2KTRA

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrA00
2PPHA 3A1QB 1OEYJ 4GGQA 1EO6A 4GB9A 3CSTA 1YQBA 3PRZA 1WX8A 4ZYNA 3TL5A 4G3XB 4NNJB 3AULA 3BY4B 2G45B 3B1LX 3OJ3A 4BKTA 1U4AA 1WRDB 3ZIMA 4RM8A 5DPTA 4HPLB 2BWES 2LRWA 3A9KA 2KDEB 2HE7A 3T9LA 2G4DB 3APDA 2JUOA 1IP9A 5LXIB 2WWZA 2REXA 1ZW7A 3VH4B 2KOXA 1GJZA 3VDZA 3KH0A 2K25A 5FR6A 2M8SA 3T8MA 2XK5B 2BYEA 2MBEA 2IY0B 4JQWC 5JHBA 2I1KA 1P3QU 4G50A 1MG8A 2KO3A 1WXSA 4EEWA 4MM3A 2GBJA 3PLUA 1WGDA 1LXDA 4JGHB 2ZNVC 2ZNVB 5C23A 3QWZB 4EFOA 4HVBA 2JRIB 3L0WB 3U7DA 1UBIA 4GXBA 3VTVA 2FAZA 4DBGA 4DHJB 2KFJA 4X57B 2N1VA 4IC7B 2HJ8A 3IVFA 2N7DA 1WR1A 3ZNID 2WYQA 2KC1A 2KMAA 3ZRFA 2J0KA 2M0XA 2KFKB 4XZ4A 4PS8A 4NAWA 1TTNA 3R7RA 3H1UA 2L8JA 4WAAA 2G3QB 2XK5A 4II2B 1P1AA 4IM3A 4NY0A 2A5UA 2LZ6A 3ECIA 2NCNA 4GDLB 1G6JA 4W9DA 2O2VA 4M8MA 1OQYA 4I6PA 4HDOA 2ZCCA 3DBHI 3GOEA 2C60A 4MSMB 2N1WA 5D2MB 3LDZE 2LXAA 2O6VD 1WGHA 3NS8A 3WANA 4EZKA 4ANXA 1BT0A 3RT3B 1IPGA 2OJRA 2KJ6A 3KVFB 4JIOU 2ZJDA 3PRMB 2K8CA 3QIJA 3UINB 2KTFA 1RRBA 3OAWA 1OTRB 4ANWA 5TR5A 3UGBB 1YX5B 2O6VB 2PJHA 1RFAA 3P2BA 1J0GA 2N7EA 4PS7A 2GBKA 2MA9B 3L54A 3CSFA 1P0RA 2IO3B 2MBOA 3ZNGC 2BF8B 2FIDA 5J2RA 3X0WA 1WGRA 3KUCB 4WWNA 3W1YA 4F7ZA 3ZLZA 3A4SC 1WZ0A 3HHMA 3WAPA 4TQ0A 1OGWA 4EOYA 2LWPA 1A5RA 2R2QA 1SE9A 5CTRC 1ZGUB 3TJPA 4EZLA 1WM2A 1D3ZA 2K6QA 1TBEA 4LDTD 2DZIA 4N9F4 2C9WB 1KLVA 3A4RA 2EMSA 2CS4A 2O6VA 5CHWA 2GMIC 4IG7B 4CHKA 2LGYA 2BKRB 3PHWB 1KM7A 2KQ7A 4AJWA 4GU2A 4LDTB 1V9JA 2RGFA 1WE6A 3JYUA 2L76A 1UGMA 2KDFB 3L17A 1T0YA 1WX7A 4IWQA 2BGFA 4GDLA 4NJ7A 3DBSA 1UELA 3DVNV 1Y8RC 2JT4B 2KX3A 4HDQA 5D94A 1LFDA 3DBLI 4W9CA 1I42A 3ZDTA 1UZXB 3RZFA 2CR5A 4KVGB 3V61A 4M0WB 3W1SA 2N9PC 2D10A 2DYBA 2AWTA 3U30A 4A3PA 4CO7A 4BOSC 3SDLC 4IUMB 4KDLB 1WJ4A 3L10B 5CX3A 3DOWA 4IWOA 1WFYA 3PZDA 2RD0A 4PS3A 1V86A 3PT2B 3VQIA 4IM2A 4W9JA 3ZO5B 2MP2B 2A4ZA 2IBIB 2NS5A 4HPMB 2L0FA 2CKHB 2NVUI 2NBVB 2KWVB 4XC2A 2IY1B 2KTRB 2DYOA 1GC7A 2MCNB 1C3TA 1YIWA 3ZUNA 2DZKA 4MH0E 4DDGD 3K9OB 2KWUB 3BINA 4KDIC 2MX2A 2VRRB 2AL6A 4I6NB 4DDID 4E74A 2DAFA 4HWIB 1PQSA 2N9XA 1WMHB 3ML8A 1L2NA 1WR6E 2AEHA 4MGZE 1LM8B 2AYOB 1M94A 4TUUA 3PLVA 1S1QB 4LJPB 2KJHB 4NJ6A 5JZEB 2YVCA 2MP2A 4FHKA 2BKFA 4ICUA 1UBQA 1V81A 4A20A 1H8CA 4WJOA 3MHSD 3KW5B 5BO4B 3QX1A 4K7UA 4WWPA 2J7QB 2JVCA 1WM3A 4FULA 4BKSD 1JRUA 2LRUA 1VCBA 4W9IA 4TQ1A 5GMVA 4MDKE 3KUZA 1XD3B 1Z2MA 3RYTA 4BVUC 3ZTCA 2GBMA 4MSQB 2IZVB 4MGIE 4DK5A 1IYFA 1EF5A 4AUQC 3PVLA 3OLMD 4ZRKA 2KDBA 1I35A 3KYCD 3H7PA 1WZ3A 3AI5A 2HTHA 2KVRA 1KJTA 3DBRI 4GDKB 4W9HA 4NPNA 2MBQA 2ZPNA 2G4SA 4FN2A 3ZNHB 4F1SA 2C5LC 3TBLD 4A3OA 1WJ6A 3VH3B 4J6IA 2K39A 4DHZE 3RUIB 2PEAA 3HIZA 2EMTA 2KTRA 4RM9A 2JXXA 2JZZA 2JZ3B 2LD9A 3IBEA 4FJVB 3ZKJC 2LXCA 5KHQA 3ZNZB 1V5OA 1WJNA 5LXHA 2HD5B 1AARA 4AJYB 3SU8X 4OVUA 2WDTB 2LGDA 4HJKA 2WX0A 3KYDD 2WX1A 4ICVA 5CHFA 3H7PB 4MEMA 3APCA 5D7GA 4BKSA 1UD7A 4BFRA 4IWPA 1WIAA 3NZUA 1TGZB 4GN1A 1Z5SB 2K6DB 2C7MB 3R7QA 3NOBA 1E8YA 4KSKC 3PTFC 2FIFA 4DHJD 3WAOA 2DHZA 3U8ZA 4KV2A 4HXDA 3WIMA 2UYZB 2ZZPB 2GOWA 2FCMA 2V4LA 5LLIA 4GOCA 3DVGX 3O65B 3VXWA 2ZEQA 4IW0A 4WJQA 5L95C 1GUAB 2KMCA 3JVZX 3EC8A 4CYEA 1S3SG 4YL8A 1WGGA 3LJ3A 4WWOA 4E3CA 3VFKA 2KN5A 1YX6B 4GIVA 3A9KB 5IA7A 1FXTB 2LVQA 4PYUA 3ZW3A 3ZRCA 1X1MA 3CF6E 2N4FA 1WXVA 2D07B 2CHZA 4FLHA 3RULA 3X23A 1WE7A 4EUTA 4HCNB 2C7NB 3UQBA 1NBFC 5D6JB 4HK2A 2M1MA 4TKNA 3RD2A 2IO0B 3D32A 2LVPA 3M62B 2N9EB 3QQ8B 2M4NA 3PHXB 3I3TB 3JW0X 4IM0A 4BKGA 2LJ5A 3K9PB 4F8CB 1SGHA 2QHOA 2CHXA 2KANA 3B0AA 3MTNB 1WI0A 2K8BA 4FJYA 4MJSA 3B08A 3V62A 4E71A 2XBBC 1WYWB 2KLCA 3Q3FA 5KHOA 2FCSA 2LASA 3ONSA 4W9FA 3DCGA 4RMAA 3R66C 4I6LB 3UIOB 2DZJA 4NAWB 3Q3JA 5HKHA 3DDCB 2RPQA 1GG3A 5DPWA 1YJ1A 2O2VB 4NQLB 2YLMA 5G55A 3VUYA 4TV3A 2NBWB 2KK8A 3UQAA 2CHWA 5E6NA 5J18A 3JSVB 3VVWB 3PGEA 5J17A 3APFA 3IFWB 4LJOB 4W9EA 2PE6B 4II3B 1GC6A 3QCAA 3RCZA 5JHAA 1LQBA 5JH5C 4M8NA 1J8CA 2NBUA 1F9JA 2W9NA 3ENEA 3PREA 3QK0A 4W9LA 2J0MA 3A1QA 1E7VA 5DCNA 2L0TA 1OEYA 4AOFA 3WALA 2FCNA 1UH6A 1E7UA 2FUHB 4ZDVA 5EDSA 2KDIA 3HK0A 4K1RB 2BWFA 2V1YA 3GZNI 1L7YA 2KQSA 2BYFA 4HLEA 2L7RA 4URKA 3JSVA 2MSED 4XX5A 2AL3A 2KJRA 1WY8A 2M17A 3A33B 3MJWA 1XQQA 2LUEA 2RR9A 2DZMA 2MQJA 2ZVNA 3A9JA 4MJSB 3TCAA 4JL9A 3VTUA 2FCQA 2Z59B 2ZVOA 5L83A 5E6PA 1EUVB 2MBHA 2KLGA 2Z0EB 1NI2A 2NPTA 4EKUA 2R2OA 4GDKA 4WJNA 2MRPA 3DVGY 3ML9A 2PE9A 2K8HA 3TIXA 4KIKB 3UIPB 3VUXA 1V6EA 2RSUA 5C1ZA 1WGYA 3PPAA 2LI5A 4LCDE 2DAJA 2KXJA 3OJ4B 2JWZA 3QA8A 2J0JA 3AU5A 2MWSB 3N32A 3V6CB 1V80A 3NZSA 3UF8A 2GBNA 2KFKA 2I1JA 3V6EB 4ANVA 4ANUA 1NDDA 3A9JB 4DHZB 4ZRIA 2V3SA 5AEKB 3QC8B 2K1FA 3RZWC 1E8ZA 2CU1A 1Q0WB 2GBRA 3HM6X 3QARA 2ZCBA 4NQKE 4B95A 3N3KB 4G11A 3R3MA 4OVVA 2KD0A 5DPSA 4FADA 3H7SA 4GMVA 3ZDMC 2KWCA 2L3ZA 3EECA 3PSEB 2DX5B 2IO1B 2NR2A 4K81A 3AXCA 3ALBA 1RAXA 2MLBA 4FHJA 5DPRA 1SIFA 2Y5BB 1R4NI 4DXAB 1WXAA 3M63B 2DYMA 4MELA 2IYDB 2D11A 1WH3A 1WF9A 3VAWA 1GNUA 1Q1OA 4B6WA 2L05A 4JLCA 5AZGA 5G2NA 3DQVA 2KZRA 3H9DA 3ZTDA 2BYVE 1WMHA 4KSLC 3VUWA 3WA0A 2NPTB 3PS6A 5AZHA 3QJZA 3V60A 4AWJA 4FA6A 2DENB 1VD2A 2JRHA 1Q5WB 4FJZA 1H4RA 1R4MI 1ZKHA 4EZJA 3H6NA 3IHPC 2IO2B 1E90A 3PRPB 4KIKA 4B9KA 2KX0A 3M3JA 2LVOA 4P7IA 5IAAC 3TMPB 3SD5A 3L08A 3SHQA 1E5WA 3W1SC 2KKCA 3IG3A 3L13A 2KC2A 3M95A 1EF1A 2JPHA 3HM3A 4BBNF 1WX9A 3NY5A 1P9DU 3S2AA 1TZ1A 5AZFA 1E8XA 2Z0DB 4W9KA 4KZ0A 2UWQA 2B3AA 2KHWB 3EFUA 3DPDA 4BBNC 1CMXB 1KOTA 3CMMB 4G0NB 2KNBA 2FNJB 3AU4A 3PV1A 4WJPA 4K7WA 1RLFA 1XT9B 2JF5A 1V5TA 2ZPYA 2MW5A 4W9GA 4FBJB 2ASQA 5CHVC 1HE8A 5E6OA 4AP4C 3NHEB 4MGKE 2L00B 2EKEC 4DWFA 2JY6A 4GSWA 4K7SA 1ISNA 4PYZA 3VHTC 1P98A 3C0RB 2C7HA 3QHTA 4ZRJA 2D2QA 1E8WA 2LGXA 3VTWA 3EHVA 3N30A 3ZVVA 1WJUA 4HCPB 4MGYE 3QAQA 3DVNU 3KUDB 1QZEA 1C1YB 3WAMA 4BOZB 1K8RB 2D3GA 4KZCA 4WQOB 4ASWC 1V2YA 2MBBB 2OOBB 1V49A 1WXMA 1YD8U 1J19A 2XEWA 3L16A 2BPSA
chains in the Genus database with same CATH superfamily
1RM6C 2AQ3B 1OEYJ 4GB9A 4ZYNA 4G3XB 1HTQA 3BY4B 2G45B 2KDMA 3OG5A 3E56A 4HPLB 2BWES 2G4DB 3APDA 4ZHPA 2REXA 1ZW7A 4HROA 3VH4B 4BZAA 3VDZA 1C4CA 3BZDB 1MG8A 4MM3A 3PLUA 4JGHB 2ZNVC 3QWZB 4YT0B 3U7DA 1UBIA 4GXBA 1GPXA 2W3RA 4AQ7A 3VTVA 2KFJA 4GLSC 1QKZA 4IC7B 2N7DA 1WR1A 4LK0M 1SJED 5FK9C 2J0KA 1QT9A 4PS8A 2L8JA 2XN9C 3IXSA 4II2B 5I4DA 4NY0A 4GDLB 2NCNA 2WXQA 3BK2A 1OQYA 4HDOA 2O6VD 2JU6X 1ZXIA 4ANXA 1BT0A 3AEDB 4EZKA 2KJ6A 3KVFB 1C78A 4RFBA 3PRMB 1OTRB 2INCC 4KKJA 1YX5B 3DHHC 1J0GA 2MA9B 1RYJA 1P0RA 1DOYA 2FIDA 2VH1A 4WIPA 3KUCB 3A4SC 2QJLA 2LWPA 1SE9A 5BMGA 4EZLA 4D2KA 1WM2A 3GS2A 1TBEA 2DZIA 2VZKB 3P4SB 2I38A 2RDHA 1J7BA 4M01A 4S17A 2O6VA 4C7YA 2GMIC 3PZ8A 3RNBC 4CHKA 3DHIC 2BKRB 2KQ7A 4GU2A 4LDTB 2L76A 2KDFB 4O1NA 1QOFA 1T0YA 1L6UA 4ZRQA 2RPVA 1Y8RC 1L6VA 2JT4B 4HDQA 1A70A 4WH4A 1UZXB 4KVGB 1J7AA 4M0WB 2N9PC 2DYBA 3RMKC 3P4PB 4BOSC 3SDLC 4IUMB 4KDLB 4C56C 3L10B 4IWOA 4C80A 4PS3A 5JXVA 3PT2B 2LJIA 2MP2B 2A4ZA 2NS5A 1UNSA 1TY2A 2CKHB 2KWVB 2KTRB 3ZUNA 1ACCA 1WRIA 4DDGD 2VRRB 4DDID 1HZ5A 4E74A 4HWIB 2N9XA 1L2NA 3ML8A 4MACA 1LM8B 3PLVA 2WDVB 3Q2AC 4LJPB 1UBQA 2QC8A 5FKAC 4A20A 1H8CA 4AS1A 1C4PA 4K7UA 1WM3A 4FULA 4BKSD 4W9IA 3SFEB 4TQ1A 5GMVA 2IZVB 2QMTA 3OLMD 2KDBA 3U4EG 5T8IA 3TEYA 1K50A 1XLQA 1D5MC 2PTLA 2EKIA 2C5LC 2L1AA 3TBLD 1I7HA 1WJ6A 2D5GA 4DHZE 2K39A 4YTMB 3ABVB 1N6ZA 4CQNA 2JXXA 2LD9A 3ZNZB 2HD5B 1XLNA 2WX0A 2WX1A 3Q8EA 4MEMA 4BFRA 3I63C 3AMZA 4IWPA 4RCOA 3NZUA 4HKZE 3URYA 1TGZB 1FRRA 2C7MB 3RNGC 4WWMA 1XEEA 1E8YA 2D3BA 4KKIA 5G5GA 4P6VF 4DHJD 2V4IB 4LTUA 4ARCA 2L52A 2V4LA 1WWTA 1GAQB 3O65B 2BBCA 5BYSA 1GUAB 1PGXA 3IT4B 3JVZX 3EC8A 2QEJC 1PYWD 4WWOA 3VFKA 1YX6B 3P1MA 5IA7A 4NAMA 2K9XA 1FXTB 1ENFA 3ZYYX 4PK1A 2LVQA 3I57A 2W55A 3CF6E 3FILA 1DOIA 3X23A 2ACZB 3UQBA 2GLSA 1Y56A 4HK2A 3RI7C 3M62B 2M4NA 3I3TB 3BVMA 4YTPB 3B0AA 3ETRA 3MTNB 4A90A 1L0VB 2J4XA 1KLGD 2FCSA 3RNAC 2DZJA 3Q3JA 5HKHA 3DDCB 4C4VA 2RPQA 2WXMA 3R2IA 4NQLB 1R4MB 1BUIC 2KK8A 5E6NA 5EE1A 3P63A 4OW0A 2WXHA 3BVZA 1FEHA 1D5ZC 4NJCA 3MC8A 3RCZA 2OHFA 3TSSA 3HRDD 4IOIE 5JH5C 1F9JA 4W9LA 3QK0A 2J0MA 3SFDB 2MHJA 3WALA 1UH6A 1E7UA 2YEPF 2BYTA 2JYTA 3GZNI 1ET6A 2KQSA 2BYFA 4HLEA 1HTOA 1TS5A 1EWYC 2MSED 2PKOA 2RR9A 2DZMA 2MQJA 1FRDA 3TCAA 2ZVOA 2LHEA 1EUVB 2KLGA 4JWUC 2R2OA 1AN8A 4GDKA 2BT6A 4XYCA 1SE3A 3DVGY 3TIXA 3DBRB 3UIPB 1V6EA 2RSUA 2LI5A 4TSSA 5HHDG 1MJDA 4IKGA 3OJ4B 2KXJA 2PVGC 2ZW0A 3VR8B 3LXFA 2MWSB 2R61A 1FXIA 2I1JA 4ANUA 3N1XC 2LHDA 2ZCBA 3EGRA 2KQ4X 2DLBA 2BVCA 2KD0A 5DPSA 2IGGA 4FADA 3GE3C 3U52E 3BWUD 3EECA 1SXTA 1CZPA 3ALBA 2G9HD 1R4NI 3VAWA 2IYDB 1WH3A 2L05A 5AZGA 2KZRA 1WMHA 4KSLC 2B76B 1TIFA 3QJZA 1TT5B 1H4RA 1YOVB 2IO2B 2KACA 2KX0A 4P7IA 3FKYA 5IAAC 1E5WA 2QDFA 3W1SC 3IG3A 2VH2A 1EF1A 3HM3A 3S2AA 2KAJA 1NEKB 2PLPA 5BYQA 5D3DA 4G0NB 2KNBA 3AU4A 2UU7A 2JSVX 2ZPYA 5CHVC 1KFYB 2L00B 2EKEC 2RDBC 4XDCA 4PYZA 2C7HA 3AEFB 2AQ2B 3FAHA 3DWMA 3ZVVA 5HI1A 1FCCC 1I4PA 4OZCA 4BOZB 1K8RB 3O13A 4KZCA 1T5XD 3R8BA 2OOBB 1V49A 2XEWA 3IAM1 1J7CA 2PPHA 3A1QB 4OZAA 1EO6A 4JE3B 1YQBA 3PRZA 1ESFA 1YMHE 1WX8A 2GB1A 1OQQA 1XF5L 1ZXHA 3P4RB 5DPTA 4ZYSA 4YXDB 1WSPA 1IGDA 2M56B 2WWZA 2PW9A 1MFWA 1YNTE 1MPEA 2CJNA 2TSSA 4YTNB 2K25A 2M8SA 2BYEA 2MBEA 2IY0B 4JQWC 1TKYA 2I1KA 4G50A 1WXSA 4EEWA 4N58A 3N1ZC 5IKCM 2GBJA 3ZGZA 2ZNVB 4IDIA 4HVBA 2IDYA 4DBGA 2FAZA 4DHJB 1T0SC 4X57B 1KRHA 1E9MA 2KC1A 2KMAA 3NJTA 4XZ4A 5EE9A 1TTNA 3H1UA 2G3QB 3GP7A 5IOIA 1KH0A 4DQOC 4M02A 2O2VA 1TY0A 3DHGC 4MSMB 3GB1A 3DWGC 5D2MB 1ZE3D 1PGAA 3RT3B 2QIEB 2PIAA 5IP4D 4ANWA 1QLBB 5TR5A 2OJWA 4HEA1 4USAA 4PS7A 1BMLC 4H2AA 2IO3B 3ZNGC 2E3TA 3X0WA 1EU4A 3ZLZA 1LGRA 3WAPA 4TQ0A 3CWIA 4EOYA 1ZDXA 4HPPA 1D5XC 1CJEA 3C19A 3AM9A 4N9F4 2MJDA 2CS4A 2QCZA 1MHXA 5CHWA 5H8YE 1FXAA 4AJWA 4J3OD 2RGFA 3TEZA 2V3NA 4NJ7A 2INDC 4RF1A 1UELA 4RGMA 4C00A 2KX3A 4W9CA 3V61A 5HG2A 1FNWA 4RGOS 3W1SA 3U30A 1JWMD 3DOWA 3VQIA 3B2GA 4IM2A 3ZO5B 4HPMB 1OFFA 4XC2A 1B1ZA 2DZKA 4MH0E 1SIJA 4KDIC 2DAFA 1PQSA 2RMMA 1JMLA 1Q10A 2AYOB 1M94A 2KJHB 4NJ6A 5JZEB 3NS1A 2MP2A 4FHKA 3AH7A 4ICUA 4DXGA 3N1YC 4WJOA 1RFKA 1JRUA 1VCBA 3TEXA 3KUZA 2J53A 1XD3B 1Z2MA 3IAS1 4BVUC 3ZTCA 2GBMA 2KMMA 4MSQB 2WNMA 1I35A 3KYCD 3AI5A 2KVRA 4WQMA 2MBQA 3NZ3A 4FN2A 3EFCA 4F1SA 1N62A 3RFZB 4KGRA 3HIZA 2EMTA 2X38A 4OHJA 1N5WA 2JZ3B 4FJVB 3ZKJC 3IBEA 5LXHA 4AJYB 4OVUA 4HJKA 3KYDD 1FO4A 4NZLB 4BKSA 1UD7A 3BK1A 1I4RA 1JRPA 3AE8B 1NYRA 1VR9A 1Z5SB 1F2RI 3W5UB 3U8ZA 4KV2A 1IUEA 2JX5A 2UYZB 3WIMA 2ZZPB 3SEBA 3VXWA 2ZEQA 1PUTA 5L95C 1QOBA 3AE1B 1S3SG 2JQRB 3LJ3A 3RNEC 3P42A 1N63A 1JCKB 2KN5A 3A9KB 5HFYA 1UWMA 1WXVA 4FLHA 3RULA 1WE7A 4ARIA 4HCNB 2C7NB 4LLGM 1YJJA 1QILA 4TKNA 3RD2A 3D32A 2N9EB 3QQ8B 2JZPA 4F8CB 2QHOA 2KANA 1JWBD 2MH7A 4FJYA 3Q3FA 3ONSA 3DCGA 4RMAA 4I6LB 3UIOB 4NAWB 1GG3A 2O2VB 5G55A 3VUYA 4LNKA 2NBWB 4L1BA 2Y3AA 3PGEA 5J17A 1STEA 3IFWB 4LJOB 1NI3A 2PE6B 1GC6A 1AWDA 1T0RC 1VDVA 5JHAA 1J8CA 2QSDA 2NBUA 4RGNA 1SSNA 5IO9A 1EWCA 2W3SA 5AUIA 1OEYA 4AOFA 4HJGE 5D3IB 1L7YA 1N60A 3EUB2 1IBXB 2L7RA 4K3BA 3BVGA 2KJRA 1SJHD 1XQQA 1L4DB 2ICIA 5E6PA 1YQ3B 3J9CA 4EKUA 5E6JA 1GOZA 1ZPSA 4WJNA 3W2DA 1F0ZA 3VUXA 1RWSA 2ONQA 1FNVA 2G1EA 2JWZA 2J0JA 3AU5A 4B0MA 3UF8A 3I9V1 3V6EB 4DHZB 4ZRIA 1Q0WB 4NQKE 3N3KB 4G11A 1B9RA 3R3MA 4OVVA 1E10A 2V3PA 3AE3B 1MG4A 2WXPA 3H7SA 4GMVA 3ZDMC 2KWCA 4K81A 1ET9A 1RAXA 1SIFA 2Y5BB 2MJEA 3DBHB 2DYMA 1GNUA 4JLCA 3ZTDA 3VUWA 3PS6A 4US9A 3W9CB 4FA6A 1YN5A 4FJZA 1EU3A 3Q3OC 3H6NA 3PRPB 1E90A 4B9KA 4QAYA 3SD5A 1F1HA 3BIID 1XO3A 4MT5A 3M95A 4BBNF 1AW7A 3AE6B 4KZ0A 1HZ6A 2WXKA 3DPDA 1N61A 1KOTA 2LGIA 1E0ZA 4WJPA 4K7WA 1RLFA 1XT9B 2GRIA 2ASQA 4AP4C 1N5XA 1XLPA 3VHTC 1YN4A 1P98A 3QHTA 4ZRJA 2D2QA 3B9JA 3EHVA 1K53A 2DNFA 1HEZE 1WJUA 4HCPB 3QAQA 1C1YB 2D3GA 4WQOB 1V2YA 2MBBB 1WXMA 3L16A 2BPSA 4OVZA 1JWSD 4GGQA 3CSTA 3TL5A 3Q8BA 1C79A 3AULA 4RM8A 1UF0A 1IGCA 3A9KA 2HE7A 2OEDA 1L0XB 1IP9A 2AX5A 2KOXA 2WXIA 3KH0A 4P1CC 3T8MA 2XK5B 1JALA 1WGDA 2Q5WD 5C23A 3Q8AA 1UUPA 2WGSA 3IVFA 2FBWB 3ZNID 3ZRFA 2JYEA 2XK5A 1P1AA 4IM3A 5FR3A 2A5UA 2LZ6A 3ECIA 4N59A 1G6JA 4W9DA 4WAFA 2ZCCA 1SE4A 2C60A 3LDZE 2LXAA 1WGHA 3EA6A 5IN7A 2CJOA 1XLOA 2ZJDA 1TS2A 2KTFA 3OAWA 2H89B 2O6VB 1RFAA 3P2BA 1XCQL 3AE2B 3L54A 3CSFA 1R4NB 2BF8B 5AUKA 3MJ5A 1PDXA 3W1YA 4WWNA 3HVZA 1UWXA 1WZ0A 3GZNB 1ZUD2 1OGWA 1A5RA 5CTRC 1ZGUB 3TJPA 4EE2A 4LDTD 3NRZA 2DWQA 2EMSA 2FE8A 4REZA 2LGYA 2VZKD 1WE6A 3JYUA 3L4PA 1UGMA 3L17A 1WX7A 2BGFA 2L83A 3DBSA 3W5VB 2WXFA 5BMIA 2YEPB 4RGTA 5D94A 1LFDA 1VJKA 3CIRB 1I42A 3RZFA 2CR5A 4ZHOA 2D10A 1FMAD 4A3PA 2LGSA 3NVYA 2IGDA 1WJ4A 4TMAB 4A55A 2BQQA 3PZDA 1V86A 3AECB 3N9YC 1C76A 2NVUI 2NBVB 1WYGA 2IY1B 1GC7A 2KWUB 3P4QB 1I4GA 1GB4A 1WMHB 1WR6E 4MGZE 4TUUA 1S1QB 4JWSC 4DXFA 4K3CA 2BB6A 2CU3A 3Q3MC 2IPKD 5BO4B 3KW5B 3QX1A 1TKGA 1TJEA 1V8CA 2ZW1A 2JVCA 2PVOD 2LRUA 2NMQA 3RYTA 3MHZA 4DK5A 4AUQC 4HRSA 3H7PA 1JWAD 2HTHA 1KJTA 3T3OA 3TEWA 4W9HA 2G4SA 3ZNHB 4A3OA 2JXTA 3V3XA 4J6IA 1C77A 4A9AA 2JZZA 5KHQA 3SU8X 3BYTB 4JX1C 2WDTB 3H7PB 3APCA 1WIAA 4P16A 2WXJA 3ZXVA 4GN1A 2N9LA 1QF6A 3R7QA 1JROA 1D6EC 2DHZA 2KYWA 3LYYA 1F52A 4HXDA 2MJ3A 2Y5PA 1PGBA 5LLIA 2H88B 4WJQA 3NUHB 3KWVA 2BS2B 3AE4B 2KMCA 4CYEA 4RF0A 4YL8A 1I4HA 1WGGA 4P1BC 2BS3B 2M19A 3ZW3A 4PYUA 3ZRCA 1X1MA 2N4FA 2D07B 2CHZA 4FXCA 1YJIA 4EUTA 4ITKA 5D6JB 2IO0B 2QILA 4IM0A 3JW0X 2LJ5A 3K9PB 3PZ7A 1SGHA 2CHXA 2W82A 1WI0A 2K8BA 1T6BX 3V62A 2WQYB 2W54A 2LASA 4W9FA 3KQ4A 4HKQA 3R66C 2WDRB 1M4VA 2Z8LA 5DPWA 3KLSX 3IT6B 2YLMA 4M00A 2CHWA 4RNAA 4W9EA 1V1OA 4LNOA 2JWUA 4II3B 4M8NA 3ENEA 3PREA 3A1QA 2D3CA 1JWUD 2FCNA 4ZDVA 2KDIA 4K1RB 2BWFA 2V1YA 5TSSA 4ZOHC 2HDEA 1AYFA 1DYQA 3A33B 3Q14C 2LUEA 3A9JA 2ZVNA 1SB3C 1D4BA 1ZDVA 3VTUA 2FCQA 5L83A 1NI2A 2NPTA 2N0SB 2NTTA 2MRPA 2PE9A 1MI0A 1SE2A 4KIKB 3GE8C 4RH6A 5C1ZA 4LCDE 2DAJA 3N32A 1LO5D 3V6CB 1V80A 2KFKA 4L23A 4ANVA 3U2SC 1PFDA 1NDDA 1T3QA 2J52A 2N9KA 5AEKB 2K1FA 1E8ZA 2CU1A 2GBRA 1KTKA 2WXOA 3PSEB 2IO1B 2NR2A 3AXCA 4KX6B 4LNFA 5DPRA 4DXAB 1WXAA 2V0GA 4MELA 3DQVA 3H9DA 1K51A 2BYVE 1TYGB 2NPTB 5AZHA 4L2YA 3SR6A 3AEAB 1R4MI 3IHPC 4KIKA 1JQ4A 3M3JA 2LVOA 1T0QC 3L08A 3SHQA 3ZJTA 3L13A 2WU2B 2JPHA 1FFVA 1P9DU 3NY5A 1TZ1A 5AZFA 1E8XA 1C4AA 2Z0DB 3AE9B 4W9KA 2UWQA 3UI3A 3MC9A 1R7SA 5H92C 1CMXB 3PO0A 3CMMB 2INPE 2FNJB 3AEBB 3PV1A 2MW5A 4W9GA 4FBJB 1HE8A 5E6OA 3NHEB 2Y5CA 1CK1A 1L5PA 4DWFA 4XDDA 2JY6A 2KVZA 4GSWA 4K7SA 1ISNA 1VZ8A 3NVVA 3RN9C 2SEBD 3N30A 4MGYE 3KUDB 1QZEA 2NTSA 4ASWC 1YD8U 3MFGA 1NENB 1NYQA 3R2TA 4NNJB 1FCLA 1MVKA 1I4QA 3OJ3A 3B1LX 4BKTA 1U4AA 1WRDB 3ZIMA 1IBXA 2LRWA 2KDEB 3T9LA 2JUOA 3AE5B 3Q6BA 5LXIB 1V1PA 1SBBB 2WS3B 1GJZA 5FR6A 2BS4B 5JHBA 1P3QU 2N7JA 2KO3A 1KLUD 1XXGA 2IGHA 1LXDA 2HJ1A 2RDGA 4EFOA 3T3NA 2JRIB 3L0WB 1L4ZB 4C7ZA 3VR9B 2N1VA 2HJ8A 2PMVA 3Q69A 2WYQA 3ZXRA 3NVWA 2M0XA 2KFKB 1HQRD 2I2YA 4NAWA 3R7RA 4WAAA 3Q8CA 4M8MA 1E7PB 4OZBA 4I6PA 1NVID 3DBHI 3GOEA 2N1WA 3NS8A 3WANA 4C4VB 2BTEA 1IPGA 1SF0A 2OJRA 1MHHE 4JIOU 1QQRA 2K8CA 3QIJA 3UINB 3V05A 4XWTA 1RRBA 3UGBB 2PJHA 2LUMA 2N7EA 1E6EB 2GBKA 1DGJA 1QOGA 3HUIA 3ZJVA 2MBOA 5J2RA 1WGRA 4F7ZA 3HHMA 2R2QA 4KGTA 1F77A 1D3ZA 2K6QA 2KT7A 2C9WB 1KLVA 3A4RA 4YSZB 4IG7B 3PHWB 1KM7A 1V9JA 5BYRA 1TS4A 1WXQA 2LEKA 3Q3NC 4GDLA 4IWQA 3DVNV 4XGAB 1VZ6A 1QOAA 2X8XX 2WLBA 3DBLI 3ZDTA 1YN3A 2AWTA 4CO7A 3ZJUA 1GB1A 5CX3A 4ACFA 1WFYA 2MEKA 2RD0A 4W9JA 2IBIB 2V9HA 3AE7B 2L0FA 3NVZA 2DYOA 3DBLB 1C3TA 2MCNB 4JPSA 1YIWA 1F2RC 3K9OB 3BINA 2MX2A 3VRAB 2AL6A 4I6NB 3RNFC 1P7FA 2AEHA 4PT5A 3N20C 1FFUA 3B2FA 2YVCA 2BKFA 2WU5B 1V1PB 1V81A 1FNUA 2K0PA 3MHSD 3AEGB 4WWPA 2J7QB 2KN4A 4MDKE 4M0WA 2BB5A 4MGIE 1IYFA 4N6EB 1EF5A 3AB5A 3PVLA 4ZRKA 1ROEA 1WZ3A 3DBRI 4GDKB 2IJ0A 4NPNA 2ZPNA 2D3AA 2M0AA 3VH3B 5BMHA 3RUIB 2PEAA 2KTRA 2EELA 4RM9A 2BW2A 2GI9A 2LXCA 1V5OA 1WJNA 1AARA 3WCQA 4XWWA 2LGDA 1P7EA 4ICVA 5CHFA 5D7GA 4S0RA 2HTME 3AN1A 2K6DB 3NOBA 1JW9D 4KSKC 2FIFA 2XNAC 2WHIA 3WAOA 1OQRA 4LNIA 1V97A 2LMCA 1FD6A 2FCMA 2GOWA 4GOCA 2WXGA 3AV8A 3DVGX 4IW0A 4US8A 4E3CA 1DOXA 4YSYB 4GIVA 2LFIA 1KF6B 4KGSA 5EE0A 1HXYD 1YQ4B 1NBFC 2ON8A 1I4XA 2M1MA 3OWEB 2LVPA 3PHXB 4BKGA 3BYYB 4MJSA 3B08A 4E71A 1K52A 1SEBD 2XBBC 1WYWB 2KLCA 3H8HA 5KHOA 3RNCC 1HA5A 2K22A 2E6XA 1YJ1A 4MH8A 2WDQB 4A6QA 4TV3A 2WXNA 3UQAA 5J18A 3JSVB 3VVWB 3AEEB 3APFA 1L0YB 3QCAA 1LQBA 2W9NA 1ZP0B 4YWGG 1E7VA 5DCNA 1UGJA 3LB8C 2L0TA 1EM7A 2FUHB 5EDSA 1TZOA 3HK0A 4URKA 1XCTL 5EE3A 3JSVA 4XX5A 2AL3A 5C2TB 1WY8A 3VRBB 2M17A 3MJWA 2J42A 4MJSB 4JL9A 2Z59B 3HVDA 2MBHA 2Z0EB 5MPOA 4A8XC 1CQVA 3ML9A 2K8HA 1TKEA 4R3DA 4Q2JA 2WXLA 1WGYA 3PPAA 2AQ1B 5GXGB 3QA8A 1TS3A 4ZRPA 3NZSA 2GBNA 3MC0B 1VRAB 3A9JB 1FM0D 2V3SA 1VZ7A 3QC8B 3RZWC 3E9SA 3HM6X 2INNE 3MP9A 3QARA 4B95A 3KWLA 5LNK1 2L3ZA 5C3JB 2DX5B 4WURA 2FUG1 2MLBA 4FHJA 3M63B 2D11A 1WF9A 2DBYA 1Q1OA 4B6WA 5G2NA 4UDUC 3TUOA 3WA0A 4YSXB 2K3UA 4AWJA 3V60A 2DENB 1VD2A 2JRHA 1Q5WB 3ZQ4A 2K5PA 1ZKHA 4EZJA 3FILB 3TMPB 2KKCA 5G5HA 2KC2A 1WGKA 3C8YA 1WX9A 3Q8FA 4XE0A 2WXRA 2B3AA 2KHWB 3EFUA 1BXTA 4BBNC 3RPFC 2WP9B 2KWDA 3FC4A 4BAXA 2JF5A 1V5TA 1FPYA 4MGKE 4B0EA 1ZOYB 2L32A 1C9FA 4LNNA 3C0RB 1E8WA 2LGXA 3NG0A 1VLBA 3VTWA 3I5JC 3DVNU 1FIQA 3WAMA 3U7ZA 2SAKA 1J19A 3PTFC 4MM3B
chains in the Genus database with same CATH topology
2PPHA 3A1QB 1OEYJ 4GGQA 1EO6A 4GB9A 3CSTA 1YQBA 3PRZA 1WX8A 4ZYNA 3TL5A 4G3XB 4NNJB 3AULA 3BY4B 2G45B 3B1LX 3OJ3A 4BKTA 1U4AA 1WRDB 3ZIMA 4RM8A 5DPTA 4HPLB 2BWES 2LRWA 3A9KA 2KDEB 2HE7A 3T9LA 2G4DB 3APDA 2JUOA 1IP9A 5LXIB 2WWZA 2REXA 1ZW7A 3VH4B 2KOXA 1GJZA 3VDZA 3KH0A 2K25A 5FR6A 2M8SA 3T8MA 2XK5B 2BYEA 2MBEA 2IY0B 4JQWC 5JHBA 2I1KA 1P3QU 4G50A 1MG8A 2KO3A 1WXSA 4EEWA 4MM3A 2GBJA 3PLUA 1WGDA 1LXDA 4JGHB 2ZNVC 2ZNVB 5C23A 3QWZB 4EFOA 4HVBA 2JRIB 3L0WB 3U7DA 1UBIA 4GXBA 3VTVA 2FAZA 4DBGA 4DHJB 2KFJA 4X57B 2N1VA 4IC7B 2HJ8A 3IVFA 2N7DA 1WR1A 3ZNID 2WYQA 2KC1A 2KMAA 3ZRFA 2J0KA 2M0XA 2KFKB 4XZ4A 4PS8A 4NAWA 1TTNA 3R7RA 3H1UA 2L8JA 4WAAA 2G3QB 2XK5A 4II2B 1P1AA 4IM3A 4NY0A 2A5UA 2LZ6A 3ECIA 2NCNA 4GDLB 1G6JA 4W9DA 2O2VA 4M8MA 1OQYA 4I6PA 4HDOA 2ZCCA 3DBHI 3GOEA 2C60A 4MSMB 2N1WA 5D2MB 3LDZE 2LXAA 2O6VD 1WGHA 3NS8A 3WANA 4EZKA 4ANXA 1BT0A 3RT3B 1IPGA 2OJRA 2KJ6A 3KVFB 4JIOU 2ZJDA 3PRMB 2K8CA 3QIJA 3UINB 2KTFA 1RRBA 3OAWA 1OTRB 4ANWA 5TR5A 3UGBB 1YX5B 2O6VB 2PJHA 1RFAA 3P2BA 1J0GA 2N7EA 4PS7A 2GBKA 2MA9B 3L54A 3CSFA 1P0RA 2IO3B 2MBOA 3ZNGC 2BF8B 2FIDA 5J2RA 3X0WA 1WGRA 3KUCB 4WWNA 3W1YA 4F7ZA 3ZLZA 3A4SC 1WZ0A 3HHMA 3WAPA 4TQ0A 1OGWA 4EOYA 2LWPA 1A5RA 2R2QA 1SE9A 5CTRC 1ZGUB 3TJPA 4EZLA 1WM2A 1D3ZA 2K6QA 1TBEA 4LDTD 2DZIA 4N9F4 2C9WB 1KLVA 3A4RA 2EMSA 2CS4A 2O6VA 5CHWA 2GMIC 4IG7B 4CHKA 2LGYA 2BKRB 3PHWB 1KM7A 2KQ7A 4AJWA 4GU2A 4LDTB 1V9JA 2RGFA 1WE6A 3JYUA 2L76A 1UGMA 2KDFB 3L17A 1T0YA 1WX7A 4IWQA 2BGFA 4GDLA 4NJ7A 3DBSA 1UELA 3DVNV 1Y8RC 2JT4B 2KX3A 4HDQA 5D94A 1LFDA 3DBLI 4W9CA 1I42A 3ZDTA 1UZXB 3RZFA 2CR5A 4KVGB 3V61A 4M0WB 3W1SA 2N9PC 2D10A 2DYBA 2AWTA 3U30A 4A3PA 4CO7A 4BOSC 3SDLC 4IUMB 4KDLB 1WJ4A 3L10B 5CX3A 3DOWA 4IWOA 1WFYA 3PZDA 2RD0A 4PS3A 1V86A 3PT2B 3VQIA 4IM2A 4W9JA 3ZO5B 2MP2B 2A4ZA 2IBIB 2NS5A 4HPMB 2L0FA 2CKHB 2NVUI 2NBVB 2KWVB 4XC2A 2IY1B 2KTRB 2DYOA 1GC7A 2MCNB 1C3TA 1YIWA 3ZUNA 2DZKA 4MH0E 4DDGD 3K9OB 2KWUB 3BINA 4KDIC 2MX2A 2VRRB 2AL6A 4I6NB 4DDID 4E74A 2DAFA 4HWIB 1PQSA 2N9XA 1WMHB 3ML8A 1L2NA 1WR6E 2AEHA 4MGZE 1LM8B 2AYOB 1M94A 4TUUA 3PLVA 1S1QB 4LJPB 2KJHB 4NJ6A 5JZEB 2YVCA 2MP2A 4FHKA 2BKFA 4ICUA 1UBQA 1V81A 4A20A 1H8CA 4WJOA 3MHSD 3KW5B 5BO4B 3QX1A 4K7UA 4WWPA 2J7QB 2JVCA 1WM3A 4FULA 4BKSD 1JRUA 2LRUA 1VCBA 4W9IA 4TQ1A 5GMVA 4MDKE 3KUZA 1XD3B 1Z2MA 3RYTA 4BVUC 3ZTCA 2GBMA 4MSQB 2IZVB 4MGIE 4DK5A 1IYFA 1EF5A 4AUQC 3PVLA 3OLMD 4ZRKA 2KDBA 1I35A 3KYCD 3H7PA 1WZ3A 3AI5A 2HTHA 2KVRA 1KJTA 3DBRI 4GDKB 4W9HA 4NPNA 2MBQA 2ZPNA 2G4SA 4FN2A 3ZNHB 4F1SA 2C5LC 3TBLD 4A3OA 1WJ6A 3VH3B 4J6IA 2K39A 4DHZE 3RUIB 2PEAA 3HIZA 2EMTA 2KTRA 4RM9A 2JXXA 2JZZA 2JZ3B 2LD9A 3IBEA 4FJVB 3ZKJC 2LXCA 5KHQA 3ZNZB 1V5OA 1WJNA 5LXHA 2HD5B 1AARA 4AJYB 3SU8X 4OVUA 2WDTB 2LGDA 4HJKA 2WX0A 3KYDD 2WX1A 4ICVA 5CHFA 3H7PB 4MEMA 3APCA 5D7GA 4BKSA 1UD7A 4BFRA 4IWPA 1WIAA 3NZUA 1TGZB 4GN1A 1Z5SB 2K6DB 2C7MB 3R7QA 3NOBA 1E8YA 4KSKC 3PTFC 2FIFA 4DHJD 3WAOA 2DHZA 3U8ZA 4KV2A 4HXDA 3WIMA 2UYZB 2ZZPB 2GOWA 2FCMA 2V4LA 5LLIA 4GOCA 3DVGX 3O65B 3VXWA 2ZEQA 4IW0A 4WJQA 5L95C 1GUAB 2KMCA 3JVZX 3EC8A 4CYEA 1S3SG 4YL8A 1WGGA 3LJ3A 4WWOA 4E3CA 3VFKA 2KN5A 1YX6B 4GIVA 3A9KB 5IA7A 1FXTB 2LVQA 4PYUA 3ZW3A 3ZRCA 1X1MA 3CF6E 2N4FA 1WXVA 2D07B 2CHZA 4FLHA 3RULA 3X23A 1WE7A 4EUTA 4HCNB 2C7NB 3UQBA 1NBFC 5D6JB 4HK2A 2M1MA 4TKNA 3RD2A 2IO0B 3D32A 2LVPA 3M62B 2N9EB 3QQ8B 2M4NA 3PHXB 3I3TB 3JW0X 4IM0A 4BKGA 2LJ5A 3K9PB 4F8CB 1SGHA 2QHOA 2CHXA 2KANA 3B0AA 3MTNB 1WI0A 2K8BA 4FJYA 4MJSA 3B08A 3V62A 4E71A 2XBBC 1WYWB 2KLCA 3Q3FA 5KHOA 2FCSA 2LASA 3ONSA 4W9FA 3DCGA 4RMAA 3R66C 4I6LB 3UIOB 2DZJA 4NAWB 3Q3JA 5HKHA 3DDCB 2RPQA 1GG3A 5DPWA 1YJ1A 2O2VB 4NQLB 2YLMA 5G55A 3VUYA 4TV3A 2NBWB 2KK8A 3UQAA 2CHWA 5E6NA 5J18A 3JSVB 3VVWB 3PGEA 5J17A 3APFA 3IFWB 4LJOB 4W9EA 2PE6B 4II3B 1GC6A 3QCAA 3RCZA 5JHAA 1LQBA 5JH5C 4M8NA 1J8CA 2NBUA 1F9JA 2W9NA 3ENEA 3PREA 3QK0A 4W9LA 2J0MA 3A1QA 1E7VA 5DCNA 2L0TA 1OEYA 4AOFA 3WALA 2FCNA 1UH6A 1E7UA 2FUHB 4ZDVA 5EDSA 2KDIA 3HK0A 4K1RB 2BWFA 2V1YA 3GZNI 1L7YA 2KQSA 2BYFA 4HLEA 2L7RA 4URKA 3JSVA 2MSED 4XX5A 2AL3A 2KJRA 1WY8A 2M17A 3A33B 3MJWA 1XQQA 2LUEA 2RR9A 2DZMA 2MQJA 2ZVNA 3A9JA 4MJSB 3TCAA 4JL9A 3VTUA 2FCQA 2Z59B 2ZVOA 5L83A 5E6PA 1EUVB 2MBHA 2KLGA 2Z0EB 1NI2A 2NPTA 4EKUA 2R2OA 4GDKA 4WJNA 2MRPA 3DVGY 3ML9A 2PE9A 2K8HA 3TIXA 4KIKB 3UIPB 3VUXA 1V6EA 2RSUA 5C1ZA 1WGYA 3PPAA 2LI5A 4LCDE 2DAJA 2KXJA 3OJ4B 2JWZA 3QA8A 2J0JA 3AU5A 2MWSB 3N32A 3V6CB 1V80A 3NZSA 3UF8A 2GBNA 2KFKA 2I1JA 3V6EB 4ANVA 4ANUA 1NDDA 3A9JB 4DHZB 4ZRIA 2V3SA 5AEKB 3QC8B 2K1FA 3RZWC 1E8ZA 2CU1A 1Q0WB 2GBRA 3HM6X 3QARA 2ZCBA 4NQKE 4B95A 3N3KB 4G11A 3R3MA 4OVVA 2KD0A 5DPSA 4FADA 3H7SA 4GMVA 3ZDMC 2KWCA 2L3ZA 3EECA 3PSEB 2DX5B 2IO1B 2NR2A 4K81A 3AXCA 3ALBA 1RAXA 2MLBA 4FHJA 5DPRA 1SIFA 2Y5BB 1R4NI 4DXAB 1WXAA 3M63B 2DYMA 4MELA 2IYDB 2D11A 1WH3A 1WF9A 3VAWA 1GNUA 1Q1OA 4B6WA 2L05A 4JLCA 5AZGA 5G2NA 3DQVA 2KZRA 3H9DA 3ZTDA 2BYVE 1WMHA 4KSLC 3VUWA 3WA0A 2NPTB 3PS6A 5AZHA 3QJZA 3V60A 4AWJA 4FA6A 2DENB 1VD2A 2JRHA 1Q5WB 4FJZA 1H4RA 1R4MI 1ZKHA 4EZJA 3H6NA 3IHPC 2IO2B 1E90A 3PRPB 4KIKA 4B9KA 2KX0A 3M3JA 2LVOA 4P7IA 5IAAC 3TMPB 3SD5A 3L08A 3SHQA 1E5WA 3W1SC 2KKCA 3IG3A 3L13A 2KC2A 3M95A 1EF1A 2JPHA 3HM3A 4BBNF 1WX9A 3NY5A 1P9DU 3S2AA 1TZ1A 5AZFA 1E8XA 2Z0DB 4W9KA 4KZ0A 2UWQA 2B3AA 2KHWB 3EFUA 3DPDA 4BBNC 1CMXB 1KOTA 3CMMB 4G0NB 2KNBA 2FNJB 3AU4A 3PV1A 4WJPA 4K7WA 1RLFA 1XT9B 2JF5A 1V5TA 2ZPYA 2MW5A 4W9GA 4FBJB 2ASQA 5CHVC 1HE8A 5E6OA 4AP4C 3NHEB 4MGKE 2L00B 2EKEC 4DWFA 2JY6A 4GSWA 4K7SA 1ISNA 4PYZA 3VHTC 1P98A 3C0RB 2C7HA 3QHTA 4ZRJA 2D2QA 1E8WA 2LGXA 3VTWA 3EHVA 3N30A 3ZVVA 1WJUA 4HCPB 4MGYE 3QAQA 3DVNU 3KUDB 1QZEA 1C1YB 3WAMA 4BOZB 1K8RB 2D3GA 4KZCA 4WQOB 4ASWC 1V2YA 2MBBB 2OOBB 1V49A 1WXMA 1YD8U 1J19A 2XEWA 3L16A 2BPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PPH A;  3A1Q B;  1OEY J;  4GGQ A;  1EO6 A;  4GB9 A;  3CST A;  1YQB A;  3PRZ A;  1WX8 A;  4ZYN A;  3TL5 A;  4G3X B;  4NNJ B;  3AUL A;  3BY4 B;  2G45 B;  3B1L X;  3OJ3 A;  4BKT A;  1U4A A;  1WRD B;  3ZIM A;  4RM8 A;  5DPT A;  4HPL B;  2BWE S;  2LRW A;  3A9K A;  2KDE B;  2HE7 A;  3T9L A;  2G4D B;  3APD A;  2JUO A;  1IP9 A;  5LXI B;  2WWZ A;  2REX A;  1ZW7 A;  3VH4 B;  2KOX A;  1GJZ A;  3VDZ A;  3KH0 A;  2K25 A;  5FR6 A;  2M8S A;  3T8M A;  2XK5 B;  2BYE A;  2MBE A;  2IY0 B;  4JQW C;  5JHB A;  2I1K A;  1P3Q U;  4G50 A;  1MG8 A;  2KO3 A;  1WXS A;  4EEW A;  4MM3 A;  2GBJ A;  3PLU A;  1WGD A;  1LXD A;  4JGH B;  2ZNV C;  2ZNV B;  5C23 A;  3QWZ B;  4EFO A;  4HVB A;  2JRI B;  3L0W B;  3U7D A;  1UBI A;  4GXB A;  3VTV A;  2FAZ A;  4DBG A;  4DHJ B;  2KFJ A;  4X57 B;  2N1V A;  4IC7 B;  2HJ8 A;  3IVF A;  2N7D A;  1WR1 A;  3ZNI D;  2WYQ A;  2KC1 A;  2KMA A;  3ZRF A;  2J0K A;  2M0X A;  2KFK B;  4XZ4 A;  4PS8 A;  4NAW A;  1TTN A;  3R7R A;  3H1U A;  2L8J A;  4WAA A;  2G3Q B;  2XK5 A;  4II2 B;  1P1A A;  4IM3 A;  4NY0 A;  2A5U A;  2LZ6 A;  3ECI A;  2NCN A;  4GDL B;  1G6J A;  4W9D A;  2O2V A;  4M8M A;  1OQY A;  4I6P A;  4HDO A;  2ZCC A;  3DBH I;  3GOE A;  2C60 A;  4MSM B;  2N1W A;  5D2M B;  3LDZ E;  2LXA A;  2O6V D;  1WGH A;  3NS8 A;  3WAN A;  4EZK A;  4ANX A;  1BT0 A;  3RT3 B;  1IPG A;  2OJR A;  2KJ6 A;  3KVF B;  4JIO U;  2ZJD A;  3PRM B;  2K8C A;  3QIJ A;  3UIN B;  2KTF A;  1RRB A;  3OAW A;  1OTR B;  4ANW A;  5TR5 A;  3UGB B;  1YX5 B;  2O6V B;  2PJH A;  1RFA A;  3P2B A;  1J0G A;  2N7E A;  4PS7 A;  2GBK A;  2MA9 B;  3L54 A;  3CSF A;  1P0R A;  2IO3 B;  2MBO A;  3ZNG C;  2BF8 B;  2FID A;  5J2R A;  3X0W A;  1WGR A;  3KUC B;  4WWN A;  3W1Y A;  4F7Z A;  3ZLZ A;  3A4S C;  1WZ0 A;  3HHM A;  3WAP A;  4TQ0 A;  1OGW A;  4EOY A;  2LWP A;  1A5R A;  2R2Q A;  1SE9 A;  5CTR C;  1ZGU B;  3TJP A;  4EZL A;  1WM2 A;  1D3Z A;  2K6Q A;  1TBE A;  4LDT D;  2DZI A;  4N9F 4;  2C9W B;  1KLV A;  3A4R A;  2EMS A;  2CS4 A;  2O6V A;  5CHW A;  2GMI C;  4IG7 B;  4CHK A;  2LGY A;  2BKR B;  3PHW B;  1KM7 A;  2KQ7 A;  4AJW A;  4GU2 A;  4LDT B;  1V9J A;  2RGF A;  1WE6 A;  3JYU A;  2L76 A;  1UGM A;  2KDF B;  3L17 A;  1T0Y A;  1WX7 A;  4IWQ A;  2BGF A;  4GDL A;  4NJ7 A;  3DBS A;  1UEL A;  3DVN V;  1Y8R C;  2JT4 B;  2KX3 A;  4HDQ A;  5D94 A;  1LFD A;  3DBL I;  4W9C A;  1I42 A;  3ZDT A;  1UZX B;  3RZF A;  2CR5 A;  4KVG B;  3V61 A;  4M0W B;  3W1S A;  2N9P C;  2D10 A;  2DYB A;  2AWT A;  3U30 A;  4A3P A;  4CO7 A;  4BOS C;  3SDL C;  4IUM B;  4KDL B;  1WJ4 A;  3L10 B;  5CX3 A;  3DOW A;  4IWO A;  1WFY A;  3PZD A;  2RD0 A;  4PS3 A;  1V86 A;  3PT2 B;  3VQI A;  4IM2 A;  4W9J A;  3ZO5 B;  2MP2 B;  2A4Z A;  2IBI B;  2NS5 A;  4HPM B;  2L0F A;  2CKH B;  2NVU I;  2NBV B;  2KWV B;  4XC2 A;  2IY1 B;  2KTR B;  2DYO A;  1GC7 A;  2MCN B;  1C3T A;  1YIW A;  3ZUN A;  2DZK A;  4MH0 E;  4DDG D;  3K9O B;  2KWU B;  3BIN A;  4KDI C;  2MX2 A;  2VRR B;  2AL6 A;  4I6N B;  4DDI D;  4E74 A;  2DAF A;  4HWI B;  1PQS A;  2N9X A;  1WMH B;  3ML8 A;  1L2N A;  1WR6 E;  2AEH A;  4MGZ E;  1LM8 B;  2AYO B;  1M94 A;  4TUU A;  3PLV A;  1S1Q B;  4LJP B;  2KJH B;  4NJ6 A;  5JZE B;  2YVC A;  2MP2 A;  4FHK A;  2BKF A;  4ICU A;  1UBQ A;  1V81 A;  4A20 A;  1H8C A;  4WJO A;  3MHS D;  3KW5 B;  5BO4 B;  3QX1 A;  4K7U A;  4WWP A;  2J7Q B;  2JVC A;  1WM3 A;  4FUL A;  4BKS D;  1JRU A;  2LRU A;  1VCB A;  4W9I A;  4TQ1 A;  5GMV A;  4MDK E;  3KUZ A;  1XD3 B;  1Z2M A;  3RYT A;  4BVU C;  3ZTC A;  2GBM A;  4MSQ B;  2IZV B;  4MGI E;  4DK5 A;  1IYF A;  1EF5 A;  4AUQ C;  3PVL A;  3OLM D;  4ZRK A;  2KDB A;  1I35 A;  3KYC D;  3H7P A;  1WZ3 A;  3AI5 A;  2HTH A;  2KVR A;  1KJT A;  3DBR I;  4GDK B;  4W9H A;  4NPN A;  2MBQ A;  2ZPN A;  2G4S A;  4FN2 A;  3ZNH B;  4F1S A;  2C5L C;  3TBL D;  4A3O A;  1WJ6 A;  3VH3 B;  4J6I A;  2K39 A;  4DHZ E;  3RUI B;  2PEA A;  3HIZ A;  2EMT A;  2KTR A;  4RM9 A;  2JXX A;  2JZZ A;  2JZ3 B;  2LD9 A;  3IBE A;  4FJV B;  3ZKJ C;  2LXC A;  5KHQ A;  3ZNZ B;  1V5O A;  1WJN A;  5LXH A;  2HD5 B;  1AAR A;  4AJY B;  3SU8 X;  4OVU A;  2WDT B;  2LGD A;  4HJK A;  2WX0 A;  3KYD D;  2WX1 A;  4ICV A;  5CHF A;  3H7P B;  4MEM A;  3APC A;  5D7G A;  4BKS A;  1UD7 A;  4BFR A;  4IWP A;  1WIA A;  3NZU A;  1TGZ B;  4GN1 A;  1Z5S B;  2K6D B;  2C7M B;  3R7Q A;  3NOB A;  1E8Y A;  4KSK C;  3PTF C;  2FIF A;  4DHJ D;  3WAO A;  2DHZ A;  3U8Z A;  4KV2 A;  4HXD A;  3WIM A;  2UYZ B;  2ZZP B;  2GOW A;  2FCM A;  2V4L A;  5LLI A;  4GOC A;  3DVG X;  3O65 B;  3VXW A;  2ZEQ A;  4IW0 A;  4WJQ A;  5L95 C;  1GUA B;  2KMC A;  3JVZ X;  3EC8 A;  4CYE A;  1S3S G;  4YL8 A;  1WGG A;  3LJ3 A;  4WWO A;  4E3C A;  3VFK A;  2KN5 A;  1YX6 B;  4GIV A;  3A9K B;  5IA7 A;  1FXT B;  2LVQ A;  4PYU A;  3ZW3 A;  3ZRC A;  1X1M A;  3CF6 E;  2N4F A;  1WXV A;  2D07 B;  2CHZ A;  4FLH A;  3RUL A;  3X23 A;  1WE7 A;  4EUT A;  4HCN B;  2C7N B;  3UQB A;  1NBF C;  5D6J B;  4HK2 A;  2M1M A;  4TKN A;  3RD2 A;  2IO0 B;  3D32 A;  2LVP A;  3M62 B;  2N9E B;  3QQ8 B;  2M4N A;  3PHX B;  3I3T B;  3JW0 X;  4IM0 A;  4BKG A;  2LJ5 A;  3K9P B;  4F8C B;  1SGH A;  2QHO A;  2CHX A;  2KAN A;  3B0A A;  3MTN B;  1WI0 A;  2K8B A;  4FJY A;  4MJS A;  3B08 A;  3V62 A;  4E71 A;  2XBB C;  1WYW B;  2KLC A;  3Q3F A;  5KHO A;  2FCS A;  2LAS A;  3ONS A;  4W9F A;  3DCG A;  4RMA A;  3R66 C;  4I6L B;  3UIO B;  2DZJ A;  4NAW B;  3Q3J A;  5HKH A;  3DDC B;  2RPQ A;  1GG3 A;  5DPW A;  1YJ1 A;  2O2V B;  4NQL B;  2YLM A;  5G55 A;  3VUY A;  4TV3 A;  2NBW B;  2KK8 A;  3UQA A;  2CHW A;  5E6N A;  5J18 A;  3JSV B;  3VVW B;  3PGE A;  5J17 A;  3APF A;  3IFW B;  4LJO B;  4W9E A;  2PE6 B;  4II3 B;  1GC6 A;  3QCA A;  3RCZ A;  5JHA A;  1LQB A;  5JH5 C;  4M8N A;  1J8C A;  2NBU A;  1F9J A;  2W9N A;  3ENE A;  3PRE A;  3QK0 A;  4W9L A;  2J0M A;  3A1Q A;  1E7V A;  5DCN A;  2L0T A;  1OEY A;  4AOF A;  3WAL A;  2FCN A;  1UH6 A;  1E7U A;  2FUH B;  4ZDV A;  5EDS A;  2KDI A;  3HK0 A;  4K1R B;  2BWF A;  2V1Y A;  3GZN I;  1L7Y A;  2KQS A;  2BYF A;  4HLE A;  2L7R A;  4URK A;  3JSV A;  2MSE D;  4XX5 A;  2AL3 A;  2KJR A;  1WY8 A;  2M17 A;  3A33 B;  3MJW A;  1XQQ A;  2LUE A;  2RR9 A;  2DZM A;  2MQJ A;  2ZVN A;  3A9J A;  4MJS B;  3TCA A;  4JL9 A;  3VTU A;  2FCQ A;  2Z59 B;  2ZVO A;  5L83 A;  5E6P A;  1EUV B;  2MBH A;  2KLG A;  2Z0E B;  1NI2 A;  2NPT A;  4EKU A;  2R2O A;  4GDK A;  4WJN A;  2MRP A;  3DVG Y;  3ML9 A;  2PE9 A;  2K8H A;  3TIX A;  4KIK B;  3UIP B;  3VUX A;  1V6E A;  2RSU A;  5C1Z A;  1WGY A;  3PPA A;  2LI5 A;  4LCD E;  2DAJ A;  2KXJ A;  3OJ4 B;  2JWZ A;  3QA8 A;  2J0J A;  3AU5 A;  2MWS B;  3N32 A;  3V6C B;  1V80 A;  3NZS A;  3UF8 A;  2GBN A;  2KFK A;  2I1J A;  3V6E B;  4ANV A;  4ANU A;  1NDD A;  3A9J B;  4DHZ B;  4ZRI A;  2V3S A;  5AEK B;  3QC8 B;  2K1F A;  3RZW C;  1E8Z A;  2CU1 A;  1Q0W B;  2GBR A;  3HM6 X;  3QAR A;  2ZCB A;  4NQK E;  4B95 A;  3N3K B;  4G11 A;  3R3M A;  4OVV A;  2KD0 A;  5DPS A;  4FAD A;  3H7S A;  4GMV A;  3ZDM C;  2KWC A;  2L3Z A;  3EEC A;  3PSE B;  2DX5 B;  2IO1 B;  2NR2 A;  4K81 A;  3AXC A;  3ALB A;  1RAX A;  2MLB A;  4FHJ A;  5DPR A;  1SIF A;  2Y5B B;  1R4N I;  4DXA B;  1WXA A;  3M63 B;  2DYM A;  4MEL A;  2IYD B;  2D11 A;  1WH3 A;  1WF9 A;  3VAW A;  1GNU A;  1Q1O A;  4B6W A;  2L05 A;  4JLC A;  5AZG A;  5G2N A;  3DQV A;  2KZR A;  3H9D A;  3ZTD A;  2BYV E;  1WMH A;  4KSL C;  3VUW A;  3WA0 A;  2NPT B;  3PS6 A;  5AZH A;  3QJZ A;  3V60 A;  4AWJ A;  4FA6 A;  2DEN B;  1VD2 A;  2JRH A;  1Q5W B;  4FJZ A;  1H4R A;  1R4M I;  1ZKH A;  4EZJ A;  3H6N A;  3IHP C;  2IO2 B;  1E90 A;  3PRP B;  4KIK A;  4B9K A;  2KX0 A;  3M3J A;  2LVO A;  4P7I A;  5IAA C;  3TMP B;  3SD5 A;  3L08 A;  3SHQ A;  1E5W A;  3W1S C;  2KKC A;  3IG3 A;  3L13 A;  2KC2 A;  3M95 A;  1EF1 A;  2JPH A;  3HM3 A;  4BBN F;  1WX9 A;  3NY5 A;  1P9D U;  3S2A A;  1TZ1 A;  5AZF A;  1E8X A;  2Z0D B;  4W9K A;  4KZ0 A;  2UWQ A;  2B3A A;  2KHW B;  3EFU A;  3DPD A;  4BBN C;  1CMX B;  1KOT A;  3CMM B;  4G0N B;  2KNB A;  2FNJ B;  3AU4 A;  3PV1 A;  4WJP A;  4K7W A;  1RLF A;  1XT9 B;  2JF5 A;  1V5T A;  2ZPY A;  2MW5 A;  4W9G A;  4FBJ B;  2ASQ A;  5CHV C;  1HE8 A;  5E6O A;  4AP4 C;  3NHE B;  4MGK E;  2L00 B;  2EKE C;  4DWF A;  2JY6 A;  4GSW A;  4K7S A;  1ISN A;  4PYZ A;  3VHT C;  1P98 A;  3C0R B;  2C7H A;  3QHT A;  4ZRJ A;  2D2Q A;  1E8W A;  2LGX A;  3VTW A;  3EHV A;  3N30 A;  3ZVV A;  1WJU A;  4HCP B;  4MGY E;  3QAQ A;  3DVN U;  3KUD B;  1QZE A;  1C1Y B;  3WAM A;  4BOZ B;  1K8R B;  2D3G A;  4KZC A;  4WQO B;  4ASW C;  1V2Y A;  2MBB B;  2OOB B;  1V49 A;  1WXM A;  1YD8 U;  1J19 A;  2XEW A;  3L16 A;  2BPS A; 
#chains in the Genus database with same CATH topology
 1RM6 C;  2AQ3 B;  1OEY J;  4GB9 A;  4ZYN A;  4G3X B;  1HTQ A;  3BY4 B;  2G45 B;  2KDM A;  3OG5 A;  3E56 A;  4HPL B;  2BWE S;  2G4D B;  3APD A;  4ZHP A;  2REX A;  1ZW7 A;  4HRO A;  3VH4 B;  4BZA A;  3VDZ A;  1C4C A;  3BZD B;  1MG8 A;  4MM3 A;  3PLU A;  4JGH B;  2ZNV C;  3QWZ B;  4YT0 B;  3U7D A;  1UBI A;  4GXB A;  1GPX A;  2W3R A;  4AQ7 A;  3VTV A;  2KFJ A;  4GLS C;  1QKZ A;  4IC7 B;  2N7D A;  1WR1 A;  4LK0 M;  1SJE D;  5FK9 C;  2J0K A;  1QT9 A;  4PS8 A;  2L8J A;  2XN9 C;  3IXS A;  4II2 B;  5I4D A;  4NY0 A;  4GDL B;  2NCN A;  2WXQ A;  3BK2 A;  1OQY A;  4HDO A;  2O6V D;  2JU6 X;  1ZXI A;  4ANX A;  1BT0 A;  3AED B;  4EZK A;  2KJ6 A;  3KVF B;  1C78 A;  4RFB A;  3PRM B;  1OTR B;  2INC C;  4KKJ A;  1YX5 B;  3DHH C;  1J0G A;  2MA9 B;  1RYJ A;  1P0R A;  1DOY A;  2FID A;  2VH1 A;  4WIP A;  3KUC B;  3A4S C;  2QJL A;  2LWP A;  1SE9 A;  5BMG A;  4EZL A;  4D2K A;  1WM2 A;  3GS2 A;  1TBE A;  2DZI A;  2VZK B;  3P4S B;  2I38 A;  2RDH A;  1J7B A;  4M01 A;  4S17 A;  2O6V A;  4C7Y A;  2GMI C;  3PZ8 A;  3RNB C;  4CHK A;  3DHI C;  2BKR B;  2KQ7 A;  4GU2 A;  4LDT B;  2L76 A;  2KDF B;  4O1N A;  1QOF A;  1T0Y A;  1L6U A;  4ZRQ A;  2RPV A;  1Y8R C;  1L6V A;  2JT4 B;  4HDQ A;  1A70 A;  4WH4 A;  1UZX B;  4KVG B;  1J7A A;  4M0W B;  2N9P C;  2DYB A;  3RMK C;  3P4P B;  4BOS C;  3SDL C;  4IUM B;  4KDL B;  4C56 C;  3L10 B;  4IWO A;  4C80 A;  4PS3 A;  5JXV A;  3PT2 B;  2LJI A;  2MP2 B;  2A4Z A;  2NS5 A;  1UNS A;  1TY2 A;  2CKH B;  2KWV B;  2KTR B;  3ZUN A;  1ACC A;  1WRI A;  4DDG D;  2VRR B;  4DDI D;  1HZ5 A;  4E74 A;  4HWI B;  2N9X A;  1L2N A;  3ML8 A;  4MAC A;  1LM8 B;  3PLV A;  2WDV B;  3Q2A C;  4LJP B;  1UBQ A;  2QC8 A;  5FKA C;  4A20 A;  1H8C A;  4AS1 A;  1C4P A;  4K7U A;  1WM3 A;  4FUL A;  4BKS D;  4W9I A;  3SFE B;  4TQ1 A;  5GMV A;  2IZV B;  2QMT A;  3OLM D;  2KDB A;  3U4E G;  5T8I A;  3TEY A;  1K50 A;  1XLQ A;  1D5M C;  2PTL A;  2EKI A;  2C5L C;  2L1A A;  3TBL D;  1I7H A;  1WJ6 A;  2D5G A;  4DHZ E;  2K39 A;  4YTM B;  3ABV B;  1N6Z A;  4CQN A;  2JXX A;  2LD9 A;  3ZNZ B;  2HD5 B;  1XLN A;  2WX0 A;  2WX1 A;  3Q8E A;  4MEM A;  4BFR A;  3I63 C;  3AMZ A;  4IWP A;  4RCO A;  3NZU A;  4HKZ E;  3URY A;  1TGZ B;  1FRR A;  2C7M B;  3RNG C;  4WWM A;  1XEE A;  1E8Y A;  2D3B A;  4KKI A;  5G5G A;  4P6V F;  4DHJ D;  2V4I B;  4LTU A;  4ARC A;  2L52 A;  2V4L A;  1WWT A;  1GAQ B;  3O65 B;  2BBC A;  5BYS A;  1GUA B;  1PGX A;  3IT4 B;  3JVZ X;  3EC8 A;  2QEJ C;  1PYW D;  4WWO A;  3VFK A;  1YX6 B;  3P1M A;  5IA7 A;  4NAM A;  2K9X A;  1FXT B;  1ENF A;  3ZYY X;  4PK1 A;  2LVQ A;  3I57 A;  2W55 A;  3CF6 E;  3FIL A;  1DOI A;  3X23 A;  2ACZ B;  3UQB A;  2GLS A;  1Y56 A;  4HK2 A;  3RI7 C;  3M62 B;  2M4N A;  3I3T B;  3BVM A;  4YTP B;  3B0A A;  3ETR A;  3MTN B;  4A90 A;  1L0V B;  2J4X A;  1KLG D;  2FCS A;  3RNA C;  2DZJ A;  3Q3J A;  5HKH A;  3DDC B;  4C4V A;  2RPQ A;  2WXM A;  3R2I A;  4NQL B;  1R4M B;  1BUI C;  2KK8 A;  5E6N A;  5EE1 A;  3P63 A;  4OW0 A;  2WXH A;  3BVZ A;  1FEH A;  1D5Z C;  4NJC A;  3MC8 A;  3RCZ A;  2OHF A;  3TSS A;  3HRD D;  4IOI E;  5JH5 C;  1F9J A;  4W9L A;  3QK0 A;  2J0M A;  3SFD B;  2MHJ A;  3WAL A;  1UH6 A;  1E7U A;  2YEP F;  2BYT A;  2JYT A;  3GZN I;  1ET6 A;  2KQS A;  2BYF A;  4HLE A;  1HTO A;  1TS5 A;  1EWY C;  2MSE D;  2PKO A;  2RR9 A;  2DZM A;  2MQJ A;  1FRD A;  3TCA A;  2ZVO A;  2LHE A;  1EUV B;  2KLG A;  4JWU C;  2R2O A;  1AN8 A;  4GDK A;  2BT6 A;  4XYC A;  1SE3 A;  3DVG Y;  3TIX A;  3DBR B;  3UIP B;  1V6E A;  2RSU A;  2LI5 A;  4TSS A;  5HHD G;  1MJD A;  4IKG A;  3OJ4 B;  2KXJ A;  2PVG C;  2ZW0 A;  3VR8 B;  3LXF A;  2MWS B;  2R61 A;  1FXI A;  2I1J A;  4ANU A;  3N1X C;  2LHD A;  2ZCB A;  3EGR A;  2KQ4 X;  2DLB A;  2BVC A;  2KD0 A;  5DPS A;  2IGG A;  4FAD A;  3GE3 C;  3U52 E;  3BWU D;  3EEC A;  1SXT A;  1CZP A;  3ALB A;  2G9H D;  1R4N I;  3VAW A;  2IYD B;  1WH3 A;  2L05 A;  5AZG A;  2KZR A;  1WMH A;  4KSL C;  2B76 B;  1TIF A;  3QJZ A;  1TT5 B;  1H4R A;  1YOV B;  2IO2 B;  2KAC A;  2KX0 A;  4P7I A;  3FKY A;  5IAA C;  1E5W A;  2QDF A;  3W1S C;  3IG3 A;  2VH2 A;  1EF1 A;  3HM3 A;  3S2A A;  2KAJ A;  1NEK B;  2PLP A;  5BYQ A;  5D3D A;  4G0N B;  2KNB A;  3AU4 A;  2UU7 A;  2JSV X;  2ZPY A;  5CHV C;  1KFY B;  2L00 B;  2EKE C;  2RDB C;  4XDC A;  4PYZ A;  2C7H A;  3AEF B;  2AQ2 B;  3FAH A;  3DWM A;  3ZVV A;  5HI1 A;  1FCC C;  1I4P A;  4OZC A;  4BOZ B;  1K8R B;  3O13 A;  4KZC A;  1T5X D;  3R8B A;  2OOB B;  1V49 A;  2XEW A;  3IAM 1;  1J7C A;  2PPH A;  3A1Q B;  4OZA A;  1EO6 A;  4JE3 B;  1YQB A;  3PRZ A;  1ESF A;  1YMH E;  1WX8 A;  2GB1 A;  1OQQ A;  1XF5 L;  1ZXH A;  3P4R B;  5DPT A;  4ZYS A;  4YXD B;  1WSP A;  1IGD A;  2M56 B;  2WWZ A;  2PW9 A;  1MFW A;  1YNT E;  1MPE A;  2CJN A;  2TSS A;  4YTN B;  2K25 A;  2M8S A;  2BYE A;  2MBE A;  2IY0 B;  4JQW C;  1TKY A;  2I1K A;  4G50 A;  1WXS A;  4EEW A;  4N58 A;  3N1Z C;  5IKC M;  2GBJ A;  3ZGZ A;  2ZNV B;  4IDI A;  4HVB A;  2IDY A;  4DBG A;  2FAZ A;  4DHJ B;  1T0S C;  4X57 B;  1KRH A;  1E9M A;  2KC1 A;  2KMA A;  3NJT A;  4XZ4 A;  5EE9 A;  1TTN A;  3H1U A;  2G3Q B;  3GP7 A;  5IOI A;  1KH0 A;  4DQO C;  4M02 A;  2O2V A;  1TY0 A;  3DHG C;  4MSM B;  3GB1 A;  3DWG C;  5D2M B;  1ZE3 D;  1PGA A;  3RT3 B;  2QIE B;  2PIA A;  5IP4 D;  4ANW A;  1QLB B;  5TR5 A;  2OJW A;  4HEA 1;  4USA A;  4PS7 A;  1BML C;  4H2A A;  2IO3 B;  3ZNG C;  2E3T A;  3X0W A;  1EU4 A;  3ZLZ A;  1LGR A;  3WAP A;  4TQ0 A;  3CWI A;  4EOY A;  1ZDX A;  4HPP A;  1D5X C;  1CJE A;  3C19 A;  3AM9 A;  4N9F 4;  2MJD A;  2CS4 A;  2QCZ A;  1MHX A;  5CHW A;  5H8Y E;  1FXA A;  4AJW A;  4J3O D;  2RGF A;  3TEZ A;  2V3N A;  4NJ7 A;  2IND C;  4RF1 A;  1UEL A;  4RGM A;  4C00 A;  2KX3 A;  4W9C A;  3V61 A;  5HG2 A;  1FNW A;  4RGO S;  3W1S A;  3U30 A;  1JWM D;  3DOW A;  3VQI A;  3B2G A;  4IM2 A;  3ZO5 B;  4HPM B;  1OFF A;  4XC2 A;  1B1Z A;  2DZK A;  4MH0 E;  1SIJ A;  4KDI C;  2DAF A;  1PQS A;  2RMM A;  1JML A;  1Q10 A;  2AYO B;  1M94 A;  2KJH B;  4NJ6 A;  5JZE B;  3NS1 A;  2MP2 A;  4FHK A;  3AH7 A;  4ICU A;  4DXG A;  3N1Y C;  4WJO A;  1RFK A;  1JRU A;  1VCB A;  3TEX A;  3KUZ A;  2J53 A;  1XD3 B;  1Z2M A;  3IAS 1;  4BVU C;  3ZTC A;  2GBM A;  2KMM A;  4MSQ B;  2WNM A;  1I35 A;  3KYC D;  3AI5 A;  2KVR A;  4WQM A;  2MBQ A;  3NZ3 A;  4FN2 A;  3EFC A;  4F1S A;  1N62 A;  3RFZ B;  4KGR A;  3HIZ A;  2EMT A;  2X38 A;  4OHJ A;  1N5W A;  2JZ3 B;  4FJV B;  3ZKJ C;  3IBE A;  5LXH A;  4AJY B;  4OVU A;  4HJK A;  3KYD D;  1FO4 A;  4NZL B;  4BKS A;  1UD7 A;  3BK1 A;  1I4R A;  1JRP A;  3AE8 B;  1NYR A;  1VR9 A;  1Z5S B;  1F2R I;  3W5U B;  3U8Z A;  4KV2 A;  1IUE A;  2JX5 A;  2UYZ B;  3WIM A;  2ZZP B;  3SEB A;  3VXW A;  2ZEQ A;  1PUT A;  5L95 C;  1QOB A;  3AE1 B;  1S3S G;  2JQR B;  3LJ3 A;  3RNE C;  3P42 A;  1N63 A;  1JCK B;  2KN5 A;  3A9K B;  5HFY A;  1UWM A;  1WXV A;  4FLH A;  3RUL A;  1WE7 A;  4ARI A;  4HCN B;  2C7N B;  4LLG M;  1YJJ A;  1QIL A;  4TKN A;  3RD2 A;  3D32 A;  2N9E B;  3QQ8 B;  2JZP A;  4F8C B;  2QHO A;  2KAN A;  1JWB D;  2MH7 A;  4FJY A;  3Q3F A;  3ONS A;  3DCG A;  4RMA A;  4I6L B;  3UIO B;  4NAW B;  1GG3 A;  2O2V B;  5G55 A;  3VUY A;  4LNK A;  2NBW B;  4L1B A;  2Y3A A;  3PGE A;  5J17 A;  1STE A;  3IFW B;  4LJO B;  1NI3 A;  2PE6 B;  1GC6 A;  1AWD A;  1T0R C;  1VDV A;  5JHA A;  1J8C A;  2QSD A;  2NBU A;  4RGN A;  1SSN A;  5IO9 A;  1EWC A;  2W3S A;  5AUI A;  1OEY A;  4AOF A;  4HJG E;  5D3I B;  1L7Y A;  1N60 A;  3EUB 2;  1IBX B;  2L7R A;  4K3B A;  3BVG A;  2KJR A;  1SJH D;  1XQQ A;  1L4D B;  2ICI A;  5E6P A;  1YQ3 B;  3J9C A;  4EKU A;  5E6J A;  1GOZ A;  1ZPS A;  4WJN A;  3W2D A;  1F0Z A;  3VUX A;  1RWS A;  2ONQ A;  1FNV A;  2G1E A;  2JWZ A;  2J0J A;  3AU5 A;  4B0M A;  3UF8 A;  3I9V 1;  3V6E B;  4DHZ B;  4ZRI A;  1Q0W B;  4NQK E;  3N3K B;  4G11 A;  1B9R A;  3R3M A;  4OVV A;  1E10 A;  2V3P A;  3AE3 B;  1MG4 A;  2WXP A;  3H7S A;  4GMV A;  3ZDM C;  2KWC A;  4K81 A;  1ET9 A;  1RAX A;  1SIF A;  2Y5B B;  2MJE A;  3DBH B;  2DYM A;  1GNU A;  4JLC A;  3ZTD A;  3VUW A;  3PS6 A;  4US9 A;  3W9C B;  4FA6 A;  1YN5 A;  4FJZ A;  1EU3 A;  3Q3O C;  3H6N A;  3PRP B;  1E90 A;  4B9K A;  4QAY A;  3SD5 A;  1F1H A;  3BII D;  1XO3 A;  4MT5 A;  3M95 A;  4BBN F;  1AW7 A;  3AE6 B;  4KZ0 A;  1HZ6 A;  2WXK A;  3DPD A;  1N61 A;  1KOT A;  2LGI A;  1E0Z A;  4WJP A;  4K7W A;  1RLF A;  1XT9 B;  2GRI A;  2ASQ A;  4AP4 C;  1N5X A;  1XLP A;  3VHT C;  1YN4 A;  1P98 A;  3QHT A;  4ZRJ A;  2D2Q A;  3B9J A;  3EHV A;  1K53 A;  2DNF A;  1HEZ E;  1WJU A;  4HCP B;  3QAQ A;  1C1Y B;  2D3G A;  4WQO B;  1V2Y A;  2MBB B;  1WXM A;  3L16 A;  2BPS A;  4OVZ A;  1JWS D;  4GGQ A;  3CST A;  3TL5 A;  3Q8B A;  1C79 A;  3AUL A;  4RM8 A;  1UF0 A;  1IGC A;  3A9K A;  2HE7 A;  2OED A;  1L0X B;  1IP9 A;  2AX5 A;  2KOX A;  2WXI A;  3KH0 A;  4P1C C;  3T8M A;  2XK5 B;  1JAL A;  1WGD A;  2Q5W D;  5C23 A;  3Q8A A;  1UUP A;  2WGS A;  3IVF A;  2FBW B;  3ZNI D;  3ZRF A;  2JYE A;  2XK5 A;  1P1A A;  4IM3 A;  5FR3 A;  2A5U A;  2LZ6 A;  3ECI A;  4N59 A;  1G6J A;  4W9D A;  4WAF A;  2ZCC A;  1SE4 A;  2C60 A;  3LDZ E;  2LXA A;  1WGH A;  3EA6 A;  5IN7 A;  2CJO A;  1XLO A;  2ZJD A;  1TS2 A;  2KTF A;  3OAW A;  2H89 B;  2O6V B;  1RFA A;  3P2B A;  1XCQ L;  3AE2 B;  3L54 A;  3CSF A;  1R4N B;  2BF8 B;  5AUK A;  3MJ5 A;  1PDX A;  3W1Y A;  4WWN A;  3HVZ A;  1UWX A;  1WZ0 A;  3GZN B;  1ZUD 2;  1OGW A;  1A5R A;  5CTR C;  1ZGU B;  3TJP A;  4EE2 A;  4LDT D;  3NRZ A;  2DWQ A;  2EMS A;  2FE8 A;  4REZ A;  2LGY A;  2VZK D;  1WE6 A;  3JYU A;  3L4P A;  1UGM A;  3L17 A;  1WX7 A;  2BGF A;  2L83 A;  3DBS A;  3W5V B;  2WXF A;  5BMI A;  2YEP B;  4RGT A;  5D94 A;  1LFD A;  1VJK A;  3CIR B;  1I42 A;  3RZF A;  2CR5 A;  4ZHO A;  2D10 A;  1FMA D;  4A3P A;  2LGS A;  3NVY A;  2IGD A;  1WJ4 A;  4TMA B;  4A55 A;  2BQQ A;  3PZD A;  1V86 A;  3AEC B;  3N9Y C;  1C76 A;  2NVU I;  2NBV B;  1WYG A;  2IY1 B;  1GC7 A;  2KWU B;  3P4Q B;  1I4G A;  1GB4 A;  1WMH B;  1WR6 E;  4MGZ E;  4TUU A;  1S1Q B;  4JWS C;  4DXF A;  4K3C A;  2BB6 A;  2CU3 A;  3Q3M C;  2IPK D;  5BO4 B;  3KW5 B;  3QX1 A;  1TKG A;  1TJE A;  1V8C A;  2ZW1 A;  2JVC A;  2PVO D;  2LRU A;  2NMQ A;  3RYT A;  3MHZ A;  4DK5 A;  4AUQ C;  4HRS A;  3H7P A;  1JWA D;  2HTH A;  1KJT A;  3T3O A;  3TEW A;  4W9H A;  2G4S A;  3ZNH B;  4A3O A;  2JXT A;  3V3X A;  4J6I A;  1C77 A;  4A9A A;  2JZZ A;  5KHQ A;  3SU8 X;  3BYT B;  4JX1 C;  2WDT B;  3H7P B;  3APC A;  1WIA A;  4P16 A;  2WXJ A;  3ZXV A;  4GN1 A;  2N9L A;  1QF6 A;  3R7Q A;  1JRO A;  1D6E C;  2DHZ A;  2KYW A;  3LYY A;  1F52 A;  4HXD A;  2MJ3 A;  2Y5P A;  1PGB A;  5LLI A;  2H88 B;  4WJQ A;  3NUH B;  3KWV A;  2BS2 B;  3AE4 B;  2KMC A;  4CYE A;  4RF0 A;  4YL8 A;  1I4H A;  1WGG A;  4P1B C;  2BS3 B;  2M19 A;  3ZW3 A;  4PYU A;  3ZRC A;  1X1M A;  2N4F A;  2D07 B;  2CHZ A;  4FXC A;  1YJI A;  4EUT A;  4ITK A;  5D6J B;  2IO0 B;  2QIL A;  4IM0 A;  3JW0 X;  2LJ5 A;  3K9P B;  3PZ7 A;  1SGH A;  2CHX A;  2W82 A;  1WI0 A;  2K8B A;  1T6B X;  3V62 A;  2WQY B;  2W54 A;  2LAS A;  4W9F A;  3KQ4 A;  4HKQ A;  3R66 C;  2WDR B;  1M4V A;  2Z8L A;  5DPW A;  3KLS X;  3IT6 B;  2YLM A;  4M00 A;  2CHW A;  4RNA A;  4W9E A;  1V1O A;  4LNO A;  2JWU A;  4II3 B;  4M8N A;  3ENE A;  3PRE A;  3A1Q A;  2D3C A;  1JWU D;  2FCN A;  4ZDV A;  2KDI A;  4K1R B;  2BWF A;  2V1Y A;  5TSS A;  4ZOH C;  2HDE A;  1AYF A;  1DYQ A;  3A33 B;  3Q14 C;  2LUE A;  3A9J A;  2ZVN A;  1SB3 C;  1D4B A;  1ZDV A;  3VTU A;  2FCQ A;  5L83 A;  1NI2 A;  2NPT A;  2N0S B;  2NTT A;  2MRP A;  2PE9 A;  1MI0 A;  1SE2 A;  4KIK B;  3GE8 C;  4RH6 A;  5C1Z A;  4LCD E;  2DAJ A;  3N32 A;  1LO5 D;  3V6C B;  1V80 A;  2KFK A;  4L23 A;  4ANV A;  3U2S C;  1PFD A;  1NDD A;  1T3Q A;  2J52 A;  2N9K A;  5AEK B;  2K1F A;  1E8Z A;  2CU1 A;  2GBR A;  1KTK A;  2WXO A;  3PSE B;  2IO1 B;  2NR2 A;  3AXC A;  4KX6 B;  4LNF A;  5DPR A;  4DXA B;  1WXA A;  2V0G A;  4MEL A;  3DQV A;  3H9D A;  1K51 A;  2BYV E;  1TYG B;  2NPT B;  5AZH A;  4L2Y A;  3SR6 A;  3AEA B;  1R4M I;  3IHP C;  4KIK A;  1JQ4 A;  3M3J A;  2LVO A;  1T0Q C;  3L08 A;  3SHQ A;  3ZJT A;  3L13 A;  2WU2 B;  2JPH A;  1FFV A;  1P9D U;  3NY5 A;  1TZ1 A;  5AZF A;  1E8X A;  1C4A A;  2Z0D B;  3AE9 B;  4W9K A;  2UWQ A;  3UI3 A;  3MC9 A;  1R7S A;  5H92 C;  1CMX B;  3PO0 A;  3CMM B;  2INP E;  2FNJ B;  3AEB B;  3PV1 A;  2MW5 A;  4W9G A;  4FBJ B;  1HE8 A;  5E6O A;  3NHE B;  2Y5C A;  1CK1 A;  1L5P A;  4DWF A;  4XDD A;  2JY6 A;  2KVZ A;  4GSW A;  4K7S A;  1ISN A;  1VZ8 A;  3NVV A;  3RN9 C;  2SEB D;  3N30 A;  4MGY E;  3KUD B;  1QZE A;  2NTS A;  4ASW C;  1YD8 U;  3MFG A;  1NEN B;  1NYQ A;  3R2T A;  4NNJ B;  1FCL A;  1MVK A;  1I4Q A;  3OJ3 A;  3B1L X;  4BKT A;  1U4A A;  1WRD B;  3ZIM A;  1IBX A;  2LRW A;  2KDE B;  3T9L A;  2JUO A;  3AE5 B;  3Q6B A;  5LXI B;  1V1P A;  1SBB B;  2WS3 B;  1GJZ A;  5FR6 A;  2BS4 B;  5JHB A;  1P3Q U;  2N7J A;  2KO3 A;  1KLU D;  1XXG A;  2IGH A;  1LXD A;  2HJ1 A;  2RDG A;  4EFO A;  3T3N A;  2JRI B;  3L0W B;  1L4Z B;  4C7Z A;  3VR9 B;  2N1V A;  2HJ8 A;  2PMV A;  3Q69 A;  2WYQ A;  3ZXR A;  3NVW A;  2M0X A;  2KFK B;  1HQR D;  2I2Y A;  4NAW A;  3R7R A;  4WAA A;  3Q8C A;  4M8M A;  1E7P B;  4OZB A;  4I6P A;  1NVI D;  3DBH I;  3GOE A;  2N1W A;  3NS8 A;  3WAN A;  4C4V B;  2BTE A;  1IPG A;  1SF0 A;  2OJR A;  1MHH E;  4JIO U;  1QQR A;  2K8C A;  3QIJ A;  3UIN B;  3V05 A;  4XWT A;  1RRB A;  3UGB B;  2PJH A;  2LUM A;  2N7E A;  1E6E B;  2GBK A;  1DGJ A;  1QOG A;  3HUI A;  3ZJV A;  2MBO A;  5J2R A;  1WGR A;  4F7Z A;  3HHM A;  2R2Q A;  4KGT A;  1F77 A;  1D3Z A;  2K6Q A;  2KT7 A;  2C9W B;  1KLV A;  3A4R A;  4YSZ B;  4IG7 B;  3PHW B;  1KM7 A;  1V9J A;  5BYR A;  1TS4 A;  1WXQ A;  2LEK A;  3Q3N C;  4GDL A;  4IWQ A;  3DVN V;  4XGA B;  1VZ6 A;  1QOA A;  2X8X X;  2WLB A;  3DBL I;  3ZDT A;  1YN3 A;  2AWT A;  4CO7 A;  3ZJU A;  1GB1 A;  5CX3 A;  4ACF A;  1WFY A;  2MEK A;  2RD0 A;  4W9J A;  2IBI B;  2V9H A;  3AE7 B;  2L0F A;  3NVZ A;  2DYO A;  3DBL B;  1C3T A;  2MCN B;  4JPS A;  1YIW A;  1F2R C;  3K9O B;  3BIN A;  2MX2 A;  3VRA B;  2AL6 A;  4I6N B;  3RNF C;  1P7F A;  2AEH A;  4PT5 A;  3N20 C;  1FFU A;  3B2F A;  2YVC A;  2BKF A;  2WU5 B;  1V1P B;  1V81 A;  1FNU A;  2K0P A;  3MHS D;  3AEG B;  4WWP A;  2J7Q B;  2KN4 A;  4MDK E;  4M0W A;  2BB5 A;  4MGI E;  1IYF A;  4N6E B;  1EF5 A;  3AB5 A;  3PVL A;  4ZRK A;  1ROE A;  1WZ3 A;  3DBR I;  4GDK B;  2IJ0 A;  4NPN A;  2ZPN A;  2D3A A;  2M0A A;  3VH3 B;  5BMH A;  3RUI B;  2PEA A;  2KTR A;  2EEL A;  4RM9 A;  2BW2 A;  2GI9 A;  2LXC A;  1V5O A;  1WJN A;  1AAR A;  3WCQ A;  4XWW A;  2LGD A;  1P7E A;  4ICV A;  5CHF A;  5D7G A;  4S0R A;  2HTM E;  3AN1 A;  2K6D B;  3NOB A;  1JW9 D;  4KSK C;  2FIF A;  2XNA C;  2WHI A;  3WAO A;  1OQR A;  4LNI A;  1V97 A;  2LMC A;  1FD6 A;  2FCM A;  2GOW A;  4GOC A;  2WXG A;  3AV8 A;  3DVG X;  4IW0 A;  4US8 A;  4E3C A;  1DOX A;  4YSY B;  4GIV A;  2LFI A;  1KF6 B;  4KGS A;  5EE0 A;  1HXY D;  1YQ4 B;  1NBF C;  2ON8 A;  1I4X A;  2M1M A;  3OWE B;  2LVP A;  3PHX B;  4BKG A;  3BYY B;  4MJS A;  3B08 A;  4E71 A;  1K52 A;  1SEB D;  2XBB C;  1WYW B;  2KLC A;  3H8H A;  5KHO A;  3RNC C;  1HA5 A;  2K22 A;  2E6X A;  1YJ1 A;  4MH8 A;  2WDQ B;  4A6Q A;  4TV3 A;  2WXN A;  3UQA A;  5J18 A;  3JSV B;  3VVW B;  3AEE B;  3APF A;  1L0Y B;  3QCA A;  1LQB A;  2W9N A;  1ZP0 B;  4YWG G;  1E7V A;  5DCN A;  1UGJ A;  3LB8 C;  2L0T A;  1EM7 A;  2FUH B;  5EDS A;  1TZO A;  3HK0 A;  4URK A;  1XCT L;  5EE3 A;  3JSV A;  4XX5 A;  2AL3 A;  5C2T B;  1WY8 A;  3VRB B;  2M17 A;  3MJW A;  2J42 A;  4MJS B;  4JL9 A;  2Z59 B;  3HVD A;  2MBH A;  2Z0E B;  5MPO A;  4A8X C;  1CQV A;  3ML9 A;  2K8H A;  1TKE A;  4R3D A;  4Q2J A;  2WXL A;  1WGY A;  3PPA A;  2AQ1 B;  5GXG B;  3QA8 A;  1TS3 A;  4ZRP A;  3NZS A;  2GBN A;  3MC0 B;  1VRA B;  3A9J B;  1FM0 D;  2V3S A;  1VZ7 A;  3QC8 B;  3RZW C;  3E9S A;  3HM6 X;  2INN E;  3MP9 A;  3QAR A;  4B95 A;  3KWL A;  5LNK 1;  2L3Z A;  5C3J B;  2DX5 B;  4WUR A;  2FUG 1;  2MLB A;  4FHJ A;  3M63 B;  2D11 A;  1WF9 A;  2DBY A;  1Q1O A;  4B6W A;  5G2N A;  4UDU C;  3TUO A;  3WA0 A;  4YSX B;  2K3U A;  4AWJ A;  3V60 A;  2DEN B;  1VD2 A;  2JRH A;  1Q5W B;  3ZQ4 A;  2K5P A;  1ZKH A;  4EZJ A;  3FIL B;  3TMP B;  2KKC A;  5G5H A;  2KC2 A;  1WGK A;  3C8Y A;  1WX9 A;  3Q8F A;  4XE0 A;  2WXR A;  2B3A A;  2KHW B;  3EFU A;  1BXT A;  4BBN C;  3RPF C;  2WP9 B;  2KWD A;  3FC4 A;  4BAX A;  2JF5 A;  1V5T A;  1FPY A;  4MGK E;  4B0E A;  1ZOY B;  2L32 A;  1C9F A;  4LNN A;  3C0R B;  1E8W A;  2LGX A;  3NG0 A;  1VLB A;  3VTW A;  3I5J C;  3DVN U;  1FIQ A;  3WAM A;  3U7Z A;  2SAK A;  1J19 A;  3PTF C;  4MM3 B; 
#chains in the Genus database with same CATH homology
 2PPH A;  3A1Q B;  1OEY J;  4GGQ A;  1EO6 A;  4GB9 A;  3CST A;  1YQB A;  3PRZ A;  1WX8 A;  4ZYN A;  3TL5 A;  4G3X B;  4NNJ B;  3AUL A;  3BY4 B;  2G45 B;  3B1L X;  3OJ3 A;  4BKT A;  1U4A A;  1WRD B;  3ZIM A;  4RM8 A;  5DPT A;  4HPL B;  2BWE S;  2LRW A;  3A9K A;  2KDE B;  2HE7 A;  3T9L A;  2G4D B;  3APD A;  2JUO A;  1IP9 A;  5LXI B;  2WWZ A;  2REX A;  1ZW7 A;  3VH4 B;  2KOX A;  1GJZ A;  3VDZ A;  3KH0 A;  2K25 A;  5FR6 A;  2M8S A;  3T8M A;  2XK5 B;  2BYE A;  2MBE A;  2IY0 B;  4JQW C;  5JHB A;  2I1K A;  1P3Q U;  4G50 A;  1MG8 A;  2KO3 A;  1WXS A;  4EEW A;  4MM3 A;  2GBJ A;  3PLU A;  1WGD A;  1LXD A;  4JGH B;  2ZNV C;  2ZNV B;  5C23 A;  3QWZ B;  4EFO A;  4HVB A;  2JRI B;  3L0W B;  3U7D A;  1UBI A;  4GXB A;  3VTV A;  2FAZ A;  4DBG A;  4DHJ B;  2KFJ A;  4X57 B;  2N1V A;  4IC7 B;  2HJ8 A;  3IVF A;  2N7D A;  1WR1 A;  3ZNI D;  2WYQ A;  2KC1 A;  2KMA A;  3ZRF A;  2J0K A;  2M0X A;  2KFK B;  4XZ4 A;  4PS8 A;  4NAW A;  1TTN A;  3R7R A;  3H1U A;  2L8J A;  4WAA A;  2G3Q B;  2XK5 A;  4II2 B;  1P1A A;  4IM3 A;  4NY0 A;  2A5U A;  2LZ6 A;  3ECI A;  2NCN A;  4GDL B;  1G6J A;  4W9D A;  2O2V A;  4M8M A;  1OQY A;  4I6P A;  4HDO A;  2ZCC A;  3DBH I;  3GOE A;  2C60 A;  4MSM B;  2N1W A;  5D2M B;  3LDZ E;  2LXA A;  2O6V D;  1WGH A;  3NS8 A;  3WAN A;  4EZK A;  4ANX A;  1BT0 A;  3RT3 B;  1IPG A;  2OJR A;  2KJ6 A;  3KVF B;  4JIO U;  2ZJD A;  3PRM B;  2K8C A;  3QIJ A;  3UIN B;  2KTF A;  1RRB A;  3OAW A;  1OTR B;  4ANW A;  5TR5 A;  3UGB B;  1YX5 B;  2O6V B;  2PJH A;  1RFA A;  3P2B A;  1J0G A;  2N7E A;  4PS7 A;  2GBK A;  2MA9 B;  3L54 A;  3CSF A;  1P0R A;  2IO3 B;  2MBO A;  3ZNG C;  2BF8 B;  2FID A;  5J2R A;  3X0W A;  1WGR A;  3KUC B;  4WWN A;  3W1Y A;  4F7Z A;  3ZLZ A;  3A4S C;  1WZ0 A;  3HHM A;  3WAP A;  4TQ0 A;  1OGW A;  4EOY A;  2LWP A;  1A5R A;  2R2Q A;  1SE9 A;  5CTR C;  1ZGU B;  3TJP A;  4EZL A;  1WM2 A;  1D3Z A;  2K6Q A;  1TBE A;  4LDT D;  2DZI A;  4N9F 4;  2C9W B;  1KLV A;  3A4R A;  2EMS A;  2CS4 A;  2O6V A;  5CHW A;  2GMI C;  4IG7 B;  4CHK A;  2LGY A;  2BKR B;  3PHW B;  1KM7 A;  2KQ7 A;  4AJW A;  4GU2 A;  4LDT B;  1V9J A;  2RGF A;  1WE6 A;  3JYU A;  2L76 A;  1UGM A;  2KDF B;  3L17 A;  1T0Y A;  1WX7 A;  4IWQ A;  2BGF A;  4GDL A;  4NJ7 A;  3DBS A;  1UEL A;  3DVN V;  1Y8R C;  2JT4 B;  2KX3 A;  4HDQ A;  5D94 A;  1LFD A;  3DBL I;  4W9C A;  1I42 A;  3ZDT A;  1UZX B;  3RZF A;  2CR5 A;  4KVG B;  3V61 A;  4M0W B;  3W1S A;  2N9P C;  2D10 A;  2DYB A;  2AWT A;  3U30 A;  4A3P A;  4CO7 A;  4BOS C;  3SDL C;  4IUM B;  4KDL B;  1WJ4 A;  3L10 B;  5CX3 A;  3DOW A;  4IWO A;  1WFY A;  3PZD A;  2RD0 A;  4PS3 A;  1V86 A;  3PT2 B;  3VQI A;  4IM2 A;  4W9J A;  3ZO5 B;  2MP2 B;  2A4Z A;  2IBI B;  2NS5 A;  4HPM B;  2L0F A;  2CKH B;  2NVU I;  2NBV B;  2KWV B;  4XC2 A;  2IY1 B;  2KTR B;  2DYO A;  1GC7 A;  2MCN B;  1C3T A;  1YIW A;  3ZUN A;  2DZK A;  4MH0 E;  4DDG D;  3K9O B;  2KWU B;  3BIN A;  4KDI C;  2MX2 A;  2VRR B;  2AL6 A;  4I6N B;  4DDI D;  4E74 A;  2DAF A;  4HWI B;  1PQS A;  2N9X A;  1WMH B;  3ML8 A;  1L2N A;  1WR6 E;  2AEH A;  4MGZ E;  1LM8 B;  2AYO B;  1M94 A;  4TUU A;  3PLV A;  1S1Q B;  4LJP B;  2KJH B;  4NJ6 A;  5JZE B;  2YVC A;  2MP2 A;  4FHK A;  2BKF A;  4ICU A;  1UBQ A;  1V81 A;  4A20 A;  1H8C A;  4WJO A;  3MHS D;  3KW5 B;  5BO4 B;  3QX1 A;  4K7U A;  4WWP A;  2J7Q B;  2JVC A;  1WM3 A;  4FUL A;  4BKS D;  1JRU A;  2LRU A;  1VCB A;  4W9I A;  4TQ1 A;  5GMV A;  4MDK E;  3KUZ A;  1XD3 B;  1Z2M A;  3RYT A;  4BVU C;  3ZTC A;  2GBM A;  4MSQ B;  2IZV B;  4MGI E;  4DK5 A;  1IYF A;  1EF5 A;  4AUQ C;  3PVL A;  3OLM D;  4ZRK A;  2KDB A;  1I35 A;  3KYC D;  3H7P A;  1WZ3 A;  3AI5 A;  2HTH A;  2KVR A;  1KJT A;  3DBR I;  4GDK B;  4W9H A;  4NPN A;  2MBQ A;  2ZPN A;  2G4S A;  4FN2 A;  3ZNH B;  4F1S A;  2C5L C;  3TBL D;  4A3O A;  1WJ6 A;  3VH3 B;  4J6I A;  2K39 A;  4DHZ E;  3RUI B;  2PEA A;  3HIZ A;  2EMT A;  2KTR A;  4RM9 A;  2JXX A;  2JZZ A;  2JZ3 B;  2LD9 A;  3IBE A;  4FJV B;  3ZKJ C;  2LXC A;  5KHQ A;  3ZNZ B;  1V5O A;  1WJN A;  5LXH A;  2HD5 B;  1AAR A;  4AJY B;  3SU8 X;  4OVU A;  2WDT B;  2LGD A;  4HJK A;  2WX0 A;  3KYD D;  2WX1 A;  4ICV A;  5CHF A;  3H7P B;  4MEM A;  3APC A;  5D7G A;  4BKS A;  1UD7 A;  4BFR A;  4IWP A;  1WIA A;  3NZU A;  1TGZ B;  4GN1 A;  1Z5S B;  2K6D B;  2C7M B;  3R7Q A;  3NOB A;  1E8Y A;  4KSK C;  3PTF C;  2FIF A;  4DHJ D;  3WAO A;  2DHZ A;  3U8Z A;  4KV2 A;  4HXD A;  3WIM A;  2UYZ B;  2ZZP B;  2GOW A;  2FCM A;  2V4L A;  5LLI A;  4GOC A;  3DVG X;  3O65 B;  3VXW A;  2ZEQ A;  4IW0 A;  4WJQ A;  5L95 C;  1GUA B;  2KMC A;  3JVZ X;  3EC8 A;  4CYE A;  1S3S G;  4YL8 A;  1WGG A;  3LJ3 A;  4WWO A;  4E3C A;  3VFK A;  2KN5 A;  1YX6 B;  4GIV A;  3A9K B;  5IA7 A;  1FXT B;  2LVQ A;  4PYU A;  3ZW3 A;  3ZRC A;  1X1M A;  3CF6 E;  2N4F A;  1WXV A;  2D07 B;  2CHZ A;  4FLH A;  3RUL A;  3X23 A;  1WE7 A;  4EUT A;  4HCN B;  2C7N B;  3UQB A;  1NBF C;  5D6J B;  4HK2 A;  2M1M A;  4TKN A;  3RD2 A;  2IO0 B;  3D32 A;  2LVP A;  3M62 B;  2N9E B;  3QQ8 B;  2M4N A;  3PHX B;  3I3T B;  3JW0 X;  4IM0 A;  4BKG A;  2LJ5 A;  3K9P B;  4F8C B;  1SGH A;  2QHO A;  2CHX A;  2KAN A;  3B0A A;  3MTN B;  1WI0 A;  2K8B A;  4FJY A;  4MJS A;  3B08 A;  3V62 A;  4E71 A;  2XBB C;  1WYW B;  2KLC A;  3Q3F A;  5KHO A;  2FCS A;  2LAS A;  3ONS A;  4W9F A;  3DCG A;  4RMA A;  3R66 C;  4I6L B;  3UIO B;  2DZJ A;  4NAW B;  3Q3J A;  5HKH A;  3DDC B;  2RPQ A;  1GG3 A;  5DPW A;  1YJ1 A;  2O2V B;  4NQL B;  2YLM A;  5G55 A;  3VUY A;  4TV3 A;  2NBW B;  2KK8 A;  3UQA A;  2CHW A;  5E6N A;  5J18 A;  3JSV B;  3VVW B;  3PGE A;  5J17 A;  3APF A;  3IFW B;  4LJO B;  4W9E A;  2PE6 B;  4II3 B;  1GC6 A;  3QCA A;  3RCZ A;  5JHA A;  1LQB A;  5JH5 C;  4M8N A;  1J8C A;  2NBU A;  1F9J A;  2W9N A;  3ENE A;  3PRE A;  3QK0 A;  4W9L A;  2J0M A;  3A1Q A;  1E7V A;  5DCN A;  2L0T A;  1OEY A;  4AOF A;  3WAL A;  2FCN A;  1UH6 A;  1E7U A;  2FUH B;  4ZDV A;  5EDS A;  2KDI A;  3HK0 A;  4K1R B;  2BWF A;  2V1Y A;  3GZN I;  1L7Y A;  2KQS A;  2BYF A;  4HLE A;  2L7R A;  4URK A;  3JSV A;  2MSE D;  4XX5 A;  2AL3 A;  2KJR A;  1WY8 A;  2M17 A;  3A33 B;  3MJW A;  1XQQ A;  2LUE A;  2RR9 A;  2DZM A;  2MQJ A;  2ZVN A;  3A9J A;  4MJS B;  3TCA A;  4JL9 A;  3VTU A;  2FCQ A;  2Z59 B;  2ZVO A;  5L83 A;  5E6P A;  1EUV B;  2MBH A;  2KLG A;  2Z0E B;  1NI2 A;  2NPT A;  4EKU A;  2R2O A;  4GDK A;  4WJN A;  2MRP A;  3DVG Y;  3ML9 A;  2PE9 A;  2K8H A;  3TIX A;  4KIK B;  3UIP B;  3VUX A;  1V6E A;  2RSU A;  5C1Z A;  1WGY A;  3PPA A;  2LI5 A;  4LCD E;  2DAJ A;  2KXJ A;  3OJ4 B;  2JWZ A;  3QA8 A;  2J0J A;  3AU5 A;  2MWS B;  3N32 A;  3V6C B;  1V80 A;  3NZS A;  3UF8 A;  2GBN A;  2KFK A;  2I1J A;  3V6E B;  4ANV A;  4ANU A;  1NDD A;  3A9J B;  4DHZ B;  4ZRI A;  2V3S A;  5AEK B;  3QC8 B;  2K1F A;  3RZW C;  1E8Z A;  2CU1 A;  1Q0W B;  2GBR A;  3HM6 X;  3QAR A;  2ZCB A;  4NQK E;  4B95 A;  3N3K B;  4G11 A;  3R3M A;  4OVV A;  2KD0 A;  5DPS A;  4FAD A;  3H7S A;  4GMV A;  3ZDM C;  2KWC A;  2L3Z A;  3EEC A;  3PSE B;  2DX5 B;  2IO1 B;  2NR2 A;  4K81 A;  3AXC A;  3ALB A;  1RAX A;  2MLB A;  4FHJ A;  5DPR A;  1SIF A;  2Y5B B;  1R4N I;  4DXA B;  1WXA A;  3M63 B;  2DYM A;  4MEL A;  2IYD B;  2D11 A;  1WH3 A;  1WF9 A;  3VAW A;  1GNU A;  1Q1O A;  4B6W A;  2L05 A;  4JLC A;  5AZG A;  5G2N A;  3DQV A;  2KZR A;  3H9D A;  3ZTD A;  2BYV E;  1WMH A;  4KSL C;  3VUW A;  3WA0 A;  2NPT B;  3PS6 A;  5AZH A;  3QJZ A;  3V60 A;  4AWJ A;  4FA6 A;  2DEN B;  1VD2 A;  2JRH A;  1Q5W B;  4FJZ A;  1H4R A;  1R4M I;  1ZKH A;  4EZJ A;  3H6N A;  3IHP C;  2IO2 B;  1E90 A;  3PRP B;  4KIK A;  4B9K A;  2KX0 A;  3M3J A;  2LVO A;  4P7I A;  5IAA C;  3TMP B;  3SD5 A;  3L08 A;  3SHQ A;  1E5W A;  3W1S C;  2KKC A;  3IG3 A;  3L13 A;  2KC2 A;  3M95 A;  1EF1 A;  2JPH A;  3HM3 A;  4BBN F;  1WX9 A;  3NY5 A;  1P9D U;  3S2A A;  1TZ1 A;  5AZF A;  1E8X A;  2Z0D B;  4W9K A;  4KZ0 A;  2UWQ A;  2B3A A;  2KHW B;  3EFU A;  3DPD A;  4BBN C;  1CMX B;  1KOT A;  3CMM B;  4G0N B;  2KNB A;  2FNJ B;  3AU4 A;  3PV1 A;  4WJP A;  4K7W A;  1RLF A;  1XT9 B;  2JF5 A;  1V5T A;  2ZPY A;  2MW5 A;  4W9G A;  4FBJ B;  2ASQ A;  5CHV C;  1HE8 A;  5E6O A;  4AP4 C;  3NHE B;  4MGK E;  2L00 B;  2EKE C;  4DWF A;  2JY6 A;  4GSW A;  4K7S A;  1ISN A;  4PYZ A;  3VHT C;  1P98 A;  3C0R B;  2C7H A;  3QHT A;  4ZRJ A;  2D2Q A;  1E8W A;  2LGX A;  3VTW A;  3EHV A;  3N30 A;  3ZVV A;  1WJU A;  4HCP B;  4MGY E;  3QAQ A;  3DVN U;  3KUD B;  1QZE A;  1C1Y B;  3WAM A;  4BOZ B;  1K8R B;  2D3G A;  4KZC A;  4WQO B;  4ASW C;  1V2Y A;  2MBB B;  2OOB B;  1V49 A;  1WXM A;  1YD8 U;  1J19 A;  2XEW A;  3L16 A;  2BPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...