2KT7A

Solution nmr structure of mucin-binding domain of protein lmo0835 from listeria monocytogenes, northeast structural genomics consortium target lmr64a
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
MDTNNFTVKVEYVDADGAEIAPSDTLTDYHYVSTPKDIPGYKLREIPHNATGNITDTGIIVRYIYDKIIDVSYVDETGKDLLPVVEIINSEAAVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative peptidoglycan bound protein (LPXTG motif)
publication title Solution NMR structure of mucin-binding domain of protein lmo0835 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes
molecule tags Cell adhesion, membrane protein
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kt7A01
2KYWA 4M02A 4M01A 2KVZA 4M00A 2KT7A
chains in the Genus database with same CATH superfamily
4CQNA 4A6QA 4ANVA 3QARA 2GI9A 3VH4B 4RFBA 4ZYSA 1EM7A 2Y5CA 5FKAC 1VD2A 2NCNA 4J6IA 3ZXRA 3IT6B 4XGAB 1K51A 4WAFA 3VTWA 1YJ1A 2JF5A 1E0ZA 3JSVA 1SF0A 4EFOA 1E7UA 1TYGB 3TBLD 1L6VA 3BYYB 3AV8A 1QOGA 4R3DA 2ONQA 4C7ZA 1HE8A 2KN5A 4GN1A 2JPHA 1PGBA 3P63A 2W3RA 3V6EB 2L1AA 3AEAB 5G55A 2INDC 4EEWA 3RNCC 3AE1B 4GLSC 2W55A 3DHIC 1K8RB 3Q2AC 3Q14C 3OWEB 1OFFA 1WFYA 2BWFA 2DAFA 4KGSA 3BVMA 5AZHA 4XWWA 4A55A 3BVZA 2KMCA 3U30A 2ZW0A 3A1QA 4OHJA 4DHJD 1MG4A 4BFRA 3JYUA 1WGHA 1ESFA 3FAHA 2KWVB 3KLSX 2M56B 4HDOA 3GZNI 2DYMA 1JWMD 2FUG1 1Z5SB 2N9PC 2D3BA 2ZPNA 2KC2A 4XYCA 1HTQA 4C7YA 3Q3FA 3L10B 2BKRB 3L54A 3PRPB 4HXDA 2RDGA 1I42A 2VH2A 2BW2A 2DAJA 3SD5A 3O13A 2IDYA 1TBEA 1SIJA 1P9DU 4FHJA 1JRUA 3LYYA 4L1BA 2MQJA 1XCTL 1WR6E 2GBKA 2M0AA 1UNSA 2NVUI 3T9LA 1FXIA 1RFKA 2BYEA 2C7HA 2KVZA 1V1PB 4HPPA 2WXIA 1BUIC 3AB5A 4G50A 1DOIA 2Q5WD 3H6NA 4EZJA 2G3QB 2GB1A 2QCZA 1XQQA 3NZUA 1TS3A 3NS1A 2N0SB 1GC7A 3KW5B 2JVCA 2PW9A 2LGDA 2BBCA 5C2TB 1CMXB 1FM0D 1K52A 1AW7A 1OQQA 3ZQ4A 4D2KA 3P4QB 3SEBA 4O1NA 3C19A 1K50A 1D4BA 3PT2B 4PT5A 5IOIA 1TKYA 2LVPA 1TTNA 2XK5A 4G3XB 4M02A 1DYQA 4MT5A 4M00A 1L4ZB 4KDLB 2AWTA 2WXRA 1E8ZA 5D7GA 4WJQA 4NQKE 4NNJB 4MM3B 2JUOA 2DBYA 1STEA 4PYUA 2LZ6A 2XN9C 3WANA 4K7WA 1P98A 2MW5A 2W3SA 4DXFA 1KLUD 2WQYB 3Q8FA 2RPQA 4WWPA 4DK5A 5J17A 2QJLA 1FXAA 4BVUC 4JWUC 2LGIA 3HM6X 1MHHE 1JWBD 5EDSA 2D3AA 4FN2A 4II2B 3VTUA 2FCQA 2KLGA 1WJNA 4ACFA 1PDXA 1QOAA 4RF1A 4OW0A 4ZRIA 3ZNID 4B0MA 4XDCA 4UDUC 3NUHB 4FULA 3SDLC 2WXFA 3L0WB 1N5XA 2N1VA 1XLQA 4KKIA 2VRRB 2WGSA 2K25A 4OVVA 4LNFA 3QHTA 1N6ZA 5LXIB 3ZLZA 4K3CA 1J19A 3MJWA 4XE0A 2BT6A 2REXA 4OVUA 3R2IA 3Q69A 4YWGG 3QA8A 3H1UA 3NHEB 2V1YA 4NJ6A 1FFVA 3ZGZA 3ONSA 4BKSD 1YIWA 1VJKA 1PFDA 3VR8B 2BWES 1NI2A 2WS3B 3KYCD 4BKSA 2GOWA 4ICUA 2LFIA 1YN5A 1WGRA 4J3OD 1T0RC 4P6VF 1R4NB 1P1AA 1TS2A 2JXXA 1ZDVA 4LNKA 5IO9A 4XC2A 1WYWB 1WXSA 2AQ3B 2R2OA 1RM6C 2B76B 2WXKA 4US8A 4NQLB 4DQOC 5H8YE 3IAM1 4F8CB 2M0XA 2BVCA 2MH7A 3AE5B 2FUHB 2ICIA 2K5PA 3MC9A 3ZJTA 4WJOA 3RYTA 3AULA 2BQQA 3CMMB 2MHJA 3BWUD 3DHHC 4XDDA 1EUVB 3R8BA 1AARA 4II3B 4JE3B 5E6PA 2DZMA 4GDLA 3E56A 3E9SA 4GXBA 2NS5A 3AH7A 4WQMA 4KV2A 5LLIA 2RR9A 4HWIB 2LJIA 2LVQA 1ZXIA 3Q8CA 2OEDA 3C0RB 3DVGX 1M94A 2JQRB 3N1XC 1XT9B 4GMVA 2KVRA 3TSSA 4FLHA 1WXVA 2DZIA 4FHKA 2NTSA 1I7HA 1XCQL 3MP9A 2JY6A 3M62B 3TEXA 1F9JA 2KDBA 4IM0A 2V3SA 2KDIA 3VFKA 2J0JA 3WALA 4N58A 5HHDG 3AMZA 1LFDA 3QX1A 3MC0B 3TUOA 3ZUNA 1WM3A 2BB5A 2D10A 2LGYA 1V6EA 4OZCA 4AWJA 3A9KB 5BMHA 1UUPA 3GB1A 4A3OA 3A4RA 3IAS1 4PS3A 1WX8A 1SJHD 4W9JA 1GOZA 1RAXA 3APDA 4WWMA 4GU2A 1NVID 1F1HA 1XLNA 3N32A 2H89B 2QC8A 3L16A 5EE0A 2KAJA 3W5UB 4IC7B 2JWUA 3JSVB 1N61A 1RFAA 2W82A 2QDFA 5MPOA 4LK0M 2MEKA 2HD5B 3QAQA 3PGEA 1XEEA 4MGYE 3APFA 3SU8X 4AP4C 1NBFC 2LRWA 3P2BA 2K8CA 3KQ4A 2JZPA 2N9KA 5AUIA 3AU5A 2FCMA 2MBHA 4IDIA 2VH1A 3IT4B 3AEEB 4TSSA 2Y5BB 1ZGUB 4KSKC 2RD0A 3QC8B 2KMAA 1Y56A 2LVOA 3J9CA 3A1QB 1HZ5A 1JWSD 1P7EA 4TQ1A 4N59A 1EF1A 1SE3A 2KQSA 1TIFA 5EE3A 3AECB 3HHMA 5TSSA 3ZNZB 2IO2B 2YLMA 3Q8EA 1L6UA 3DBRI 1WXQA 1SE4A 1BMLC 4XWTA 1WZ0A 2FCNA 3LDZE 3FILB 4MEMA 2WXPA 2KTFA 3TCAA 3ML9A 2RGFA 4E3CA 2KHWB 1OGWA 1GPXA 2WXQA 1OQYA 1J8CA 1WIAA 3UI3A 1CZPA 1VZ7A 2NBWB 2K1FA 2N7EA 1V5TA 2MLBA 4YSZB 4WJNA 3HRDD 2KZRA 2PVOD 4A3PA 1JALA 1WXAA 2HJ1A 3OG5A 3TEYA 3NG0A 4ITKA 2K9XA 1SE9A 4C00A 1R4MI 3RUIB 4MELA 2MBEA 1BXTA 1HA5A 1LM8B 2UU7A 1FRDA 3AE7B 3BIID 2AQ1B 1UF0A 2DYBA 2TSSA 1FEHA 2ZCBA 3ZXVA 3NRZA 3L17A 2SAKA 3W1SA 2D2QA 2L32A 4YTMB 1JWAD 1C77A 5AZGA 2MA9B 4YL8A 2KJRA 4P16A 4GGQA 1R7SA 1LGRA 4P7IA 1XLPA 1JW9D 1Q0WB 3WA0A 3IVFA 1AWDA 2AEHA 2GBJA 2NPTB 2XK5B 1D5ZC 2LXAA 4NAMA 5BO4B 3S2AA 2MBOA 1FPYA 4G11A 4AUQC 2D11A 1WY8A 3N1YC 4YSXB 5FR3A 1HXYD 2FE8A 5CTRC 3ZO5B 3EC8A 3U8ZA 3VHTC 2LJ5A 2XBBC 5IAAC 3QCAA 2VZKD 2QHOA 1EU3A 2A4ZA 3H7SA 2IGHA 4QAYA 4G0NB 3VTVA 4TMAB 1V1OA 1MVKA 4K7UA 3MFGA 4URKA 2KX0A 2J52A 4NPNA 1Q1OA 4N6EB 5J18A 5EE1A 3ZDMC 3A9JA 5AUKA 1CJEA 3RI7C 1WXMA 2K8HA 5DPTA 3MJ5A 3SFEB 1XXGA 2EKEC 2ZZPB 1X1MA 3TEZA 1RLFA 4EOYA 3PLUA 4B0EA 5J2RA 3RFZB 1FMAD 1PGAA 3PTFC 1WF9A 2KDEB 3AXCA 2IZVB 1QOFA 4S17A 1ET9A 1WJ4A 2N7JA 5I4DA 5HFYA 2WXMA 2RMMA 4A9AA 2G9HD 4EZLA 5DPSA 3TIXA 3RCZA 2JX5A 4BOSC 3DPDA 3B9JA 3UQBA 4TV3A 3PPAA 3APCA 3I57A 3ABVB 3DVNU 2RPVA 3AE4B 5IKCM 4WAAA 2O2VB 2JYTA 2LI5A 3KUDB 2MRPA 1N62A 3IXSA 2KC1A 3M63B 1WX7A 2O6VB 3CWIA 5CHVC 3RT3B 2LHDA 1L2NA 4RGMA 4LDTB 2C5LC 4HLEA 4DXGA 1XLOA 4PS7A 1WYGA 2IO1B 1XF5L 4W9FA 2J0MA 4XX5A 2KACA 2CU3A 3B08A 4MACA 4GDLB 3DBHB 2MCNB 3KWVA 3NVWA 1E8WA 2DWQA 4RH6A 4MSMB 1P7FA 1WWTA 1E90A 2BS2B 2E3TA 1HQRD 3ALBA 3QQ8B 2CJOA 4KDIC 2WDQB 1L4DB 4GDKA 3EFCA 2J42A 3ZDTA 1FO4A 4RCOA 4C4VA 2IJ0A 4WURA 5D3IB 2PPHA 2QIEB 3HUIA 1LXDA 3ZKJC 4KSLC 2PE6B 4MSQB 1TKEA 3RZWC 1IPGA 1T0SC 2MJDA 3RD2A 2BGFA 1WRIA 2WXGA 2ZCCA 1UBIA 2AL3A 3ZJVA 5L83A 2RDHA 3PVLA 2KFKB 2W54A 1RYJA 2GLSA 1PUTA 2L0FA 3PRZA 1OEYA 2ZVOA 3U52E 3U7DA 3CSFA 4JL9A 1YX6B 5LNK1 1FNUA 3JW0X 3VUYA 3AU4A 2IY1B 2FBWB 3MTNB 4BBNF 3EHVA 1WM2A 3BZDB 3V6CB 1IBXA 3OLMD 1N60A 3RMKC 2KK8A 1ACCA 2KWUB 2RDBC 2OOBB 3VDZA 3ZNGC 2GBNA 3UIOB 3ZJUA 3DQVA 4PS8A 4WJPA 1ZUD2 4MH8A 3VUXA 3DOWA 1U4AA 2AX5A 2A5UA 5L95C 4W9HA 2LRUA 1N63A 1ZW7A 1F0ZA 3W5VB 2C7MB 3N1ZC 1TS5A 3H8HA 3BK2A 1KM7A 1JROA 2OHFA 2K3UA 2I1JA 5G5GA 2WHIA 2EKIA 2QMTA 4KIKB 4RGOS 4WQOB 1C76A 1V97A 3ZNHB 3RNBC 2BS4B 1YN3A 3VVWB 4USAA 1QQRA 2Y3AA 5IN7A 4ANUA 4AQ7A 1WR1A 4YXDB 1WZ3A 1QILA 3NZ3A 3O65B 3Q3NC 4KZCA 2D3CA 5BMGA 2GMIC 3MHZA 2QSDA 2JRHA 2NBUA 3ZTCA 3NY5A 3Q3OC 3GOEA 2PIAA 1YN4A 5C3JB 1VR9A 2DENB 2WXNA 2R2QA 1VZ8A 2AL6A 1E9MA 3AE9B 3B1LX 1EWCA 1I4RA 4L23A 3IG3A 3ECIA 3QIJA 2H88B 3PZ7A 3QJZA 1YD8U 4H2AA 4E71A 4ANXA 2KQ7A 4X57B 3DHGC 3TMPB 5IA7A 1V1PA 2EMSA 4AJYB 1Q5WB 3H9DA 1WI0A 2QEJC 3R7QA 1L0VB 1UZXB 2L05A 1R4NI 1ENFA 3N3KB 2N9LA 1WSPA 2ON8A 4MGZE 1OEYJ 5LXHA 3SHQA 2WYQA 1FXTB 4TQ0A 3K9PB 1SJED 2PJHA 2KANA 2MP2A 4A90A 3HK0A 3Q3MC 3AEFB 4M8NA 4NAWB 1DOYA 1LO5D 3VH3B 1HZ6A 4FJZA 2Y5PA 3P4SB 3LJ3A 2J53A 3EGRA 4W9KA 2K0PA 3PZ8A 2DNFA 4TKNA 1HEZE 2WDVB 1D6EC 3N30A 1UELA 4JX1C 2ZJDA 2X8XX 2C60A 2CKHB 3P1MA 4W9LA 2ACZB 5JH5C 4MM3A 4OZBA 4MJSA 5FR6A 3C8YA 4WWNA 4PK1A 1KRHA 1V9JA 3B0AA 5BMIA 1C4PA 1V81A 1FNWA 2E6XA 2FIFA 2DZJA 4ARCA 1JRPA 1C79A 3MHSD 1WGGA 2C9WB 2M8SA 4MDKE 4EKUA 2R61A 2EMTA 2BTEA 2G4SA 4MH0E 1I4XA 3R3MA 3IFWB 2L76A 3M95A 3Q3JA 2IGDA 3KH0A 4K7SA 4KX6B 1P0RA 4Q2JA 1WRDB 1C4CA 3DWGC 1PGXA 1WE7A 3DBLB 1SB3C 2BS3B 1FCLA 3KUZA 3AEDB 3DDCB 1FCCC 1KJTA 3AM9A 2INPE 4M0WA 2MX2A 2CR5A 3DBRB 1NENB 2L3ZA 4P1BC 4HCPB 1RRBA 3U2SC 2PEAA 3TL5A 1E8XA 1XO3A 1C9FA 2LMCA 1E7PB 4DHZB 2L0TA 4DHJB 1WGYA 3RULA 2N9EB 2DZKA 5CHFA 4LLGM 3NVZA 4ANWA 1DOXA 2FAZA 5JZEB 2WDTB 2KX3A 3CF6E 1R4MB 1EWYC 2CS4A 4WIPA 4C80A 4XZ4A 2LHEA 5JHBA 5KHQA 1KF6B 2K39A 1GB4A 1JQ4A 3RNGC 2KT7A 3H7PA 1ZPSA 2WXJA 4DDGD 2CHZA 3Q8AA 2LUMA 4HRSA 3NZSA 4HKQA 3L08A 3TJPA 1MHXA 5JXVA 1P3QU 1WMHA 3DVGY 3JVZX 3BVGA 2K8BA 2GBRA 2JYEA 2X38A 1C78A 5H92C 5G2NA 4GB9A 4KVGB 3OJ4B 2J7QB 1WE6A 5CHWA 2WLBA 1GB1A 2KLCA 4E74A 3MC8A 4GIVA 1WJ6A 4RGNA 1V86A 4DHZE 2C7NB 2QILA 3U4EG 3NVYA 1EF5A 3N9YC 4K81A 4LNNA 2KJHB 2WXHA 3X23A 4US9A 4GDKB 2NMQA 1L0XB 2WWZA 2PMVA 4K1RB 4C4VB 3KYDD 2IGGA 2GRIA 2NTTA 5AZFA 2CJNA 4RM9A 2DLBA 4HVBA 2IPKD 2BB6A 4BZAA 3U7ZA 3ML8A 5C23A 4JQWC 3FC4A 3A9KA 3A4SC 5T8IA 1F2RC 1ZXHA 5DPWA 4BKTA 4ZHOA 1PYWD 3VR9B 4OZAA 1A70A 4ZHPA 4RMAA 1Y8RC 4AOFA 2KNBA 2IY0B 2JSVX 4NJ7A 1V8CA 4HJKA 1E7VA 1Q10A 2BYTA 3EUB2 4NY0A 2KYWA 4JGHB 1CK1A 2IO3B 1IBXB 4OVZA 2AYOB 4IWPA 3GZNB 3HVDA 2Z8LA 3PREA 2MBBB 4BBNC 5AEKB 3GS2A 3PSEB 3W1YA 2WXLA 1D5MC 2UYZB 5DCNA 1JCKB 2WU2B 2BPSA 1QLBB 1F77A 2ASQA 3LB8C 2JWZA 1MPEA 3M3JA 2KTRA 1T0YA 2V4IB 2ZVNA 3V60A 2V3NA 1IUEA 4W9EA 3I63C 1D3ZA 2LGXA 2DYOA 2PKOA 1VDVA 1SIFA 2OJWA 4KZ0A 5CX3A 1T6BX 1WX9A 3ZVVA 3QWZB 4W9IA 1VCBA 4B6WA 3FILA 2JZ3B 1N5WA 1VZ6A 4ASWC 2I1KA 2WDRB 4MGKE 4A20A 1GC6A 2PE9A 4W9DA 1NYQA 1SBBB 4F7ZA 4GSWA 3LXFA 4L2YA 4FJYA 3IBEA 1B9RA 1C3TA 5HG2A 3P42A 3AE3B 4LJPB 4DDID 2KO3A 3Q8BA 1NEKB 2KWCA 2WU5B 1AN8A 2KFJA 4IKGA 2LXCA 2JT4B 2M1MA 4KKJA 3PV1A 2WX0A 1IGCA 3PLVA 1NYRA 1IGDA 4REZA 4S0RA 1KH0A 3DCGA 3V3XA 3EECA 3AE2B 1NDDA 1MJDA 2OJRA 3V62A 3WCQA 5D94A 5G5HA 2BKFA 2LGSA 3WAMA 1JMLA 2KJ6A 3T3NA 4LJOB 2DX5B 1QF6A 5BYQA 2BF8B 4M01A 4B9KA 4EUTA 2Z0DB 2MP2B 3AN1A 2KDMA 2PVGC 3ZRFA 1UWMA 4HK2A 1WH3A 3V05A 1B1ZA 2M17A 3FKYA 1MI0A 1QKZA 2HE7A 1YJIA 2AQ2B 3K9OB 2NPTA 2V3PA 2PTLA 1LQBA 2L8JA 1YJJA 1CQVA 2WXOA 2GBMA 3DBHI 2KOXA 3AE6B 3PO0A 1S3SG 3RNFC 2ZPYA 1SSNA 3KVFB 3P4RB 4MJSB 3ZYYX 2CU1A 3ZRCA 3HM3A 2YEPF 3RPFC 4C56C 2KKCA 3UINB 2I2YA 2L7RA 3UQAA 1EU4A 2LWPA 1GUAB 2NR2A 4HDQA 2RSUA 1UBQA 1V80A 3ZW3A 4JPSA 3OJ3A 2L00B 1UD7A 1GJZA 3X0WA 5GXGB 1I4PA 3PZDA 1T5XD 5E6JA 1KFYB 2BYVE 3WAPA 3NOBA 3DWMA 5DPRA 4HCNB 3W9CB 1TKGA 3UGBB 4HPLB 2M4NA 2N7DA 1ISNA 3R66C 5E6OA 1TY2A 2G1EA 3AEBB 1UWXA 1YNTE 3B2GA 1YQ3B 2KDFB 4LNIA 2K22A 1IP9A 4YTNB 4ARIA 3NS8A 1S1QB 2XNAC 1GNUA 3I9V1 4M0WB 5FK9C 1AYFA 1XD3B 4CO7A 1I4HA 2DHZA 2N4FA 5D6JB 3UIPB 4HROA 2B3AA 2CHXA 2XEWA 4RM8A 3RNAC 1TGZB 4YT0B 2INNE 2IYDB 4KGRA 2N1WA 4YSYB 4BOZB 2KMMA 3CSTA 1H8CA 2MBQA 2FNJB 1YQBA 1A5RA 3VXWA 1YOVB 3BYTB 4P1CC 2O2VA 2HJ8A 3TEWA 4IG7B 4IOIE 1KOTA 1VLBA 2JZZA 1KLGD 4F1SA 5D3DA 4FXCA 3DBSA 2PLPA 2O6VD 1SEBD 2INCC 3H7PB 4LDTD 2O6VA 1C1YB 3WIMA 3V61A 4LNOA 2Z59B 4WH4A 1WGDA 1UH6A 5KHOA 3T8MA 3ETRA 4ZRPA 1GG3A 1SGHA 1IYFA 5D2MB 2SEBD 4HJGE 3PRMB 1E8YA 3AE8B 3VAWA 2MSED 1WMHB 3EA6A 5C1ZA 1QT9A 1M4VA 2ZW1A 1E5WA 2JXTA 2LEKA 4LTUA 2D5GA 1TZOA 1J7BA 2K6DB 1V2YA 2ZEQA 3PS6A 4GOCA 3AI5A 4IM2A 2JU6X 3RZFA 1V49A 2EELA 1ET6A 3P4PB 2BYFA 1HTOA 3BK1A 3CIRB 1I4QA 2WP9B 3SR6A 1KTKA 4DBGA 2LD9A 1FRRA 4IM3A 3I3TB 1L5PA 1OQRA 1WGKA 3D32A 1JWUD 2KFKA 4BAXA 2JRIB 2J0KA 2HTHA 1G6JA 2V4LA 3RNEC 2LUEA 3WAOA 4IW0A 4ICVA 3Q6BA 4KGTA 1OTRB 1BT0A 1FD6A 1ZDXA 2VZKB 4RF0A 2V9HA 3URYA 3NJTA 3PHWB 1V5OA 3L4PA 1QOBA 1E6EB 4MGIE 4AJWA 2V0GA 2IBIB 4FADA 3ZIMA 1VRAB 5HI1A 3HVZA 3N20C 2WNMA 2KN4A 3A9JB 3UF8A 1J0GA 1I35A 1T0QC 4EZKA 3W1SC 2D3GA 2M19A 1KLVA 1DGJA 2N9XA 4FA6A 3R7RA 2G45B 4NZLB 1YQ4B 2ZNVB 1Z2MA 3W2DA 4JIOU 1YMHE 3DVNV 4HPMB 1E10A 3ENEA 3OAWA 4A8XC 4N9F4 2CHWA 4KIKA 4I6NB 3AEGB 2KQ4X 4JWSC 4IWQA 4CYEA 4ZOHC 1TZ1A 4IWOA 2KTRB 1RWSA 1FNVA 2HTME 3SFDB 1J7CA 3VQIA 2MWSB 2KD0A 3RN9C 4LCDE 1ZOYB 4EE2A 4JLCA 4RNAA 1ZP0B 1I4GA 3DBLI 3PHXB 4ZDVA 2MJEA 3QK0A 1YX5B 2L52A 1QZEA 1MFWA 4W9CA 2KXJA 1J7AA 1C4AA 2Z0EB 5HKHA 1FFUA 1PQSA 2KWDA 4RGTA 2UWQA 1UGMA 1ZE3D 4ZRQA 1TS4A 1L0YB 3IHPC 3L13A 4I6PA 4YTPB 2YVCA 2J4XA 2I38A 1UGJA 1SE2A 1T3QA 4CHKA 4IUMB 4FJVB 1EO6A 4HKZE 3VRAB 2LASA 3T3OA 3GP7A 4M8MA 4PYZA 1FIQA 4ZRJA 5BYSA 2L83A 2HDEA 4DWFA 1ZKHA 2NBVB 2ZNVC 4W9GA 2W9NA 2IO0B 1D5XC 1WJUA 3BINA 2YEPB 3NVVA 4TUUA 4WWOA 4DXAB 5TR5A 3KWLA 4NJCA 4ZYNA 4I6LB 2G4DB 4BKGA 4FBJB 1MG8A 2D07B 2FCSA 3A33B 3GE8C 5E6NA 4ZRKA 3R2TA 1NI3A 3HIZA 3KUCB 4K3BA 4NAWA 1ROEA 3ZTDA 5GMVA 1F2RI 3B2FA 1TJEA 1K53A 5BYRA 1TT5B 4B95A 3VUWA 2FIDA 1SXTA 1L7YA 3VRBB 3EFUA 4HEA1 1H4RA 1GAQB 3I5JC 5JHAA 2MJ3A 3BY4B 2K6QA 2WX1A 4AS1A 5EE9A 5IP4D 1F52A 1TY0A 3GE3C
chains in the Genus database with same CATH topology
2KYWA 4M02A 4M01A 2KVZA 4M00A 2KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYW A;  4M02 A;  4M01 A;  2KVZ A;  4M00 A;  2KT7 A; 
#chains in the Genus database with same CATH topology
 4CQN A;  4A6Q A;  4ANV A;  3QAR A;  2GI9 A;  3VH4 B;  4RFB A;  4ZYS A;  1EM7 A;  2Y5C A;  5FKA C;  1VD2 A;  2NCN A;  4J6I A;  3ZXR A;  3IT6 B;  4XGA B;  1K51 A;  4WAF A;  3VTW A;  1YJ1 A;  2JF5 A;  1E0Z A;  3JSV A;  1SF0 A;  4EFO A;  1E7U A;  1TYG B;  3TBL D;  1L6V A;  3BYY B;  3AV8 A;  1QOG A;  4R3D A;  2ONQ A;  4C7Z A;  1HE8 A;  2KN5 A;  4GN1 A;  2JPH A;  1PGB A;  3P63 A;  2W3R A;  3V6E B;  2L1A A;  3AEA B;  5G55 A;  2IND C;  4EEW A;  3RNC C;  3AE1 B;  4GLS C;  2W55 A;  3DHI C;  1K8R B;  3Q2A C;  3Q14 C;  3OWE B;  1OFF A;  1WFY A;  2BWF A;  2DAF A;  4KGS A;  3BVM A;  5AZH A;  4XWW A;  4A55 A;  3BVZ A;  2KMC A;  3U30 A;  2ZW0 A;  3A1Q A;  4OHJ A;  4DHJ D;  1MG4 A;  4BFR A;  3JYU A;  1WGH A;  1ESF A;  3FAH A;  2KWV B;  3KLS X;  2M56 B;  4HDO A;  3GZN I;  2DYM A;  1JWM D;  2FUG 1;  1Z5S B;  2N9P C;  2D3B A;  2ZPN A;  2KC2 A;  4XYC A;  1HTQ A;  4C7Y A;  3Q3F A;  3L10 B;  2BKR B;  3L54 A;  3PRP B;  4HXD A;  2RDG A;  1I42 A;  2VH2 A;  2BW2 A;  2DAJ A;  3SD5 A;  3O13 A;  2IDY A;  1TBE A;  1SIJ A;  1P9D U;  4FHJ A;  1JRU A;  3LYY A;  4L1B A;  2MQJ A;  1XCT L;  1WR6 E;  2GBK A;  2M0A A;  1UNS A;  2NVU I;  3T9L A;  1FXI A;  1RFK A;  2BYE A;  2C7H A;  2KVZ A;  1V1P B;  4HPP A;  2WXI A;  1BUI C;  3AB5 A;  4G50 A;  1DOI A;  2Q5W D;  3H6N A;  4EZJ A;  2G3Q B;  2GB1 A;  2QCZ A;  1XQQ A;  3NZU A;  1TS3 A;  3NS1 A;  2N0S B;  1GC7 A;  3KW5 B;  2JVC A;  2PW9 A;  2LGD A;  2BBC A;  5C2T B;  1CMX B;  1FM0 D;  1K52 A;  1AW7 A;  1OQQ A;  3ZQ4 A;  4D2K A;  3P4Q B;  3SEB A;  4O1N A;  3C19 A;  1K50 A;  1D4B A;  3PT2 B;  4PT5 A;  5IOI A;  1TKY A;  2LVP A;  1TTN A;  2XK5 A;  4G3X B;  4M02 A;  1DYQ A;  4MT5 A;  4M00 A;  1L4Z B;  4KDL B;  2AWT A;  2WXR A;  1E8Z A;  5D7G A;  4WJQ A;  4NQK E;  4NNJ B;  4MM3 B;  2JUO A;  2DBY A;  1STE A;  4PYU A;  2LZ6 A;  2XN9 C;  3WAN A;  4K7W A;  1P98 A;  2MW5 A;  2W3S A;  4DXF A;  1KLU D;  2WQY B;  3Q8F A;  2RPQ A;  4WWP A;  4DK5 A;  5J17 A;  2QJL A;  1FXA A;  4BVU C;  4JWU C;  2LGI A;  3HM6 X;  1MHH E;  1JWB D;  5EDS A;  2D3A A;  4FN2 A;  4II2 B;  3VTU A;  2FCQ A;  2KLG A;  1WJN A;  4ACF A;  1PDX A;  1QOA A;  4RF1 A;  4OW0 A;  4ZRI A;  3ZNI D;  4B0M A;  4XDC A;  4UDU C;  3NUH B;  4FUL A;  3SDL C;  2WXF A;  3L0W B;  1N5X A;  2N1V A;  1XLQ A;  4KKI A;  2VRR B;  2WGS A;  2K25 A;  4OVV A;  4LNF A;  3QHT A;  1N6Z A;  5LXI B;  3ZLZ A;  4K3C A;  1J19 A;  3MJW A;  4XE0 A;  2BT6 A;  2REX A;  4OVU A;  3R2I A;  3Q69 A;  4YWG G;  3QA8 A;  3H1U A;  3NHE B;  2V1Y A;  4NJ6 A;  1FFV A;  3ZGZ A;  3ONS A;  4BKS D;  1YIW A;  1VJK A;  1PFD A;  3VR8 B;  2BWE S;  1NI2 A;  2WS3 B;  3KYC D;  4BKS A;  2GOW A;  4ICU A;  2LFI A;  1YN5 A;  1WGR A;  4J3O D;  1T0R C;  4P6V F;  1R4N B;  1P1A A;  1TS2 A;  2JXX A;  1ZDV A;  4LNK A;  5IO9 A;  4XC2 A;  1WYW B;  1WXS A;  2AQ3 B;  2R2O A;  1RM6 C;  2B76 B;  2WXK A;  4US8 A;  4NQL B;  4DQO C;  5H8Y E;  3IAM 1;  4F8C B;  2M0X A;  2BVC A;  2MH7 A;  3AE5 B;  2FUH B;  2ICI A;  2K5P A;  3MC9 A;  3ZJT A;  4WJO A;  3RYT A;  3AUL A;  2BQQ A;  3CMM B;  2MHJ A;  3BWU D;  3DHH C;  4XDD A;  1EUV B;  3R8B A;  1AAR A;  4II3 B;  4JE3 B;  5E6P A;  2DZM A;  4GDL A;  3E56 A;  3E9S A;  4GXB A;  2NS5 A;  3AH7 A;  4WQM A;  4KV2 A;  5LLI A;  2RR9 A;  4HWI B;  2LJI A;  2LVQ A;  1ZXI A;  3Q8C A;  2OED A;  3C0R B;  3DVG X;  1M94 A;  2JQR B;  3N1X C;  1XT9 B;  4GMV A;  2KVR A;  3TSS A;  4FLH A;  1WXV A;  2DZI A;  4FHK A;  2NTS A;  1I7H A;  1XCQ L;  3MP9 A;  2JY6 A;  3M62 B;  3TEX A;  1F9J A;  2KDB A;  4IM0 A;  2V3S A;  2KDI A;  3VFK A;  2J0J A;  3WAL A;  4N58 A;  5HHD G;  3AMZ A;  1LFD A;  3QX1 A;  3MC0 B;  3TUO A;  3ZUN A;  1WM3 A;  2BB5 A;  2D10 A;  2LGY A;  1V6E A;  4OZC A;  4AWJ A;  3A9K B;  5BMH A;  1UUP A;  3GB1 A;  4A3O A;  3A4R A;  3IAS 1;  4PS3 A;  1WX8 A;  1SJH D;  4W9J A;  1GOZ A;  1RAX A;  3APD A;  4WWM A;  4GU2 A;  1NVI D;  1F1H A;  1XLN A;  3N32 A;  2H89 B;  2QC8 A;  3L16 A;  5EE0 A;  2KAJ A;  3W5U B;  4IC7 B;  2JWU A;  3JSV B;  1N61 A;  1RFA A;  2W82 A;  2QDF A;  5MPO A;  4LK0 M;  2MEK A;  2HD5 B;  3QAQ A;  3PGE A;  1XEE A;  4MGY E;  3APF A;  3SU8 X;  4AP4 C;  1NBF C;  2LRW A;  3P2B A;  2K8C A;  3KQ4 A;  2JZP A;  2N9K A;  5AUI A;  3AU5 A;  2FCM A;  2MBH A;  4IDI A;  2VH1 A;  3IT4 B;  3AEE B;  4TSS A;  2Y5B B;  1ZGU B;  4KSK C;  2RD0 A;  3QC8 B;  2KMA A;  1Y56 A;  2LVO A;  3J9C A;  3A1Q B;  1HZ5 A;  1JWS D;  1P7E A;  4TQ1 A;  4N59 A;  1EF1 A;  1SE3 A;  2KQS A;  1TIF A;  5EE3 A;  3AEC B;  3HHM A;  5TSS A;  3ZNZ B;  2IO2 B;  2YLM A;  3Q8E A;  1L6U A;  3DBR I;  1WXQ A;  1SE4 A;  1BML C;  4XWT A;  1WZ0 A;  2FCN A;  3LDZ E;  3FIL B;  4MEM A;  2WXP A;  2KTF A;  3TCA A;  3ML9 A;  2RGF A;  4E3C A;  2KHW B;  1OGW A;  1GPX A;  2WXQ A;  1OQY A;  1J8C A;  1WIA A;  3UI3 A;  1CZP A;  1VZ7 A;  2NBW B;  2K1F A;  2N7E A;  1V5T A;  2MLB A;  4YSZ B;  4WJN A;  3HRD D;  2KZR A;  2PVO D;  4A3P A;  1JAL A;  1WXA A;  2HJ1 A;  3OG5 A;  3TEY A;  3NG0 A;  4ITK A;  2K9X A;  1SE9 A;  4C00 A;  1R4M I;  3RUI B;  4MEL A;  2MBE A;  1BXT A;  1HA5 A;  1LM8 B;  2UU7 A;  1FRD A;  3AE7 B;  3BII D;  2AQ1 B;  1UF0 A;  2DYB A;  2TSS A;  1FEH A;  2ZCB A;  3ZXV A;  3NRZ A;  3L17 A;  2SAK A;  3W1S A;  2D2Q A;  2L32 A;  4YTM B;  1JWA D;  1C77 A;  5AZG A;  2MA9 B;  4YL8 A;  2KJR A;  4P16 A;  4GGQ A;  1R7S A;  1LGR A;  4P7I A;  1XLP A;  1JW9 D;  1Q0W B;  3WA0 A;  3IVF A;  1AWD A;  2AEH A;  2GBJ A;  2NPT B;  2XK5 B;  1D5Z C;  2LXA A;  4NAM A;  5BO4 B;  3S2A A;  2MBO A;  1FPY A;  4G11 A;  4AUQ C;  2D11 A;  1WY8 A;  3N1Y C;  4YSX B;  5FR3 A;  1HXY D;  2FE8 A;  5CTR C;  3ZO5 B;  3EC8 A;  3U8Z A;  3VHT C;  2LJ5 A;  2XBB C;  5IAA C;  3QCA A;  2VZK D;  2QHO A;  1EU3 A;  2A4Z A;  3H7S A;  2IGH A;  4QAY A;  4G0N B;  3VTV A;  4TMA B;  1V1O A;  1MVK A;  4K7U A;  3MFG A;  4URK A;  2KX0 A;  2J52 A;  4NPN A;  1Q1O A;  4N6E B;  5J18 A;  5EE1 A;  3ZDM C;  3A9J A;  5AUK A;  1CJE A;  3RI7 C;  1WXM A;  2K8H A;  5DPT A;  3MJ5 A;  3SFE B;  1XXG A;  2EKE C;  2ZZP B;  1X1M A;  3TEZ A;  1RLF A;  4EOY A;  3PLU A;  4B0E A;  5J2R A;  3RFZ B;  1FMA D;  1PGA A;  3PTF C;  1WF9 A;  2KDE B;  3AXC A;  2IZV B;  1QOF A;  4S17 A;  1ET9 A;  1WJ4 A;  2N7J A;  5I4D A;  5HFY A;  2WXM A;  2RMM A;  4A9A A;  2G9H D;  4EZL A;  5DPS A;  3TIX A;  3RCZ A;  2JX5 A;  4BOS C;  3DPD A;  3B9J A;  3UQB A;  4TV3 A;  3PPA A;  3APC A;  3I57 A;  3ABV B;  3DVN U;  2RPV A;  3AE4 B;  5IKC M;  4WAA A;  2O2V B;  2JYT A;  2LI5 A;  3KUD B;  2MRP A;  1N62 A;  3IXS A;  2KC1 A;  3M63 B;  1WX7 A;  2O6V B;  3CWI A;  5CHV C;  3RT3 B;  2LHD A;  1L2N A;  4RGM A;  4LDT B;  2C5L C;  4HLE A;  4DXG A;  1XLO A;  4PS7 A;  1WYG A;  2IO1 B;  1XF5 L;  4W9F A;  2J0M A;  4XX5 A;  2KAC A;  2CU3 A;  3B08 A;  4MAC A;  4GDL B;  3DBH B;  2MCN B;  3KWV A;  3NVW A;  1E8W A;  2DWQ A;  4RH6 A;  4MSM B;  1P7F A;  1WWT A;  1E90 A;  2BS2 B;  2E3T A;  1HQR D;  3ALB A;  3QQ8 B;  2CJO A;  4KDI C;  2WDQ B;  1L4D B;  4GDK A;  3EFC A;  2J42 A;  3ZDT A;  1FO4 A;  4RCO A;  4C4V A;  2IJ0 A;  4WUR A;  5D3I B;  2PPH A;  2QIE B;  3HUI A;  1LXD A;  3ZKJ C;  4KSL C;  2PE6 B;  4MSQ B;  1TKE A;  3RZW C;  1IPG A;  1T0S C;  2MJD A;  3RD2 A;  2BGF A;  1WRI A;  2WXG A;  2ZCC A;  1UBI A;  2AL3 A;  3ZJV A;  5L83 A;  2RDH A;  3PVL A;  2KFK B;  2W54 A;  1RYJ A;  2GLS A;  1PUT A;  2L0F A;  3PRZ A;  1OEY A;  2ZVO A;  3U52 E;  3U7D A;  3CSF A;  4JL9 A;  1YX6 B;  5LNK 1;  1FNU A;  3JW0 X;  3VUY A;  3AU4 A;  2IY1 B;  2FBW B;  3MTN B;  4BBN F;  3EHV A;  1WM2 A;  3BZD B;  3V6C B;  1IBX A;  3OLM D;  1N60 A;  3RMK C;  2KK8 A;  1ACC A;  2KWU B;  2RDB C;  2OOB B;  3VDZ A;  3ZNG C;  2GBN A;  3UIO B;  3ZJU A;  3DQV A;  4PS8 A;  4WJP A;  1ZUD 2;  4MH8 A;  3VUX A;  3DOW A;  1U4A A;  2AX5 A;  2A5U A;  5L95 C;  4W9H A;  2LRU A;  1N63 A;  1ZW7 A;  1F0Z A;  3W5V B;  2C7M B;  3N1Z C;  1TS5 A;  3H8H A;  3BK2 A;  1KM7 A;  1JRO A;  2OHF A;  2K3U A;  2I1J A;  5G5G A;  2WHI A;  2EKI A;  2QMT A;  4KIK B;  4RGO S;  4WQO B;  1C76 A;  1V97 A;  3ZNH B;  3RNB C;  2BS4 B;  1YN3 A;  3VVW B;  4USA A;  1QQR A;  2Y3A A;  5IN7 A;  4ANU A;  4AQ7 A;  1WR1 A;  4YXD B;  1WZ3 A;  1QIL A;  3NZ3 A;  3O65 B;  3Q3N C;  4KZC A;  2D3C A;  5BMG A;  2GMI C;  3MHZ A;  2QSD A;  2JRH A;  2NBU A;  3ZTC A;  3NY5 A;  3Q3O C;  3GOE A;  2PIA A;  1YN4 A;  5C3J B;  1VR9 A;  2DEN B;  2WXN A;  2R2Q A;  1VZ8 A;  2AL6 A;  1E9M A;  3AE9 B;  3B1L X;  1EWC A;  1I4R A;  4L23 A;  3IG3 A;  3ECI A;  3QIJ A;  2H88 B;  3PZ7 A;  3QJZ A;  1YD8 U;  4H2A A;  4E71 A;  4ANX A;  2KQ7 A;  4X57 B;  3DHG C;  3TMP B;  5IA7 A;  1V1P A;  2EMS A;  4AJY B;  1Q5W B;  3H9D A;  1WI0 A;  2QEJ C;  3R7Q A;  1L0V B;  1UZX B;  2L05 A;  1R4N I;  1ENF A;  3N3K B;  2N9L A;  1WSP A;  2ON8 A;  4MGZ E;  1OEY J;  5LXH A;  3SHQ A;  2WYQ A;  1FXT B;  4TQ0 A;  3K9P B;  1SJE D;  2PJH A;  2KAN A;  2MP2 A;  4A90 A;  3HK0 A;  3Q3M C;  3AEF B;  4M8N A;  4NAW B;  1DOY A;  1LO5 D;  3VH3 B;  1HZ6 A;  4FJZ A;  2Y5P A;  3P4S B;  3LJ3 A;  2J53 A;  3EGR A;  4W9K A;  2K0P A;  3PZ8 A;  2DNF A;  4TKN A;  1HEZ E;  2WDV B;  1D6E C;  3N30 A;  1UEL A;  4JX1 C;  2ZJD A;  2X8X X;  2C60 A;  2CKH B;  3P1M A;  4W9L A;  2ACZ B;  5JH5 C;  4MM3 A;  4OZB A;  4MJS A;  5FR6 A;  3C8Y A;  4WWN A;  4PK1 A;  1KRH A;  1V9J A;  3B0A A;  5BMI A;  1C4P A;  1V81 A;  1FNW A;  2E6X A;  2FIF A;  2DZJ A;  4ARC A;  1JRP A;  1C79 A;  3MHS D;  1WGG A;  2C9W B;  2M8S A;  4MDK E;  4EKU A;  2R61 A;  2EMT A;  2BTE A;  2G4S A;  4MH0 E;  1I4X A;  3R3M A;  3IFW B;  2L76 A;  3M95 A;  3Q3J A;  2IGD A;  3KH0 A;  4K7S A;  4KX6 B;  1P0R A;  4Q2J A;  1WRD B;  1C4C A;  3DWG C;  1PGX A;  1WE7 A;  3DBL B;  1SB3 C;  2BS3 B;  1FCL A;  3KUZ A;  3AED B;  3DDC B;  1FCC C;  1KJT A;  3AM9 A;  2INP E;  4M0W A;  2MX2 A;  2CR5 A;  3DBR B;  1NEN B;  2L3Z A;  4P1B C;  4HCP B;  1RRB A;  3U2S C;  2PEA A;  3TL5 A;  1E8X A;  1XO3 A;  1C9F A;  2LMC A;  1E7P B;  4DHZ B;  2L0T A;  4DHJ B;  1WGY A;  3RUL A;  2N9E B;  2DZK A;  5CHF A;  4LLG M;  3NVZ A;  4ANW A;  1DOX A;  2FAZ A;  5JZE B;  2WDT B;  2KX3 A;  3CF6 E;  1R4M B;  1EWY C;  2CS4 A;  4WIP A;  4C80 A;  4XZ4 A;  2LHE A;  5JHB A;  5KHQ A;  1KF6 B;  2K39 A;  1GB4 A;  1JQ4 A;  3RNG C;  2KT7 A;  3H7P A;  1ZPS A;  2WXJ A;  4DDG D;  2CHZ A;  3Q8A A;  2LUM A;  4HRS A;  3NZS A;  4HKQ A;  3L08 A;  3TJP A;  1MHX A;  5JXV A;  1P3Q U;  1WMH A;  3DVG Y;  3JVZ X;  3BVG A;  2K8B A;  2GBR A;  2JYE A;  2X38 A;  1C78 A;  5H92 C;  5G2N A;  4GB9 A;  4KVG B;  3OJ4 B;  2J7Q B;  1WE6 A;  5CHW A;  2WLB A;  1GB1 A;  2KLC A;  4E74 A;  3MC8 A;  4GIV A;  1WJ6 A;  4RGN A;  1V86 A;  4DHZ E;  2C7N B;  2QIL A;  3U4E G;  3NVY A;  1EF5 A;  3N9Y C;  4K81 A;  4LNN A;  2KJH B;  2WXH A;  3X23 A;  4US9 A;  4GDK B;  2NMQ A;  1L0X B;  2WWZ A;  2PMV A;  4K1R B;  4C4V B;  3KYD D;  2IGG A;  2GRI A;  2NTT A;  5AZF A;  2CJN A;  4RM9 A;  2DLB A;  4HVB A;  2IPK D;  2BB6 A;  4BZA A;  3U7Z A;  3ML8 A;  5C23 A;  4JQW C;  3FC4 A;  3A9K A;  3A4S C;  5T8I A;  1F2R C;  1ZXH A;  5DPW A;  4BKT A;  4ZHO A;  1PYW D;  3VR9 B;  4OZA A;  1A70 A;  4ZHP A;  4RMA A;  1Y8R C;  4AOF A;  2KNB A;  2IY0 B;  2JSV X;  4NJ7 A;  1V8C A;  4HJK A;  1E7V A;  1Q10 A;  2BYT A;  3EUB 2;  4NY0 A;  2KYW A;  4JGH B;  1CK1 A;  2IO3 B;  1IBX B;  4OVZ A;  2AYO B;  4IWP A;  3GZN B;  3HVD A;  2Z8L A;  3PRE A;  2MBB B;  4BBN C;  5AEK B;  3GS2 A;  3PSE B;  3W1Y A;  2WXL A;  1D5M C;  2UYZ B;  5DCN A;  1JCK B;  2WU2 B;  2BPS A;  1QLB B;  1F77 A;  2ASQ A;  3LB8 C;  2JWZ A;  1MPE A;  3M3J A;  2KTR A;  1T0Y A;  2V4I B;  2ZVN A;  3V60 A;  2V3N A;  1IUE A;  4W9E A;  3I63 C;  1D3Z A;  2LGX A;  2DYO A;  2PKO A;  1VDV A;  1SIF A;  2OJW A;  4KZ0 A;  5CX3 A;  1T6B X;  1WX9 A;  3ZVV A;  3QWZ B;  4W9I A;  1VCB A;  4B6W A;  3FIL A;  2JZ3 B;  1N5W A;  1VZ6 A;  4ASW C;  2I1K A;  2WDR B;  4MGK E;  4A20 A;  1GC6 A;  2PE9 A;  4W9D A;  1NYQ A;  1SBB B;  4F7Z A;  4GSW A;  3LXF A;  4L2Y A;  4FJY A;  3IBE A;  1B9R A;  1C3T A;  5HG2 A;  3P42 A;  3AE3 B;  4LJP B;  4DDI D;  2KO3 A;  3Q8B A;  1NEK B;  2KWC A;  2WU5 B;  1AN8 A;  2KFJ A;  4IKG A;  2LXC A;  2JT4 B;  2M1M A;  4KKJ A;  3PV1 A;  2WX0 A;  1IGC A;  3PLV A;  1NYR A;  1IGD A;  4REZ A;  4S0R A;  1KH0 A;  3DCG A;  3V3X A;  3EEC A;  3AE2 B;  1NDD A;  1MJD A;  2OJR A;  3V62 A;  3WCQ A;  5D94 A;  5G5H A;  2BKF A;  2LGS A;  3WAM A;  1JML A;  2KJ6 A;  3T3N A;  4LJO B;  2DX5 B;  1QF6 A;  5BYQ A;  2BF8 B;  4M01 A;  4B9K A;  4EUT A;  2Z0D B;  2MP2 B;  3AN1 A;  2KDM A;  2PVG C;  3ZRF A;  1UWM A;  4HK2 A;  1WH3 A;  3V05 A;  1B1Z A;  2M17 A;  3FKY A;  1MI0 A;  1QKZ A;  2HE7 A;  1YJI A;  2AQ2 B;  3K9O B;  2NPT A;  2V3P A;  2PTL A;  1LQB A;  2L8J A;  1YJJ A;  1CQV A;  2WXO A;  2GBM A;  3DBH I;  2KOX A;  3AE6 B;  3PO0 A;  1S3S G;  3RNF C;  2ZPY A;  1SSN A;  3KVF B;  3P4R B;  4MJS B;  3ZYY X;  2CU1 A;  3ZRC A;  3HM3 A;  2YEP F;  3RPF C;  4C56 C;  2KKC A;  3UIN B;  2I2Y A;  2L7R A;  3UQA A;  1EU4 A;  2LWP A;  1GUA B;  2NR2 A;  4HDQ A;  2RSU A;  1UBQ A;  1V80 A;  3ZW3 A;  4JPS A;  3OJ3 A;  2L00 B;  1UD7 A;  1GJZ A;  3X0W A;  5GXG B;  1I4P A;  3PZD A;  1T5X D;  5E6J A;  1KFY B;  2BYV E;  3WAP A;  3NOB A;  3DWM A;  5DPR A;  4HCN B;  3W9C B;  1TKG A;  3UGB B;  4HPL B;  2M4N A;  2N7D A;  1ISN A;  3R66 C;  5E6O A;  1TY2 A;  2G1E A;  3AEB B;  1UWX A;  1YNT E;  3B2G A;  1YQ3 B;  2KDF B;  4LNI A;  2K22 A;  1IP9 A;  4YTN B;  4ARI A;  3NS8 A;  1S1Q B;  2XNA C;  1GNU A;  3I9V 1;  4M0W B;  5FK9 C;  1AYF A;  1XD3 B;  4CO7 A;  1I4H A;  2DHZ A;  2N4F A;  5D6J B;  3UIP B;  4HRO A;  2B3A A;  2CHX A;  2XEW A;  4RM8 A;  3RNA C;  1TGZ B;  4YT0 B;  2INN E;  2IYD B;  4KGR A;  2N1W A;  4YSY B;  4BOZ B;  2KMM A;  3CST A;  1H8C A;  2MBQ A;  2FNJ B;  1YQB A;  1A5R A;  3VXW A;  1YOV B;  3BYT B;  4P1C C;  2O2V A;  2HJ8 A;  3TEW A;  4IG7 B;  4IOI E;  1KOT A;  1VLB A;  2JZZ A;  1KLG D;  4F1S A;  5D3D A;  4FXC A;  3DBS A;  2PLP A;  2O6V D;  1SEB D;  2INC C;  3H7P B;  4LDT D;  2O6V A;  1C1Y B;  3WIM A;  3V61 A;  4LNO A;  2Z59 B;  4WH4 A;  1WGD A;  1UH6 A;  5KHO A;  3T8M A;  3ETR A;  4ZRP A;  1GG3 A;  1SGH A;  1IYF A;  5D2M B;  2SEB D;  4HJG E;  3PRM B;  1E8Y A;  3AE8 B;  3VAW A;  2MSE D;  1WMH B;  3EA6 A;  5C1Z A;  1QT9 A;  1M4V A;  2ZW1 A;  1E5W A;  2JXT A;  2LEK A;  4LTU A;  2D5G A;  1TZO A;  1J7B A;  2K6D B;  1V2Y A;  2ZEQ A;  3PS6 A;  4GOC A;  3AI5 A;  4IM2 A;  2JU6 X;  3RZF A;  1V49 A;  2EEL A;  1ET6 A;  3P4P B;  2BYF A;  1HTO A;  3BK1 A;  3CIR B;  1I4Q A;  2WP9 B;  3SR6 A;  1KTK A;  4DBG A;  2LD9 A;  1FRR A;  4IM3 A;  3I3T B;  1L5P A;  1OQR A;  1WGK A;  3D32 A;  1JWU D;  2KFK A;  4BAX A;  2JRI B;  2J0K A;  2HTH A;  1G6J A;  2V4L A;  3RNE C;  2LUE A;  3WAO A;  4IW0 A;  4ICV A;  3Q6B A;  4KGT A;  1OTR B;  1BT0 A;  1FD6 A;  1ZDX A;  2VZK B;  4RF0 A;  2V9H A;  3URY A;  3NJT A;  3PHW B;  1V5O A;  3L4P A;  1QOB A;  1E6E B;  4MGI E;  4AJW A;  2V0G A;  2IBI B;  4FAD A;  3ZIM A;  1VRA B;  5HI1 A;  3HVZ A;  3N20 C;  2WNM A;  2KN4 A;  3A9J B;  3UF8 A;  1J0G A;  1I35 A;  1T0Q C;  4EZK A;  3W1S C;  2D3G A;  2M19 A;  1KLV A;  1DGJ A;  2N9X A;  4FA6 A;  3R7R A;  2G45 B;  4NZL B;  1YQ4 B;  2ZNV B;  1Z2M A;  3W2D A;  4JIO U;  1YMH E;  3DVN V;  4HPM B;  1E10 A;  3ENE A;  3OAW A;  4A8X C;  4N9F 4;  2CHW A;  4KIK A;  4I6N B;  3AEG B;  2KQ4 X;  4JWS C;  4IWQ A;  4CYE A;  4ZOH C;  1TZ1 A;  4IWO A;  2KTR B;  1RWS A;  1FNV A;  2HTM E;  3SFD B;  1J7C A;  3VQI A;  2MWS B;  2KD0 A;  3RN9 C;  4LCD E;  1ZOY B;  4EE2 A;  4JLC A;  4RNA A;  1ZP0 B;  1I4G A;  3DBL I;  3PHX B;  4ZDV A;  2MJE A;  3QK0 A;  1YX5 B;  2L52 A;  1QZE A;  1MFW A;  4W9C A;  2KXJ A;  1J7A A;  1C4A A;  2Z0E B;  5HKH A;  1FFU A;  1PQS A;  2KWD A;  4RGT A;  2UWQ A;  1UGM A;  1ZE3 D;  4ZRQ A;  1TS4 A;  1L0Y B;  3IHP C;  3L13 A;  4I6P A;  4YTP B;  2YVC A;  2J4X A;  2I38 A;  1UGJ A;  1SE2 A;  1T3Q A;  4CHK A;  4IUM B;  4FJV B;  1EO6 A;  4HKZ E;  3VRA B;  2LAS A;  3T3O A;  3GP7 A;  4M8M A;  4PYZ A;  1FIQ A;  4ZRJ A;  5BYS A;  2L83 A;  2HDE A;  4DWF A;  1ZKH A;  2NBV B;  2ZNV C;  4W9G A;  2W9N A;  2IO0 B;  1D5X C;  1WJU A;  3BIN A;  2YEP B;  3NVV A;  4TUU A;  4WWO A;  4DXA B;  5TR5 A;  3KWL A;  4NJC A;  4ZYN A;  4I6L B;  2G4D B;  4BKG A;  4FBJ B;  1MG8 A;  2D07 B;  2FCS A;  3A33 B;  3GE8 C;  5E6N A;  4ZRK A;  3R2T A;  1NI3 A;  3HIZ A;  3KUC B;  4K3B A;  4NAW A;  1ROE A;  3ZTD A;  5GMV A;  1F2R I;  3B2F A;  1TJE A;  1K53 A;  5BYR A;  1TT5 B;  4B95 A;  3VUW A;  2FID A;  1SXT A;  1L7Y A;  3VRB B;  3EFU A;  4HEA 1;  1H4R A;  1GAQ B;  3I5J C;  5JHA A;  2MJ3 A;  3BY4 B;  2K6Q A;  2WX1 A;  4AS1 A;  5EE9 A;  5IP4 D;  1F52 A;  1TY0 A;  3GE3 C; 
#chains in the Genus database with same CATH homology
 2KYW A;  4M02 A;  4M01 A;  2KVZ A;  4M00 A;  2KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...