58A 3L10B 4IG7B 4WURA 1I4QA 1E9MA 4S0RA 2N9KA 3L13A 1EWYC 4HCNB 3T8MA 1WJ4A 1FRDA 2MEKA 4F8CB 2J52A 1FNUA 1E8YA 2M17A 3UQBA 4D2KA 3I57A 3HHMA 3DHHC 4N6EB 1FCLA 2JQRB 1YQ4B 1C3TA 5D6JB 3NS8A 1SF0A 3ALBA 5C23A 3CSTA 5LLIA 3LDZE 4BVUC 4RMAA 3AE1B 4IM3A 4J6IA 4KV2A 2LGYA 3WAMA 4EE2A 1I4XA 4DDGD 1GC7A 1MJDA 2BKFA 1KTKA 1N5XA 3N1ZC 1A5RA 4IW0A 3DBSA 1FFUA 1C76A 2FCQA 5JZEB 3QK0A 3NZSA 3U7ZA 3RUIB 2JZ3B 2WDQB 2WYQA 1K8RB 2V3SA 4XC2A 3NS1A 2IO2B 2FCMA 2O6VA 3PRMB 2W3SA 3DBHI 3FILB 5HKHA 1VRAB 2V4LA 2KANA 3KYDD 1Q5WB 4DHZB 1K51A 2LI5A 4HEA1 4K7SA 5GXGB 4CQNA 3AE3B 2LASA 4GOCA 4FHKA 2L3ZA 1AARA 1IUEA 2IPKD 1TZOA 1E8ZA 4K7WA 4ASWC 4MGZE 1FIQA 4JLCA 4HDOA 2FNJB 4W9EA 1JWBD 1L0VB 2MJEA 2MJDA 4MSMB 1ZDVA 2ICIA 1LXDA 4NQLB 3QA8A 4NJCA 2LFIA 4BZAA 5GMVA 1SE4A 2DZMA 4HPMB 1RRBA 2QMTA 1DGJA 1F52A 4WWNA 3BWUD 2GBKA 1WY8A 2RDGA 2HD5B 3U7DA 2CHZA 4E71A 4L2YA 1HXYD 1ZDXA 2WDVB 2MBHA 3H6NA 4N59A 2WXJA 4GLSC 3SHQA 3R7RA 4FBJB 4K81A 2PMVA 1IBXB 1J8CA 4C00A 2DZIA 1JWAD 1OQRA 1KOTA 4XWTA 1N6ZA 2BBCA 2GBJA 1J0GA 2WXNA 3TL5A 3DVNV 3URYA 3DQVA 3L4PA 1KFYB 4A8XC 2XBBC 3VDZA 1SXTA 1WM3A 1KF6B 1EF5A 2IGGA 1UWMA 3QHTA 3N32A 4HPLB 3ETRA 2WXHA 1E90A 2L32A 3GZNI 4F7ZA 5H92C 5HFYA 3R2TA 4ZOHC 2NCNA 3AE6B 4HXDA 3SFEB 2NS5A 5LXHA 3DWMA 2B76B 4HPPA 2ZEQA 3NY5A 2J0KA 1F77A 3TEYA 3U8ZA 2KFJA 1NBFC 2NPTA 2NR2A 1EF1A 1GNUA 2W54A 2M4NA 3KH0A 2RGFA 3CMMB 1AN8A 4TQ0A 3HRDD 2IYDB 2K25A 2V3PA 1TS5A 3QWZB 3SEBA 2LGIA 3E56A 1SE9A 4AS1A 4DXGA 1ZPSA 1JWMD 3EA6A 1TTNA 1OTRB 4LNFA 4W9JA 1T0QC 1NDDA 1Z5SB 1CQVA 1N5WA 4KKJA 2MWSB 4YT0B 3PPAA 2KJHB 3AE9B 4AP4C 2ZZPB 3DBRI 1F2RI 4ZYNA 1C4PA 4B95A 1CZPA 1L5PA 3DDCB 2LHDA 4RFBA 5EE1A 1VCBA 5EDSA 4M02A 3MHZA 3IAM1 4GSWA 4IDIA 4URKA 1C1YB 1LO5D 4DWFA 3W1SA 1NEKB 1YN4A 3LB8C 1V1OA 2VZKB 3APFA 2XEWA 2FIDA 4FJZA 4G0NB 3Q3OC 5JXVA 1SB3C 2KO3A 2BT6A 3Q69A 3DHGC 3RMKC 4WWPA 2WXGA 4GDKB 2KNBA 4XE0A 2Y5BB 3EUB2 4DQOC 2L05A 3P2BA 3HK0A 2GI9A 4W9FA 4A55A 1YQ3B 1WM2A 2O2VB 4TV3A 1WGGA 4DHZE 2GBRA 3A1QB 1I4RA 4I6LB 2OJWA 3OLMD 4BBNC 3OG5A 3ZNZB 3ZIMA 4XWWA 4USAA 5LNK1 5BYSA 1VD2A 4C56C 1MG8A 2K6DB 5G2NA 3KUZA 4ZDVA 4ICVA 5E6PA 4ITKA 3T9LA 5DCNA 2KLCA 1GOZA 1L0YB 2KT7A 4W9GA 4NNJB 1YJIA 3M63B 1IPGA 2RSUA 1CMXB 4K1RB 1VR9A 2WDTB 3VTWA 5E6JA 2E3TA 1MI0A 4FA6A 2KDEB 3PTFC 3V6EB 3FAHA 5I4DA 4GXBA 3Q8FA 1YIWA 2DAFA 2W3RA 4E74A 3AE7B 4BKGA 1JWSD 1FFVA 3U4EG 1WYWB 1GJZA 3PLVA 3A4RA 1WYGA 1XEEA 1UGJA 2KN4A 1JWUD 2L83A 3K9PB 1I42A 2FBWB 3NUHB 4ZRJA 1WE7A 1HEZE 2LUEA 1RFAA 1K52A 2LZ6A 4MGIE 4FULA 4IWOA 4MM3B 2LEKA 1Z2MA 3T3NA 1V86A 1E8XA 1FXIA 2XK5B 3J9CA 3DCGA 2MCNB 2Z0EB 5AUIA 4KZ0A 1QOAA 1WH3A 1V49A 4GB9A 5DPRA 3X0WA 1WIAA 2QEJC 2CR5A 1TS4A 5D94A 4GMVA 3ZO5B 3W1SC 2WU5B 3NHEB 4ANXA 3VUXA 1TKYA 1QF6A 2V3NA 4EEWA 4IKGA 3Q3FA 1EU4A 3RCZA 1E0ZA 1YQBA 1EWCA 1DYQA 4ACFA 4P16A 2HDEA 2LVOA 2WP9B 4FJVB 3VUYA 3AEAB 5IAAC 2ZW0A 3SD5A 1E5WA 4KVGB 4HKQA 3P4SB 5EE0A 2Z59B 4MELA 4ARIA 4JIOU 1V1PB 3AEBB 3RNFC 1WWTA 2N4FA 5D7GA 2PKOA 1XLOA 2VH1A 1KLGD 4M8MA 3P42A 2N0SB 2DHZA 3K9OB 5JHAA 3P1MA 4GDLA 3TJPA 3APDA 3H9DA 1D3ZA 2RR9A 3EC8A 2J7QB 4EZKA 1WRDB 3TMPB 1CJEA 3L08A 2GB1A 1JROA 1EU3A 1RWSA 1MG4A 1FNWA 1WMHB 3VTUA 1VZ8A 3RNGC 3H7SA 2WNMA 1ET6A 3Q8AA 1HA5A 2WXPA 3Q8EA 1I4GA 2MA9B 2QC8A 1QOGA 2N7JA 1CK1A 2D3BA 2C9WB 2KAJA 2XN9C 2W82A 3NVZA 4I6PA 1N63A 3IT4B 3IT6B 4WH4A 3Q8CA 1IYFA 1P9DU 1WJ6A 3OJ3A 1R7SA 1WXQA 2KWDA 3ZNID 1MHHE 2KQ4X 1YN5A 3FILA 4P6VF 3ZDMC 1D4BA 4BOZB 1Q10A 1IBXA 3EFCA 2BPSA 2K3UA 4TQ1A 2N1WA 2A5UA 4RF1A 5G55A 2D2QA 3AE2B 2DAJA 4WIPA 3RNEC 1YN3A 4KDIC 1N60A 3UIOB 3ZGZA 2ZJDA 4XDDA 3AU4A 4BFRA 2IGHA 2CHXA 3NG0A 3HIZA 4LJOB 4K3CA 4LNIA 2MP2A 5G5HA 3AE8B 1FMAD 2L52A 2AQ1B 2N9XA 1QZEA 5HG2A 2JVCA 3FC4A 3O13A 3H7PA 2UYZB 3V3XA 4Q2JA 4ICUA 1R4NI 2NTTA 1LFDA 3BVZA 3QAQA 1PUTA 1FXAA 2DX5B 2KQSA 3VTVA 2JYEA 1YNTE 2WXFA 4MM3A 3H8HA 2ZW1A 1VZ7A 3OAWA 3NVYA 2IDYA 3Q8BA 2KVRA 1JRPA 2ON8A 2MJ3A 1WR1A 2V4IB 4ZRKA 5MPOA 2RMMA 3RULA 2EKEC 1D5ZC 3RZWC 3KVFB 3JSVB 2JX5A 2DYOA 4WJQA 1JW9D 1SIJA 4JGHB 4A20A 2FAZA 4ANUA 2AL6A 4AQ7A 1C79A 4CHKA 2PE6B 3DBLB 4C4VA 1P3QU 2IGDA 3P63A 2ONQA 1GG3A 4LTUA 2OHFA 1L2NA 3NOBA 2HTHA 4FXCA 1MHXA 2LGXA 1DOXA 2DZJA 4NPNA 1SEBD 1E8WA 4TUUA 1FPYA 3B0AA 4B0MA 1WXVA 3AU5A 3RPFC 3RNCC 1F9JA 3MP9A 4PS3A 3I63C 2KTRA 1RFKA 1NENB 5IN7A 2K8HA 2FE8A 3IG3A 1ZXHA 4DBGA 4W9DA 4YWGG 2WXKA 1TJEA 1F1HA 4JE3B 1B9RA 3PSEB 4PYUA 2C60A 3OJ4B 2WDRB 4PK1A 4N9F4 1NVID 4ZHPA 4IC7B 3ZUNA 2K8BA 2KOXA 4KSLC 2JUOA 1F2RC 2KACA 2BS2B 2OOBB 3L54A 4WWMA 2KD0A 1JMLA 3B08A 2TSSA 1MVKA 1R4MB 4JWUC 1PGXA 1L7YA 1QOFA 1UF0A 2C7MB 1ESFA 2RPVA 3I3TB 3RZFA 4LDTD 2I2YA 1TKGA 1R4MI 2K8CA 4RM8A 4WQOB 2GOWA 3ZNHB 4AUQC 4YTMB 1C78A 5C1ZA 2VZKD 3EFUA 4BKTA 3ZJTA 1WSPA 4REZA 1ZP0B 3LJ3A 1E7PB 1Q0WB 4NAWA 4DXFA 2H88B 1U4AA 2MHJA 1SSNA 2CS4A 2MQJA 3S2AA 3NZ3A 4II2B 1L0XB 2DYMA 4US8A 2CKHB 4LK0M 1T3QA 3GE8C 3P4RB 5D2MB 3ENEA 5E6OA 4A90A 2KWVB 3AN1A 1WF9A 3ABVB 3VAWA 2INNE 3M62B 2IY1B 1E10A 5FR6A 1OEYA 4MH0E 1WI0A 2CU3A 2NTSA 4LNOA 5JHBA 4IOIE 4NAWB 5CX3A 3UGBB 1G6JA 4NJ7A 4NQKE 3ECIA 1FNVA 4L1BA 1M4VA 5AEKB 2KJ6A 3EHVA 1TGZB 2CJNA 5BYQA 5IP4D 5CHVC 4ANWA 1FRRA 2ZCCA 3VRBB 2WLBA 3VR8B 1HZ5A 2LJ5A 4OVUA 2KN5A 2GBNA 3VFKA 4WJOA 2MRPA 4W9HA 2BYEA 2QHOA 4TMAB 5EE3A 3VRAB 4TSSA 2WQYB 1R4NB 1I7HA 1UD7A 5TR5A 3FKYA 2FUG1 4BOSC 3PO0A 4XGAB 1A70A 1Q1OA 1EUVB 2G4DB 2J42A 3IHPC 1WGKA 5D3DA 1K50A 3T3OA 3AH7A 3UIPB 4FADA 1SBBB 2B3AA 1ISNA 2WXMA 4YTNB 1C77A 2O6VB 2LD9A 4NAMA 4BBNF 2BGFA 1VZ6A 5HHDG 4BAXA 2ZVNA 3WA0A 2HE7A 4JX1C 1WXMA 1IGDA 3DVNU 4HROA 2N9LA 2IZVB 4YSXB 3R3MA 1OQYA 1WFYA 3HUIA 2JZPA 4RM9A 1OGWA 4CO7A 1GC6A 2R2OA 3C19A 4LDTB 1QOBA 1T6BX 4MT5A 3QC8B 4M00A 4IWPA 1YD8U 2WXQA 2ZVOA 3ZTDA 1GAQB 1S3SG 2OJRA 3TCAA 5T8IA 1BT0A 3A1QA 4WAAA 2BWES 1KM7A 3ZTCA 1D6EC 2WXOA 4PT5A 2JPHA 2JY6A 4W9KA 2IY0B 2BTEA 4KGSA 2W55A 1KLVA 2KLGA 2MW5A 3QJZA 2WX1A 4RGTA 3AI5A 2V9HA 2PEAA 3PZ7A 3L16A 5FR3A 4R3DA 4IWQA 1F0ZA 3DBLI 1IGCA 2Z0DB 4YSYB 1J7BA 2JWUA 1XCQL 3WAPA 1OQQA 1Y56A 3TEWA 5DPSA 1H8CA 1C4AA 2HJ8A 2INPE 2QDFA 5BMGA 2M0XA 3ZJVA 3JYUA 2JT4B 5BO4B 1ZXIA 3ZRFA 1HTQA 4IM2A 4NJ6A 1TY0A 2WX0A 3R2IA 4US9A 2M19A 2QCZA 2LWPA 1WRIA 1LGRA 2AL3A 1ZKHA 4HCPB 1PQSA 2BWFA 1V9JA 4M0WA 2Y5PA 1TY2A 2VH2A 2H89B 1NI2A 1ZOYB 3IVFA 1ROEA 2ASQA 1RYJA 3W5UB 1UBIA 2RPQA 3U2SC 4OZCA 3ZRCA 3RYTA 3U52E 2K1FA 5IOIA 1UZXB 3A9KB 4B6WA 2FUHB 1L6UA 2BYVE 2JF5A 2ZPYA 4ZYSA 3WIMA 2LVPA 2O6VD 1I35A 1QQRA 2AYOB 4RGOS 3D32A 3H7PB 1P7EA 4L23A 4O1NA 2L0TA 4MEMA 4X57B 1C4CA 4KIKA 4XZ4A 5L83A 1AWDA 5FKAC 1N61A 1TZ1A 1P0RA 1FCCC 4KKIA 3IXSA 1RLFA 4RGNA 5IO9A 3NVWA 4FHJA 4XYCA 1J7CA 1UGMA 1VDVA 1GUAB 3BYYB 2BVCA 5C3JB 2L1AA 1RM6C 4RF0A 4ZRIA 4WAFA 3A9KA 2KX0A 4GDKA 2R61A 4FJYA 2C7NB 2G4SA 1RAXA 3M3JA 4KDLB 2EELA 3VVWB 2MBQA 2ZCBA 1IP9A 1WGRA 3MTNB 1TT5B 2KFKA 2M8SA 2LJIA 2KWCA 1YMHE 3IBEA 4UDUC 4AJWA 1V97A 4GDLB 1OFFA 2D11A 3AECB 2KMCA 5AZGA 2J0JA 2NVUI 4WJNA 1TYGB 1KLUD 4XX5A 3BY4B 4EZJA 4EZLA 3MC9A 4HK2A 2XNAC 4NY0A 2JYTA 1T0RC 1FEHA 4HVBA 3BINA 2HTME 5CHFA 3W1YA 2JXTA 4ANVA 1WJNA 2KVZA 3Q3NC 1WZ3A 5BMHA 3AEFB 3UF8A 4KGTA 1B1ZA 2V1YA 2Q5WD 2K5PA 2YEPF 4JPSA 2EMTA 1C9FA 3VXWA 2KC2A 3N20C 3CF6E 1PGBA 2REXA 2V0GA 1QKZA 4HJKA 1JRUA 2O2VA 3A4SC 2LVQA 4DXAB 3DVGY 4LLGM 2DENB 3PHWB 2AX5A 3WANA 4II3B 2D07B 2N9EB 3NVVA 3O65B 2ACZB 1XO3A 3KYCD 4HJGE 1T5XD 2UWQA 3ZQ4A 3ZJUA 1D5MC 2QSDA 4J3OD 4MJSB 4MSQB 3ZNGC 2RD0A 5JH5C 3WCQA 2J53A 3DWGC 3B2GA 1YX5B 1XLPA 3KLSX 1V5TA 3PRPB 4P7IA 4K3BA 3JW0X 2WXRA 2D5GA 4A3OA 5E6NA 3MJWA 3IFWB 3TBLD 3NZUA 1PYWD 4HLEA 1WGHA 2KJRA 3PT2B 2L00B 3KWLA 3DBHB 1V6EA 1AYFA 1XCTL 4GGQA 3TUOA 4DHJB 1LQBA 3HM3A 1KJTA 1GB1A 3MC8A 1YJJA 5AUKA 4MH8A 3X23A 2MBOA 3QARA 2BS3B 2DNFA 3EGRA 3UINB 2JWZA 2FCNA 3L17A 2GRIA 1OEYJ 3RFZB 4KZCA 1V5OA 3C0RB 4MJSA 2UU7A 4EUTA 2Z8LA 1MFWA 3CIRB 2JU6X 2PJHA 3KUDB 1V81A 2KTFA 2BB6A 2GLSA 4OVZA 4RNAA 3EECA 2D3GA 3ML9A 4YXDB 2W9NA 2ZNVB 3AULA 4KIKB 2M56B 3PZ8A 3ZXVA 2MP2B 4G3XB 4BKSA 4HWIB 2WXLA 3N3KB 4MDKE 1WR6E 3SU8X 3Q14C 3V6CB 3KQ4A 3PVLA 3SDLC 2Y3AA 4H2AA 1ZUD2 1SJHD 2D3CA 4PS8A 2QJLA 1J7AA 3WAOA 5BMIA 3N9YC 2KTRB 1WE6A 4LJPB 4GU2A 1WZ0A 2LRUA 2NMQA 1V2YA 2KX3A 4W9IA 2ZPNA 2WWZA 1SJED 1UELA 3AEEB 1XT9B 2Y5CA 3DHIC 2J0MA 3Q3JA 2GMIC 2QIEB 4FLHA 3ZW3A 3AEGB 4ZRPA 2KHWB 3GE3C 1JCKB 1PDXA 2N9PC 3HVDA 4OVVA 4LNNA 2I1KA 3PREA 2YVCA 3CWIA 3W9CB 1H4RA 2KKCA 5AZHA 3AEDB 3QCAA 1V1PA 1JQ4A 2JXXA 1L4DB 3BK1A 2DWQA 2RDBC 5AZFA 1WGYA 2AEHA 4EKUA 2KK8A 2NPTB 2KQ7A 2LMCA 4MGYE 3N30A 5J18A 3N1YC 5H8YE 2M0AA 4LNKA 3RT3B 4DK5A 3P4QB 4QAYA 4M01A 4YL8A 4E3CA 2LGSA 4A3PA 3VHTC 4EOYA 3GS2A 2NBVB 3A9JB 1UNSA 3BZDB 3ZXRA 3VQIA 1TKEA 5CTRC 2LGDA 1WX7A 1P1AA 1SGHA 2YEPB 2KC1A 2IO1B 4OZBA 1AW7A 4GN1A 3PS6A 1L4ZB 2WHIA 2JZZA 1Y8RC 2RDHA 3JVZX 2LXCA 4PYZA 5L95C 3GOEA 1WXAA 1TS3A 4JWSC 2NBUA 5KHQA 2BYFA 3HM6X 5LXIB 2PVGC 3ZKJC 4WJPA 5D3IB 2PVOD 1TIFA 2INCC 1YX6B 2MH7A 2BQQA 3SFDB 2MBBB 1HZ6A 3BIID 1KH0A 1QLBB 2G45B 2L76A 4P1CC 2BKRB 1ACCA 2KYWA 4OZAA 1D5XC 4FN2A 3KW5B 2CHWA 3PGEA 1TBEA 4HKZE 2KMAA 3BVGA 3MJ5A 3AB5A 4ZHOA 1XLQA 1XQQA 3QX1A 4M8NA 3RI7C 2D3AA 1LM8B 4G11A 5HI1A 3NRZA 2KDMA 2IJ0A 2M1MA 2QILA 4WQMA 4DHJD 4K7UA 3TSSA 4NZLB 4C7ZA 3A33B 2ZNVC 2KXJA 1HQRD 2VRRB 3V61A 3UQAA 2WU2B 3W2DA 5G5GA 3BYTB 5J2RA 3LYYA 4F1SA 1VJKA 2PW9A 5C2TB 1PFDA 4JQWC 2X38A 2LUMA 5DPWA 1DOIA 2OEDA 3R7QA 4AWJA 1E7VA
chains in the Genus database with same CATH topology
4M02A 2KT7A 4M00A 4M01A 2KVZA 2KYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M02 A;  2KT7 A;  4M00 A;  4M01 A;  2KVZ A;  2KYW A; 
#chains in the Genus database with same CATH topology
 2KDI A;  3DPD A;  1YOV B;  2K39 A;  2PE9 A;  1DOY A;  3C8Y A;  2DZK A;  3GB1 A;  4HDQ A;  1UWX A;  2EMS A;  2SAK A;  1T0Y A;  1GPX A;  2G3Q B;  2PPH A;  1BXT A;  2KWU B;  4MAC A;  1GB4 A;  1V80 A;  4IUM B;  3DVG X;  3PHX B;  3VH3 B;  1BUI C;  4MGK E;  4LCD E;  3PRZ A;  1ENF A;  2K0P A;  3SR6 A;  1WJU A;  3P4P B;  2WGS A;  4C4V B;  2I38 A;  3H1U A;  3ZLZ A;  1I4P A;  3DBR B;  1UBQ A;  4CYE A;  2JSV X;  2IO0 B;  2HJ1 A;  1SIF A;  2WXI A;  2IBI B;  3VH4 B;  2K22 A;  2C7H A;  2FCS A;  4YSZ B;  2CJO A;  4KSK C;  3DOW A;  2DLB A;  2MSE D;  3PZD A;  5BYR A;  1TS2 A;  1P98 A;  1E6E B;  3MHS D;  3WAL A;  1ET9 A;  3VUW A;  5KHO A;  2YLM A;  2L0F A;  4M0W B;  4YTP B;  5IA7 A;  5J17 A;  4ZRQ A;  2G9H D;  4KX6 B;  1J19 A;  2AQ3 B;  2PLP A;  1T0S C;  1XD3 B;  4GIV A;  2DBY A;  2KDF B;  2L8J A;  1WX8 A;  3R66 C;  2MLB A;  1NI3 A;  3L0W B;  4HRS A;  3MC0 B;  5IKC M;  3Q2A C;  1ZGU B;  3W5V B;  4RH6 A;  1UUP A;  4PS7 A;  4A9A A;  3ML8 A;  2X8X X;  2IND C;  1QIL A;  1WXS A;  4WWO A;  2IO3 B;  3M95 A;  1WGD A;  2LRW A;  4AOF A;  1HE8 A;  2BW2 A;  2GBM A;  1XF5 L;  1YJ1 A;  1FXT B;  3BVM A;  2BF8 B;  2KFK B;  4RCO A;  1WMH A;  2JRH A;  4OW0 A;  3KUC B;  2KZR A;  2WS3 B;  3Q3M C;  2PIA A;  2KMM A;  3PV1 A;  3B2F A;  2SEB D;  4B0E A;  3I5J C;  1MPE A;  4G50 A;  2EKI A;  3PLU A;  3HVZ A;  3ZVV A;  4OHJ A;  4KGR A;  3VR9 B;  1I4H A;  2N7E A;  3CSF A;  4IM0 A;  2LHE A;  4RGM A;  3I9V 1;  3R8B A;  1FO4 A;  1L6V A;  2J4X A;  3LXF A;  2JRI B;  4W9L A;  1FM0 D;  1SE3 A;  2E6X A;  3AE5 B;  3ZYY X;  3UI3 A;  2MBE A;  3IAS 1;  2D10 A;  4AJY B;  1N62 A;  4TKN A;  1E7U A;  2A4Z A;  1PGA A;  1K53 A;  3TEZ A;  5FK9 C;  1ZW7 A;  4I6N B;  3ZDT A;  3GP7 A;  3AMZ A;  4W9C A;  3AM9 A;  2G1E A;  2N1V A;  1NYR A;  2AWT A;  5TSS A;  2PTL A;  1S1Q B;  3TEX A;  4P1B C;  1UH6 A;  3V62 A;  2C5L C;  3RNB C;  4A6Q A;  4S17 A;  1V8C A;  2R2Q A;  3Q6B A;  2L7R A;  3U30 A;  1EM7 A;  1SE2 A;  1HTO A;  3JSV A;  5EE9 A;  4B9K A;  1ZE3 D;  3B1L X;  1WX9 A;  3TIX A;  2AQ2 B;  2XK5 A;  2FIF A;  2BB5 A;  1KRH A;  2NBW B;  1X1M A;  3APC A;  2K9X A;  3GZN B;  3QIJ A;  3NJT A;  3QQ8 B;  3BK2 A;  1EO6 A;  3E9S A;  2BS4 B;  2K6Q A;  3N1X C;  3B9J A;  1P7F A;  5DPT A;  1FD6 A;  4ARC A;  4DDI D;  1NYQ A;  1STE A;  1BML C;  3AV8 A;  2MX2 A;  3AE4 B;  1QT9 A;  5CHW A;  2N7D A;  2LXA A;  4BKS D;  1VLB A;  1M94 A;  2KDB A;  4EFO A;  3RN9 C;  2BYT A;  3RD2 A;  3V60 A;  3ONS A;  3MFG A;  3RNA C;  1JAL A;  4XDC A;  3AXC A;  1XLN A;  2CU1 A;  3A9J A;  3OWE B;  3KWV A;  3V05 A;  4C80 A;  4JL9 A;  2DYB A;  4C7Y A;  2I1J A;  1XXG A;  4N58 A;  3L10 B;  4IG7 B;  4WUR A;  1I4Q A;  1E9M A;  4S0R A;  2N9K A;  3L13 A;  1EWY C;  4HCN B;  3T8M A;  1WJ4 A;  1FRD A;  2MEK A;  4F8C B;  2J52 A;  1FNU A;  1E8Y A;  2M17 A;  3UQB A;  4D2K A;  3I57 A;  3HHM A;  3DHH C;  4N6E B;  1FCL A;  2JQR B;  1YQ4 B;  1C3T A;  5D6J B;  3NS8 A;  1SF0 A;  3ALB A;  5C23 A;  3CST A;  5LLI A;  3LDZ E;  4BVU C;  4RMA A;  3AE1 B;  4IM3 A;  4J6I A;  4KV2 A;  2LGY A;  3WAM A;  4EE2 A;  1I4X A;  4DDG D;  1GC7 A;  1MJD A;  2BKF A;  1KTK A;  1N5X A;  3N1Z C;  1A5R A;  4IW0 A;  3DBS A;  1FFU A;  1C76 A;  2FCQ A;  5JZE B;  3QK0 A;  3NZS A;  3U7Z A;  3RUI B;  2JZ3 B;  2WDQ B;  2WYQ A;  1K8R B;  2V3S A;  4XC2 A;  3NS1 A;  2IO2 B;  2FCM A;  2O6V A;  3PRM B;  2W3S A;  3DBH I;  3FIL B;  5HKH A;  1VRA B;  2V4L A;  2KAN A;  3KYD D;  1Q5W B;  4DHZ B;  1K51 A;  2LI5 A;  4HEA 1;  4K7S A;  5GXG B;  4CQN A;  3AE3 B;  2LAS A;  4GOC A;  4FHK A;  2L3Z A;  1AAR A;  1IUE A;  2IPK D;  1TZO A;  1E8Z A;  4K7W A;  4ASW C;  4MGZ E;  1FIQ A;  4JLC A;  4HDO A;  2FNJ B;  4W9E A;  1JWB D;  1L0V B;  2MJE A;  2MJD A;  4MSM B;  1ZDV A;  2ICI A;  1LXD A;  4NQL B;  3QA8 A;  4NJC A;  2LFI A;  4BZA A;  5GMV A;  1SE4 A;  2DZM A;  4HPM B;  1RRB A;  2QMT A;  1DGJ A;  1F52 A;  4WWN A;  3BWU D;  2GBK A;  1WY8 A;  2RDG A;  2HD5 B;  3U7D A;  2CHZ A;  4E71 A;  4L2Y A;  1HXY D;  1ZDX A;  2WDV B;  2MBH A;  3H6N A;  4N59 A;  2WXJ A;  4GLS C;  3SHQ A;  3R7R A;  4FBJ B;  4K81 A;  2PMV A;  1IBX B;  1J8C A;  4C00 A;  2DZI A;  1JWA D;  1OQR A;  1KOT A;  4XWT A;  1N6Z A;  2BBC A;  2GBJ A;  1J0G A;  2WXN A;  3TL5 A;  3DVN V;  3URY A;  3DQV A;  3L4P A;  1KFY B;  4A8X C;  2XBB C;  3VDZ A;  1SXT A;  1WM3 A;  1KF6 B;  1EF5 A;  2IGG A;  1UWM A;  3QHT A;  3N32 A;  4HPL B;  3ETR A;  2WXH A;  1E90 A;  2L32 A;  3GZN I;  4F7Z A;  5H92 C;  5HFY A;  3R2T A;  4ZOH C;  2NCN A;  3AE6 B;  4HXD A;  3SFE B;  2NS5 A;  5LXH A;  3DWM A;  2B76 B;  4HPP A;  2ZEQ A;  3NY5 A;  2J0K A;  1F77 A;  3TEY A;  3U8Z A;  2KFJ A;  1NBF C;  2NPT A;  2NR2 A;  1EF1 A;  1GNU A;  2W54 A;  2M4N A;  3KH0 A;  2RGF A;  3CMM B;  1AN8 A;  4TQ0 A;  3HRD D;  2IYD B;  2K25 A;  2V3P A;  1TS5 A;  3QWZ B;  3SEB A;  2LGI A;  3E56 A;  1SE9 A;  4AS1 A;  4DXG A;  1ZPS A;  1JWM D;  3EA6 A;  1TTN A;  1OTR B;  4LNF A;  4W9J A;  1T0Q C;  1NDD A;  1Z5S B;  1CQV A;  1N5W A;  4KKJ A;  2MWS B;  4YT0 B;  3PPA A;  2KJH B;  3AE9 B;  4AP4 C;  2ZZP B;  3DBR I;  1F2R I;  4ZYN A;  1C4P A;  4B95 A;  1CZP A;  1L5P A;  3DDC B;  2LHD A;  4RFB A;  5EE1 A;  1VCB A;  5EDS A;  4M02 A;  3MHZ A;  3IAM 1;  4GSW A;  4IDI A;  4URK A;  1C1Y B;  1LO5 D;  4DWF A;  3W1S A;  1NEK B;  1YN4 A;  3LB8 C;  1V1O A;  2VZK B;  3APF A;  2XEW A;  2FID A;  4FJZ A;  4G0N B;  3Q3O C;  5JXV A;  1SB3 C;  2KO3 A;  2BT6 A;  3Q69 A;  3DHG C;  3RMK C;  4WWP A;  2WXG A;  4GDK B;  2KNB A;  4XE0 A;  2Y5B B;  3EUB 2;  4DQO C;  2L05 A;  3P2B A;  3HK0 A;  2GI9 A;  4W9F A;  4A55 A;  1YQ3 B;  1WM2 A;  2O2V B;  4TV3 A;  1WGG A;  4DHZ E;  2GBR A;  3A1Q B;  1I4R A;  4I6L B;  2OJW A;  3OLM D;  4BBN C;  3OG5 A;  3ZNZ B;  3ZIM A;  4XWW A;  4USA A;  5LNK 1;  5BYS A;  1VD2 A;  4C56 C;  1MG8 A;  2K6D B;  5G2N A;  3KUZ A;  4ZDV A;  4ICV A;  5E6P A;  4ITK A;  3T9L A;  5DCN A;  2KLC A;  1GOZ A;  1L0Y B;  2KT7 A;  4W9G A;  4NNJ B;  1YJI A;  3M63 B;  1IPG A;  2RSU A;  1CMX B;  4K1R B;  1VR9 A;  2WDT B;  3VTW A;  5E6J A;  2E3T A;  1MI0 A;  4FA6 A;  2KDE B;  3PTF C;  3V6E B;  3FAH A;  5I4D A;  4GXB A;  3Q8F A;  1YIW A;  2DAF A;  2W3R A;  4E74 A;  3AE7 B;  4BKG A;  1JWS D;  1FFV A;  3U4E G;  1WYW B;  1GJZ A;  3PLV A;  3A4R A;  1WYG A;  1XEE A;  1UGJ A;  2KN4 A;  1JWU D;  2L83 A;  3K9P B;  1I42 A;  2FBW B;  3NUH B;  4ZRJ A;  1WE7 A;  1HEZ E;  2LUE A;  1RFA A;  1K52 A;  2LZ6 A;  4MGI E;  4FUL A;  4IWO A;  4MM3 B;  2LEK A;  1Z2M A;  3T3N A;  1V86 A;  1E8X A;  1FXI A;  2XK5 B;  3J9C A;  3DCG A;  2MCN B;  2Z0E B;  5AUI A;  4KZ0 A;  1QOA A;  1WH3 A;  1V49 A;  4GB9 A;  5DPR A;  3X0W A;  1WIA A;  2QEJ C;  2CR5 A;  1TS4 A;  5D94 A;  4GMV A;  3ZO5 B;  3W1S C;  2WU5 B;  3NHE B;  4ANX A;  3VUX A;  1TKY A;  1QF6 A;  2V3N A;  4EEW A;  4IKG A;  3Q3F A;  1EU4 A;  3RCZ A;  1E0Z A;  1YQB A;  1EWC A;  1DYQ A;  4ACF A;  4P16 A;  2HDE A;  2LVO A;  2WP9 B;  4FJV B;  3VUY A;  3AEA B;  5IAA C;  2ZW0 A;  3SD5 A;  1E5W A;  4KVG B;  4HKQ A;  3P4S B;  5EE0 A;  2Z59 B;  4MEL A;  4ARI A;  4JIO U;  1V1P B;  3AEB B;  3RNF C;  1WWT A;  2N4F A;  5D7G A;  2PKO A;  1XLO A;  2VH1 A;  1KLG D;  4M8M A;  3P42 A;  2N0S B;  2DHZ A;  3K9O B;  5JHA A;  3P1M A;  4GDL A;  3TJP A;  3APD A;  3H9D A;  1D3Z A;  2RR9 A;  3EC8 A;  2J7Q B;  4EZK A;  1WRD B;  3TMP B;  1CJE A;  3L08 A;  2GB1 A;  1JRO A;  1EU3 A;  1RWS A;  1MG4 A;  1FNW A;  1WMH B;  3VTU A;  1VZ8 A;  3RNG C;  3H7S A;  2WNM A;  1ET6 A;  3Q8A A;  1HA5 A;  2WXP A;  3Q8E A;  1I4G A;  2MA9 B;  2QC8 A;  1QOG A;  2N7J A;  1CK1 A;  2D3B A;  2C9W B;  2KAJ A;  2XN9 C;  2W82 A;  3NVZ A;  4I6P A;  1N63 A;  3IT4 B;  3IT6 B;  4WH4 A;  3Q8C A;  1IYF A;  1P9D U;  1WJ6 A;  3OJ3 A;  1R7S A;  1WXQ A;  2KWD A;  3ZNI D;  1MHH E;  2KQ4 X;  1YN5 A;  3FIL A;  4P6V F;  3ZDM C;  1D4B A;  4BOZ B;  1Q10 A;  1IBX A;  3EFC A;  2BPS A;  2K3U A;  4TQ1 A;  2N1W A;  2A5U A;  4RF1 A;  5G55 A;  2D2Q A;  3AE2 B;  2DAJ A;  4WIP A;  3RNE C;  1YN3 A;  4KDI C;  1N60 A;  3UIO B;  3ZGZ A;  2ZJD A;  4XDD A;  3AU4 A;  4BFR A;  2IGH A;  2CHX A;  3NG0 A;  3HIZ A;  4LJO B;  4K3C A;  4LNI A;  2MP2 A;  5G5H A;  3AE8 B;  1FMA D;  2L52 A;  2AQ1 B;  2N9X A;  1QZE A;  5HG2 A;  2JVC A;  3FC4 A;  3O13 A;  3H7P A;  2UYZ B;  3V3X A;  4Q2J A;  4ICU A;  1R4N I;  2NTT A;  1LFD A;  3BVZ A;  3QAQ A;  1PUT A;  1FXA A;  2DX5 B;  2KQS A;  3VTV A;  2JYE A;  1YNT E;  2WXF A;  4MM3 A;  3H8H A;  2ZW1 A;  1VZ7 A;  3OAW A;  3NVY A;  2IDY A;  3Q8B A;  2KVR A;  1JRP A;  2ON8 A;  2MJ3 A;  1WR1 A;  2V4I B;  4ZRK A;  5MPO A;  2RMM A;  3RUL A;  2EKE C;  1D5Z C;  3RZW C;  3KVF B;  3JSV B;  2JX5 A;  2DYO A;  4WJQ A;  1JW9 D;  1SIJ A;  4JGH B;  4A20 A;  2FAZ A;  4ANU A;  2AL6 A;  4AQ7 A;  1C79 A;  4CHK A;  2PE6 B;  3DBL B;  4C4V A;  1P3Q U;  2IGD A;  3P63 A;  2ONQ A;  1GG3 A;  4LTU A;  2OHF A;  1L2N A;  3NOB A;  2HTH A;  4FXC A;  1MHX A;  2LGX A;  1DOX A;  2DZJ A;  4NPN A;  1SEB D;  1E8W A;  4TUU A;  1FPY A;  3B0A A;  4B0M A;  1WXV A;  3AU5 A;  3RPF C;  3RNC C;  1F9J A;  3MP9 A;  4PS3 A;  3I63 C;  2KTR A;  1RFK A;  1NEN B;  5IN7 A;  2K8H A;  2FE8 A;  3IG3 A;  1ZXH A;  4DBG A;  4W9D A;  4YWG G;  2WXK A;  1TJE A;  1F1H A;  4JE3 B;  1B9R A;  3PSE B;  4PYU A;  2C60 A;  3OJ4 B;  2WDR B;  4PK1 A;  4N9F 4;  1NVI D;  4ZHP A;  4IC7 B;  3ZUN A;  2K8B A;  2KOX A;  4KSL C;  2JUO A;  1F2R C;  2KAC A;  2BS2 B;  2OOB B;  3L54 A;  4WWM A;  2KD0 A;  1JML A;  3B08 A;  2TSS A;  1MVK A;  1R4M B;  4JWU C;  1PGX A;  1L7Y A;  1QOF A;  1UF0 A;  2C7M B;  1ESF A;  2RPV A;  3I3T B;  3RZF A;  4LDT D;  2I2Y A;  1TKG A;  1R4M I;  2K8C A;  4RM8 A;  4WQO B;  2GOW A;  3ZNH B;  4AUQ C;  4YTM B;  1C78 A;  5C1Z A;  2VZK D;  3EFU A;  4BKT A;  3ZJT A;  1WSP A;  4REZ A;  1ZP0 B;  3LJ3 A;  1E7P B;  1Q0W B;  4NAW A;  4DXF A;  2H88 B;  1U4A A;  2MHJ A;  1SSN A;  2CS4 A;  2MQJ A;  3S2A A;  3NZ3 A;  4II2 B;  1L0X B;  2DYM A;  4US8 A;  2CKH B;  4LK0 M;  1T3Q A;  3GE8 C;  3P4R B;  5D2M B;  3ENE A;  5E6O A;  4A90 A;  2KWV B;  3AN1 A;  1WF9 A;  3ABV B;  3VAW A;  2INN E;  3M62 B;  2IY1 B;  1E10 A;  5FR6 A;  1OEY A;  4MH0 E;  1WI0 A;  2CU3 A;  2NTS A;  4LNO A;  5JHB A;  4IOI E;  4NAW B;  5CX3 A;  3UGB B;  1G6J A;  4NJ7 A;  4NQK E;  3ECI A;  1FNV A;  4L1B A;  1M4V A;  5AEK B;  2KJ6 A;  3EHV A;  1TGZ B;  2CJN A;  5BYQ A;  5IP4 D;  5CHV C;  4ANW A;  1FRR A;  2ZCC A;  3VRB B;  2WLB A;  3VR8 B;  1HZ5 A;  2LJ5 A;  4OVU A;  2KN5 A;  2GBN A;  3VFK A;  4WJO A;  2MRP A;  4W9H A;  2BYE A;  2QHO A;  4TMA B;  5EE3 A;  3VRA B;  4TSS A;  2WQY B;  1R4N B;  1I7H A;  1UD7 A;  5TR5 A;  3FKY A;  2FUG 1;  4BOS C;  3PO0 A;  4XGA B;  1A70 A;  1Q1O A;  1EUV B;  2G4D B;  2J42 A;  3IHP C;  1WGK A;  5D3D A;  1K50 A;  3T3O A;  3AH7 A;  3UIP B;  4FAD A;  1SBB B;  2B3A A;  1ISN A;  2WXM A;  4YTN B;  1C77 A;  2O6V B;  2LD9 A;  4NAM A;  4BBN F;  2BGF A;  1VZ6 A;  5HHD G;  4BAX A;  2ZVN A;  3WA0 A;  2HE7 A;  4JX1 C;  1WXM A;  1IGD A;  3DVN U;  4HRO A;  2N9L A;  2IZV B;  4YSX B;  3R3M A;  1OQY A;  1WFY A;  3HUI A;  2JZP A;  4RM9 A;  1OGW A;  4CO7 A;  1GC6 A;  2R2O A;  3C19 A;  4LDT B;  1QOB A;  1T6B X;  4MT5 A;  3QC8 B;  4M00 A;  4IWP A;  1YD8 U;  2WXQ A;  2ZVO A;  3ZTD A;  1GAQ B;  1S3S G;  2OJR A;  3TCA A;  5T8I A;  1BT0 A;  3A1Q A;  4WAA A;  2BWE S;  1KM7 A;  3ZTC A;  1D6E C;  2WXO A;  4PT5 A;  2JPH A;  2JY6 A;  4W9K A;  2IY0 B;  2BTE A;  4KGS A;  2W55 A;  1KLV A;  2KLG A;  2MW5 A;  3QJZ A;  2WX1 A;  4RGT A;  3AI5 A;  2V9H A;  2PEA A;  3PZ7 A;  3L16 A;  5FR3 A;  4R3D A;  4IWQ A;  1F0Z A;  3DBL I;  1IGC A;  2Z0D B;  4YSY B;  1J7B A;  2JWU A;  1XCQ L;  3WAP A;  1OQQ A;  1Y56 A;  3TEW A;  5DPS A;  1H8C A;  1C4A A;  2HJ8 A;  2INP E;  2QDF A;  5BMG A;  2M0X A;  3ZJV A;  3JYU A;  2JT4 B;  5BO4 B;  1ZXI A;  3ZRF A;  1HTQ A;  4IM2 A;  4NJ6 A;  1TY0 A;  2WX0 A;  3R2I A;  4US9 A;  2M19 A;  2QCZ A;  2LWP A;  1WRI A;  1LGR A;  2AL3 A;  1ZKH A;  4HCP B;  1PQS A;  2BWF A;  1V9J A;  4M0W A;  2Y5P A;  1TY2 A;  2VH2 A;  2H89 B;  1NI2 A;  1ZOY B;  3IVF A;  1ROE A;  2ASQ A;  1RYJ A;  3W5U B;  1UBI A;  2RPQ A;  3U2S C;  4OZC A;  3ZRC A;  3RYT A;  3U52 E;  2K1F A;  5IOI A;  1UZX B;  3A9K B;  4B6W A;  2FUH B;  1L6U A;  2BYV E;  2JF5 A;  2ZPY A;  4ZYS A;  3WIM A;  2LVP A;  2O6V D;  1I35 A;  1QQR A;  2AYO B;  4RGO S;  3D32 A;  3H7P B;  1P7E A;  4L23 A;  4O1N A;  2L0T A;  4MEM A;  4X57 B;  1C4C A;  4KIK A;  4XZ4 A;  5L83 A;  1AWD A;  5FKA C;  1N61 A;  1TZ1 A;  1P0R A;  1FCC C;  4KKI A;  3IXS A;  1RLF A;  4RGN A;  5IO9 A;  3NVW A;  4FHJ A;  4XYC A;  1J7C A;  1UGM A;  1VDV A;  1GUA B;  3BYY B;  2BVC A;  5C3J B;  2L1A A;  1RM6 C;  4RF0 A;  4ZRI A;  4WAF A;  3A9K A;  2KX0 A;  4GDK A;  2R61 A;  4FJY A;  2C7N B;  2G4S A;  1RAX A;  3M3J A;  4KDL B;  2EEL A;  3VVW B;  2MBQ A;  2ZCB A;  1IP9 A;  1WGR A;  3MTN B;  1TT5 B;  2KFK A;  2M8S A;  2LJI A;  2KWC A;  1YMH E;  3IBE A;  4UDU C;  4AJW A;  1V97 A;  4GDL B;  1OFF A;  2D11 A;  3AEC B;  2KMC A;  5AZG A;  2J0J A;  2NVU I;  4WJN A;  1TYG B;  1KLU D;  4XX5 A;  3BY4 B;  4EZJ A;  4EZL A;  3MC9 A;  4HK2 A;  2XNA C;  4NY0 A;  2JYT A;  1T0R C;  1FEH A;  4HVB A;  3BIN A;  2HTM E;  5CHF A;  3W1Y A;  2JXT A;  4ANV A;  1WJN A;  2KVZ A;  3Q3N C;  1WZ3 A;  5BMH A;  3AEF B;  3UF8 A;  4KGT A;  1B1Z A;  2V1Y A;  2Q5W D;  2K5P A;  2YEP F;  4JPS A;  2EMT A;  1C9F A;  3VXW A;  2KC2 A;  3N20 C;  3CF6 E;  1PGB A;  2REX A;  2V0G A;  1QKZ A;  4HJK A;  1JRU A;  2O2V A;  3A4S C;  2LVQ A;  4DXA B;  3DVG Y;  4LLG M;  2DEN B;  3PHW B;  2AX5 A;  3WAN A;  4II3 B;  2D07 B;  2N9E B;  3NVV A;  3O65 B;  2ACZ B;  1XO3 A;  3KYC D;  4HJG E;  1T5X D;  2UWQ A;  3ZQ4 A;  3ZJU A;  1D5M C;  2QSD A;  4J3O D;  4MJS B;  4MSQ B;  3ZNG C;  2RD0 A;  5JH5 C;  3WCQ A;  2J53 A;  3DWG C;  3B2G A;  1YX5 B;  1XLP A;  3KLS X;  1V5T A;  3PRP B;  4P7I A;  4K3B A;  3JW0 X;  2WXR A;  2D5G A;  4A3O A;  5E6N A;  3MJW A;  3IFW B;  3TBL D;  3NZU A;  1PYW D;  4HLE A;  1WGH A;  2KJR A;  3PT2 B;  2L00 B;  3KWL A;  3DBH B;  1V6E A;  1AYF A;  1XCT L;  4GGQ A;  3TUO A;  4DHJ B;  1LQB A;  3HM3 A;  1KJT A;  1GB1 A;  3MC8 A;  1YJJ A;  5AUK A;  4MH8 A;  3X23 A;  2MBO A;  3QAR A;  2BS3 B;  2DNF A;  3EGR A;  3UIN B;  2JWZ A;  2FCN A;  3L17 A;  2GRI A;  1OEY J;  3RFZ B;  4KZC A;  1V5O A;  3C0R B;  4MJS A;  2UU7 A;  4EUT A;  2Z8L A;  1MFW A;  3CIR B;  2JU6 X;  2PJH A;  3KUD B;  1V81 A;  2KTF A;  2BB6 A;  2GLS A;  4OVZ A;  4RNA A;  3EEC A;  2D3G A;  3ML9 A;  4YXD B;  2W9N A;  2ZNV B;  3AUL A;  4KIK B;  2M56 B;  3PZ8 A;  3ZXV A;  2MP2 B;  4G3X B;  4BKS A;  4HWI B;  2WXL A;  3N3K B;  4MDK E;  1WR6 E;  3SU8 X;  3Q14 C;  3V6C B;  3KQ4 A;  3PVL A;  3SDL C;  2Y3A A;  4H2A A;  1ZUD 2;  1SJH D;  2D3C A;  4PS8 A;  2QJL A;  1J7A A;  3WAO A;  5BMI A;  3N9Y C;  2KTR B;  1WE6 A;  4LJP B;  4GU2 A;  1WZ0 A;  2LRU A;  2NMQ A;  1V2Y A;  2KX3 A;  4W9I A;  2ZPN A;  2WWZ A;  1SJE D;  1UEL A;  3AEE B;  1XT9 B;  2Y5C A;  3DHI C;  2J0M A;  3Q3J A;  2GMI C;  2QIE B;  4FLH A;  3ZW3 A;  3AEG B;  4ZRP A;  2KHW B;  3GE3 C;  1JCK B;  1PDX A;  2N9P C;  3HVD A;  4OVV A;  4LNN A;  2I1K A;  3PRE A;  2YVC A;  3CWI A;  3W9C B;  1H4R A;  2KKC A;  5AZH A;  3AED B;  3QCA A;  1V1P A;  1JQ4 A;  2JXX A;  1L4D B;  3BK1 A;  2DWQ A;  2RDB C;  5AZF A;  1WGY A;  2AEH A;  4EKU A;  2KK8 A;  2NPT B;  2KQ7 A;  2LMC A;  4MGY E;  3N30 A;  5J18 A;  3N1Y C;  5H8Y E;  2M0A A;  4LNK A;  3RT3 B;  4DK5 A;  3P4Q B;  4QAY A;  4M01 A;  4YL8 A;  4E3C A;  2LGS A;  4A3P A;  3VHT C;  4EOY A;  3GS2 A;  2NBV B;  3A9J B;  1UNS A;  3BZD B;  3ZXR A;  3VQI A;  1TKE A;  5CTR C;  2LGD A;  1WX7 A;  1P1A A;  1SGH A;  2YEP B;  2KC1 A;  2IO1 B;  4OZB A;  1AW7 A;  4GN1 A;  3PS6 A;  1L4Z B;  2WHI A;  2JZZ A;  1Y8R C;  2RDH A;  3JVZ X;  2LXC A;  4PYZ A;  5L95 C;  3GOE A;  1WXA A;  1TS3 A;  4JWS C;  2NBU A;  5KHQ A;  2BYF A;  3HM6 X;  5LXI B;  2PVG C;  3ZKJ C;  4WJP A;  5D3I B;  2PVO D;  1TIF A;  2INC C;  1YX6 B;  2MH7 A;  2BQQ A;  3SFD B;  2MBB B;  1HZ6 A;  3BII D;  1KH0 A;  1QLB B;  2G45 B;  2L76 A;  4P1C C;  2BKR B;  1ACC A;  2KYW A;  4OZA A;  1D5X C;  4FN2 A;  3KW5 B;  2CHW A;  3PGE A;  1TBE A;  4HKZ E;  2KMA A;  3BVG A;  3MJ5 A;  3AB5 A;  4ZHO A;  1XLQ A;  1XQQ A;  3QX1 A;  4M8N A;  3RI7 C;  2D3A A;  1LM8 B;  4G11 A;  5HI1 A;  3NRZ A;  2KDM A;  2IJ0 A;  2M1M A;  2QIL A;  4WQM A;  4DHJ D;  4K7U A;  3TSS A;  4NZL B;  4C7Z A;  3A33 B;  2ZNV C;  2KXJ A;  1HQR D;  2VRR B;  3V61 A;  3UQA A;  2WU2 B;  3W2D A;  5G5G A;  3BYT B;  5J2R A;  3LYY A;  4F1S A;  1VJK A;  2PW9 A;  5C2T B;  1PFD A;  4JQW C;  2X38 A;  2LUM A;  5DPW A;  1DOI A;  2OED A;  3R7Q A;  4AWJ A;  1E7V A; 
#chains in the Genus database with same CATH homology
 4M02 A;  2KT7 A;  4M00 A;  4M01 A;  2KVZ A;  2KYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...