2KT9A

Solution nmr structure of probable 30s ribosomal protein psrp-3 (ycf65-like protein) from synechocystis sp. (strain pcc 6803), northeast structural genomics consortium target target sgr46
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
MAASTVHTSFILKVLWLDQNVAIAVDQIVGKGTSPLTSYFFWPRADAWQQLKDELEAKHWIAEADRINVLNQATEVINFWQDLKNQNKQISMAEAQGKFPEVVFSGSNLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of Probable 30S ribosomal protein PSRP-3 (Ycf65-like protein) from Synechocystis sp. (PCC 6803), Northeast Structural Genomics Consortium Target Target SgR46
rcsb
source organism Synechocystis sp.
molecule tags Ribosomal protein
molecule keywords Probable 30S ribosomal protein PSRP-3
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04839 PSRP-3_Ycf65 Plastid and cyanobacterial ribosomal protein (PSRP-3 / Ycf65)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.750 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kt9A01
2KT9A
chains in the Genus database with same CATH superfamily
5FY1A 4EV6A 2C0SA 5C8YE 2IIUA 3E22E 2CWYA 3I1AA 1OEDE 2QYWA 4IDOA 4JUYA 4JI2T 3VKGA 5LXTE 2DLRA 2QA7A 2VVSA 2WQYA 2XAHB 3AVSA 3CIRA 3EDVA 1HCIA 3X1DA 4U33A 2L8KA 5CB4E 2W4XA 4EIWA 3AEAA 2BS2A 3CPZA 2BDEA 3WI3A 4YSZA 4ZEYA 2KSRA 5AQPB 4CI1B 4ILAA 3UUNA 3ZSTA 5J2UE 4HWDA 2J4GA 1QUUA 4UELA 4AQYT 3PUVF 1IBLT 4U2YA 4UVBB 5AQHB 2XZEA 3UT5E 4IIJE 3ZT5A 2FBWA 4LMKA 3PU8A 4EB6E 2IC6A 2QVAA 5CA1E 5L3FB 5JVDE 4JI3T 3UFEA 4AQGA 3RGLA 5KXJA 1XNRT 3TLVA 4PJNA 3AECA 2JQQA 2LSYA 2E9XA 4JBWF 2LSKA 2XQ6A 2YEVC 4PFPA 5AQVB 4ISTA 2X51A 5LGTB 4C91A 3N2GE 4TX5A 4CN6A 2X0HA 1MNDA 1J1JA 1MMGA 1OEDA 3ZLIA 5A1LA 3AEEA 4LF7T 4GK5E 2MPKA 4PJMA 4UF0A 4X1YE 5KMGP 5J0ZA 4U2ZA 1E2AA 1XZYA 3DTOA 1CHUA 5FP3A 5J1GA 2E5VA 4X66T 2ACXA 2D9DA 3UTKA 2Y6XA 2BVMA 3AB3B 4JEHB 5JR9A 1I94T 3KV9A 2XSAA 2NOXA 3RC3A 1VOMA 2MOZA 4HWIB 3BK9A 4X20E 4QHOA 4IE4A 1D0XA 3B57A 5EK3A 3SOLA 3PUGA 3QK6A 5FXVA 4YJ3E 3R84B 1KNZA 4KHPT 1E7PA 2XJ7A 3AE6A 3HKDE 3LK2B 3Q9DA 3AA6B 2VKOA 3L8RA 3ZEFB 2JJ9A 4CZZB 5LG3A 4IE0A 4B3ST 3ONJA 3AVRA 2XQAA 2YU2A 3UUBA 1HTJF 1MIVA 1MMDA 3EABA 2KNDA 3EUHA 4I0UA 4YY3T 3PUWF 1T8BA 2PFVA 1CUNA 4XAXB 2VL0A 1UUSA 2QRXA 3OYZA 4PFOA 3ZYKA 4A5XA 4ERRA 5JREA 1XMOT 3HA4A 4X1IE 3K3QC 4Z8XA 2VWAA 4ZS3A 3NRYA 1LKXA 3A7MA 3AEDA 4UF0B 2D5UA 3MKDA 2MBGA 4IE5A 3ZKRA 3AE9A 4TV9E 3IHRA 1D1BA 1U4QA 4QKNA 4HWFA 2CA5A 4UIGA 3H3MA 5ETWA 1BR2A 2WU5A 4MFRA 1NWMX 3MK7C 3FZLB 4LMJA 3RYHE 1XDPA 3V5UA 2E9XB 2NP9A 2VK9A 2VASA 4LF5T 5LA6E 2NWBA 2LKHA 3FXEB 4MHCA 5AQFB 1ZHCA 3UULA 3RQWA 1MMAA 2A9UA 2EHOC 2XQ9A 3AXJB 3ETVA 4TNWA 5ABFB 2XM1A 2LE8A 2M67A 3NZPA 2KWIB 3C64A 2CHOA 3OBVE 4QH5A 1HFAA 2JQKA 3AE4A 5AQGB 3RRCA 3VHLA 5CGMA 4O4LE 2E9XD 1YKHB 4WYVA 3TLUA 1QSDA 2YINA 3KBUA 3ZN0B 4QXHB 4DMVA 4JI8T 2UXBT 1DU2A 2PTFA 3LFMA 4H9PC 1IBMT 1XWMA 4KBMB 4KI0F 2CXLA 5LNKA 3ANWB 3Q5EA 3PUYF 4ZOLE 3DJBA 4EXTA 4K0KT 4BAYB 2L3LA 2E2AA 2KINB 4U3CA 1XMQT 2J62A 2FJBA 1VCSA 4HFCA 4JLEA 5H6RB 3V5SA 2IDOB 3MZKB 4X65T 4ILBA 4B3MT 4DR4T 4NUUA 4DR6T 3L09A 3UU8A 3ZMUB 3CX6B 3HKCE 2MTQA 2RA1A 2V7LA 4MBQA 1M62A 2QGSA 1E1HB 2XASB 4WNKA 4CXXA 5L3GB 4I43B 4M1PA 4JI0T 4I50E 3KV6A 4ISSA 1KF6A 5HCJA 4LMLA 1L0VA 5ABHA 2B76A 2R6GF 2CLYB 2OA5A 2AE9A 3G06A 1Z8UA 3JCFA 3RI5A 4DNDA 1R8IA 2H89A 3OTOT 4X5TA 1KFYA 3P4RA 3ZC1A 3UQ4A 2JQ9A 3CMLA 5L3BB 4IDPA 4X64T 2YDSA 5AQTB 4GYSA 2WM9A 2P9BA 4DIDB 1O3XA 3CVRA 4OYJA 3FHNA 4J2CA 5LYJE 1J5WA 4DV2T 2BG9E 2CE7A 5LOVE 4DO0A 5FXWA 3LK42 4YTMA 4EEDA 1KNRA 5JQGE 5JR9B 4DVDA 1HG5A 4LFCT 3ZT7A 2YK0A 5AQLB 5JH7E 3UU3A 1S94A 2VB6A 2BKNA 3RIUC 4ZS2A 1D0ZA 4WBOA 3CQXC 3T8OA 3RF1A 3VR8A 5LJNA 1HR0T 2BG9A 2LLYA 2YDQA 4HN9A 1WLXA 5HEOA 3BQKA 3C4XA 1HF8A 2UUAT 4LFAT 1T7SA 2XUEA 4AIUA 5F5WA 2JMKA 3E0ZA 3RX6A 2D0UA 2XM2A 4YFSA 1Z0PA 3JAFA 5JTGA 2W62A 4P1NA 5LBQB 5EK2A 1ZOYA 2W2UA 1OXZA 4G63A 3C50A 1WYBA 4U7YA 2ZM0A 5LBMA 3PV0F 3OYXA 2V26A 5IUXA 2J47A 4Q25A 4ZI7E 3O1IA 2BBJA 4UVCB 2FJEA 2H3RA 2IMLA 3DP7A 4QH1A 2LOPA 3U78A 4DUYT 4HWCA 1QLBA 2WSSV 3AE5A 4PJJA 5ABGA 4HFVA 3LJCA 2N2NA 2DWGA 4HFBA 2YDRA 3RH3A 4G2AA 4IDNA 2FUPA 3SS1A 3EDUA 1SUMB 2V7KA 4HGAA 4GKJT 5F8PA 4I55E 3PUXF 2BS3A 4PK4A 4TZ4C 1X9BA 3GA8A 1MMNA 2WMNA 3EVYA 3P4QA 3FZFB 3GN5A 4YJ2E 1HX8A 4H63H 4CXWA 5LMUT 3ETUA 4DUZT 3TKLB 4KUMB 1FMWA 3RIAA 2J1DG 5AQOB 2ZM6T 5HXSA 2F4VT 3PURA 4GKKT 5AFUL 1UURA 1IBKT 2D0TA 4JV5T 2AXDS 3L39A 3FZMB 3NWIA 3IEEA 2I59A 3C51A 4XBFB 3OKQA 3J7Yq 3SFDA 2V6YB 5HCMA 1MIYA 1UGOA 5F3JA 2UXXB 2JQHA 3CK6A 3F2EA 3FXDB 4N78D 4O8SA 4ZXLA 2BVLA 4AQFA 4B3RT 2X0YA 4UEMA 1HG2A 2XQYA 4U72A 4TNVA 3I9YA 4TV8E 4X1KE 4E7SA 4CI3B 2ES0A 4YTPA 3VR9A 1XDOA 4V1Av 2WDVA 5JDHA 2SPCA 4P0BA 3J9X1 3IBPA 3PJAA 2X9XA 1BR4A 4YLHA 2IW5B 3KVBA 4YSXA 1N34T 4P0AA 2OV9A 2CWOA 2PJQA 2WDRA 3AE1A 4DV4T 1I6ZA 2WZIA 4I4TE 1WR6A 4NIQA 4DV5T 3N2KE 1KEYA 4IE6A 3AAEB 5L2LA 4XZCA 2K5BB 3ZN1B 5KDMC 4K0UA 3PUQA 2W61A 3FBZA 1YXRA 1B7TA 5LG4A 2LT3A 1Y64B 2XTLA 4DMWA 2WCAA 4DBQA 3RRWA 2WY2A 5DQWA 1HNZT 4AKHA 5AQQB 4YXDA 1NENA 4O4JE 4U31A 3PE0A 4LF9T 1IAPA 2W00A 4HWHA 4QWNB 4PK6A 4WBNE 2VL8A 5L47A 5JDNA 2YOEA 3OJAA 2HN1A 5LHHB 3FZKB 3EAMA 4HKAA 4OYKA 4YTNA 2LM2A 2CLYC 1ZKEA 2DL1A 2FJDA 4ASKA 4JI6T 3KV4A 1YKEB 1US7B 5CFBA 3WAJA 3PUAA 2B1EA 5AQMB 5HXRA 3TLWA 5C3JA 2JMHA 3MJXA 3IF8B 5L3EB 4DR5T 1IJ6A 2Y8DA 1EZ3A 2M6BA 3A8YC 3PUSA 4ZI2D 1FJGT 4OFZA 2Q9QB 4F6RC 2BZBA 3MXZA 3UU5A 3KVAA 3ZYLA 4AISA 4ZI3D 3OVUA 2CM0A 2CRBA 3AEFA 3ZJ2A 2NW8A 3BQIA 1X79A 2IUBA 1W0AA 3AAIA 3UUXB 1NAFA 2BG9C 4DV6T 1YD8G 2XPKA 1IJ5A 5HXHA 4HTEA 4NXMT 3N5LA 3N9PA 4EEBA 4PK5A 3KBTA 1UX4A 5HAXA 4H63V 2VQFT 5GONE 1ZP0A 2XAFB 2BKOA 2VKJA 4MALA 3W15B 3PUZF 1MNEA 3Q2MA 4QXBB 5JDMA 5L3DB 1FMVA 3JC6C 3MACA 4WZXA 4DV3T 4DBRA 1WR0A 2WP9A 3D0TA 2Y48B 3N2OA 4A97A 2UXDT 3SFEA 3O1JA 2X67A 1Y01A 3B13A 4GYRA 1SA0E 2RPAA 5ABEA 3ZCIA 2HN2A 4FI5A 2LRKA 5HEHA 4AI6A 5AQRB 2LEHA 5DQVA 4ADZA 3CKDA 1M7KA 2DHRA 2M6IA 4O4HE 3N9LA 2XY8B 2DCFA 4KP3C 2Q9QA 1W09A 3I0QA 3B5MA 3ZT6A 2PBIA 4KX6A 4X62T 3ZMTB 1JNRA 2BS4A 4PNIA 2CEAA 4HFDA 4KHZF 4HE8A 2KLQA 4HFEA 2NW9A 4EZ4A 2C5IT 4IDQA 1LRZA 5AQUB 4COFA 5HXEA 4JYAT 5TAOA 2RP4A 3LSVA 1KNPA 2K3WA 2I6HA 2WBLA 3OPCA 3NKZA 5LGNB 1UCUA 2IAKA 2V7MA 2DI4A 1FEWA 1OEDC 4MLKA 5DABA 4EAHA 4YHHT 5LCYA 2N9DA 3KFWX 5J2TE 4ZI3C 2KWHA 3ONLC 4H9QC 3NZQA 3AEGA 4TUYE 4Z91A 5H6QB 2Q9QC 3HKBE 1H7CA 1LVFA 2CCQA 5CA0E 2KXPB 2YN6A 3IA3A 4O4IE 4UV9B 5HWYA 4ZI2C 3S4UA 2LM9A 3L3PA 4C90A 5FY0A 3R6NA 1YW0A 2ZM8A 2E5LT 5JRCA 5AQKB 2L9QA 5LHIB 3UQ7A 3NRXA 2EHOD 4NXNT 1ZV4X 2OLTA 5HEJA 4DR2T 4JI7T 3K8PC 2XSBA 3I0OA 4HEAA 4ZZCA 2NTXA 5AQIB 1S35A 2ZMAA 1G73A 3CWZB 2H7OA 3HL6A 3LBXA 5FVLA 4AQFC 5AQNB 3N9QA 5FVKA 5HWXA 1MIWA 3AAAB 2A72A 4EGWA 5L4HA 1YQ3A 2XQ5A 4DV1T 2V7JA 2BG9B 1SE7A 1FIOA 3AE3A 3C4WA 3LG7A 3O1HA 4UVAB 5FL0A 2CMRA 5FXXA 4JI1T 3O4XE 4L9IA 3VRAA 1HNWT 2CXDA 4QXCB 5IWAT 3F57A 5DJQC 4JI4T 2XAJB 1V9DA 3ESLA 4UXNB 2MYSA 4PJLA 4BJNA 4GK0E 4LF8T 2W0GA 1T98A 2C5KT 2G0UA 2LJLA 3RIUA 3ZC0A 5HEGA 2D2SA 1YQ4A 3P4SA 3AE2A 5LHGB 4QH4A 4IT4A 1D1CA 2ODUA 4LFBT 3RPUA 3AE7A 4KMCA 5ABFA 4Z90A 4CI2B 5IYZE 2WU2A 4WW0A 5CJ5A 2WDQA 4A98A 2LSJA 2X68A 3FB2A 3JADA 5HXCA 1J5ET 4DR7T 4AKRB 2E9XC 2LHNA 4AXPA 4ZZBA 1G8XA 5FL1A 4TWDA 5LJMA 2VURA 2JPFA 4DR1T 4B6XA 5FXZA 3I9WA 3RLFF 1N33T 1BR0A 2X0LB 3P4WA 4U74A 3RYIE 2UXNB 4QX8B 3MA9A 3ZMSB 3QUJA 3UUMA 4DV7T 2X66A 4B3TT 1OEDB 2A2FX 5JR9C 4PW8A 1N36T 2UXCT 3QC9A 4H9NC 2C5JA 3HI2A 3NBXX 4QX7B 1ZEEA 3ANWA 3K3OA 2Q9QD 3JAEA 1WYCA 2E8IA 3AE8A 3HR0A 5IHYA 2H7VC 4EOZB 4CQIA 4AKGA 4H9RC 2WZHA 2ACZA 3AEBA 4UV8B 3SRZA 2NTYA 4O2AE 3UFGA 2N1GA 3ZJ1A 3QOFA 1N32T 2V6YA 3M65A 3GWHA 4ANJA 2CBIA 3TLTA 1XNQT 4L0RA 4YHJA 4AKIA 2LRLA 4E7ZA 1AJ3A 4TWHA 4BA9A 3RHWA 2NW7A 2H88A 5FMNA 2CBJA 3K3NA 3ZYMA 4F8HA 2XQ4A 5JDLA 5FKYA 1LVKA 3EHZA 3Q5WA 1W9RA 3A5XA 2X9WA 3AXJA 3RYFE 3UU6A 5JDQA 3E08A 3ZSSA 3P50A 2IHR1 4IGUA 2WMOA 4TN7B 3VRBA 2CXFA 5JDGA 4H9OC 4OX9T 5FYMA 2VVNA 4ILUA 2V5DA 2EHOA 3ABVA 3CQCB 5AQSB 3UU4A 3VU7H 4ILCA 4LF4T 2YU1A 3KINB 4JI5T 3T1HT 3GMIA 4TWFA 5FNVE 5LGUB 2VQET 3N9NA 2WS3A 5M4YA 3SWHA 2BKPA 2LSGA 3QB5A 5BR8T 2HH7A 2WWUA 4U7IA 5EK4A 3RIFA 3M3ZB 3WAKA 3T1YT 4H9SE 3LDQB 3LK3B 4IE7A 5E0OA 2BBHA 2KT9A 2MAWA 3RKOA 3ZPOA 5LMNT 2V1DB 3BQLA 3ZMVB 3C98B 5L3CB 3N9MA 2FJAA 4EZHA 2VKDA 2DWKA 5L4EA 4GIWA 1UK5A 2CPTA 4NPPA 4L5GA 4IHJE 5HYAA 4DR3T 1VRBA 1HNXT 4IL4A 2A3DA 1WFDA 1VCTA 2NR4A 3CX8B 3PDYA 4UR9A 3U3IA 4EYYR 3AA1B 4LF6T 2JIWA 1NEKA 2W63A 3ZCJA 4CN4A 4IDZA 4PAGA 2HHHT 2UUCT 1HS7A 2DNXA 2IC9A 3P4PA 2K24A 1JNZA 3CX7B 2WWVA 2W66A 4NUVA 5AQJB 1IZNB 2LHRA 2ZLYA 1BR1A 3ONXA 3P8CD 2XQ7A 3QNUA 4CN1A 1HX1B 3AA7B 3LBXB 3KDSE 1OWAA 2WAUA 4BJMA 1WCRA 2KZ7B 3C4ZA 5LB7B 3PU3A 4IREA 3PJAJ 3RKGA 5KX5E 3P7IA 4FJOA 4HFHA 1T72A 2K48A 1U5PA 2KMFA 2XQ8A 5EZYE 4EYUA 1D1AA 1SHZC 2WB5A 3HKEE 3AA0B 3JC6D 3VKHA 1WRDA 1KK7A 4P09A 2JRKA 3N9OA 2W67A 2GK9A 2XAQB 2X9HA 5JRCB 3QB5K 2UU9T 3RYCE 3K1SA 3PTRB 4AKLA 4IL9A 4O2BE 1GQEA 2XHEB 2XAGB 3FZHB 2UUBT 3RC8A 2VKHA 4YT0A 4OK0A 2XQ3A 4GOUA 1D0YA 3CQGB 3EI0A 2X9YA 3GN5B 3H37A 3H3AA 2V5CA 2CHNA 4JEUB 5FY7A 2Z6EA 5JDFA 3RQUA 2HPLA 2PG8A 3TLSA 2V8SV 1W0BA 3NVOA 4OHFA 5HEUA 2YKSA 3Q5DA 5BMVE 2V7IA 2ODVA 1UX5A 2LSIA 4A56A 2ZM2A 5LP6E 2LOSA 3KV5A 4YSYA 5ADXL 4CXYA 4DV0T 4ZHQE 3ZMZB 2I0MA 3FBLA 2LKGA 5C2TA 3O9XA 2K9AA 2HPJA 2V6XA 4HFIA 3F31A 3Q5XA 2EHOB
chains in the Genus database with same CATH topology
5FY1A 2C0SA 5C8YE 3E22E 2CWYA 3I1AA 4JUYA 3VKGA 5LXTE 2DLRA 2QA7A 3AVSA 3EDVA 2XAHB 4EIWA 1HCIA 5CB4E 2L8KA 3CPZA 2BDEA 3WI3A 4CI1B 5J2UE 3UUNA 1QUUA 4UELA 4UVBB 3UT5E 4IIJE 4EB6E 5L3FB 3PU8A 2IC6A 5CA1E 5JVDE 3UFEA 4AQGA 4PJNA 2JQQA 2LSYA 2E9XA 2LSKA 4PFPA 2YEVC 4ISTA 2X51A 5LGTB 4C91A 3N2GE 4TX5A 1MNDA 1MMGA 3ZLIA 5A1LA 4GK5E 4PJMA 4X1YE 4UF0A 5KMGP 3DTOA 5FP3A 5J1GA 2ACXA 3UTKA 2Y6XA 2BVMA 3AB3B 4JEHB 5JR9A 3KV9A 3RC3A 2NOXA 1VOMA 2MOZA 4X20E 3BK9A 4QHOA 4IE4A 1D0XA 3B57A 5EK3A 3SOLA 3PUGA 3QK6A 5FXVA 4YJ3E 3R84B 1KNZA 3LK2B 3Q9DA 3HKDE 3ZEFB 3AA6B 2VKOA 2JJ9A 4CZZB 4IE0A 3AVRA 2YU2A 1HTJF 1MIVA 1MMDA 2KNDA 3EUHA 2PFVA 1CUNA 4XAXB 3ZYKA 5JREA 3OYZA 4ERRA 4PFOA 3HA4A 4X1IE 3K3QC 4Z8XA 2VWAA 4ZS3A 3NRYA 1LKXA 2MBGA 4UF0B 2D5UA 3MKDA 4IE5A 4TV9E 3IHRA 1D1BA 1U4QA 4QKNA 2CA5A 4UIGA 5ETWA 1BR2A 4MFRA 1NWMX 3MK7C 3RYHE 3V5UA 2E9XB 2NP9A 2VK9A 2VASA 5LA6E 2NWBA 3FXEB 4MHCA 1ZHCA 3UULA 1MMAA 2EHOC 3ETVA 2LE8A 2M67A 3NZPA 2KWIB 3C64A 3OBVE 5FY7A 1HFAA 3VHLA 3RRCA 4O4LE 2E9XD 1YKHB 3ZN0B 1QSDA 2YINA 3KBUA 4AKHA 4QXHB 4DMVA 3LFMA 4H9PC 4KBMB 2CXLA 5LNKA 3ANWB 4EXTA 4ZOLE 3DJBA 4BAYB 2L3LA 2KINB 5H6RB 4JLEA 3V5SA 3MZKB 4NUUA 3L09A 3ZMUB 3CX6B 3HKCE 2MTQA 2RA1A 2V7LA 4MBQA 2QGSA 4WNKA 1E1HB 2XASB 4CXXA 5L3GB 4I43B 4M1PA 4I50E 3KV6A 4ISSA 2CLYB 2OA5A 4DNDA 3ZC1A 3CMLA 5L3BB 4GYSA 2WM9A 2P9BA 1O3XA 3CVRA 4OYJA 3FHNA 4J2CA 5LYJE 2CE7A 5LOVE 4DO0A 5FXWA 3LK42 5JQGE 5JR9B 4DVDA 1HG5A 2YK0A 5JH7E 1S94A 2VB6A 4ZS2A 1D0ZA 4WBOA 3CQXC 3T8OA 5LJNA 4HN9A 1WLXA 3BQKA 3C4XA 1HF8A 2XUEA 2JMKA 3E0ZA 3RX6A 2D0UA 4YFSA 1Z0PA 2W62A 5LBQB 5EK2A 1OXZA 4G63A 3C50A 1WYBA 5LBMA 2ZM0A 3OYXA 2V26A 4ZI7E 3O1IA 4UVCB 2H3RA 3U78A 3DP7A 2LOPA 2WSSV 4PJJA 4HFVA 3LJCA 2N2NA 2DWGA 3RH3A 4G2AA 3SS1A 3EDUA 2V7KA 4HGAA 5F8PA 4I55E 4PK4A 4TZ4C 3GA8A 1MMNA 2WMNA 3EVYA 4YJ2E 3GN5A 1HX8A 4H63H 4CXWA 3ETUA 3TKLB 4KUMB 1FMWA 2J1DG 5HXSA 3PURA 5AFUL 2D0TA 3IEEA 2I59A 3C51A 4XBFB 3OKQA 3J7Yq 1MIYA 5F3JA 2UXXB 3FXDB 3F2EA 4N78D 4O8SA 4AQFA 2BVLA 4UEMA 1HG2A 2XQYA 4U72A 3I9YA 4TV8E 4X1KE 4E7SA 4CI3B 2ES0A 4V1Av 5JDHA 2SPCA 4P0BA 3J9X1 3IBPA 2X9XA 1BR4A 4YLHA 2IW5B 3KVBA 4P0AA 2CWOA 2PJQA 4I4TE 1WR6A 3N2KE 4IE6A 3AAEB 5L2LA 4XZCA 2K5BB 3ZN1B 5KDMC 4K0UA 3PUQA 2W61A 3FBZA 1B7TA 5LG4A 2LT3A 1Y64B 2XTLA 4DMWA 4DBQA 3RRWA 5DQWA 4O4JE 3PE0A 1IAPA 2W00A 4QWNB 4PK6A 4WBNE 2VL8A 5JDNA 3OJAA 5LHHB 4HKAA 4OYKA 2CLYC 1ZKEA 4ASKA 3KV4A 1YKEB 1US7B 3WAJA 3PUAA 2B1EA 5HXRA 2JMHA 3MJXA 3IF8B 1IJ6A 2Y8DA 1EZ3A 4ZI2D 3PUSA 4OFZA 2Q9QB 4F6RC 2BZBA 3MXZA 3ZYLA 3KVAA 4ZI3D 2CM0A 3ZJ2A 2NW8A 3BQIA 1X79A 3AAIA 3UUXB 1NAFA 1YD8G 5HXHA 1IJ5A 4HTEA 3N5LA 3N9PA 4PK5A 3KBTA 1UX4A 5HAXA 4H63V 5GONE 2XAFB 5L3EB 2VKJA 4MALA 3W15B 1MNEA 3Q2MA 4QXBB 5JDMA 5L3DB 1FMVA 3JC6C 3MACA 4DBRA 3D0TA 2Y48B 3N2OA 3O1JA 2X67A 3B13A 4GYRA 1SA0E 3ZCIA 4FI5A 4AI6A 2LEHA 5DQVA 4ADZA 3CKDA 2DHRA 4O4HE 3N9LA 2DCFA 4KP3C 2Q9QA 3I0QA 2PBIA 3ZMTB 4PNIA 2CEAA 2NW9A 4EZ4A 4HE8A 2KLQA 2C5IT 5HXEA 1LRZA 5TAOA 2RP4A 2WBLA 5LGNB 1UCUA 2IAKA 2V7MA 2DI4A 1FEWA 4MLKA 5DABA 4EAHA 5LCYA 2N9DA 3KFWX 5J2TE 4ZI3C 2KWHA 4H9QC 5H6QB 3NZQA 4TUYE 2Q9QC 3HKBE 1H7CA 1LVFA 2CCQA 5CA0E 2KXPB 4O4IE 4UV9B 5HWYA 4ZI2C 3S4UA 2LM9A 3L3PA 4C90A 5FY0A 3R6NA 1YW0A 2ZM8A 5JRCA 5LHIB 2L9QA 3NRXA 2EHOD 1ZV4X 3K8PC 3I0OA 4HEAA 2NTXA 3CWZB 1S35A 1G73A 2ZMAA 2H7OA 3HL6A 3LBXA 5HWXA 4AQFC 3N9QA 1MIWA 3AAAB 2A72A 2V7JA 3O1HA 1FIOA 3LG7A 3C4WA 4UVAB 5FXXA 2CMRA 3O4XE 4L9IA 2CXDA 4QXCB 3F57A 5DJQC 2XAJB 1V9DA 3ESLA 4UXNB 2MYSA 4PJLA 4BJNA 4GK0E 2W0GA 1T98A 2C5KT 2G0UA 2LJLA 3ZC0A 2D2SA 5LHGB 1D1CA 2ODUA 3RPUA 4KMCA 4CI2B 5IYZE 4WW0A 2LSJA 2X68A 3FB2A 5HXCA 4AKRB 2E9XC 2LHNA 4AXPA 1G8XA 5LJMA 2JPFA 4B6XA 5FXZA 3I9WA 1BR0A 2X0LB 4U74A 3RYIE 2UXNB 4QX8B 3MA9A 3ZMSB 3QUJA 3UUMA 2X66A 2A2FX 5JR9C 4PW8A 3QC9A 4H9NC 2C5JA 3HI2A 3NBXX 4QX7B 1ZEEA 3ANWA 3K3OA 2Q9QD 4EOZB 1WYCA 2E8IA 3HR0A 5IHYA 4AKGA 2H7VC 4CQIA 4H9RC 4UV8B 3SRZA 2NTYA 4O2AE 3ZJ1A 2N1GA 3M65A 3GWHA 4ANJA 4L0RA 4YHJA 4AKIA 4E7ZA 1AJ3A 4BA9A 2NW7A 5FMNA 3K3NA 3ZYMA 5JDLA 1LVKA 3Q5WA 3A5XA 2X9WA 3RYFE 5JDQA 3E08A 4IGUA 2WMOA 4TN7B 5JDGA 2CXFA 4H9OC 5FYMA 4ILUA 2EHOA 3CQCB 3VU7H 2YU1A 3KINB 3GMIA 5FNVE 5LGUB 3N9NA 5M4YA 3SWHA 2LSGA 2HH7A 2WWUA 5EK4A 3WAKA 4H9SE 3LK3B 4IE7A 5E0OA 2KT9A 3RKOA 3ZPOA 2V1DB 3BQLA 3ZMVB 3C98B 5L3CB 3N9MA 4EZHA 2VKDA 2DWKA 4GIWA 4L5GA 4IHJE 5HYAA 1VRBA 2A3DA 3CX8B 3PDYA 4EYYR 3U3IA 3AA1B 2W63A 3ZCJA 4IDZA 4PAGA 1HS7A 2DNXA 2IC9A 2K24A 3CX7B 4NUVA 1IZNB 2LHRA 2ZLYA 1BR1A 3ONXA 3P8CD 3AA7B 3LBXB 3KDSE 1OWAA 2WAUA 4BJMA 2KZ7B 3C4ZA 3PU3A 5KX5E 3P7IA 4FJOA 2K48A 1U5PA 2KMFA 5EZYE 4EYUA 1D1AA 1SHZC 3HKEE 3VKHA 3AA0B 3JC6D 1WRDA 1KK7A 4P09A 2JRKA 3N9OA 2GK9A 2XAQB 2X9HA 5JRCB 3RYCE 3PTRB 4AKLA 4O2BE 2XHEB 2XAGB 3RC8A 2VKHA 4OK0A 4GOUA 1D0YA 3CQGB 2X9YA 3GN5B 3H37A 3H3AA 4JEUB 2Z6EA 5JDFA 2HPLA 2PG8A 4OHFA 5BMVE 2V7IA 2ODVA 1UX5A 2LSIA 4A56A 2ZM2A 5LP6E 2LOSA 3KV5A 5ADXL 4CXYA 4ZHQE 3ZMZB 3FBLA 3O9XA 2K9AA 2HPJA 3F31A 3Q5XA 2EHOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT9 A; 
#chains in the Genus database with same CATH topology
 5FY1 A;  4EV6 A;  2C0S A;  5C8Y E;  2IIU A;  3E22 E;  2CWY A;  3I1A A;  1OED E;  2QYW A;  4IDO A;  4JUY A;  4JI2 T;  3VKG A;  5LXT E;  2DLR A;  2QA7 A;  2VVS A;  2WQY A;  2XAH B;  3AVS A;  3CIR A;  3EDV A;  1HCI A;  3X1D A;  4U33 A;  2L8K A;  5CB4 E;  2W4X A;  4EIW A;  3AEA A;  2BS2 A;  3CPZ A;  2BDE A;  3WI3 A;  4YSZ A;  4ZEY A;  2KSR A;  5AQP B;  4CI1 B;  4ILA A;  3UUN A;  3ZST A;  5J2U E;  4HWD A;  2J4G A;  1QUU A;  4UEL A;  4AQY T;  3PUV F;  1IBL T;  4U2Y A;  4UVB B;  5AQH B;  2XZE A;  3UT5 E;  4IIJ E;  3ZT5 A;  2FBW A;  4LMK A;  3PU8 A;  4EB6 E;  2IC6 A;  2QVA A;  5CA1 E;  5L3F B;  5JVD E;  4JI3 T;  3UFE A;  4AQG A;  3RGL A;  5KXJ A;  1XNR T;  3TLV A;  4PJN A;  3AEC A;  2JQQ A;  2LSY A;  2E9X A;  4JBW F;  2LSK A;  2XQ6 A;  2YEV C;  4PFP A;  5AQV B;  4IST A;  2X51 A;  5LGT B;  4C91 A;  3N2G E;  4TX5 A;  4CN6 A;  2X0H A;  1MND A;  1J1J A;  1MMG A;  1OED A;  3ZLI A;  5A1L A;  3AEE A;  4LF7 T;  4GK5 E;  2MPK A;  4PJM A;  4UF0 A;  4X1Y E;  5KMG P;  5J0Z A;  4U2Z A;  1E2A A;  1XZY A;  3DTO A;  1CHU A;  5FP3 A;  5J1G A;  2E5V A;  4X66 T;  2ACX A;  2D9D A;  3UTK A;  2Y6X A;  2BVM A;  3AB3 B;  4JEH B;  5JR9 A;  1I94 T;  3KV9 A;  2XSA A;  2NOX A;  3RC3 A;  1VOM A;  2MOZ A;  4HWI B;  3BK9 A;  4X20 E;  4QHO A;  4IE4 A;  1D0X A;  3B57 A;  5EK3 A;  3SOL A;  3PUG A;  3QK6 A;  5FXV A;  4YJ3 E;  3R84 B;  1KNZ A;  4KHP T;  1E7P A;  2XJ7 A;  3AE6 A;  3HKD E;  3LK2 B;  3Q9D A;  3AA6 B;  2VKO A;  3L8R A;  3ZEF B;  2JJ9 A;  4CZZ B;  5LG3 A;  4IE0 A;  4B3S T;  3ONJ A;  3AVR A;  2XQA A;  2YU2 A;  3UUB A;  1HTJ F;  1MIV A;  1MMD A;  3EAB A;  2KND A;  3EUH A;  4I0U A;  4YY3 T;  3PUW F;  1T8B A;  2PFV A;  1CUN A;  4XAX B;  2VL0 A;  1UUS A;  2QRX A;  3OYZ A;  4PFO A;  3ZYK A;  4A5X A;  4ERR A;  5JRE A;  1XMO T;  3HA4 A;  4X1I E;  3K3Q C;  4Z8X A;  2VWA A;  4ZS3 A;  3NRY A;  1LKX A;  3A7M A;  3AED A;  4UF0 B;  2D5U A;  3MKD A;  2MBG A;  4IE5 A;  3ZKR A;  3AE9 A;  4TV9 E;  3IHR A;  1D1B A;  1U4Q A;  4QKN A;  4HWF A;  2CA5 A;  4UIG A;  3H3M A;  5ETW A;  1BR2 A;  2WU5 A;  4MFR A;  1NWM X;  3MK7 C;  3FZL B;  4LMJ A;  3RYH E;  1XDP A;  3V5U A;  2E9X B;  2NP9 A;  2VK9 A;  2VAS A;  4LF5 T;  5LA6 E;  2NWB A;  2LKH A;  3FXE B;  4MHC A;  5AQF B;  1ZHC A;  3UUL A;  3RQW A;  1MMA A;  2A9U A;  2EHO C;  2XQ9 A;  3AXJ B;  3ETV A;  4TNW A;  5ABF B;  2XM1 A;  2LE8 A;  2M67 A;  3NZP A;  2KWI B;  3C64 A;  2CHO A;  3OBV E;  4QH5 A;  1HFA A;  2JQK A;  3AE4 A;  5AQG B;  3RRC A;  3VHL A;  5CGM A;  4O4L E;  2E9X D;  1YKH B;  4WYV A;  3TLU A;  1QSD A;  2YIN A;  3KBU A;  3ZN0 B;  4QXH B;  4DMV A;  4JI8 T;  2UXB T;  1DU2 A;  2PTF A;  3LFM A;  4H9P C;  1IBM T;  1XWM A;  4KBM B;  4KI0 F;  2CXL A;  5LNK A;  3ANW B;  3Q5E A;  3PUY F;  4ZOL E;  3DJB A;  4EXT A;  4K0K T;  4BAY B;  2L3L A;  2E2A A;  2KIN B;  4U3C A;  1XMQ T;  2J62 A;  2FJB A;  1VCS A;  4HFC A;  4JLE A;  5H6R B;  3V5S A;  2IDO B;  3MZK B;  4X65 T;  4ILB A;  4B3M T;  4DR4 T;  4NUU A;  4DR6 T;  3L09 A;  3UU8 A;  3ZMU B;  3CX6 B;  3HKC E;  2MTQ A;  2RA1 A;  2V7L A;  4MBQ A;  1M62 A;  2QGS A;  1E1H B;  2XAS B;  4WNK A;  4CXX A;  5L3G B;  4I43 B;  4M1P A;  4JI0 T;  4I50 E;  3KV6 A;  4ISS A;  1KF6 A;  5HCJ A;  4LML A;  1L0V A;  5ABH A;  2B76 A;  2R6G F;  2CLY B;  2OA5 A;  2AE9 A;  3G06 A;  1Z8U A;  3JCF A;  3RI5 A;  4DND A;  1R8I A;  2H89 A;  3OTO T;  4X5T A;  1KFY A;  3P4R A;  3ZC1 A;  3UQ4 A;  2JQ9 A;  3CML A;  5L3B B;  4IDP A;  4X64 T;  2YDS A;  5AQT B;  4GYS A;  2WM9 A;  2P9B A;  4DID B;  1O3X A;  3CVR A;  4OYJ A;  3FHN A;  4J2C A;  5LYJ E;  1J5W A;  4DV2 T;  2BG9 E;  2CE7 A;  5LOV E;  4DO0 A;  5FXW A;  3LK4 2;  4YTM A;  4EED A;  1KNR A;  5JQG E;  5JR9 B;  4DVD A;  1HG5 A;  4LFC T;  3ZT7 A;  2YK0 A;  5AQL B;  5JH7 E;  3UU3 A;  1S94 A;  2VB6 A;  2BKN A;  3RIU C;  4ZS2 A;  1D0Z A;  4WBO A;  3CQX C;  3T8O A;  3RF1 A;  3VR8 A;  5LJN A;  1HR0 T;  2BG9 A;  2LLY A;  2YDQ A;  4HN9 A;  1WLX A;  5HEO A;  3BQK A;  3C4X A;  1HF8 A;  2UUA T;  4LFA T;  1T7S A;  2XUE A;  4AIU A;  5F5W A;  2JMK A;  3E0Z A;  3RX6 A;  2D0U A;  2XM2 A;  4YFS A;  1Z0P A;  3JAF A;  5JTG A;  2W62 A;  4P1N A;  5LBQ B;  5EK2 A;  1ZOY A;  2W2U A;  1OXZ A;  4G63 A;  3C50 A;  1WYB A;  4U7Y A;  2ZM0 A;  5LBM A;  3PV0 F;  3OYX A;  2V26 A;  5IUX A;  2J47 A;  4Q25 A;  4ZI7 E;  3O1I A;  2BBJ A;  4UVC B;  2FJE A;  2H3R A;  2IML A;  3DP7 A;  4QH1 A;  2LOP A;  3U78 A;  4DUY T;  4HWC A;  1QLB A;  2WSS V;  3AE5 A;  4PJJ A;  5ABG A;  4HFV A;  3LJC A;  2N2N A;  2DWG A;  4HFB A;  2YDR A;  3RH3 A;  4G2A A;  4IDN A;  2FUP A;  3SS1 A;  3EDU A;  1SUM B;  2V7K A;  4HGA A;  4GKJ T;  5F8P A;  4I55 E;  3PUX F;  2BS3 A;  4PK4 A;  4TZ4 C;  1X9B A;  3GA8 A;  1MMN A;  2WMN A;  3EVY A;  3P4Q A;  3FZF B;  3GN5 A;  4YJ2 E;  1HX8 A;  4H63 H;  4CXW A;  5LMU T;  3ETU A;  4DUZ T;  3TKL B;  4KUM B;  1FMW A;  3RIA A;  2J1D G;  5AQO B;  2ZM6 T;  5HXS A;  2F4V T;  3PUR A;  4GKK T;  5AFU L;  1UUR A;  1IBK T;  2D0T A;  4JV5 T;  2AXD S;  3L39 A;  3FZM B;  3NWI A;  3IEE A;  2I59 A;  3C51 A;  4XBF B;  3OKQ A;  3J7Y q;  3SFD A;  2V6Y B;  5HCM A;  1MIY A;  1UGO A;  5F3J A;  2UXX B;  2JQH A;  3CK6 A;  3F2E A;  3FXD B;  4N78 D;  4O8S A;  4ZXL A;  2BVL A;  4AQF A;  4B3R T;  2X0Y A;  4UEM A;  1HG2 A;  2XQY A;  4U72 A;  4TNV A;  3I9Y A;  4TV8 E;  4X1K E;  4E7S A;  4CI3 B;  2ES0 A;  4YTP A;  3VR9 A;  1XDO A;  4V1A v;  2WDV A;  5JDH A;  2SPC A;  4P0B A;  3J9X 1;  3IBP A;  3PJA A;  2X9X A;  1BR4 A;  4YLH A;  2IW5 B;  3KVB A;  4YSX A;  1N34 T;  4P0A A;  2OV9 A;  2CWO A;  2PJQ A;  2WDR A;  3AE1 A;  4DV4 T;  1I6Z A;  2WZI A;  4I4T E;  1WR6 A;  4NIQ A;  4DV5 T;  3N2K E;  1KEY A;  4IE6 A;  3AAE B;  5L2L A;  4XZC A;  2K5B B;  3ZN1 B;  5KDM C;  4K0U A;  3PUQ A;  2W61 A;  3FBZ A;  1YXR A;  1B7T A;  5LG4 A;  2LT3 A;  1Y64 B;  2XTL A;  4DMW A;  2WCA A;  4DBQ A;  3RRW A;  2WY2 A;  5DQW A;  1HNZ T;  4AKH A;  5AQQ B;  4YXD A;  1NEN A;  4O4J E;  4U31 A;  3PE0 A;  4LF9 T;  1IAP A;  2W00 A;  4HWH A;  4QWN B;  4PK6 A;  4WBN E;  2VL8 A;  5L47 A;  5JDN A;  2YOE A;  3OJA A;  2HN1 A;  5LHH B;  3FZK B;  3EAM A;  4HKA A;  4OYK A;  4YTN A;  2LM2 A;  2CLY C;  1ZKE A;  2DL1 A;  2FJD A;  4ASK A;  4JI6 T;  3KV4 A;  1YKE B;  1US7 B;  5CFB A;  3WAJ A;  3PUA A;  2B1E A;  5AQM B;  5HXR A;  3TLW A;  5C3J A;  2JMH A;  3MJX A;  3IF8 B;  5L3E B;  4DR5 T;  1IJ6 A;  2Y8D A;  1EZ3 A;  2M6B A;  3A8Y C;  3PUS A;  4ZI2 D;  1FJG T;  4OFZ A;  2Q9Q B;  4F6R C;  2BZB A;  3MXZ A;  3UU5 A;  3KVA A;  3ZYL A;  4AIS A;  4ZI3 D;  3OVU A;  2CM0 A;  2CRB A;  3AEF A;  3ZJ2 A;  2NW8 A;  3BQI A;  1X79 A;  2IUB A;  1W0A A;  3AAI A;  3UUX B;  1NAF A;  2BG9 C;  4DV6 T;  1YD8 G;  2XPK A;  1IJ5 A;  5HXH A;  4HTE A;  4NXM T;  3N5L A;  3N9P A;  4EEB A;  4PK5 A;  3KBT A;  1UX4 A;  5HAX A;  4H63 V;  2VQF T;  5GON E;  1ZP0 A;  2XAF B;  2BKO A;  2VKJ A;  4MAL A;  3W15 B;  3PUZ F;  1MNE A;  3Q2M A;  4QXB B;  5JDM A;  5L3D B;  1FMV A;  3JC6 C;  3MAC A;  4WZX A;  4DV3 T;  4DBR A;  1WR0 A;  2WP9 A;  3D0T A;  2Y48 B;  3N2O A;  4A97 A;  2UXD T;  3SFE A;  3O1J A;  2X67 A;  1Y01 A;  3B13 A;  4GYR A;  1SA0 E;  2RPA A;  5ABE A;  3ZCI A;  2HN2 A;  4FI5 A;  2LRK A;  5HEH A;  4AI6 A;  5AQR B;  2LEH A;  5DQV A;  4ADZ A;  3CKD A;  1M7K A;  2DHR A;  2M6I A;  4O4H E;  3N9L A;  2XY8 B;  2DCF A;  4KP3 C;  2Q9Q A;  1W09 A;  3I0Q A;  3B5M A;  3ZT6 A;  2PBI A;  4KX6 A;  4X62 T;  3ZMT B;  1JNR A;  2BS4 A;  4PNI A;  2CEA A;  4HFD A;  4KHZ F;  4HE8 A;  2KLQ A;  4HFE A;  2NW9 A;  4EZ4 A;  2C5I T;  4IDQ A;  1LRZ A;  5AQU B;  4COF A;  5HXE A;  4JYA T;  5TAO A;  2RP4 A;  3LSV A;  1KNP A;  2K3W A;  2I6H A;  2WBL A;  3OPC A;  3NKZ A;  5LGN B;  1UCU A;  2IAK A;  2V7M A;  2DI4 A;  1FEW A;  1OED C;  4MLK A;  5DAB A;  4EAH A;  4YHH T;  5LCY A;  2N9D A;  3KFW X;  5J2T E;  4ZI3 C;  2KWH A;  3ONL C;  4H9Q C;  3NZQ A;  3AEG A;  4TUY E;  4Z91 A;  5H6Q B;  2Q9Q C;  3HKB E;  1H7C A;  1LVF A;  2CCQ A;  5CA0 E;  2KXP B;  2YN6 A;  3IA3 A;  4O4I E;  4UV9 B;  5HWY A;  4ZI2 C;  3S4U A;  2LM9 A;  3L3P A;  4C90 A;  5FY0 A;  3R6N A;  1YW0 A;  2ZM8 A;  2E5L T;  5JRC A;  5AQK B;  2L9Q A;  5LHI B;  3UQ7 A;  3NRX A;  2EHO D;  4NXN T;  1ZV4 X;  2OLT A;  5HEJ A;  4DR2 T;  4JI7 T;  3K8P C;  2XSB A;  3I0O A;  4HEA A;  4ZZC A;  2NTX A;  5AQI B;  1S35 A;  2ZMA A;  1G73 A;  3CWZ B;  2H7O A;  3HL6 A;  3LBX A;  5FVL A;  4AQF C;  5AQN B;  3N9Q A;  5FVK A;  5HWX A;  1MIW A;  3AAA B;  2A72 A;  4EGW A;  5L4H A;  1YQ3 A;  2XQ5 A;  4DV1 T;  2V7J A;  2BG9 B;  1SE7 A;  1FIO A;  3AE3 A;  3C4W A;  3LG7 A;  3O1H A;  4UVA B;  5FL0 A;  2CMR A;  5FXX A;  4JI1 T;  3O4X E;  4L9I A;  3VRA A;  1HNW T;  2CXD A;  4QXC B;  5IWA T;  3F57 A;  5DJQ C;  4JI4 T;  2XAJ B;  1V9D A;  3ESL A;  4UXN B;  2MYS A;  4PJL A;  4BJN A;  4GK0 E;  4LF8 T;  2W0G A;  1T98 A;  2C5K T;  2G0U A;  2LJL A;  3RIU A;  3ZC0 A;  5HEG A;  2D2S A;  1YQ4 A;  3P4S A;  3AE2 A;  5LHG B;  4QH4 A;  4IT4 A;  1D1C A;  2ODU A;  4LFB T;  3RPU A;  3AE7 A;  4KMC A;  5ABF A;  4Z90 A;  4CI2 B;  5IYZ E;  2WU2 A;  4WW0 A;  5CJ5 A;  2WDQ A;  4A98 A;  2LSJ A;  2X68 A;  3FB2 A;  3JAD A;  5HXC A;  1J5E T;  4DR7 T;  4AKR B;  2E9X C;  2LHN A;  4AXP A;  4ZZB A;  1G8X A;  5FL1 A;  4TWD A;  5LJM A;  2VUR A;  2JPF A;  4DR1 T;  4B6X A;  5FXZ A;  3I9W A;  3RLF F;  1N33 T;  1BR0 A;  2X0L B;  3P4W A;  4U74 A;  3RYI E;  2UXN B;  4QX8 B;  3MA9 A;  3ZMS B;  3QUJ A;  3UUM A;  4DV7 T;  2X66 A;  4B3T T;  1OED B;  2A2F X;  5JR9 C;  4PW8 A;  1N36 T;  2UXC T;  3QC9 A;  4H9N C;  2C5J A;  3HI2 A;  3NBX X;  4QX7 B;  1ZEE A;  3ANW A;  3K3O A;  2Q9Q D;  3JAE A;  1WYC A;  2E8I A;  3AE8 A;  3HR0 A;  5IHY A;  2H7V C;  4EOZ B;  4CQI A;  4AKG A;  4H9R C;  2WZH A;  2ACZ A;  3AEB A;  4UV8 B;  3SRZ A;  2NTY A;  4O2A E;  3UFG A;  2N1G A;  3ZJ1 A;  3QOF A;  1N32 T;  2V6Y A;  3M65 A;  3GWH A;  4ANJ A;  2CBI A;  3TLT A;  1XNQ T;  4L0R A;  4YHJ A;  4AKI A;  2LRL A;  4E7Z A;  1AJ3 A;  4TWH A;  4BA9 A;  3RHW A;  2NW7 A;  2H88 A;  5FMN A;  2CBJ A;  3K3N A;  3ZYM A;  4F8H A;  2XQ4 A;  5JDL A;  5FKY A;  1LVK A;  3EHZ A;  3Q5W A;  1W9R A;  3A5X A;  2X9W A;  3AXJ A;  3RYF E;  3UU6 A;  5JDQ A;  3E08 A;  3ZSS A;  3P50 A;  2IHR 1;  4IGU A;  2WMO A;  4TN7 B;  3VRB A;  2CXF A;  5JDG A;  4H9O C;  4OX9 T;  5FYM A;  2VVN A;  4ILU A;  2V5D A;  2EHO A;  3ABV A;  3CQC B;  5AQS B;  3UU4 A;  3VU7 H;  4ILC A;  4LF4 T;  2YU1 A;  3KIN B;  4JI5 T;  3T1H T;  3GMI A;  4TWF A;  5FNV E;  5LGU B;  2VQE T;  3N9N A;  2WS3 A;  5M4Y A;  3SWH A;  2BKP A;  2LSG A;  3QB5 A;  5BR8 T;  2HH7 A;  2WWU A;  4U7I A;  5EK4 A;  3RIF A;  3M3Z B;  3WAK A;  3T1Y T;  4H9S E;  3LDQ B;  3LK3 B;  4IE7 A;  5E0O A;  2BBH A;  2KT9 A;  2MAW A;  3RKO A;  3ZPO A;  5LMN T;  2V1D B;  3BQL A;  3ZMV B;  3C98 B;  5L3C B;  3N9M A;  2FJA A;  4EZH A;  2VKD A;  2DWK A;  5L4E A;  4GIW A;  1UK5 A;  2CPT A;  4NPP A;  4L5G A;  4IHJ E;  5HYA A;  4DR3 T;  1VRB A;  1HNX T;  4IL4 A;  2A3D A;  1WFD A;  1VCT A;  2NR4 A;  3CX8 B;  3PDY A;  4UR9 A;  3U3I A;  4EYY R;  3AA1 B;  4LF6 T;  2JIW A;  1NEK A;  2W63 A;  3ZCJ A;  4CN4 A;  4IDZ A;  4PAG A;  2HHH T;  2UUC T;  1HS7 A;  2DNX A;  2IC9 A;  3P4P A;  2K24 A;  1JNZ A;  3CX7 B;  2WWV A;  2W66 A;  4NUV A;  5AQJ B;  1IZN B;  2LHR A;  2ZLY A;  1BR1 A;  3ONX A;  3P8C D;  2XQ7 A;  3QNU A;  4CN1 A;  1HX1 B;  3AA7 B;  3LBX B;  3KDS E;  1OWA A;  2WAU A;  4BJM A;  1WCR A;  2KZ7 B;  3C4Z A;  5LB7 B;  3PU3 A;  4IRE A;  3PJA J;  3RKG A;  5KX5 E;  3P7I A;  4FJO A;  4HFH A;  1T72 A;  2K48 A;  1U5P A;  2KMF A;  2XQ8 A;  5EZY E;  4EYU A;  1D1A A;  1SHZ C;  2WB5 A;  3HKE E;  3AA0 B;  3JC6 D;  3VKH A;  1WRD A;  1KK7 A;  4P09 A;  2JRK A;  3N9O A;  2W67 A;  2GK9 A;  2XAQ B;  2X9H A;  5JRC B;  3QB5 K;  2UU9 T;  3RYC E;  3K1S A;  3PTR B;  4AKL A;  4IL9 A;  4O2B E;  1GQE A;  2XHE B;  2XAG B;  3FZH B;  2UUB T;  3RC8 A;  2VKH A;  4YT0 A;  4OK0 A;  2XQ3 A;  4GOU A;  1D0Y A;  3CQG B;  3EI0 A;  2X9Y A;  3GN5 B;  3H37 A;  3H3A A;  2V5C A;  2CHN A;  4JEU B;  5FY7 A;  2Z6E A;  5JDF A;  3RQU A;  2HPL A;  2PG8 A;  3TLS A;  2V8S V;  1W0B A;  3NVO A;  4OHF A;  5HEU A;  2YKS A;  3Q5D A;  5BMV E;  2V7I A;  2ODV A;  1UX5 A;  2LSI A;  4A56 A;  2ZM2 A;  5LP6 E;  2LOS A;  3KV5 A;  4YSY A;  5ADX L;  4CXY A;  4DV0 T;  4ZHQ E;  3ZMZ B;  2I0M A;  3FBL A;  2LKG A;  5C2T A;  3O9X A;  2K9A A;  2HPJ A;  2V6X A;  4HFI A;  3F31 A;  3Q5X A;  2EHO B; 
#chains in the Genus database with same CATH homology
 5FY1 A;  2C0S A;  5C8Y E;  3E22 E;  2CWY A;  3I1A A;  4JUY A;  3VKG A;  5LXT E;  2DLR A;  2QA7 A;  3AVS A;  3EDV A;  2XAH B;  4EIW A;  1HCI A;  5CB4 E;  2L8K A;  3CPZ A;  2BDE A;  3WI3 A;  4CI1 B;  5J2U E;  3UUN A;  1QUU A;  4UEL A;  4UVB B;  3UT5 E;  4IIJ E;  4EB6 E;  5L3F B;  3PU8 A;  2IC6 A;  5CA1 E;  5JVD E;  3UFE A;  4AQG A;  4PJN A;  2JQQ A;  2LSY A;  2E9X A;  2LSK A;  4PFP A;  2YEV C;  4IST A;  2X51 A;  5LGT B;  4C91 A;  3N2G E;  4TX5 A;  1MND A;  1MMG A;  3ZLI A;  5A1L A;  4GK5 E;  4PJM A;  4X1Y E;  4UF0 A;  5KMG P;  3DTO A;  5FP3 A;  5J1G A;  2ACX A;  3UTK A;  2Y6X A;  2BVM A;  3AB3 B;  4JEH B;  5JR9 A;  3KV9 A;  3RC3 A;  2NOX A;  1VOM A;  2MOZ A;  4X20 E;  3BK9 A;  4QHO A;  4IE4 A;  1D0X A;  3B57 A;  5EK3 A;  3SOL A;  3PUG A;  3QK6 A;  5FXV A;  4YJ3 E;  3R84 B;  1KNZ A;  3LK2 B;  3Q9D A;  3HKD E;  3ZEF B;  3AA6 B;  2VKO A;  2JJ9 A;  4CZZ B;  4IE0 A;  3AVR A;  2YU2 A;  1HTJ F;  1MIV A;  1MMD A;  2KND A;  3EUH A;  2PFV A;  1CUN A;  4XAX B;  3ZYK A;  5JRE A;  3OYZ A;  4ERR A;  4PFO A;  3HA4 A;  4X1I E;  3K3Q C;  4Z8X A;  2VWA A;  4ZS3 A;  3NRY A;  1LKX A;  2MBG A;  4UF0 B;  2D5U A;  3MKD A;  4IE5 A;  4TV9 E;  3IHR A;  1D1B A;  1U4Q A;  4QKN A;  2CA5 A;  4UIG A;  5ETW A;  1BR2 A;  4MFR A;  1NWM X;  3MK7 C;  3RYH E;  3V5U A;  2E9X B;  2NP9 A;  2VK9 A;  2VAS A;  5LA6 E;  2NWB A;  3FXE B;  4MHC A;  1ZHC A;  3UUL A;  1MMA A;  2EHO C;  3ETV A;  2LE8 A;  2M67 A;  3NZP A;  2KWI B;  3C64 A;  3OBV E;  5FY7 A;  1HFA A;  3VHL A;  3RRC A;  4O4L E;  2E9X D;  1YKH B;  3ZN0 B;  1QSD A;  2YIN A;  3KBU A;  4AKH A;  4QXH B;  4DMV A;  3LFM A;  4H9P C;  4KBM B;  2CXL A;  5LNK A;  3ANW B;  4EXT A;  4ZOL E;  3DJB A;  4BAY B;  2L3L A;  2KIN B;  5H6R B;  4JLE A;  3V5S A;  3MZK B;  4NUU A;  3L09 A;  3ZMU B;  3CX6 B;  3HKC E;  2MTQ A;  2RA1 A;  2V7L A;  4MBQ A;  2QGS A;  4WNK A;  1E1H B;  2XAS B;  4CXX A;  5L3G B;  4I43 B;  4M1P A;  4I50 E;  3KV6 A;  4ISS A;  2CLY B;  2OA5 A;  4DND A;  3ZC1 A;  3CML A;  5L3B B;  4GYS A;  2WM9 A;  2P9B A;  1O3X A;  3CVR A;  4OYJ A;  3FHN A;  4J2C A;  5LYJ E;  2CE7 A;  5LOV E;  4DO0 A;  5FXW A;  3LK4 2;  5JQG E;  5JR9 B;  4DVD A;  1HG5 A;  2YK0 A;  5JH7 E;  1S94 A;  2VB6 A;  4ZS2 A;  1D0Z A;  4WBO A;  3CQX C;  3T8O A;  5LJN A;  4HN9 A;  1WLX A;  3BQK A;  3C4X A;  1HF8 A;  2XUE A;  2JMK A;  3E0Z A;  3RX6 A;  2D0U A;  4YFS A;  1Z0P A;  2W62 A;  5LBQ B;  5EK2 A;  1OXZ A;  4G63 A;  3C50 A;  1WYB A;  5LBM A;  2ZM0 A;  3OYX A;  2V26 A;  4ZI7 E;  3O1I A;  4UVC B;  2H3R A;  3U78 A;  3DP7 A;  2LOP A;  2WSS V;  4PJJ A;  4HFV A;  3LJC A;  2N2N A;  2DWG A;  3RH3 A;  4G2A A;  3SS1 A;  3EDU A;  2V7K A;  4HGA A;  5F8P A;  4I55 E;  4PK4 A;  4TZ4 C;  3GA8 A;  1MMN A;  2WMN A;  3EVY A;  4YJ2 E;  3GN5 A;  1HX8 A;  4H63 H;  4CXW A;  3ETU A;  3TKL B;  4KUM B;  1FMW A;  2J1D G;  5HXS A;  3PUR A;  5AFU L;  2D0T A;  3IEE A;  2I59 A;  3C51 A;  4XBF B;  3OKQ A;  3J7Y q;  1MIY A;  5F3J A;  2UXX B;  3FXD B;  3F2E A;  4N78 D;  4O8S A;  4AQF A;  2BVL A;  4UEM A;  1HG2 A;  2XQY A;  4U72 A;  3I9Y A;  4TV8 E;  4X1K E;  4E7S A;  4CI3 B;  2ES0 A;  4V1A v;  5JDH A;  2SPC A;  4P0B A;  3J9X 1;  3IBP A;  2X9X A;  1BR4 A;  4YLH A;  2IW5 B;  3KVB A;  4P0A A;  2CWO A;  2PJQ A;  4I4T E;  1WR6 A;  3N2K E;  4IE6 A;  3AAE B;  5L2L A;  4XZC A;  2K5B B;  3ZN1 B;  5KDM C;  4K0U A;  3PUQ A;  2W61 A;  3FBZ A;  1B7T A;  5LG4 A;  2LT3 A;  1Y64 B;  2XTL A;  4DMW A;  4DBQ A;  3RRW A;  5DQW A;  4O4J E;  3PE0 A;  1IAP A;  2W00 A;  4QWN B;  4PK6 A;  4WBN E;  2VL8 A;  5JDN A;  3OJA A;  5LHH B;  4HKA A;  4OYK A;  2CLY C;  1ZKE A;  4ASK A;  3KV4 A;  1YKE B;  1US7 B;  3WAJ A;  3PUA A;  2B1E A;  5HXR A;  2JMH A;  3MJX A;  3IF8 B;  1IJ6 A;  2Y8D A;  1EZ3 A;  4ZI2 D;  3PUS A;  4OFZ A;  2Q9Q B;  4F6R C;  2BZB A;  3MXZ A;  3ZYL A;  3KVA A;  4ZI3 D;  2CM0 A;  3ZJ2 A;  2NW8 A;  3BQI A;  1X79 A;  3AAI A;  3UUX B;  1NAF A;  1YD8 G;  5HXH A;  1IJ5 A;  4HTE A;  3N5L A;  3N9P A;  4PK5 A;  3KBT A;  1UX4 A;  5HAX A;  4H63 V;  5GON E;  2XAF B;  5L3E B;  2VKJ A;  4MAL A;  3W15 B;  1MNE A;  3Q2M A;  4QXB B;  5JDM A;  5L3D B;  1FMV A;  3JC6 C;  3MAC A;  4DBR A;  3D0T A;  2Y48 B;  3N2O A;  3O1J A;  2X67 A;  3B13 A;  4GYR A;  1SA0 E;  3ZCI A;  4FI5 A;  4AI6 A;  2LEH A;  5DQV A;  4ADZ A;  3CKD A;  2DHR A;  4O4H E;  3N9L A;  2DCF A;  4KP3 C;  2Q9Q A;  3I0Q A;  2PBI A;  3ZMT B;  4PNI A;  2CEA A;  2NW9 A;  4EZ4 A;  4HE8 A;  2KLQ A;  2C5I T;  5HXE A;  1LRZ A;  5TAO A;  2RP4 A;  2WBL A;  5LGN B;  1UCU A;  2IAK A;  2V7M A;  2DI4 A;  1FEW A;  4MLK A;  5DAB A;  4EAH A;  5LCY A;  2N9D A;  3KFW X;  5J2T E;  4ZI3 C;  2KWH A;  4H9Q C;  5H6Q B;  3NZQ A;  4TUY E;  2Q9Q C;  3HKB E;  1H7C A;  1LVF A;  2CCQ A;  5CA0 E;  2KXP B;  4O4I E;  4UV9 B;  5HWY A;  4ZI2 C;  3S4U A;  2LM9 A;  3L3P A;  4C90 A;  5FY0 A;  3R6N A;  1YW0 A;  2ZM8 A;  5JRC A;  5LHI B;  2L9Q A;  3NRX A;  2EHO D;  1ZV4 X;  3K8P C;  3I0O A;  4HEA A;  2NTX A;  3CWZ B;  1S35 A;  1G73 A;  2ZMA A;  2H7O A;  3HL6 A;  3LBX A;  5HWX A;  4AQF C;  3N9Q A;  1MIW A;  3AAA B;  2A72 A;  2V7J A;  3O1H A;  1FIO A;  3LG7 A;  3C4W A;  4UVA B;  5FXX A;  2CMR A;  3O4X E;  4L9I A;  2CXD A;  4QXC B;  3F57 A;  5DJQ C;  2XAJ B;  1V9D A;  3ESL A;  4UXN B;  2MYS A;  4PJL A;  4BJN A;  4GK0 E;  2W0G A;  1T98 A;  2C5K T;  2G0U A;  2LJL A;  3ZC0 A;  2D2S A;  5LHG B;  1D1C A;  2ODU A;  3RPU A;  4KMC A;  4CI2 B;  5IYZ E;  4WW0 A;  2LSJ A;  2X68 A;  3FB2 A;  5HXC A;  4AKR B;  2E9X C;  2LHN A;  4AXP A;  1G8X A;  5LJM A;  2JPF A;  4B6X A;  5FXZ A;  3I9W A;  1BR0 A;  2X0L B;  4U74 A;  3RYI E;  2UXN B;  4QX8 B;  3MA9 A;  3ZMS B;  3QUJ A;  3UUM A;  2X66 A;  2A2F X;  5JR9 C;  4PW8 A;  3QC9 A;  4H9N C;  2C5J A;  3HI2 A;  3NBX X;  4QX7 B;  1ZEE A;  3ANW A;  3K3O A;  2Q9Q D;  4EOZ B;  1WYC A;  2E8I A;  3HR0 A;  5IHY A;  4AKG A;  2H7V C;  4CQI A;  4H9R C;  4UV8 B;  3SRZ A;  2NTY A;  4O2A E;  3ZJ1 A;  2N1G A;  3M65 A;  3GWH A;  4ANJ A;  4L0R A;  4YHJ A;  4AKI A;  4E7Z A;  1AJ3 A;  4BA9 A;  2NW7 A;  5FMN A;  3K3N A;  3ZYM A;  5JDL A;  1LVK A;  3Q5W A;  3A5X A;  2X9W A;  3RYF E;  5JDQ A;  3E08 A;  4IGU A;  2WMO A;  4TN7 B;  5JDG A;  2CXF A;  4H9O C;  5FYM A;  4ILU A;  2EHO A;  3CQC B;  3VU7 H;  2YU1 A;  3KIN B;  3GMI A;  5FNV E;  5LGU B;  3N9N A;  5M4Y A;  3SWH A;  2LSG A;  2HH7 A;  2WWU A;  5EK4 A;  3WAK A;  4H9S E;  3LK3 B;  4IE7 A;  5E0O A;  2KT9 A;  3RKO A;  3ZPO A;  2V1D B;  3BQL A;  3ZMV B;  3C98 B;  5L3C B;  3N9M A;  4EZH A;  2VKD A;  2DWK A;  4GIW A;  4L5G A;  4IHJ E;  5HYA A;  1VRB A;  2A3D A;  3CX8 B;  3PDY A;  4EYY R;  3U3I A;  3AA1 B;  2W63 A;  3ZCJ A;  4IDZ A;  4PAG A;  1HS7 A;  2DNX A;  2IC9 A;  2K24 A;  3CX7 B;  4NUV A;  1IZN B;  2LHR A;  2ZLY A;  1BR1 A;  3ONX A;  3P8C D;  3AA7 B;  3LBX B;  3KDS E;  1OWA A;  2WAU A;  4BJM A;  2KZ7 B;  3C4Z A;  3PU3 A;  5KX5 E;  3P7I A;  4FJO A;  2K48 A;  1U5P A;  2KMF A;  5EZY E;  4EYU A;  1D1A A;  1SHZ C;  3HKE E;  3VKH A;  3AA0 B;  3JC6 D;  1WRD A;  1KK7 A;  4P09 A;  2JRK A;  3N9O A;  2GK9 A;  2XAQ B;  2X9H A;  5JRC B;  3RYC E;  3PTR B;  4AKL A;  4O2B E;  2XHE B;  2XAG B;  3RC8 A;  2VKH A;  4OK0 A;  4GOU A;  1D0Y A;  3CQG B;  2X9Y A;  3GN5 B;  3H37 A;  3H3A A;  4JEU B;  2Z6E A;  5JDF A;  2HPL A;  2PG8 A;  4OHF A;  5BMV E;  2V7I A;  2ODV A;  1UX5 A;  2LSI A;  4A56 A;  2ZM2 A;  5LP6 E;  2LOS A;  3KV5 A;  5ADX L;  4CXY A;  4ZHQ E;  3ZMZ B;  3FBL A;  3O9X A;  2K9A A;  2HPJ A;  3F31 A;  3Q5X A;  2EHO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...