2KT9A

Solution nmr structure of probable 30s ribosomal protein psrp-3 (ycf65-like protein) from synechocystis sp. (strain pcc 6803), northeast structural genomics consortium target target sgr46
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 30S ribosomal protein PSRP-3
publication title Solution NMR Structure of Probable 30S ribosomal protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46
rcsb
source organism Synechocystis sp.
molecule tags Ribosomal protein
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04839 PSRP-3_Ycf65 Plastid and cyanobacterial ribosomal protein (PSRP-3 / Ycf65)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.750 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kt9A01
2KT9A
chains in the Genus database with same CATH superfamily
3KBUA 3E08A 3TLSA 3M3ZB 4TX5A 5LJNA 2VASA 5FNVE 4X5TA 1HS7A 3K3OA 4OYJA 4ZEYA 1OEDC 1U5PA 1OEDA 1N33T 2CM0A 3AE4A 1XZYA 1LVKA 5FY7A 4ANJA 1YW0A 2VKDA 2ZM0A 4LF6T 1S94A 4KHPT 3UU4A 2MAWA 1WYCA 4YT0A 5CA1E 2A3DA 4U31A 3AE7A 3X1DA 2WDRA 2FBWA 5L4EA 5FVLA 3HKEE 5J2TE 2CBJA 3ANWB 2BG9C 3P7IA 2BG9A 2LKHA 3UQ4A 2F4VT 1J5ET 4JI6T 2V5CA 3M65A 3ZMTB 4ERRA 5FMNA 2B76A 2BS3A 3ZT5A 3AEFA 2W67A 5IHYA 3A7MA 4ZI3D 2WB5A 5AQNB 4NXMT 2BS2A 4DMVA 1BR0A 1YD8G 1T8BA 4JI7T 4HFHA 4ILBA 1XNQT 3VKHA 3JAFA 4DO0A 4KP3C 5L47A 2NTXA 1UK5A 5HWYA 4CQIA 1UGOA 1UCUA 2XM2A 4EAHA 4UV9B 4QXCB 2D2SA 3FHNA 3ZMVB 1T7SA 4I43B 3IF8B 3UULA 2VL0A 2L3LA 2DHRA 4JI5T 1YKHB 2JIWA 2CLYB 3UUMA 4GYRA 5HEGA 2ACZA 5ABFB 4OYKA 3L3PA 3MK7C 2WMOA 3P4WA 2V7KA 3MKDA 4CI2B 3AA0B 3C50A 1BR2A 4HFCA 4BJMA 1FJGT 5FVKA 2PFVA 4DR5T 2DL1A 2VL8A 1HX8A 2YDSA 2KWIB 1MIYA 1J1JA 1YXRA 4LF7T 3C4WA 2W0GA 4MALA 1QSDA 3AE6A 2Q9QB 2X67A 2A72A 3KV6A 2IC6A 4YY3T 3KV9A 3PUAA 3T1YT 3SWHA 3WAJA 2DWGA 4P1NA 4EGWA 3PUQA 3B57A 3RYIE 5L3EB 2PBIA 4I4TE 4NUUA 3C64A 3RQUA 2DNXA 4HWFA 2JQKA 4BJNA 1HG5A 2WWUA 1M7KA 1YQ3A 4CXYA 4IL4A 2FJBA 3ZKRA 3PU8A 4MBQA 5HXEA 3GWHA 4EZ4A 5LYJE 3FZMB 4U7IA 2UXDT 2DI4A 2LM9A 2YU1A 5HEJA 2MPKA 1WCRA 2UU9T 1N32T 4LF5T 4ILUA 4OK0A 1HFAA 2MTQA 1HNWT 1KFYA 2CHNA 3ONJA 4WYVA 3CQXC 4AQGA 1QLBA 5AQFB 4U74A 2YOEA 5LG4A 3IEEA 1JNZA 2H7VC 4E7SA 4IDOA 4YTPA 2BKOA 3RC3A 2RA1A 5FL1A 2BKNA 2X0YA 3BQIA 1N36T 2UUAT 1T72A 4ZZCA 1IJ6A 2BZBA 4DR1T 4CN4A 3TLVA 4A98A 2WU5A 3BK9A 4KUMB 1J5WA 5DQWA 1WR6A 3GMIA 4HFEA 5J1GA 1MMAA 3LJCA 2E9XB 3UFGA 1H7CA 2KZ7B 2MYSA 5AFUL 4IHJE 5BR8T 3H3MA 2CXLA 3I0QA 2LRLA 4TV9E 4EXTA 2CBIA 2XAQB 2BVLA 3SFEA 5LHIB 1D0ZA 2YDQA 3AE1A 5ADXL 4XAXB 1R8IA 2AXDS 2V6YB 4WBOA 5AQJB 3J9X1 5JRCA 1VCTA 4H9RC 2EHOD 2LLYA 3PUSA 4UELA 4CXWA 3UTKA 2EHOC 3VR9A 2WMNA 2WY2A 2VKHA 2XQAA 2Q9QA 3VR8A 2X9WA 2LSIA 4EYUA 1XDPA 4B3MT 3ZYMA 2Y6XA 5DABA 4Z91A 4TNVA 3C4XA 5AQRB 2XASB 4KI0F 2V7IA 5AQPB 3AEBA 5KDMC 4DR7T 1OEDB 1MIWA 4X64T 3PU3A 4GOUA 3C51A 4U7YA 4JV5T 2XAJB 1MMDA 3FXDB 1VOMA 1XNRT 2D0UA 3F2EA 3SOLA 1HF8A 4DNDA 3FBZA 2C0SA 4GYSA 3NWIA 4FJOA 3QNUA 2XZEA 5CGMA 4WW0A 4EEDA 4COFA 3DTOA 3L39A 5EK3A 2L9QA 2K5BB 3DJBA 2XQ6A 2ACXA 3OYZA 5EZYE 4X62T 3AXJA 4GK0E 5AQIB 2M6BA 4PJLA 5HXSA 2YKSA 4GK5E 2BG9B 2NW9A 4TNWA 3AA1B 3FZLB 4K0UA 3RIAA 2WZHA 2BS4A 3ZJ1A 4PK6A 3RI5A 2UUBT 2IW5B 4GKJT 2ZLYA 3RLFF 1UUSA 2I59A 4ILCA 4HWHA 1N34T 2NW7A 4OFZA 3ZN0B 4KMCA 3JC6C 4B3RT 1UURA 3RYCE 3OBVE 2XAFB 4LFCT 4HN9A 2X51A 2QGSA 5LB7B 2IUBA 5HXCA 4TWHA 3OVUA 5LNKA 4YJ3E 3LFMA 4QX7B 5FL0A 4UVCB 2WCAA 1I6ZA 3ZYKA 5HXRA 4YSZA 2J62A 1I94T 2LHNA 4UF0A 3P8CD 1BR1A 2V7LA 2W2UA 5TAOA 3O1IA 4YJ2E 1YKEB 3BQLA 3I9YA 4A56A 5EK2A 5AQHB 2YINA 4L5GA 3E22E 4HTEA 3KVBA 2H3RA 2C5IT 2I0MA 1D1CA 2H89A 1NENA 1SUMB 1UX4A 2ZMAA 4HFVA 2LEHA 3Q9DA 1KNPA 3VRBA 3LSVA 3UUNA 3NRYA 1GQEA 3RC8A 4QXHB 3VRAA 5F3JA 1G8XA 4EV6A 5C2TA 4FI5A 2LT3A 2M67A 3UQ7A 4ISSA 4H9SE 4O8SA 2WWVA 4CZZB 3P4QA 2QRXA 4IREA 3CKDA 3PUXF 5AQQB 1W09A 1W9RA 5J2UE 2JMHA 5L3GB 3AB3B 2LOPA 2V7MA 2K3WA 3OYXA 3AA6B 4JBWF 5DJQC 2CWYA 4DR3T 2VVSA 2XSAA 3PUZF 2J4GA 2V6XA 2E8IA 2FJEA 3PUYF 4N78D 3B5MA 4DUYT 4ZI3C 3S4UA 3UU5A 4JI1T 4JI0T 3CVRA 4UV8B 1V9DA 2V7JA 4O4JE 2BDEA 4AKIA 3F57A 2A2FX 3N9MA 3ZCJA 1D1AA 2XAGB 3AEEA 2H7OA 1HX1B 4TZ4C 4GIWA 3ZSTA 5LXTE 3KFWX 4IDNA 5CA0E 3LBXA 3QB5A 3AE5A 3RYHE 1B7TA 4DBRA 4AXPA 3NRXA 5IWAT 4YTMA 2W66A 3ONLC 1CHUA 3B13A 3RF1A 3UU8A 5A1LA 4QXBB 4HFDA 1KK7A 2WP9A 3I0OA 2WDQA 4XBFB 1OWAA 5LJMA 4NIQA 2ZM2A 2KLQA 4ADZA 2V26A 4WNKA 3N9PA 4DV0T 1LRZA 4JYAT 2WS3A 2X66A 3ETVA 3AVSA 2VVNA 2WSSV 5CFBA 3EI0A 4O2AE 5JRCB 3UU6A 4YSXA 2UXCT 2CRBA 4IT4A 5L3DB 2NTYA 4TWDA 3EHZA 1IBLT 3OKQA 1LKXA 4AKRB 4DR6T 3AE9A 2JRKA 5EK4A 1T98A 1ZHCA 3RRCA 1Y01A 3ZLIA 3TKLB 3EDVA 2C5KT 3C98B 2BKPA 4IGUA 3U78A 5IUXA 2B1EA 2CA5A 2UXBT 4X66T 3J7Yq 3FXEB 5AQGB 2IAKA 4DR4T 2MBGA 4LFBT 5JREA 3O9XA 3GN5A 1HTJF 3N9LA 1EZ3A 2KXPB 5E0OA 2KMFA 4L9IA 1MIVA 2JJ9A 5KMGP 3E0ZA 5HAXA 2XQ3A 3AXJB 1WYBA 4YHHT 3FB2A 3FBLA 4IIJE 3OJAA 4Z90A 3AAIA 2IIUA 2H88A 4NXNT 4H9QC 3G06A 1Z8UA 2CCQA 3N9QA 4QH4A 3ZT7A 4AKLA 2C5JA 2UXNB 4BA9A 5AQLB 3ETUA 2L8KA 4G63A 5AQSB 2K9AA 2ODVA 2YK0A 3K1SA 3LG7A 4F6RC 2FUPA 1U4QA 4YXDA 4WBNE 3ZMSB 2KT9A 5LBQB 4DV5T 4ZI7E 4H9PC 4H9OC 2HHHT 2VKJA 3Q5DA 4A97A 5IYZE 2HPLA 4JI4T 4JI8T 4DV6T 5AQVB 1XMOT 4IDZA 2IDOB 5FYMA 1BR4A 4ISTA 2I6HA 5JQGE 4E7ZA 5AQOB 2D0TA 2FJAA 3HI2A 4JUYA 4F8HA 1QUUA 2VURA 3H3AA 4UF0B 3QB5K 5DQVA 1SHZC 2LSJA 1XDOA 3EUHA 3O1JA 2EHOA 5LP6E 4I55E 4ASKA 5AQMB 1FEWA 1NWMX 4X1IE 4OHFA 1CUNA 2XHEB 3O4XE 1Z0PA 1US7B 5CB4E 5L3FB 3H37A 4ZXLA 4OX9T 3Q5XA 3CPZA 3JCFA 1KNZA 3HKDE 1IAPA 4IE7A 3ABVA 4M1PA 4CXXA 4IE0A 4L0RA 3I9WA 4DV3T 2XY8B 1HNZT 5LBMA 5AQKB 3CIRA 3R84B 4WZXA 1HG2A 3RKGA 3L09A 4B3TT 5FY1A 4U2ZA 2XUEA 4JEHB 2VB6A 2KINB 2IHR1 3MXZA 3CX6B 4B6XA 5FY0A 4B3ST 3AAAB 3ZMUB 4DR2T 1E2AA 2CEAA 3AAEB 1X9BA 2KSRA 2LKGA 2LM2A 3CK6A 2WZIA 2Y8DA 3WI3A 3ZSSA 1SE7A 2IC9A 2K48A 3Q2MA 2CXDA 4C90A 5JDNA 3D0TA 3KINB 1ZP0A 1ZV4X 3CX8B 4UR9A 4QHOA 3A5XA 3AE8A 2DLRA 3BQKA 3K3NA 3R6NA 1VRBA 4HGAA 2JPFA 3NVOA 3ZC1A 4CN6A 2E5VA 2E9XD 3LBXB 4KX6A 2XPKA 4KHZF 2N1GA 4JI2T 3HKCE 3NZQA 2XQ4A 4ZHQE 3RRWA 4EOZB 3PE0A 5KX5E 3RH3A 2LRKA 2JQHA 1MMNA 4X1KE 3ZCIA 1XMQT 1HNXT 3HR0A 2LE8A 3MA9A 3CX7B 4ZS3A 5LGUB 3LK3B 2XM1A 4I0UA 2V1DB 2PTFA 1O3XA 2SPCA 2X9HA 3ONXA 4LMLA 4QH5A 1KNRA 4YLHA 2YU2A 1W0AA 3RIFA 4NUVA 5JR9C 3V5UA 2YN6A 5JR9A 4DV4T 5FXWA 4HKAA 2WU2A 4H63H 2J1DG 2PJQA 4H9NC 5LHHB 2CMRA 2X68A 2QYWA 3PDYA 4P0BA 4YFSA 4AKGA 3L8RA 2HN1A 3RIUC 3O1HA 2Y48B 3RIUA 3SFDA 1KF6A 2QA7A 2XJ7A 3AVRA 3ZJ2A 4IE4A 3PUVF 5L4HA 4AKHA 3ZC0A 2W00A 1W0BA 3K3QC 3U3IA 4I50E 3UU3A 5LMNT 3ZEFB 4MFRA 4LF9T 3GN5B 4TN7B 3UT5E 3N2KE 5H6QB 3JAEA 3ZYLA 5AQTB 3RHWA 3PJAJ 4QX8B 5ETWA 4U72A 3EDUA 4CI3B 4UVBB 4HE8A 3N2OA 3FZHB 2QVAA 2NWBA 4NPPA 3GA8A 1OXZA 4X20E 3UUXB 4ILAA 4J2CA 5F8PA 3PURA 1NAFA 3EAMA 3EABA 5HXHA 4PK4A 3SS1A 2Z6EA 1IZNB 2MOZA 3KV5A 2P9BA 4DBQA 2HH7A 4X1YE 4HWIB 4UEMA 3UUBA 5HWXA 5CJ5A 2E5LT 4MLKA 1G73A 4LMKA 5HEOA 1MNEA 3VHLA 3CMLA 3N9NA 2CXFA 4YSYA 3T8OA 5LG3A 3LK2B 2ODUA 2LHRA 4X65T 2YDRA 4ZZBA 3QK6A 4LF4T 2CPTA 4HFIA 3EVYA 3N5LA 3VU7H 3KDSE 4PAGA 4V1Av 4AQFC 2D5UA 2D9DA 4TWFA 4AQFA 2M6IA 3RKOA 1WFDA 4TV8E 2XSBA 3NKZA 1OEDE 2K24A 3NBXX 2ES0A 2W4XA 5GONE 3PJAA 2KWHA 2X9YA 2X0LB 2EHOB 3A8YC 4AQYT 4JEUB 3T1HT 2IMLA 3N9OA 5JDQA 2LJLA 2XQ7A 4IL9A 4O4LE 3N2GE 1KEYA 5FKYA 3P4PA 5HEUA 1HCIA 4QH1A 3AEAA 4P0AA 1ZKEA 1FIOA 2W61A 4DV7T 5JDFA 3RYFE 2BG9E 2LSYA 4DIDB 4DV2T 1AJ3A 5LA6E 1HR0T 2KNDA 1NEKA 2WDVA 4EYYR 3UFEA 5C3JA 4IE5A 1ZOYA 2E2AA 3KBTA 2AE9A 4PFOA 2W62A 2DCFA 3TLTA 1WRDA 5C8YE 3ANWA 4UVAB 1D0YA 2ZM6T 3HL6A 2XAHB 1MNDA 4EEBA 4G2AA 4HFBA 2V8SV 4PW8A 4ZI2D 4O2BE 2NW8A 1JNRA 2NOXA 5JDHA 3CQCB 4IDQA 3ZN1B 4ZI2C 2DWKA 1IJ5A 3P50A 3ZPOA 4PK5A 5ABGA 1YQ4A 5JVDE 2A9UA 4XZCA 3PUGA 3QOFA 5JTGA 5HYAA 3LDQB 3AEGA 1ZEEA 2CE7A 4YHJA 5LMUT 4HEAA 1IBMT 4Q25A 5JH7E 3PV0F 5L3BB 4EB6E 3F31A 2XQYA 4LF8T 4O4IE 2VQET 4PJJA 5FXVA 3I1AA 5H6RB 4ZS2A 2OA5A 4EIWA 4O4HE 3CWZB 2OV9A 4C91A 2CLYC 1DU2A 5ABFA 4H63V 3IA3A 4PJNA 3KVAA 4CN1A 3TLUA 2UXXB 1Y64B 4PJMA 2BBHA 3FZFB 5L2LA 2JQQA 3FZKB 2GK9A 5FXZA 5JDGA 2LSGA 5FP3A 4A5XA 1D1BA 2WAUA 4UXNB 1IBKT 2PG8A 4QWNB 2VQFT 4AIUA 1LVFA 4TUYE 2Q9QD 1X79A 1FMWA 3DP7A 3QC9A 2JMKA 5HCMA 1SA0E 2NR4A 2V5DA 2BVMA 3LK42 2Q9QC 3OPCA 5ABEA 3PUWF 4IE6A 1WR0A 3RPUA 4U3CA 3ZMZB 3Q5WA 5J0ZA 5JR9B 4YTNA 3RQWA 2W63A 2WQYA 3AECA 4DVDA 3P4RA 1MMGA 2XQ5A 5FXXA 3AEDA 2N2NA 4BAYB 2OLTA 3QUJA 3RX6A 5M4YA 5HEHA 3VKGA 4AISA 2G0UA 5ABHA 3IBPA 3JADA 2UUCT 3HA4A 2J47A 3MACA 2XQ9A 5F5WA 4DV1T 3WAKA 4ZOLE 4LMJA 2VKOA 1D0XA 3IHRA 5AQUB 4QKNA 1UX5A 5LGTB 2VWAA 2FJDA 2WM9A 1WLXA 2XQ8A 4PNIA 5KXJA 2CHOA 4DMWA 2VK9A 5LGNB 3HKBE 4HWDA 2NP9A 3JC6D 3KV4A 2LSKA 1M62A 2N9DA 2ZM8A 3SRZA 3K8PC 3RGLA 3W15B 5JDLA 1VCSA 2E9XC 2E9XA 4PFPA 4AI6A 5L3CB 2HPJA 3C4ZA 3NZPA 4Z8XA 1L0VA 4UIGA 2JQ9A 2RPAA 4GKKT 1XWMA 4K0KT 2RP4A 3MJXA 3ESLA 3AE3A 4DUZT 2XTLA 4U2YA 2YEVC 4U33A 5BMVE 5LHGB 5LCYA 3ZT6A 3V5SA 2HN2A 2WBLA 5HCJA 3P4SA 3PTRB 2V6YA 3MZKB 4MHCA 3AA7B 4JI3T 3CQGB 4EZHA 5JDMA 4HWCA 4LFAT 2X9XA 4JLEA 2BBJA 1E7PA 2LOSA 4P09A 2R6GF 5LOVE 3OTOT 4IDPA 1E1HB 2X0HA 4KBMB 3AE2A 3TLWA 1FMVA 2CWOA 4CI1B 1S35A 3Q5EA
chains in the Genus database with same CATH topology
3KBUA 3E08A 3N9QA 3T8OA 3LK2B 3DTOA 2ODUA 2LHRA 4TX5A 5EK3A 4AKLA 2C5JA 2UXNB 5LJNA 2VASA 2L9QA 4BA9A 2K5BB 3QK6A 3DJBA 3ETUA 2L8KA 4G63A 2K9AA 3EVYA 2ODVA 2YK0A 5FNVE 1HS7A 3LG7A 2ACXA 3N5LA 3OYZA 3K3OA 5EZYE 4F6RC 1U4QA 3VU7H 4WBNE 3KDSE 4GK0E 4PAGA 4OYJA 4V1Av 3ZMSB 4AQFC 2KT9A 2D5UA 4PJLA 4AQFA 5LBQB 1U5PA 5HXSA 2CM0A 3RKOA 5FY7A 1LVKA 4ANJA 4GK5E 1YW0A 4ZI7E 2VKDA 4TV8E 2ZM0A 4H9PC 2NW9A 3AA1B 4H9OC 2K24A 1S94A 2ES0A 3NBXX 2VKJA 5GONE 4K0UA 1WYCA 3ZJ1A 2KWHA 2X9YA 4PK6A 2X0LB 5IYZE 2EHOB 5CA1E 2IW5B 2HPLA 4JEUB 2A3DA 2ZLYA 3N9OA 5JDQA 2LJLA 4O4LE 3N2GE 4IDZA 2I59A 5FYMA 2NW7A 4OFZA 3HKEE 1BR4A 1HCIA 4ISTA 5JQGE 5J2TE 4E7ZA 3ZN0B 2D0TA 4KMCA 4P0AA 3JC6C 1ZKEA 3RYCE 3ANWB 3P7IA 3HI2A 3OBVE 4JUYA 1FIOA 2W61A 2XAFB 1QUUA 3H3AA 4UF0B 5JDFA 3M65A 4ERRA 3ZMTB 4HN9A 5FMNA 3RYFE 2X51A 2QGSA 5DQVA 5HXCA 1SHZC 2LSJA 5LNKA 2LSYA 3EUHA 3O1JA 2EHOA 5IHYA 5LP6E 4I55E 4YJ3E 4ASKA 1AJ3A 5LA6E 1FEWA 4ZI3D 3LFMA 4QX7B 1NWMX 2KNDA 4EYYR 3UFEA 4UVCB 4X1IE 4IE5A 4OHFA 4DMVA 1BR0A 1CUNA 1YD8G 2XHEB 3O4XE 1Z0PA 3KBTA 4PFOA 1US7B 2W62A 5CB4E 3ZYKA 2DCFA 5L3FB 3VKHA 3H37A 1WRDA 5C8YE 4DO0A 4KP3C 5HXRA 3ANWA 3Q5XA 2LHNA 3CPZA 4UF0A 3P8CD 4UVAB 1D0YA 3HL6A 1BR1A 2XAHB 3HKDE 2V7LA 1MNDA 1KNZA 1IAPA 5TAOA 3O1IA 2NTXA 4IE7A 4G2AA 4YJ2E 5HWYA 4CQIA 4M1PA 1UCUA 1YKEB 3BQLA 4CXXA 4EAHA 3I9YA 4PW8A 4IE0A 4ZI2D 4L0RA 4A56A 4UV9B 4O2BE 4QXCB 3I9WA 5EK2A 2NW8A 2D2SA 2NOXA 5JDHA 3CQCB 3FHNA 3ZN1B 2YINA 4ZI2C 2DWKA 3ZMVB 1IJ5A 4L5GA 4I43B 3E22E 3IF8B 4HTEA 3UULA 3KVBA 2H3RA 2C5IT 1D1CA 2L3LA 3ZPOA 4PK5A 1UX4A 4HFVA 2ZMAA 2DHRA 5LBMA 2LEHA 1YKHB 3Q9DA 5JVDE 3R84B 4XZCA 1HG2A 2CLYB 3UUMA 3PUGA 3L09A 4GYRA 5HYAA 5FY1A 2XUEA 3NRYA 3UUNA 4OYKA 1ZEEA 2CE7A 4YHJA 3RC8A 3L3PA 3MK7C 4JEHB 4QXHB 2WMOA 2VB6A 2V7KA 3MKDA 4HEAA 5F3JA 4CI2B 2KINB 3AA0B 5JH7E 1G8XA 3C50A 3MXZA 1BR2A 3CX6B 4B6XA 5L3BB 5FY0A 4EB6E 3F31A 4BJMA 2XQYA 4FI5A 2LT3A 3AAAB 3ZMUB 2M67A 4O4IE 4ISSA 4PJJA 2PFVA 5FXVA 2CEAA 3AAEB 4H9SE 3I1AA 4O8SA 2VL8A 4CZZB 5H6RB 1HX8A 2KWIB 4ZS2A 2OA5A 1MIYA 4EIWA 4O4HE 3CWZB 4C91A 2CLYC 2Y8DA 3WI3A 3C4WA 2W0GA 3CKDA 2IC9A 4H63V 4MALA 1QSDA 2K48A 4PJNA 3KVAA 3Q2MA 2Q9QB 5J2UE 2JMHA 2X67A 2A72A 2UXXB 1Y64B 3KV6A 2IC6A 2CXDA 4PJMA 4C90A 5JDNA 5L3GB 3KV9A 3D0TA 3KINB 1ZV4X 3CX8B 3AB3B 2LOPA 2V7MA 3PUAA 3SWHA 2DWGA 4QHOA 3WAJA 5L2LA 3A5XA 3OYXA 2JQQA 3BQKA 2DLRA 2GK9A 3K3NA 5FXZA 3R6NA 5JDGA 3AA6B 1VRBA 3B57A 3PUQA 2JPFA 4HGAA 3ZC1A 5DJQC 3RYIE 2CWYA 5L3EB 2LSGA 2PBIA 2E9XD 5FP3A 3LBXB 4I4TE 1D1BA 2WAUA 4UXNB 2E8IA 2PG8A 2N1GA 4QWNB 4N78D 4NUUA 3HKCE 1LVFA 3NZQA 4ZI3C 4TUYE 3C64A 3S4UA 2Q9QD 1X79A 1FMWA 3DP7A 3QC9A 3RRWA 2JMKA 4ZHQE 2DNXA 1SA0E 3CVRA 4UV8B 4BJNA 1HG5A 4EOZB 2WWUA 2BVMA 1V9DA 3LK42 2V7JA 4O4JE 2Q9QC 2BDEA 3PE0A 5KX5E 3RH3A 4AKIA 3F57A 4CXYA 1MMNA 4X1KE 3ZCIA 4IE6A 3RPUA 2A2FX 3N9MA 3PU8A 3HR0A 4MBQA 3ZCJA 5HXEA 1D1AA 2LE8A 3MA9A 3GWHA 2XAGB 4EZ4A 5LYJE 2H7OA 2DI4A 3ZMZB 3CX7B 3Q5WA 4ZS3A 5LGUB 5JR9B 2LM9A 4TZ4C 2YU1A 4GIWA 2W63A 3LK3B 5LXTE 3KFWX 5CA0E 3LBXA 4DVDA 3RYHE 4ILUA 4OK0A 2V1DB 1HFAA 1B7TA 4DBRA 4AXPA 1MMGA 2MTQA 3NRXA 5FXXA 1O3XA 2SPCA 2X9HA 3B13A 3CQXC 3ONXA 4AQGA 2N2NA 4BAYB 4U74A 3QUJA 4YLHA 3RX6A 5M4YA 5LG4A 5A1LA 4QXBB 3VKGA 2YU2A 3IEEA 1KK7A 2H7VC 4NUVA 4E7SA 3I0OA 2G0UA 4XBFB 1OWAA 5LJMA 5JR9C 2ZM2A 3IBPA 2KLQA 2RA1A 3RC3A 3V5UA 5JR9A 3BQIA 5FXWA 4HKAA 4ADZA 2V26A 4H63H 4WNKA 2J1DG 3HA4A 2PJQA 4H9NC 3N9PA 5LHHB 2CMRA 2X68A 1LRZA 3PDYA 1IJ6A 2BZBA 3MACA 2X66A 3ETVA 4P0BA 4YFSA 3WAKA 3AVSA 3BK9A 4KUMB 4ZOLE 4AKGA 2WSSV 2VKOA 1D0XA 5DQWA 1WR6A 3IHRA 3GMIA 3O1HA 4O2AE 2Y48B 5J1GA 5JRCB 1MMAA 3LJCA 2E9XB 4QKNA 2QA7A 1UX5A 3AVRA 3ZJ2A 1H7CA 4IE4A 5L3DB 5LGTB 2VWAA 4AKHA 2KZ7B 2NTYA 3ZC0A 2WM9A 1WLXA 2MYSA 2W00A 4PNIA 5AFUL 3K3QC 4IHJE 3U3IA 4I50E 2CXLA 4DMWA 2VK9A 3OKQA 1LKXA 4AKRB 5LGNB 3I0QA 2JRKA 4TV9E 3ZEFB 4EXTA 4MFRA 5EK4A 3GN5B 3HKBE 1T98A 1ZHCA 4TN7B 2NP9A 2XAQB 3JC6D 2BVLA 3KV4A 2LSKA 3RRCA 3ZLIA 3UT5E 2N9DA 3TKLB 2ZM8A 5LHIB 1D0ZA 3SRZA 3N2KE 3K8PC 5ADXL 5H6QB 3W15B 3EDVA 5JDLA 4XAXB 4WBOA 2C5KT 3J9X1 3ZYLA 5JRCA 2E9XC 4H9RC 2E9XA 2EHOD 4PFPA 4AI6A 5L3CB 3PUSA 2HPJA 3C4ZA 3C98B 4UELA 4IGUA 3NZPA 4Z8XA 3U78A 4CXWA 4QX8B 4UIGA 3UTKA 5ETWA 2EHOC 4U72A 3EDUA 4CI3B 2B1EA 2CA5A 4UVBB 2WMNA 4HE8A 3J7Yq 3N2OA 2VKHA 2Q9QA 2X9WA 2NWBA 2LSIA 3FXEB 2IAKA 4EYUA 2RP4A 3GA8A 1OXZA 3MJXA 2MBGA 3ESLA 4WW0A 4X20E 3UUXB 4J2CA 2XTLA 5F8PA 5JREA 2YEVC 3GN5A 1HTJF 5BMVE 5LHGB 3O9XA 3ZYMA 2Y6XA 3N9LA 5DABA 3PURA 1EZ3A 5LCYA 1NAFA 2KXPB 5E0OA 2KMFA 4L9IA 3V5SA 1MIVA 3C4XA 2JJ9A 5KMGP 2WBLA 2XASB 4PK4A 5HXHA 3E0ZA 3SS1A 5HAXA 2Z6EA 2V7IA 3PTRB 3MZKB 4MHCA 3AA7B 1WYBA 3CQGB 1IZNB 4EZHA 2MOZA 5JDMA 5KDMC 3KV5A 2P9BA 2X9XA 4DBQA 1MIWA 3FB2A 3PU3A 4GOUA 4JLEA 3FBLA 3C51A 2LOSA 2HH7A 4X1YE 2XAJB 1MMDA 4IIJE 4P09A 3OJAA 3FXDB 1VOMA 4UEMA 5LOVE 1E1HB 3AAIA 4KBMB 5HWXA 1FMVA 2D0UA 3F2EA 4H9QC 3SOLA 2CWOA 4MLKA 1G73A 1HF8A 1MNEA 4DNDA 3FBZA 2C0SA 3VHLA 4GYSA 4CI1B 3CMLA 1S35A 3N9NA 4FJOA 2CXFA 2CCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT9 A; 
#chains in the Genus database with same CATH topology
 3KBU A;  3E08 A;  3TLS A;  3M3Z B;  4TX5 A;  5LJN A;  2VAS A;  5FNV E;  4X5T A;  1HS7 A;  3K3O A;  4OYJ A;  4ZEY A;  1OED C;  1U5P A;  1OED A;  1N33 T;  2CM0 A;  3AE4 A;  1XZY A;  1LVK A;  5FY7 A;  4ANJ A;  1YW0 A;  2VKD A;  2ZM0 A;  4LF6 T;  1S94 A;  4KHP T;  3UU4 A;  2MAW A;  1WYC A;  4YT0 A;  5CA1 E;  2A3D A;  4U31 A;  3AE7 A;  3X1D A;  2WDR A;  2FBW A;  5L4E A;  5FVL A;  3HKE E;  5J2T E;  2CBJ A;  3ANW B;  2BG9 C;  3P7I A;  2BG9 A;  2LKH A;  3UQ4 A;  2F4V T;  1J5E T;  4JI6 T;  2V5C A;  3M65 A;  3ZMT B;  4ERR A;  5FMN A;  2B76 A;  2BS3 A;  3ZT5 A;  3AEF A;  2W67 A;  5IHY A;  3A7M A;  4ZI3 D;  2WB5 A;  5AQN B;  4NXM T;  2BS2 A;  4DMV A;  1BR0 A;  1YD8 G;  1T8B A;  4JI7 T;  4HFH A;  4ILB A;  1XNQ T;  3VKH A;  3JAF A;  4DO0 A;  4KP3 C;  5L47 A;  2NTX A;  1UK5 A;  5HWY A;  4CQI A;  1UGO A;  1UCU A;  2XM2 A;  4EAH A;  4UV9 B;  4QXC B;  2D2S A;  3FHN A;  3ZMV B;  1T7S A;  4I43 B;  3IF8 B;  3UUL A;  2VL0 A;  2L3L A;  2DHR A;  4JI5 T;  1YKH B;  2JIW A;  2CLY B;  3UUM A;  4GYR A;  5HEG A;  2ACZ A;  5ABF B;  4OYK A;  3L3P A;  3MK7 C;  2WMO A;  3P4W A;  2V7K A;  3MKD A;  4CI2 B;  3AA0 B;  3C50 A;  1BR2 A;  4HFC A;  4BJM A;  1FJG T;  5FVK A;  2PFV A;  4DR5 T;  2DL1 A;  2VL8 A;  1HX8 A;  2YDS A;  2KWI B;  1MIY A;  1J1J A;  1YXR A;  4LF7 T;  3C4W A;  2W0G A;  4MAL A;  1QSD A;  3AE6 A;  2Q9Q B;  2X67 A;  2A72 A;  3KV6 A;  2IC6 A;  4YY3 T;  3KV9 A;  3PUA A;  3T1Y T;  3SWH A;  3WAJ A;  2DWG A;  4P1N A;  4EGW A;  3PUQ A;  3B57 A;  3RYI E;  5L3E B;  2PBI A;  4I4T E;  4NUU A;  3C64 A;  3RQU A;  2DNX A;  4HWF A;  2JQK A;  4BJN A;  1HG5 A;  2WWU A;  1M7K A;  1YQ3 A;  4CXY A;  4IL4 A;  2FJB A;  3ZKR A;  3PU8 A;  4MBQ A;  5HXE A;  3GWH A;  4EZ4 A;  5LYJ E;  3FZM B;  4U7I A;  2UXD T;  2DI4 A;  2LM9 A;  2YU1 A;  5HEJ A;  2MPK A;  1WCR A;  2UU9 T;  1N32 T;  4LF5 T;  4ILU A;  4OK0 A;  1HFA A;  2MTQ A;  1HNW T;  1KFY A;  2CHN A;  3ONJ A;  4WYV A;  3CQX C;  4AQG A;  1QLB A;  5AQF B;  4U74 A;  2YOE A;  5LG4 A;  3IEE A;  1JNZ A;  2H7V C;  4E7S A;  4IDO A;  4YTP A;  2BKO A;  3RC3 A;  2RA1 A;  5FL1 A;  2BKN A;  2X0Y A;  3BQI A;  1N36 T;  2UUA T;  1T72 A;  4ZZC A;  1IJ6 A;  2BZB A;  4DR1 T;  4CN4 A;  3TLV A;  4A98 A;  2WU5 A;  3BK9 A;  4KUM B;  1J5W A;  5DQW A;  1WR6 A;  3GMI A;  4HFE A;  5J1G A;  1MMA A;  3LJC A;  2E9X B;  3UFG A;  1H7C A;  2KZ7 B;  2MYS A;  5AFU L;  4IHJ E;  5BR8 T;  3H3M A;  2CXL A;  3I0Q A;  2LRL A;  4TV9 E;  4EXT A;  2CBI A;  2XAQ B;  2BVL A;  3SFE A;  5LHI B;  1D0Z A;  2YDQ A;  3AE1 A;  5ADX L;  4XAX B;  1R8I A;  2AXD S;  2V6Y B;  4WBO A;  5AQJ B;  3J9X 1;  5JRC A;  1VCT A;  4H9R C;  2EHO D;  2LLY A;  3PUS A;  4UEL A;  4CXW A;  3UTK A;  2EHO C;  3VR9 A;  2WMN A;  2WY2 A;  2VKH A;  2XQA A;  2Q9Q A;  3VR8 A;  2X9W A;  2LSI A;  4EYU A;  1XDP A;  4B3M T;  3ZYM A;  2Y6X A;  5DAB A;  4Z91 A;  4TNV A;  3C4X A;  5AQR B;  2XAS B;  4KI0 F;  2V7I A;  5AQP B;  3AEB A;  5KDM C;  4DR7 T;  1OED B;  1MIW A;  4X64 T;  3PU3 A;  4GOU A;  3C51 A;  4U7Y A;  4JV5 T;  2XAJ B;  1MMD A;  3FXD B;  1VOM A;  1XNR T;  2D0U A;  3F2E A;  3SOL A;  1HF8 A;  4DND A;  3FBZ A;  2C0S A;  4GYS A;  3NWI A;  4FJO A;  3QNU A;  2XZE A;  5CGM A;  4WW0 A;  4EED A;  4COF A;  3DTO A;  3L39 A;  5EK3 A;  2L9Q A;  2K5B B;  3DJB A;  2XQ6 A;  2ACX A;  3OYZ A;  5EZY E;  4X62 T;  3AXJ A;  4GK0 E;  5AQI B;  2M6B A;  4PJL A;  5HXS A;  2YKS A;  4GK5 E;  2BG9 B;  2NW9 A;  4TNW A;  3AA1 B;  3FZL B;  4K0U A;  3RIA A;  2WZH A;  2BS4 A;  3ZJ1 A;  4PK6 A;  3RI5 A;  2UUB T;  2IW5 B;  4GKJ T;  2ZLY A;  3RLF F;  1UUS A;  2I59 A;  4ILC A;  4HWH A;  1N34 T;  2NW7 A;  4OFZ A;  3ZN0 B;  4KMC A;  3JC6 C;  4B3R T;  1UUR A;  3RYC E;  3OBV E;  2XAF B;  4LFC T;  4HN9 A;  2X51 A;  2QGS A;  5LB7 B;  2IUB A;  5HXC A;  4TWH A;  3OVU A;  5LNK A;  4YJ3 E;  3LFM A;  4QX7 B;  5FL0 A;  4UVC B;  2WCA A;  1I6Z A;  3ZYK A;  5HXR A;  4YSZ A;  2J62 A;  1I94 T;  2LHN A;  4UF0 A;  3P8C D;  1BR1 A;  2V7L A;  2W2U A;  5TAO A;  3O1I A;  4YJ2 E;  1YKE B;  3BQL A;  3I9Y A;  4A56 A;  5EK2 A;  5AQH B;  2YIN A;  4L5G A;  3E22 E;  4HTE A;  3KVB A;  2H3R A;  2C5I T;  2I0M A;  1D1C A;  2H89 A;  1NEN A;  1SUM B;  1UX4 A;  2ZMA A;  4HFV A;  2LEH A;  3Q9D A;  1KNP A;  3VRB A;  3LSV A;  3UUN A;  3NRY A;  1GQE A;  3RC8 A;  4QXH B;  3VRA A;  5F3J A;  1G8X A;  4EV6 A;  5C2T A;  4FI5 A;  2LT3 A;  2M67 A;  3UQ7 A;  4ISS A;  4H9S E;  4O8S A;  2WWV A;  4CZZ B;  3P4Q A;  2QRX A;  4IRE A;  3CKD A;  3PUX F;  5AQQ B;  1W09 A;  1W9R A;  5J2U E;  2JMH A;  5L3G B;  3AB3 B;  2LOP A;  2V7M A;  2K3W A;  3OYX A;  3AA6 B;  4JBW F;  5DJQ C;  2CWY A;  4DR3 T;  2VVS A;  2XSA A;  3PUZ F;  2J4G A;  2V6X A;  2E8I A;  2FJE A;  3PUY F;  4N78 D;  3B5M A;  4DUY T;  4ZI3 C;  3S4U A;  3UU5 A;  4JI1 T;  4JI0 T;  3CVR A;  4UV8 B;  1V9D A;  2V7J A;  4O4J E;  2BDE A;  4AKI A;  3F57 A;  2A2F X;  3N9M A;  3ZCJ A;  1D1A A;  2XAG B;  3AEE A;  2H7O A;  1HX1 B;  4TZ4 C;  4GIW A;  3ZST A;  5LXT E;  3KFW X;  4IDN A;  5CA0 E;  3LBX A;  3QB5 A;  3AE5 A;  3RYH E;  1B7T A;  4DBR A;  4AXP A;  3NRX A;  5IWA T;  4YTM A;  2W66 A;  3ONL C;  1CHU A;  3B13 A;  3RF1 A;  3UU8 A;  5A1L A;  4QXB B;  4HFD A;  1KK7 A;  2WP9 A;  3I0O A;  2WDQ A;  4XBF B;  1OWA A;  5LJM A;  4NIQ A;  2ZM2 A;  2KLQ A;  4ADZ A;  2V26 A;  4WNK A;  3N9P A;  4DV0 T;  1LRZ A;  4JYA T;  2WS3 A;  2X66 A;  3ETV A;  3AVS A;  2VVN A;  2WSS V;  5CFB A;  3EI0 A;  4O2A E;  5JRC B;  3UU6 A;  4YSX A;  2UXC T;  2CRB A;  4IT4 A;  5L3D B;  2NTY A;  4TWD A;  3EHZ A;  1IBL T;  3OKQ A;  1LKX A;  4AKR B;  4DR6 T;  3AE9 A;  2JRK A;  5EK4 A;  1T98 A;  1ZHC A;  3RRC A;  1Y01 A;  3ZLI A;  3TKL B;  3EDV A;  2C5K T;  3C98 B;  2BKP A;  4IGU A;  3U78 A;  5IUX A;  2B1E A;  2CA5 A;  2UXB T;  4X66 T;  3J7Y q;  3FXE B;  5AQG B;  2IAK A;  4DR4 T;  2MBG A;  4LFB T;  5JRE A;  3O9X A;  3GN5 A;  1HTJ F;  3N9L A;  1EZ3 A;  2KXP B;  5E0O A;  2KMF A;  4L9I A;  1MIV A;  2JJ9 A;  5KMG P;  3E0Z A;  5HAX A;  2XQ3 A;  3AXJ B;  1WYB A;  4YHH T;  3FB2 A;  3FBL A;  4IIJ E;  3OJA A;  4Z90 A;  3AAI A;  2IIU A;  2H88 A;  4NXN T;  4H9Q C;  3G06 A;  1Z8U A;  2CCQ A;  3N9Q A;  4QH4 A;  3ZT7 A;  4AKL A;  2C5J A;  2UXN B;  4BA9 A;  5AQL B;  3ETU A;  2L8K A;  4G63 A;  5AQS B;  2K9A A;  2ODV A;  2YK0 A;  3K1S A;  3LG7 A;  4F6R C;  2FUP A;  1U4Q A;  4YXD A;  4WBN E;  3ZMS B;  2KT9 A;  5LBQ B;  4DV5 T;  4ZI7 E;  4H9P C;  4H9O C;  2HHH T;  2VKJ A;  3Q5D A;  4A97 A;  5IYZ E;  2HPL A;  4JI4 T;  4JI8 T;  4DV6 T;  5AQV B;  1XMO T;  4IDZ A;  2IDO B;  5FYM A;  1BR4 A;  4IST A;  2I6H A;  5JQG E;  4E7Z A;  5AQO B;  2D0T A;  2FJA A;  3HI2 A;  4JUY A;  4F8H A;  1QUU A;  2VUR A;  3H3A A;  4UF0 B;  3QB5 K;  5DQV A;  1SHZ C;  2LSJ A;  1XDO A;  3EUH A;  3O1J A;  2EHO A;  5LP6 E;  4I55 E;  4ASK A;  5AQM B;  1FEW A;  1NWM X;  4X1I E;  4OHF A;  1CUN A;  2XHE B;  3O4X E;  1Z0P A;  1US7 B;  5CB4 E;  5L3F B;  3H37 A;  4ZXL A;  4OX9 T;  3Q5X A;  3CPZ A;  3JCF A;  1KNZ A;  3HKD E;  1IAP A;  4IE7 A;  3ABV A;  4M1P A;  4CXX A;  4IE0 A;  4L0R A;  3I9W A;  4DV3 T;  2XY8 B;  1HNZ T;  5LBM A;  5AQK B;  3CIR A;  3R84 B;  4WZX A;  1HG2 A;  3RKG A;  3L09 A;  4B3T T;  5FY1 A;  4U2Z A;  2XUE A;  4JEH B;  2VB6 A;  2KIN B;  2IHR 1;  3MXZ A;  3CX6 B;  4B6X A;  5FY0 A;  4B3S T;  3AAA B;  3ZMU B;  4DR2 T;  1E2A A;  2CEA A;  3AAE B;  1X9B A;  2KSR A;  2LKG A;  2LM2 A;  3CK6 A;  2WZI A;  2Y8D A;  3WI3 A;  3ZSS A;  1SE7 A;  2IC9 A;  2K48 A;  3Q2M A;  2CXD A;  4C90 A;  5JDN A;  3D0T A;  3KIN B;  1ZP0 A;  1ZV4 X;  3CX8 B;  4UR9 A;  4QHO A;  3A5X A;  3AE8 A;  2DLR A;  3BQK A;  3K3N A;  3R6N A;  1VRB A;  4HGA A;  2JPF A;  3NVO A;  3ZC1 A;  4CN6 A;  2E5V A;  2E9X D;  3LBX B;  4KX6 A;  2XPK A;  4KHZ F;  2N1G A;  4JI2 T;  3HKC E;  3NZQ A;  2XQ4 A;  4ZHQ E;  3RRW A;  4EOZ B;  3PE0 A;  5KX5 E;  3RH3 A;  2LRK A;  2JQH A;  1MMN A;  4X1K E;  3ZCI A;  1XMQ T;  1HNX T;  3HR0 A;  2LE8 A;  3MA9 A;  3CX7 B;  4ZS3 A;  5LGU B;  3LK3 B;  2XM1 A;  4I0U A;  2V1D B;  2PTF A;  1O3X A;  2SPC A;  2X9H A;  3ONX A;  4LML A;  4QH5 A;  1KNR A;  4YLH A;  2YU2 A;  1W0A A;  3RIF A;  4NUV A;  5JR9 C;  3V5U A;  2YN6 A;  5JR9 A;  4DV4 T;  5FXW A;  4HKA A;  2WU2 A;  4H63 H;  2J1D G;  2PJQ A;  4H9N C;  5LHH B;  2CMR A;  2X68 A;  2QYW A;  3PDY A;  4P0B A;  4YFS A;  4AKG A;  3L8R A;  2HN1 A;  3RIU C;  3O1H A;  2Y48 B;  3RIU A;  3SFD A;  1KF6 A;  2QA7 A;  2XJ7 A;  3AVR A;  3ZJ2 A;  4IE4 A;  3PUV F;  5L4H A;  4AKH A;  3ZC0 A;  2W00 A;  1W0B A;  3K3Q C;  3U3I A;  4I50 E;  3UU3 A;  5LMN T;  3ZEF B;  4MFR A;  4LF9 T;  3GN5 B;  4TN7 B;  3UT5 E;  3N2K E;  5H6Q B;  3JAE A;  3ZYL A;  5AQT B;  3RHW A;  3PJA J;  4QX8 B;  5ETW A;  4U72 A;  3EDU A;  4CI3 B;  4UVB B;  4HE8 A;  3N2O A;  3FZH B;  2QVA A;  2NWB A;  4NPP A;  3GA8 A;  1OXZ A;  4X20 E;  3UUX B;  4ILA A;  4J2C A;  5F8P A;  3PUR A;  1NAF A;  3EAM A;  3EAB A;  5HXH A;  4PK4 A;  3SS1 A;  2Z6E A;  1IZN B;  2MOZ A;  3KV5 A;  2P9B A;  4DBQ A;  2HH7 A;  4X1Y E;  4HWI B;  4UEM A;  3UUB A;  5HWX A;  5CJ5 A;  2E5L T;  4MLK A;  1G73 A;  4LMK A;  5HEO A;  1MNE A;  3VHL A;  3CML A;  3N9N A;  2CXF A;  4YSY A;  3T8O A;  5LG3 A;  3LK2 B;  2ODU A;  2LHR A;  4X65 T;  2YDR A;  4ZZB A;  3QK6 A;  4LF4 T;  2CPT A;  4HFI A;  3EVY A;  3N5L A;  3VU7 H;  3KDS E;  4PAG A;  4V1A v;  4AQF C;  2D5U A;  2D9D A;  4TWF A;  4AQF A;  2M6I A;  3RKO A;  1WFD A;  4TV8 E;  2XSB A;  3NKZ A;  1OED E;  2K24 A;  3NBX X;  2ES0 A;  2W4X A;  5GON E;  3PJA A;  2KWH A;  2X9Y A;  2X0L B;  2EHO B;  3A8Y C;  4AQY T;  4JEU B;  3T1H T;  2IML A;  3N9O A;  5JDQ A;  2LJL A;  2XQ7 A;  4IL9 A;  4O4L E;  3N2G E;  1KEY A;  5FKY A;  3P4P A;  5HEU A;  1HCI A;  4QH1 A;  3AEA A;  4P0A A;  1ZKE A;  1FIO A;  2W61 A;  4DV7 T;  5JDF A;  3RYF E;  2BG9 E;  2LSY A;  4DID B;  4DV2 T;  1AJ3 A;  5LA6 E;  1HR0 T;  2KND A;  1NEK A;  2WDV A;  4EYY R;  3UFE A;  5C3J A;  4IE5 A;  1ZOY A;  2E2A A;  3KBT A;  2AE9 A;  4PFO A;  2W62 A;  2DCF A;  3TLT A;  1WRD A;  5C8Y E;  3ANW A;  4UVA B;  1D0Y A;  2ZM6 T;  3HL6 A;  2XAH B;  1MND A;  4EEB A;  4G2A A;  4HFB A;  2V8S V;  4PW8 A;  4ZI2 D;  4O2B E;  2NW8 A;  1JNR A;  2NOX A;  5JDH A;  3CQC B;  4IDQ A;  3ZN1 B;  4ZI2 C;  2DWK A;  1IJ5 A;  3P50 A;  3ZPO A;  4PK5 A;  5ABG A;  1YQ4 A;  5JVD E;  2A9U A;  4XZC A;  3PUG A;  3QOF A;  5JTG A;  5HYA A;  3LDQ B;  3AEG A;  1ZEE A;  2CE7 A;  4YHJ A;  5LMU T;  4HEA A;  1IBM T;  4Q25 A;  5JH7 E;  3PV0 F;  5L3B B;  4EB6 E;  3F31 A;  2XQY A;  4LF8 T;  4O4I E;  2VQE T;  4PJJ A;  5FXV A;  3I1A A;  5H6R B;  4ZS2 A;  2OA5 A;  4EIW A;  4O4H E;  3CWZ B;  2OV9 A;  4C91 A;  2CLY C;  1DU2 A;  5ABF A;  4H63 V;  3IA3 A;  4PJN A;  3KVA A;  4CN1 A;  3TLU A;  2UXX B;  1Y64 B;  4PJM A;  2BBH A;  3FZF B;  5L2L A;  2JQQ A;  3FZK B;  2GK9 A;  5FXZ A;  5JDG A;  2LSG A;  5FP3 A;  4A5X A;  1D1B A;  2WAU A;  4UXN B;  1IBK T;  2PG8 A;  4QWN B;  2VQF T;  4AIU A;  1LVF A;  4TUY E;  2Q9Q D;  1X79 A;  1FMW A;  3DP7 A;  3QC9 A;  2JMK A;  5HCM A;  1SA0 E;  2NR4 A;  2V5D A;  2BVM A;  3LK4 2;  2Q9Q C;  3OPC A;  5ABE A;  3PUW F;  4IE6 A;  1WR0 A;  3RPU A;  4U3C A;  3ZMZ B;  3Q5W A;  5J0Z A;  5JR9 B;  4YTN A;  3RQW A;  2W63 A;  2WQY A;  3AEC A;  4DVD A;  3P4R A;  1MMG A;  2XQ5 A;  5FXX A;  3AED A;  2N2N A;  4BAY B;  2OLT A;  3QUJ A;  3RX6 A;  5M4Y A;  5HEH A;  3VKG A;  4AIS A;  2G0U A;  5ABH A;  3IBP A;  3JAD A;  2UUC T;  3HA4 A;  2J47 A;  3MAC A;  2XQ9 A;  5F5W A;  4DV1 T;  3WAK A;  4ZOL E;  4LMJ A;  2VKO A;  1D0X A;  3IHR A;  5AQU B;  4QKN A;  1UX5 A;  5LGT B;  2VWA A;  2FJD A;  2WM9 A;  1WLX A;  2XQ8 A;  4PNI A;  5KXJ A;  2CHO A;  4DMW A;  2VK9 A;  5LGN B;  3HKB E;  4HWD A;  2NP9 A;  3JC6 D;  3KV4 A;  2LSK A;  1M62 A;  2N9D A;  2ZM8 A;  3SRZ A;  3K8P C;  3RGL A;  3W15 B;  5JDL A;  1VCS A;  2E9X C;  2E9X A;  4PFP A;  4AI6 A;  5L3C B;  2HPJ A;  3C4Z A;  3NZP A;  4Z8X A;  1L0V A;  4UIG A;  2JQ9 A;  2RPA A;  4GKK T;  1XWM A;  4K0K T;  2RP4 A;  3MJX A;  3ESL A;  3AE3 A;  4DUZ T;  2XTL A;  4U2Y A;  2YEV C;  4U33 A;  5BMV E;  5LHG B;  5LCY A;  3ZT6 A;  3V5S A;  2HN2 A;  2WBL A;  5HCJ A;  3P4S A;  3PTR B;  2V6Y A;  3MZK B;  4MHC A;  3AA7 B;  4JI3 T;  3CQG B;  4EZH A;  5JDM A;  4HWC A;  4LFA T;  2X9X A;  4JLE A;  2BBJ A;  1E7P A;  2LOS A;  4P09 A;  2R6G F;  5LOV E;  3OTO T;  4IDP A;  1E1H B;  2X0H A;  4KBM B;  3AE2 A;  3TLW A;  1FMV A;  2CWO A;  4CI1 B;  1S35 A;  3Q5E A; 
#chains in the Genus database with same CATH homology
 3KBU A;  3E08 A;  3N9Q A;  3T8O A;  3LK2 B;  3DTO A;  2ODU A;  2LHR A;  4TX5 A;  5EK3 A;  4AKL A;  2C5J A;  2UXN B;  5LJN A;  2VAS A;  2L9Q A;  4BA9 A;  2K5B B;  3QK6 A;  3DJB A;  3ETU A;  2L8K A;  4G63 A;  2K9A A;  3EVY A;  2ODV A;  2YK0 A;  5FNV E;  1HS7 A;  3LG7 A;  2ACX A;  3N5L A;  3OYZ A;  3K3O A;  5EZY E;  4F6R C;  1U4Q A;  3VU7 H;  4WBN E;  3KDS E;  4GK0 E;  4PAG A;  4OYJ A;  4V1A v;  3ZMS B;  4AQF C;  2KT9 A;  2D5U A;  4PJL A;  4AQF A;  5LBQ B;  1U5P A;  5HXS A;  2CM0 A;  3RKO A;  5FY7 A;  1LVK A;  4ANJ A;  4GK5 E;  1YW0 A;  4ZI7 E;  2VKD A;  4TV8 E;  2ZM0 A;  4H9P C;  2NW9 A;  3AA1 B;  4H9O C;  2K24 A;  1S94 A;  2ES0 A;  3NBX X;  2VKJ A;  5GON E;  4K0U A;  1WYC A;  3ZJ1 A;  2KWH A;  2X9Y A;  4PK6 A;  2X0L B;  5IYZ E;  2EHO B;  5CA1 E;  2IW5 B;  2HPL A;  4JEU B;  2A3D A;  2ZLY A;  3N9O A;  5JDQ A;  2LJL A;  4O4L E;  3N2G E;  4IDZ A;  2I59 A;  5FYM A;  2NW7 A;  4OFZ A;  3HKE E;  1BR4 A;  1HCI A;  4IST A;  5JQG E;  5J2T E;  4E7Z A;  3ZN0 B;  2D0T A;  4KMC A;  4P0A A;  3JC6 C;  1ZKE A;  3RYC E;  3ANW B;  3P7I A;  3HI2 A;  3OBV E;  4JUY A;  1FIO A;  2W61 A;  2XAF B;  1QUU A;  3H3A A;  4UF0 B;  5JDF A;  3M65 A;  4ERR A;  3ZMT B;  4HN9 A;  5FMN A;  3RYF E;  2X51 A;  2QGS A;  5DQV A;  5HXC A;  1SHZ C;  2LSJ A;  5LNK A;  2LSY A;  3EUH A;  3O1J A;  2EHO A;  5IHY A;  5LP6 E;  4I55 E;  4YJ3 E;  4ASK A;  1AJ3 A;  5LA6 E;  1FEW A;  4ZI3 D;  3LFM A;  4QX7 B;  1NWM X;  2KND A;  4EYY R;  3UFE A;  4UVC B;  4X1I E;  4IE5 A;  4OHF A;  4DMV A;  1BR0 A;  1CUN A;  1YD8 G;  2XHE B;  3O4X E;  1Z0P A;  3KBT A;  4PFO A;  1US7 B;  2W62 A;  5CB4 E;  3ZYK A;  2DCF A;  5L3F B;  3VKH A;  3H37 A;  1WRD A;  5C8Y E;  4DO0 A;  4KP3 C;  5HXR A;  3ANW A;  3Q5X A;  2LHN A;  3CPZ A;  4UF0 A;  3P8C D;  4UVA B;  1D0Y A;  3HL6 A;  1BR1 A;  2XAH B;  3HKD E;  2V7L A;  1MND A;  1KNZ A;  1IAP A;  5TAO A;  3O1I A;  2NTX A;  4IE7 A;  4G2A A;  4YJ2 E;  5HWY A;  4CQI A;  4M1P A;  1UCU A;  1YKE B;  3BQL A;  4CXX A;  4EAH A;  3I9Y A;  4PW8 A;  4IE0 A;  4ZI2 D;  4L0R A;  4A56 A;  4UV9 B;  4O2B E;  4QXC B;  3I9W A;  5EK2 A;  2NW8 A;  2D2S A;  2NOX A;  5JDH A;  3CQC B;  3FHN A;  3ZN1 B;  2YIN A;  4ZI2 C;  2DWK A;  3ZMV B;  1IJ5 A;  4L5G A;  4I43 B;  3E22 E;  3IF8 B;  4HTE A;  3UUL A;  3KVB A;  2H3R A;  2C5I T;  1D1C A;  2L3L A;  3ZPO A;  4PK5 A;  1UX4 A;  4HFV A;  2ZMA A;  2DHR A;  5LBM A;  2LEH A;  1YKH B;  3Q9D A;  5JVD E;  3R84 B;  4XZC A;  1HG2 A;  2CLY B;  3UUM A;  3PUG A;  3L09 A;  4GYR A;  5HYA A;  5FY1 A;  2XUE A;  3NRY A;  3UUN A;  4OYK A;  1ZEE A;  2CE7 A;  4YHJ A;  3RC8 A;  3L3P A;  3MK7 C;  4JEH B;  4QXH B;  2WMO A;  2VB6 A;  2V7K A;  3MKD A;  4HEA A;  5F3J A;  4CI2 B;  2KIN B;  3AA0 B;  5JH7 E;  1G8X A;  3C50 A;  3MXZ A;  1BR2 A;  3CX6 B;  4B6X A;  5L3B B;  5FY0 A;  4EB6 E;  3F31 A;  4BJM A;  2XQY A;  4FI5 A;  2LT3 A;  3AAA B;  3ZMU B;  2M67 A;  4O4I E;  4ISS A;  4PJJ A;  2PFV A;  5FXV A;  2CEA A;  3AAE B;  4H9S E;  3I1A A;  4O8S A;  2VL8 A;  4CZZ B;  5H6R B;  1HX8 A;  2KWI B;  4ZS2 A;  2OA5 A;  1MIY A;  4EIW A;  4O4H E;  3CWZ B;  4C91 A;  2CLY C;  2Y8D A;  3WI3 A;  3C4W A;  2W0G A;  3CKD A;  2IC9 A;  4H63 V;  4MAL A;  1QSD A;  2K48 A;  4PJN A;  3KVA A;  3Q2M A;  2Q9Q B;  5J2U E;  2JMH A;  2X67 A;  2A72 A;  2UXX B;  1Y64 B;  3KV6 A;  2IC6 A;  2CXD A;  4PJM A;  4C90 A;  5JDN A;  5L3G B;  3KV9 A;  3D0T A;  3KIN B;  1ZV4 X;  3CX8 B;  3AB3 B;  2LOP A;  2V7M A;  3PUA A;  3SWH A;  2DWG A;  4QHO A;  3WAJ A;  5L2L A;  3A5X A;  3OYX A;  2JQQ A;  3BQK A;  2DLR A;  2GK9 A;  3K3N A;  5FXZ A;  3R6N A;  5JDG A;  3AA6 B;  1VRB A;  3B57 A;  3PUQ A;  2JPF A;  4HGA A;  3ZC1 A;  5DJQ C;  3RYI E;  2CWY A;  5L3E B;  2LSG A;  2PBI A;  2E9X D;  5FP3 A;  3LBX B;  4I4T E;  1D1B A;  2WAU A;  4UXN B;  2E8I A;  2PG8 A;  2N1G A;  4QWN B;  4N78 D;  4NUU A;  3HKC E;  1LVF A;  3NZQ A;  4ZI3 C;  4TUY E;  3C64 A;  3S4U A;  2Q9Q D;  1X79 A;  1FMW A;  3DP7 A;  3QC9 A;  3RRW A;  2JMK A;  4ZHQ E;  2DNX A;  1SA0 E;  3CVR A;  4UV8 B;  4BJN A;  1HG5 A;  4EOZ B;  2WWU A;  2BVM A;  1V9D A;  3LK4 2;  2V7J A;  4O4J E;  2Q9Q C;  2BDE A;  3PE0 A;  5KX5 E;  3RH3 A;  4AKI A;  3F57 A;  4CXY A;  1MMN A;  4X1K E;  3ZCI A;  4IE6 A;  3RPU A;  2A2F X;  3N9M A;  3PU8 A;  3HR0 A;  4MBQ A;  3ZCJ A;  5HXE A;  1D1A A;  2LE8 A;  3MA9 A;  3GWH A;  2XAG B;  4EZ4 A;  5LYJ E;  2H7O A;  2DI4 A;  3ZMZ B;  3CX7 B;  3Q5W A;  4ZS3 A;  5LGU B;  5JR9 B;  2LM9 A;  4TZ4 C;  2YU1 A;  4GIW A;  2W63 A;  3LK3 B;  5LXT E;  3KFW X;  5CA0 E;  3LBX A;  4DVD A;  3RYH E;  4ILU A;  4OK0 A;  2V1D B;  1HFA A;  1B7T A;  4DBR A;  4AXP A;  1MMG A;  2MTQ A;  3NRX A;  5FXX A;  1O3X A;  2SPC A;  2X9H A;  3B13 A;  3CQX C;  3ONX A;  4AQG A;  2N2N A;  4BAY B;  4U74 A;  3QUJ A;  4YLH A;  3RX6 A;  5M4Y A;  5LG4 A;  5A1L A;  4QXB B;  3VKG A;  2YU2 A;  3IEE A;  1KK7 A;  2H7V C;  4NUV A;  4E7S A;  3I0O A;  2G0U A;  4XBF B;  1OWA A;  5LJM A;  5JR9 C;  2ZM2 A;  3IBP A;  2KLQ A;  2RA1 A;  3RC3 A;  3V5U A;  5JR9 A;  3BQI A;  5FXW A;  4HKA A;  4ADZ A;  2V26 A;  4H63 H;  4WNK A;  2J1D G;  3HA4 A;  2PJQ A;  4H9N C;  3N9P A;  5LHH B;  2CMR A;  2X68 A;  1LRZ A;  3PDY A;  1IJ6 A;  2BZB A;  3MAC A;  2X66 A;  3ETV A;  4P0B A;  4YFS A;  3WAK A;  3AVS A;  3BK9 A;  4KUM B;  4ZOL E;  4AKG A;  2WSS V;  2VKO A;  1D0X A;  5DQW A;  1WR6 A;  3IHR A;  3GMI A;  3O1H A;  4O2A E;  2Y48 B;  5J1G A;  5JRC B;  1MMA A;  3LJC A;  2E9X B;  4QKN A;  2QA7 A;  1UX5 A;  3AVR A;  3ZJ2 A;  1H7C A;  4IE4 A;  5L3D B;  5LGT B;  2VWA A;  4AKH A;  2KZ7 B;  2NTY A;  3ZC0 A;  2WM9 A;  1WLX A;  2MYS A;  2W00 A;  4PNI A;  5AFU L;  3K3Q C;  4IHJ E;  3U3I A;  4I50 E;  2CXL A;  4DMW A;  2VK9 A;  3OKQ A;  1LKX A;  4AKR B;  5LGN B;  3I0Q A;  2JRK A;  4TV9 E;  3ZEF B;  4EXT A;  4MFR A;  5EK4 A;  3GN5 B;  3HKB E;  1T98 A;  1ZHC A;  4TN7 B;  2NP9 A;  2XAQ B;  3JC6 D;  2BVL A;  3KV4 A;  2LSK A;  3RRC A;  3ZLI A;  3UT5 E;  2N9D A;  3TKL B;  2ZM8 A;  5LHI B;  1D0Z A;  3SRZ A;  3N2K E;  3K8P C;  5ADX L;  5H6Q B;  3W15 B;  3EDV A;  5JDL A;  4XAX B;  4WBO A;  2C5K T;  3J9X 1;  3ZYL A;  5JRC A;  2E9X C;  4H9R C;  2E9X A;  2EHO D;  4PFP A;  4AI6 A;  5L3C B;  3PUS A;  2HPJ A;  3C4Z A;  3C98 B;  4UEL A;  4IGU A;  3NZP A;  4Z8X A;  3U78 A;  4CXW A;  4QX8 B;  4UIG A;  3UTK A;  5ETW A;  2EHO C;  4U72 A;  3EDU A;  4CI3 B;  2B1E A;  2CA5 A;  4UVB B;  2WMN A;  4HE8 A;  3J7Y q;  3N2O A;  2VKH A;  2Q9Q A;  2X9W A;  2NWB A;  2LSI A;  3FXE B;  2IAK A;  4EYU A;  2RP4 A;  3GA8 A;  1OXZ A;  3MJX A;  2MBG A;  3ESL A;  4WW0 A;  4X20 E;  3UUX B;  4J2C A;  2XTL A;  5F8P A;  5JRE A;  2YEV C;  3GN5 A;  1HTJ F;  5BMV E;  5LHG B;  3O9X A;  3ZYM A;  2Y6X A;  3N9L A;  5DAB A;  3PUR A;  1EZ3 A;  5LCY A;  1NAF A;  2KXP B;  5E0O A;  2KMF A;  4L9I A;  3V5S A;  1MIV A;  3C4X A;  2JJ9 A;  5KMG P;  2WBL A;  2XAS B;  4PK4 A;  5HXH A;  3E0Z A;  3SS1 A;  5HAX A;  2Z6E A;  2V7I A;  3PTR B;  3MZK B;  4MHC A;  3AA7 B;  1WYB A;  3CQG B;  1IZN B;  4EZH A;  2MOZ A;  5JDM A;  5KDM C;  3KV5 A;  2P9B A;  2X9X A;  4DBQ A;  1MIW A;  3FB2 A;  3PU3 A;  4GOU A;  4JLE A;  3FBL A;  3C51 A;  2LOS A;  2HH7 A;  4X1Y E;  2XAJ B;  1MMD A;  4IIJ E;  4P09 A;  3OJA A;  3FXD B;  1VOM A;  4UEM A;  5LOV E;  1E1H B;  3AAI A;  4KBM B;  5HWX A;  1FMV A;  2D0U A;  3F2E A;  4H9Q C;  3SOL A;  2CWO A;  4MLK A;  1G73 A;  1HF8 A;  1MNE A;  4DND A;  3FBZ A;  2C0S A;  3VHL A;  4GYS A;  4CI1 B;  3CML A;  1S35 A;  3N9N A;  4FJO A;  2CXF A;  2CCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...