2KTRA

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrA00
4BKSA 4EZKA 2LXAA 4KIKA 2KNBA 2KLCA 4KZ0A 3QARA 3TCAA 5EDSA 4W9GA 1GNUA 4HPMB 3NY5A 4II2B 3V6EB 4EZLA 1WM2A 2FCNA 2REXA 3L17A 4HPLB 3UF8A 3N32A 3SHQA 3NZUA 3Q3FA 1OQYA 4AJYB 2PE9A 2JXXA 4GDKA 3TL5A 2XEWA 3PLUA 3ZDTA 2NR2A 3IVFA 4FJYA 3ML8A 3VTVA 2ZPYA 5AZHA 1WJNA 2D2QA 3PHXB 1KOTA 2V3SA 2JZ3B 5AZFA 2EKEC 1E7VA 3LDZE 2OJRA 3QIJA 1X1MA 1WX9A 1KM7A 4G11A 3QC8B 4EUTA 4NQKE 2KX0A 4KV2A 5J2RA 4GGQA 3ML9A 2KDFB 1V49A 3ALBA 3UQBA 3R3MA 4XX5A 2JY6A 1VD2A 1WMHB 3NHEB 3ZRFA 2CU1A 3PGEA 2BKRB 5C1ZA 1V6EA 2KJHB 3A9KB 1P1AA 2KJRA 2WX0A 3M3JA 4DBGA 4HDQA 2NBVB 2DENB 1Y8RC 3CSTA 1GUAB 1IP9A 2Z0DB 2LD9A 3R7QA 3HHMA 1TTNA 4URKA 1HE8A 2FCMA 4WWNA 2K6DB 2L8JA 1WFYA 2M4NA 4DDID 1G6JA 2MW5A 3QX1A 2C7MB 2MRPA 5DPWA 2K6QA 4RMAA 4IWOA 3UQAA 2DYOA 3H7PB 5CTRC 2D07B 2CR5A 1OEYJ 3APCA 5C23A 1EF1A 3VAWA 4W9DA 1J0GA 1WXMA 2NPTB 5LLIA 1V80A 5JHBA 1SGHA 3A9JB 4FADA 2MWSB 2ZCBA 3L13A 1MG8A 3PV1A 4K7WA 4FBJB 1V5TA 4WJOA 3RZFA 2BPSA 4ICUA 2R2OA 4YL8A 4LJOB 4B9KA 1J8CA 3GOEA 4HWIB 4ZYNA 2C60A 2GOWA 1CMXB 1UELA 2GBRA 2KDBA 2JVCA 5J17A 5L83A 4J6IA 2N4FA 2DAJA 2M0XA 5J18A 1LFDA 4X57B 4NPNA 4CYEA 1R4NI 2WX1A 1WE7A 5GMVA 5E6PA 3M95A 1RRBA 2JF5A 3QK0A 5G55A 2C5LC 2KWCA 2Y5BB 3H9DA 4MGIE 2M8SA 3QA8A 4F8CB 4ZRIA 2M1MA 3WAMA 2KMCA 4M8MA 5BO4B 4ICVA 2LGDA 1RLFA 4LDTD 1AARA 1K8RB 3C0RB 3TJPA 5KHQA 3JVZX 1YIWA 4KVGB 2B3AA 2D3GA 3TBLD 2FIFA 4GXBA 3L08A 2JPHA 4M0WB 4G50A 3L0WB 2MA9B 4KSLC 3RCZA 5KHOA 1EF5A 3KUDB 5CHFA 1LM8B 2HE7A 2YVCA 3DVGX 4ZRJA 4CO7A 1V2YA 1C1YB 1WGRA 1M94A 2DHZA 3X0WA 2IY1B 2KFKB 4WJNA 3DVNV 4WWPA 2FCQA 3VXWA 2LVPA 2IO0B 1Z5SB 2KWVB 3SDLC 2WYQA 3K9PB 3AULA 2J0MA 2ZVNA 1KLVA 2W9NA 2G45B 2BYVE 5CHVC 4ANVA 4DXAB 1WYWB 3VDZA 1YX6B 4W9HA 2RGFA 4LDTB 1E8ZA 2JT4B 2DZIA 4NAWB 2WWZA 3DVNU 1H4RA 2IO2B 4ANXA 1NBFC 3RULA 1GG3A 1BT0A 1F9JA 3ZUNA 2LWPA 2XBBC 2LASA 4GB9A 2L7RA 4W9JA 4GN1A 4JL9A 4WJPA 5LXIB 2BF8B 3GZNI 4NY0A 1UZXB 2KD0A 3CSFA 4P7IA 3UIPB 3M62B 5FR6A 1E8WA 3BINA 2XK5B 3HK0A 4DK5A 3QWZB 4G3XB 4W9IA 3A9KA 3PVLA 4MM3A 2G4SA 2PPHA 1D3ZA 1WE6A 3DBRI 5D94A 3B0AA 3EECA 3VUXA 5CX3A 2NCNA 3HIZA 3CF6E 3L54A 1L2NA 2N9PC 2MBBB 3ZVVA 4EKUA 1WJ4A 3JW0X 4W9EA 4N9F4 3QJZA 2ZEQA 4M8NA 1NI2A 3WAOA 3OAWA 2HTHA 2DYMA 1E5WA 3H7PA 3Q3JA 1UBQA 3DDCB 4DHJD 2GBKA 1WZ3A 1E8XA 1WXVA 2BYFA 2KFJA 2K39A 4AP4C 2NPTA 1RFAA 5DPRA 5HKHA 3A9JA 4MJSB 3OJ3A 2BYEA 2ZJDA 4AOFA 1IYFA 2J0JA 2N7EA 2A5UA 3DBLI 4IM2A 4BBNF 1E8YA 3NZSA 2L00B 3ZDMC 2K25A 3PHWB 3PRPB 3ZNZB 2KWUB 4TQ0A 1Q0WB 3WA0A 2K8CA 3NOBA 3ZTDA 3UGBB 5DPTA 1EO6A 2C7NB 2O6VA 4GDLB 2OOBB 1XD3B 5LXHA 2KTRB 2A4ZA 2AYOB 2N9XA 4DHJB 2KZRA 2LJ5A 2K8HA 3VH3B 1V5OA 2L0TA 3DBHI 3LJ3A 3H1UA 1WIAA 4JLCA 3ZIMA 2LXCA 2IZVB 2WDTB 3N3KB 3B1LX 1I35A 4G0NB 2V4LA 4ZDVA 3PS6A 2KANA 3R7RA 2N9EB 3V6CB 3VUWA 4DDGD 1OGWA 4NQLB 4NJ6A 4KDIC 4DHZB 5IA7A 1IPGA 1Q1OA 2NBWB 1C3TA 1WJUA 1XQQA 1WR6E 4PYZA 3W1SC 1ZGUB 1XT9B 3PRZA 3JSVB 3U30A 3V60A 5JH5C 2LRWA 2ZCCA 3CMMB 4TV3A 5E6OA 1WF9A 3JYUA 2GBMA 3QCAA 2KFKA 4GOCA 2N1VA 2JRHA 1WGDA 3X23A 2LGXA 3RD2A 3EC8A 2DZJA 3KH0A 2N1WA 4E3CA 4GSWA 2UWQA 3UINB 5JHAA 3VUYA 3R66C 4MDKE 2MP2B 3P2BA 1Z2MA 3ZRCA 2KHWB 1KJTA 3VVWB 2QHOA 3BY4B 1TGZB 4WJQA 1YX5B 3IG3A 1A5RA 1TZ1A 3QAQA 3TMPB 2O2VB 4NAWA 4AUQC 3L10B 3D32A 4FN2A 2CKHB 2BWFA 2KXJA 4IUMB 4HCPB 4PS7A 3U7DA 3A1QB 4IWQA 1WZ0A 1P98A 2IYDB 4ANUA 2BGFA 3KYDD 1LQBA 4II3B 2LVQA 3A4RA 3IFWB 1E7UA 2MQJA 4I6NB 3RYTA 1P3QU 2IBIB 2MBQA 2XK5A 4W9LA 3W1YA 1WXAA 2KX3A 2LRUA 1ZKHA 1OEYA 3I3TB 2L3ZA 3ZKJC 1LXDA 3M63B 1H8CA 1WGGA 4PYUA 2KOXA 2KC2A 4IW0A 1P0RA 2K1FA 5AEKB 3VHTC 2KDEB 1WRDB 4WAAA 4TUUA 3V62A 3O65B 1UD7A 2C7HA 5D2MB 2MX2A 2FUHB 1E90A 3KUZA 1WGYA 1SIFA 3KYCD 3MJWA 4B6WA 2IO1B 3B08A 1NDDA 2GMIC 4K81A 1WMHA 4MSMB 2MBHA 4GU2A 3ZO5B 4HJKA 4MJSA 3L16A 4AJWA 3ZTCA 2KO3A 2ZZPB 2ZVOA 1Q5WB 1WH3A 3VH4B 4F7ZA 5DCNA 3PRMB 2G3QB 2N7DA 2PE6B 2BKFA 4BKSD 2RD0A 4W9FA 2FCSA 2EMSA 3OJ4B 4WQOB 2DAFA 4W9CA 4I6PA 4B95A 4BOSC 2VRRB 2LZ6A 2RR9A 4K7UA 2NBUA 1J19A 1V9JA 2DZKA 2EMTA 4GDLA 1S3SG 1FXTB 4BKTA 2LUEA 4EZJA 2GBNA 2KTRA 2RSUA 1YD8U 3ZNID 1WXSA 3QHTA 4FHJA 4LJPB 2FNJB 4DWFA 5L95C 3DQVA 3A33B 1UH6A 3HM6X 3SU8X 2JRIB 1P9DU 3PTFC 4E71A 2DX5B 4FJZA 2L76A 1S1QB 3W1SA 4FJVB 2V1YA 1SE9A 2D11A 4RM8A 4XZ4A 5CHWA 2KK8A 3EHVA 2L0FA 4HK2A 4OVUA 2YLMA 3KVFB 2CS4A 2C9WB 3WANA 4HXDA 2AL6A 4XC2A 1ISNA 4HCNB 4KIKB 4MEMA 2I1JA 1WI0A 3JSVA 4FA6A 3EFUA 4HDOA 4IG7B 2DYBA 2FIDA 1RAXA 2JUOA 2Z0EB 3PT2B 3PZDA 4TKNA 2CHWA 2PEAA 2ASQA 2MBEA 4IM0A 4ASWC 2KDIA 3T8MA 3AXCA 1ZW7A 1GC6A 4GDKB 2KLGA 3ZNGC 3T9LA 2NVUI 2ZNVB 2MP2A 1R4MI 3DOWA 3H7SA 3PLVA 3PREA 4EOYA 3S2AA 4HLEA 2M17A 2IO3B 2AEHA 2O6VD 4FULA 2O2VA 2KKCA 1I42A 4K1RB 3WAPA 4GMVA 2MBOA 3U8ZA 2ZNVC 4PS3A 5DPSA 1UBIA 1QZEA 3A1QA 4MGZE 1T0YA 3DBSA 3WIMA 3MHSD 2AL3A 3ECIA 3K9OB 4F1SA 1OTRB 2J7QB 5IAAC 3V61A 1V86A 4BBNC 4I6LB 2DZMA 3ZLZA 2MCNB 3IBEA 4KDLB 3ZNHB 1GJZA 3DPDA 1WGHA 2HD5B 2KTFA 3DVGY 4A3OA 4JGHB 3UIOB 4BFRA 1JRUA 4KSKC 4DHZE 1PQSA 3PPAA 4IM3A 3H6NA 3VTWA 1WX7A 4MH0E 1EUVB 3IHPC 5D7GA 4ZRKA 4ANWA 4BVUC 4HVBA 2O6VB 2LI5A 5D6JB 3AI5A 2MLBA 3APFA 2J0KA 4K7SA 4E74A 2KJ6A 3RZWC 4KZCA 2KC1A 3RUIB 4A20A 2K8BA 3ONSA 4MGYE 4A3PA 4AWJA 3OLMD 2KVRA 4OVVA 4FLHA 2CHXA 5AZGA 5TR5A 4MSQB 2KN5A 4BOZB 2UYZB 5E6NA 4PS8A 3VTUA 2AWTA 4IWPA 2D10A 1WX8A 3DCGA 3HM3A 2PJHA 2L05A 2RPQA 4MELA 3N30A 3KW5B 4WWOA 2BWES 2KQSA 4JQWC 4BKGA 1U4AA 2FAZA 1WY8A 4TQ1A 3RT3B 4RM9A 2HJ8A 4MGKE 1TBEA 2GBJA 1YJ1A 2CHZA 2G4DB 3A4SC 3ZW3A 1VCBA 2Z59B 3APDA 4EFOA 1YQBA 3AU5A 4GIVA 1WJ6A 3VQIA 4LCDE 2JZZA 3VFKA 4NJ7A 4FHKA 2KQ7A 1V81A 2R2QA 4W9KA 4NNJB 1WM3A 3SD5A 3MTNB 2MSED 2LVOA 3KUCB 2I1KA 3QQ8B 4IC7B 2JWZA 1UGMA 1WR1A 2ZPNA 1GC7A 5G2NA 5JZEB 2NS5A 3NS8A 3WALA 3AU4A 2KMAA 2LGYA 4JIOU 4CHKA 4EEWA 3ENEA 2IY0B 3TIXA 3PSEB 1L7YA
chains in the Genus database with same CATH superfamily
4EZKA 2KLCA 3L17A 4HPLB 3SHQA 3NZUA 1OQYA 2PE9A 5AUKA 2NR2A 4FJYA 3ML8A 5AZHA 1KOTA 3P4PB 2OJRA 4C80A 1I4HA 4NQKE 4CQNA 1I4XA 4GGQA 3ZRFA 4Q2JA 4DBGA 4XYCA 1E7PB 2Z0DB 2KMMA 1HE8A 2DBYA 2ONQA 3B2FA 3UQAA 3H8HA 5CTRC 2CR5A 3IT4B 1WXMA 4HRSA 4FADA 2INDC 4FBJB 5BYRA 1V5TA 1D5XC 1PGXA 2BPSA 1SXTA 4M02A 1UELA 2GBRA 1JQ4A 3N1YC 2JVCA 5L83A 1JMLA 1LFDA 1MVKA 2WX1A 1WE7A 5G55A 1SJHD 2KWCA 3B9JA 2M8SA 1MJDA 4WH4A 5BO4B 1AARA 1K8RB 3V3XA 1TS2A 2WXNA 2QILA 3JVZX 2KVZA 2AQ1B 4G50A 4KSLC 3RCZA 4KX6B 5KHOA 1EF5A 3DHGC 4CO7A 3X0WA 2IY1B 4HPPA 3NJTA 1A70A 3VXWA 3P42A 4MT5A 2IO0B 1Z5SB 5AUIA 2ZVNA 2W9NA 5CHVC 1WYWB 2JQRB 2RGFA 4LDTB 1H4RA 4ANXA 3RULA 4LK0M 1QILA 1F9JA 3ZUNA 5E6JA 4W9JA 4YXDB 3GZNI 1UZXB 3CSFA 3M62B 2BTEA 3Q3NC 3BINA 4DXGA 3QWZB 4OZAA 3J9CA 1ROEA 4L23A 4O1NA 3C19A 1MG4A 1WE6A 3EECA 3VUXA 3L54A 1L2NA 2PLPA 3ZVVA 1WJ4A 1LO5D 4N9F4 1UWMA 1XXGA 3WAOA 2HTHA 1E5WA 1ZE3D 4DHJD 1UBQA 1WYGA 1E8XA 1WXVA 2YEPB 2K39A 3AE6B 5DPRA 1FRRA 3OJ3A 2ZJDA 2J0JA 3DBLI 4BBNF 1Q10A 4A9AA 2K25A 2QJLA 3PHWB 3PRPB 4TQ0A 3ZTDA 3NOBA 3UGBB 4N58A 3RNGC 4IOIE 1XD3B 2A4ZA 2AYOB 3NVZA 2LJ5A 2K8HA 3DBHI 3ZIMA 4A6QA 2GB1A 1YN5A 2V4LA 1NVID 2KANA 1K50A 3VUWA 4NQLB 5IA7A 1IPGA 2JZPA 1WR6E 3I63C 1ZUD2 2W3SA 5JH5C 2LHEA 1F2RC 4TV3A 4YT0B 3QCAA 1WGDA 3X23A 2LGXA 1I4GA 4EE2A 4OVZA 2CU3A 3ETRA 4MDKE 1Z2MA 3BY4B 1YX5B 3R8BA 1TY0A 1UNSA 3L10B 2LGIA 2IDYA 2KXJA 1R4NB 3U7DA 3A1QB 2IYDB 4ANUA 1LQBA 1EWYC 3KQ4A 3N1ZC 1PYWD 4OZCA 3A4RA 3KWLA 1E7UA 4I6NB 4S17A 2KX3A 5H8YE 3DWGC 2L3ZA 3M63B 1WGGA 4LNFA 4PYUA 4YSYB 1L6VA 2K1FA 2JYEA 2KDEB 1WRDB 3AN1A 2PVGC 2EELA 2KDMA 3V62A 1FNWA 1UD7A 5D3DA 1BMLC 1CQVA 1SIJA 3E9SA 4ZRQA 2QCZA 1WGYA 1SIFA 2IO1B 1NDDA 2GMIC 4H2AA 4MSMB 1C79A 1GPXA 2K5PA 2ZZPB 3HVDA 1WH3A 3VH4B 3PRMB 2G3QB 1KLUD 2PE6B 4BKSD 2RD0A 2WS3B 2DAFA 2LZ6A 2RR9A 5MPOA 2DZKA 5EE3A 2RSUA 3T3OA 1HTOA 1RFKA 4FHJA 2FNJB 3SU8X 2IGGA 3U2SC 3PTFC 1D6EC 2DX5B 1ACCA 3AEDB 3HUIA 2BB5A 4XZ4A 3EHVA 2WXRA 4YWGG 1QOGA 2L0FA 3KVFB 1GAQB 4XC2A 2RMMA 1YN4A 4MEMA 1WI0A 3N1XC 4FA6A 5JXVA 2XN9C 1RAXA 2RDBC 1VDVA 3U52E 3TSSA 3R2TA 5BMHA 2X8XX 3WCQA 1F2RI 3DOWA 3AE1B 3H7SA 2WU5B 2WXPA 3NZ3A 4K1RB 5G5HA 3WAPA 2MBOA 4PT5A 1UBIA 3A1QA 4MGZE 3WIMA 3K9OB 4F1SA 1C4AA 1J7CA 4I6LB 3ZLZA 4UDUC 2WXFA 1KLGD 4A3OA 1DGJA 3UIOB 4C4VB 4KSKC 4DHZE 1NYQA 1WX7A 3VR9B 4MH0E 1EUVB 3AEFB 4ZRKA 4ANWA 2O6VB 2LI5A 3FC4A 1TKGA 2MLBA 4TSSA 1WRIA 5EE9A 1L0YB 3ONSA 4AWJA 4FLHA 3RFZB 1UWXA 3AE3B 2AWTA 2GRIA 2WXIA 2PJHA 1F77A 1FFUA 2QMTA 1WY8A 2E6XA 1TBEA 2GBJA 3NVVA 3KWVA 1T0RC 1YQBA 3AU5A 1WJ6A 3VFKA 3O13A 2Y3AA 4FHKA 1SE2A 2KQ7A 4XWTA 1V81A 4W9KA 1WM3A 2MSED 2LVOA 1KF6B 4IC7B 2MJ3A 3NVYA 5FR3A 5JZEB 1GC7A 3WALA 2LMCA 3ENEA 2IY0B 3TIXA 2Y5CA 1L7YA 3DHIC 2D5GA 1FRDA 2JYTA 5EDSA 2K22A 4W9GA 1GNUA 1B1ZA 1ET9A 3N32A 1PGBA 4AJYB 4PK1A 1J7BA 2W54A 3IVFA 4IDIA 1WJNA 2V3SA 1E7VA 1ZP0B 3QIJA 1X1MA 1WX9A 2KACA 2KX0A 3ML9A 2KDFB 1VD2A 1V6EA 2WX0A 4MM3B 1TKEA 4HDQA 2NBVB 1YQ3B 2FCMA 2M56B 4AS1A 2M4NA 4RMAA 3PZ7A 1NI3A 1JALA 1OEYJ 1JWSD 1EF1A 3AV8A 5C23A 4W9DA 3VAWA 2D3BA 5LLIA 4XGAB 4US8A 4RGNA 4P1CC 3L13A 5HHDG 1MG8A 3PV1A 5TSSA 1J8CA 4YL8A 1R4MB 4ZYNA 1YOVB 2UU7A 2GOWA 2WXKA 4RGOS 5J17A 1N6ZA 4J6IA 5HG2A 4XE0A 1V1OA 1HZ6A 3QK0A 1F1HA 4MGIE 4F8CB 2KMCA 2WXHA 2FUG1 2I2YA 4NZLB 3C0RB 2LGSA 5BMIA 3TJPA 1C4CA 1YIWA 3TEYA 1EWCA 3TBLD 1JWUD 1OQQA 4TMAB 3L0WB 4ARIA 3L4PA 3DVGX 3FAHA 4RGMA 1WGRA 2WXQA 2DHZA 1TKYA 2LVPA 2WYQA 2J0MA 2BYVE 4ANVA 4AQ7A 3GE8C 3BVZA 1YX6B 2DZIA 3DVNU 1NBFC 2SEBD 3DWMA 2GI9A 2LASA 2KYWA 5LXIB 2BF8B 2AQ2B 3UIPB 2QC8A 3AEBB 2H88B 4DK5A 1C4PA 1D4BA 1K53A 4MM3A 1D3ZA 4ZHOA 1FEHA 3P4SB 1C78A 3CF6E 1F52A 3JW0X 3QJZA 2DYMA 3Q3JA 2CJNA 3P4QB 1VJKA 2SAKA 2QEJC 2BYFA 1HTQA 1RFAA 2JWUA 3Q8FA 1KH0A 1UF0A 2N7EA 4N6EB 3ZDMC 1YMHE 2BS3B 3ZNZB 2K8CA 5DPTA 3P63A 2RDHA 5LXHA 4DHJB 4YSZB 1V5OA 2L0TA 1K52A 1WIAA 3BZDB 1FNUA 1FCCC 4A55A 3AB5A 3B1LX 4US9A 3DBLB 4ZDVA 3PS6A 4OZBA 1ENFA 1OGWA 4M01A 4KDIC 4DHZB 1JROA 2LHDA 2NBWB 1XQQA 2K3UA 2WDRB 2PKOA 4PYZA 1D5ZC 1XT9B 3PRZA 3JSVB 3V60A 4B0MA 2LRWA 2ZCCA 4MH8A 1N63A 2KT7A 2N1VA 2DZJA 3KH0A 2N1WA 4GSWA 5BYQA 5JHAA 3VUYA 3ZRCA 3N20C 4WJQA 3QAQA 3TMPB 3TUOA 3MP9A 2N7JA 3AEEB 1DOIA 1SE3A 1WZ0A 1P98A 1EU4A 1V8CA 4RH6A 1XLNA 2BGFA 1EM7A 4REZA 2MQJA 2IBIB 4DQOC 1WXAA 2LRUA 3I3TB 3ZKJC 1LXDA 2BW2A 3MC0B 3N9YC 2KOXA 4IW0A 1I7HA 1LGRA 3VHTC 1XLQA 4TUUA 3MJ5A 2WXOA 2MX2A 3KYCD 4K81A 2MJDA 3ZO5B 4HJKA 3EFCA 5D3IB 5C2TB 4AJWA 1FPYA 1OQRA 4LTUA 4KGSA 2ZVOA 1TS4A 1M4VA 4W9CA 4I6PA 2VRRB 4K7UA 1J19A 1V9JA 2V3NA 1S3SG 1FXTB 1QQRA 3DQVA 1L4ZB 1UH6A 1CK1A 1BXTA 1SE9A 2D11A 2OJWA 1PDXA 3P1MA 2PVOD 1ISNA 2I1JA 3JSVA 3MC8A 2DYBA 2JUOA 3GS2A 1MHXA 2CHWA 3UI3A 5G5GA 2KDIA 1MPEA 3TEWA 2ICIA 4GDKB 3ZNGC 4ITKA 2ZNVB 4K3BA 4HLEA 2J42A 4FULA 2WDQB 2ZNVC 1QZEA 3DBSA 2V4IB 2AL3A 4LLGM 1OTRB 2J7QB 1KTKA 2MCNB 3IBEA 5HFYA 1GJZA 1WGHA 1YJJA 4BFRA 3PZ8A 2ZW1A 4ZOHC 4BVUC 2WNMA 4ZRPA 3ZJTA 3AI5A 3APFA 2J0KA 4NJCA 3URYA 2KJ6A 2KC1A 3RUIB 4A20A 4A3PA 1YQ4B 2KVRA 2M0AA 2KN5A 4PS8A 5BYSA 3DCGA 2RPQA 4MELA 3N30A 4BKGA 1U4AA 4TQ1A 4RM9A 2HJ8A 4KGRA 4MGKE 1B9RA 1CJEA 3ZW3A 3ZJUA 4GIVA 4LCDE 2JZZA 4NJ7A 1ZDXA 2R2QA 1CZPA 2OHFA 4YTMB 1JRPA 2ZPNA 2NS5A 3NS8A 2KMAA 2LGYA 1OFFA 4JIOU 2YEPF 3FKYA 4EEWA 1I4RA 4B95A 4BKSA 2LXAA 4KZ0A 3QARA 2Z8LA 1L6UA 5IO9A 1SSNA 3NY5A 3V6EB 2FCNA 2REXA 2L1AA 2JX5A 3Q3FA 2J53A 1FCLA 1XO3A 2JXXA 4GDKA 2DNFA 2XEWA 3ZDTA 1N5WA 2ZPYA 1QT9A 2LUMA 2INNE 2EKEC 1QLBB 3CWIA 4HJGE 3LDZE 4HKZE 1KM7A 3QC8B 4EUTA 1SBBB 4KV2A 2QSDA 2LEKA 1WMHB 2CU1A 3PGEA 2BKRB 2BS2B 5C1ZA 2KJHB 1P1AA 2KJRA 5LNK1 3CSTA 1GUAB 1IP9A 1STEA 2LD9A 3HHMA 4URKA 4DDID 1G6JA 2C7MB 2MRPA 2K6QA 2DYOA 4C7ZA 1J0GA 3I57A 2NPTB 1V80A 3A9JB 3EUB2 3MFGA 2ZCBA 3E56A 3I9V1 3AEAB 4WJOA 3AE5B 4ICUA 2XNAC 2BQQA 1FMAD 4LJOB 3GOEA 2C60A 4ZYSA 4YTPB 1FO4A 2KDBA 1RYJA 1HEZE 5J18A 1AWDA 4X57B 4NPNA 1R4NI 5GMVA 2B76B 5E6PA 1PFDA 1RRBA 2JF5A 3M95A 3U7ZA 2C5LC 1T0QC 4JWUC 2Y5BB 3C8YA 3H9DA 2M1MA 1ZOYB 3TEZA 2LGDA 2BBCA 3V05A 4KVGB 2B3AA 2D3GA 2BVCA 2FIFA 1RM6C 2JPHA 4M0WB 3BK1A 2MA9B 3HVZA 1ZDVA 2YVCA 4ZRJA 1C1YB 1M94A 2KFKB 2L52A 3HRDD 4WJNA 3DVNV 4WWPA 1Y56A 3GE3C 3K9PB 3AULA 4FXCA 1KLVA 3AECB 2G45B 1AN8A 2V0GA 1VR9A 3VDZA 1NEKB 4W9HA 1TS5A 1E8ZA 2JT4B 4NAWB 2IO2B 2MHJA 1GG3A 1I4QA 5IOIA 2LWPA 2L7RA 4WJPA 4GN1A 4JL9A 1DOXA 1L5PA 4WWMA 3ZYYX 4IKGA 2KD0A 4P7IA 3AE8B 5FR6A 1E8WA 1QOBA 2LFIA 4JX1C 4W9IA 4G3XB 3PVLA 3AE7B 2G4SA 2VZKD 2PPHA 4ZHPA 3DBRI 4L2YA 5D94A 4RFBA 2NCNA 2N9PC 2MBBB 4W9EA 3NG0A 3Q8CA 4YTNB 4M8NA 2AX5A 3EA6A 2KFJA 1TJEA 4AP4C 2NPTA 1YNTE 5HKHA 1TY2A 3A9JA 4C00A 4MJSB 4USAA 4AOFA 1IYFA 3B2GA 1QKZA 2NTTA 1GOZA 4C4VA 4YSXB 4BZAA 2JXTA 2KWUB 3WA0A 2HJ1A 1FIQA 2C7NB 2O6VA 2OOBB 2KTRB 3BVGA 2N9XA 1C77A 2KZRA 2WGSA 1AW7A 1ZPSA 1T6BX 2LXCA 2WXMA 2WDTB 3N3KB 1GB1A 4DDGD 2N9EB 1QOFA 4M0WA 3U30A 3CMMB 4R3DA 2FE8A 5E6OA 3VRAB 1WF9A 2KN4A 4KGTA 2KFKA 2IPKD 1JWBD 3EC8A 4JWSC 1WGKA 1TS3A 2UWQA 3R66C 5EE0A 2KHWB 1K51A 2QHOA 1PGAA 3AE4B 3IG3A 1TZ1A 2O2VB 3Q14C 4NAWA 4AUQC 4RCOA 4FN2A 2CKHB 2BWFA 4IUMB 4PS7A 1VLBA 3OWEB 4HCPB 5H92C 1QF6A 2AQ3B 1VZ8A 3Q8AA 4DXFA 2K9XA 3RYTA 1P3QU 4W9LA 4P1BC 4XDCA 1OEYA 1KFYB 3LYYA 2V9HA 1TIFA 2KAJA 2KC2A 3NVWA 1SEBD 2MJEA 4WAAA 3O65B 2JSVX 3ZXRA 5D2MB 3AE2B 3NUHB 2FUHB 1E90A 3RI7C 3KUZA 3MJWA 4B6WA 1XF5L 2MBHA 4MJSA 3ZXVA 3ZTCA 2KO3A 2BYTA 1Q5WB 2BKFA 1C76A 4W9FA 2FCSA 2EMSA 4WQOB 2W3RA 1QOAA 2NBUA 3GZNB 2EMTA 1WXQA 4EZJA 2KTRA 3Q6BA 2INCC 1I4PA 1WXSA 3QHTA 5I4DA 4DWFA 3A33B 4FJZA 2L76A 1S1QB 4FJVB 2V1YA 1DYQA 1F0ZA 4RM8A 5CHWA 2KK8A 5IKCM 4OVUA 2YLMA 2CS4A 2BT6A 3WANA 4HXDA 3R2IA 4HCNB 4KIKB 1T3QA 1MHHE 4HDOA 4IG7B 1WWTA 4TKNA 2LJIA 5BMGA 2PEAA 2ASQA 1N60A 2MBEA 4ASWC 3AXCA 1GC6A 1SE4A 1R4MI 2WLBA 1KRHA 2M17A 2AEHA 2CJOA 2O2VA 1I42A 1EU3A 2HTME 3U8ZA 3FILB 2PMVA 5DPSA 1J7AA 2WP9B 2D3AA 3MHSD 3ECIA 3DBHB 5IAAC 1E0ZA 3V61A 2D3CA 4BBNC 3ZNHB 3DPDA 2HD5B 2KTFA 1JCKB 1JRUA 1TT5B 1JWAD 2L32A 3VR8B 3CIRB 5D6JB 1V97A 4LNIA 4K7SA 3RZWC 4KZCA 1TZOA 4MGYE 4OVVA 5AZGA 2I38A 2CHXA 5TR5A 1XCQL 2UYZB 1XCTL 2X38A 5E6NA 3VTUA 4JE3B 1JW9D 4IWPA 2RDGA 3DHHC 3HM3A 4OHJA 2L05A 4WWOA 4JQWC 3VRBB 3P4RB 2MH7A 4NAMA 2G4DB 2CHZA 5FKAC 2OEDA 1IUEA 3RNFC 2IJ0A 3MTNB 2I1KA 1UGMA 1WR1A 3AU4A 1HQRD 1JWMD 2L83A 2G9HD 4KIKA 2KNBA 3TCAA 1FM0D 4HPMB 4EZLA 4II2B 1A5RA 1WM2A 2IGDA 3UF8A 4KKJA 1E6EB 2WXGA 3IAM1 3TL5A 3PLUA 5IN7A 3T3NA 1XLOA 3VTVA 2D2QA 2WHIA 3PHXB 2JZ3B 5AZFA 2MEKA 2R61A 3MHZA 3RPFC 4G11A 3W5VB 1GB4A 5J2RA 3FILA 1V49A 3ALBA 5GXGB 1ESFA 3UQBA 3R3MA 4XX5A 2JY6A 2PTLA 3NHEB 3AH7A 3ZQ4A 1SF0A 3Q3MC 3A9KB 4D2KA 4A8XC 4P16A 3M3JA 4LNNA 4RF0A 1P7FA 2DENB 1Y8RC 4J3OD 2N9KA 3R7QA 1SJED 1TTNA 2DLBA 4WWNA 2K6DB 2L8JA 1WFYA 2INPE 2MW5A 3QX1A 5DPWA 2M19A 3Q69A 4IWOA 5HI1A 2HDEA 3H7PB 3KLSX 4L1BA 2D07B 4LNKA 3APCA 3AM9A 2J52A 3BWUD 1YJIA 5JHBA 1SGHA 4HEA1 2MWSB 3BK2A 4K7WA 3RZFA 2R2OA 1FNVA 4S0RA 4B9KA 4HWIB 1CMXB 3GB1A 2N4FA 4JPSA 2DAJA 2M0XA 4CYEA 1V1PB 2FBWB 2PW9A 5FK9C 3QA8A 4ZRIA 3WAMA 4M8MA 4XDDA 1VRAB 4ICVA 1RLFA 4LDTD 1IBXB 5KHQA 4GXBA 3L08A 1SB3C 3I5JC 1FXAA 3KUDB 5CHFA 1LM8B 2HE7A 3BYYB 1V2YA 3SFDB 4RNAA 1FXIA 2FCQA 1E10A 3SDLC 2KWVB 1N5XA 1IGDA 3RN9C 4DXAB 2WWZA 2Y5PA 1BT0A 1XEEA 1VZ7A 2XBBC 4GB9A 3RMKC 4NY0A 4OW0A 2NTSA 2XK5B 3HK0A 1T0SC 4MACA 2IGHA 3A9KA 4XWWA 3RNCC 5C3JB 2ON8A 3B0AA 5CX3A 3HIZA 4EKUA 1HZ5A 2J4XA 2ZEQA 5T8IA 1NI2A 3OAWA 3H7PA 3ZGZA 3DDCB 2GBKA 1WZ3A 3SEBA 2BYEA 2QIEB 2A5UA 3DBRB 4IM2A 1E8YA 2VZKB 3NZSA 2L00B 1ZXHA 1Q0WB 1L0XB 3RNAC 1EO6A 1V1PA 2VH1A 4GDLB 3W5UB 1NENB 3VH3B 3LJ3A 4JLCA 3H1UA 4GLSC 2IZVB 4LNOA 4RGTA 1I35A 4G0NB 4N59A 3R7RA 3V6CB 1IBXA 1XLPA 2JU6X 4NJ6A 1Q1OA 4B0EA 1C3TA 1WJUA 2BB6A 3W1SC 1ZGUB 3Q8BA 3JYUA 4WIPA 2GBMA 1T5XD 4GOCA 2PIAA 2JRHA 4WAFA 1PUTA 3RD2A 3MC9A 4E3CA 2H89B 3UINB 1N62A 1R7SA 2MP2B 3P2BA 1KJTA 3VVWB 1TGZB 4M00A 2V3PA 3D32A 4IWQA 2WDVB 2Q5WD 3KYDD 2NMQA 3Q8EA 1DOYA 1ZXIA 4II3B 3AMZA 2LVQA 3IFWB 3LB8C 2MBQA 2XK5A 3EGRA 3W1YA 1ZKHA 1FD6A 1L4DB 2E3TA 1H8CA 2TSSA 3Q2AC 2N0SB 3NS1A 1P0RA 5AEKB 3AEGB 2C7HA 4KKIA 2G1EA 1VZ6A 2BS4B 3B08A 3IT6B 1WMHA 3GP7A 3NRZA 4GU2A 1E9MA 3L16A 1N61A 2WXLA 2W82A 4F7ZA 1UGJA 5DCNA 2N7DA 3OJ4B 2ZW0A 4HKQA 4BOSC 2ACZB 4GDLA 4BKTA 1WSPA 2LUEA 3SR6A 2GBNA 1UUPA 1YD8U 3ZNID 4LJPB 5L95C 3ZJVA 2DWQA 3HM6X 1YN3A 1P9DU 2JRIB 2KWDA 3IAS1 4E71A 3OG5A 3BVMA 3W1SA 1D5MC 4WQMA 1HA5A 4HK2A 4HROA 2WQYB 2C9WB 1C9FA 2AL6A 3EFUA 4C56C 2FIDA 2Z0EB 3PT2B 3PZDA 1RWSA 3RNEC 4BAXA 4IM0A 2N9LA 3T8MA 1ZW7A 2KLGA 2WU2B 3T9LA 3TEXA 2NVUI 1TYGB 2MP2A 3PLVA 3PREA 4EOYA 3S2AA 2GLSA 2IO3B 2O6VD 2KKCA 4GMVA 4PS3A 4ARCA 1T0YA 1HXYD 4C7YA 3W2DA 4QAYA 3U4EG 1AYFA 1V86A 2RPVA 2DZMA 4KDLB 2QDFA 3DVGY 4JGHB 1ET6A 5IP4D 4K3CA 1PQSA 2WXJA 3PPAA 4IM3A 3H6NA 3VTWA 4A90A 5EE1A 4WURA 3IHPC 5D7GA 4P6VF 2EKIA 4HVBA 3PO0A 4RF1A 4E74A 1MI0A 3LXFA 3BIID 3AE9B 2K8BA 3OLMD 4MSQB 4BOZB 3BYTB 1FFVA 2W55A 2D10A 1WX8A 1NYRA 1P7EA 3KW5B 2BWES 2KQSA 2K0PA 2FAZA 3RT3B 1YJ1A 2KQ4X 3A4SC 1VCBA 2Z59B 3APDA 1IGCA 3Q3OC 4EFOA 3VQIA 2VH2A 3RNBC 3W9CB 4NNJB 3SD5A 3KUCB 3QQ8B 2JWZA 1L0VB 5G2NA 3SFEB 3IXSA 4ACFA 1MFWA 4CHKA 3ABVB 3PSEB 1BUIC
chains in the Genus database with same CATH topology
4BKSA 4EZKA 2LXAA 4KIKA 2KNBA 2KLCA 4KZ0A 3QARA 3TCAA 5EDSA 4W9GA 1GNUA 4HPMB 3NY5A 4II2B 3V6EB 4EZLA 1WM2A 2FCNA 2REXA 3L17A 4HPLB 3UF8A 3N32A 3SHQA 3NZUA 3Q3FA 1OQYA 4AJYB 2PE9A 2JXXA 4GDKA 3TL5A 2XEWA 3PLUA 3ZDTA 2NR2A 3IVFA 4FJYA 3ML8A 3VTVA 2ZPYA 5AZHA 1WJNA 2D2QA 3PHXB 1KOTA 2V3SA 2JZ3B 5AZFA 2EKEC 1E7VA 3LDZE 2OJRA 3QIJA 1X1MA 1WX9A 1KM7A 4G11A 3QC8B 4EUTA 4NQKE 2KX0A 4KV2A 5J2RA 4GGQA 3ML9A 2KDFB 1V49A 3ALBA 3UQBA 3R3MA 4XX5A 2JY6A 1VD2A 1WMHB 3NHEB 3ZRFA 2CU1A 3PGEA 2BKRB 5C1ZA 1V6EA 2KJHB 3A9KB 1P1AA 2KJRA 2WX0A 3M3JA 4DBGA 4HDQA 2NBVB 2DENB 1Y8RC 3CSTA 1GUAB 1IP9A 2Z0DB 2LD9A 3R7QA 3HHMA 1TTNA 4URKA 1HE8A 2FCMA 4WWNA 2K6DB 2L8JA 1WFYA 2M4NA 4DDID 1G6JA 2MW5A 3QX1A 2C7MB 2MRPA 5DPWA 2K6QA 4RMAA 4IWOA 3UQAA 2DYOA 3H7PB 5CTRC 2D07B 2CR5A 1OEYJ 3APCA 5C23A 1EF1A 3VAWA 4W9DA 1J0GA 1WXMA 2NPTB 5LLIA 1V80A 5JHBA 1SGHA 3A9JB 4FADA 2MWSB 2ZCBA 3L13A 1MG8A 3PV1A 4K7WA 4FBJB 1V5TA 4WJOA 3RZFA 2BPSA 4ICUA 2R2OA 4YL8A 4LJOB 4B9KA 1J8CA 3GOEA 4HWIB 4ZYNA 2C60A 2GOWA 1CMXB 1UELA 2GBRA 2KDBA 2JVCA 5J17A 5L83A 4J6IA 2N4FA 2DAJA 2M0XA 5J18A 1LFDA 4X57B 4NPNA 4CYEA 1R4NI 2WX1A 1WE7A 5GMVA 5E6PA 3M95A 1RRBA 2JF5A 3QK0A 5G55A 2C5LC 2KWCA 2Y5BB 3H9DA 4MGIE 2M8SA 3QA8A 4F8CB 4ZRIA 2M1MA 3WAMA 2KMCA 4M8MA 5BO4B 4ICVA 2LGDA 1RLFA 4LDTD 1AARA 1K8RB 3C0RB 3TJPA 5KHQA 3JVZX 1YIWA 4KVGB 2B3AA 2D3GA 3TBLD 2FIFA 4GXBA 3L08A 2JPHA 4M0WB 4G50A 3L0WB 2MA9B 4KSLC 3RCZA 5KHOA 1EF5A 3KUDB 5CHFA 1LM8B 2HE7A 2YVCA 3DVGX 4ZRJA 4CO7A 1V2YA 1C1YB 1WGRA 1M94A 2DHZA 3X0WA 2IY1B 2KFKB 4WJNA 3DVNV 4WWPA 2FCQA 3VXWA 2LVPA 2IO0B 1Z5SB 2KWVB 3SDLC 2WYQA 3K9PB 3AULA 2J0MA 2ZVNA 1KLVA 2W9NA 2G45B 2BYVE 5CHVC 4ANVA 4DXAB 1WYWB 3VDZA 1YX6B 4W9HA 2RGFA 4LDTB 1E8ZA 2JT4B 2DZIA 4NAWB 2WWZA 3DVNU 1H4RA 2IO2B 4ANXA 1NBFC 3RULA 1GG3A 1BT0A 1F9JA 3ZUNA 2LWPA 2XBBC 2LASA 4GB9A 2L7RA 4W9JA 4GN1A 4JL9A 4WJPA 5LXIB 2BF8B 3GZNI 4NY0A 1UZXB 2KD0A 3CSFA 4P7IA 3UIPB 3M62B 5FR6A 1E8WA 3BINA 2XK5B 3HK0A 4DK5A 3QWZB 4G3XB 4W9IA 3A9KA 3PVLA 4MM3A 2G4SA 2PPHA 1D3ZA 1WE6A 3DBRI 5D94A 3B0AA 3EECA 3VUXA 5CX3A 2NCNA 3HIZA 3CF6E 3L54A 1L2NA 2N9PC 2MBBB 3ZVVA 4EKUA 1WJ4A 3JW0X 4W9EA 4N9F4 3QJZA 2ZEQA 4M8NA 1NI2A 3WAOA 3OAWA 2HTHA 2DYMA 1E5WA 3H7PA 3Q3JA 1UBQA 3DDCB 4DHJD 2GBKA 1WZ3A 1E8XA 1WXVA 2BYFA 2KFJA 2K39A 4AP4C 2NPTA 1RFAA 5DPRA 5HKHA 3A9JA 4MJSB 3OJ3A 2BYEA 2ZJDA 4AOFA 1IYFA 2J0JA 2N7EA 2A5UA 3DBLI 4IM2A 4BBNF 1E8YA 3NZSA 2L00B 3ZDMC 2K25A 3PHWB 3PRPB 3ZNZB 2KWUB 4TQ0A 1Q0WB 3WA0A 2K8CA 3NOBA 3ZTDA 3UGBB 5DPTA 1EO6A 2C7NB 2O6VA 4GDLB 2OOBB 1XD3B 5LXHA 2KTRB 2A4ZA 2AYOB 2N9XA 4DHJB 2KZRA 2LJ5A 2K8HA 3VH3B 1V5OA 2L0TA 3DBHI 3LJ3A 3H1UA 1WIAA 4JLCA 3ZIMA 2LXCA 2IZVB 2WDTB 3N3KB 3B1LX 1I35A 4G0NB 2V4LA 4ZDVA 3PS6A 2KANA 3R7RA 2N9EB 3V6CB 3VUWA 4DDGD 1OGWA 4NQLB 4NJ6A 4KDIC 4DHZB 5IA7A 1IPGA 1Q1OA 2NBWB 1C3TA 1WJUA 1XQQA 1WR6E 4PYZA 3W1SC 1ZGUB 1XT9B 3PRZA 3JSVB 3U30A 3V60A 5JH5C 2LRWA 2ZCCA 3CMMB 4TV3A 5E6OA 1WF9A 3JYUA 2GBMA 3QCAA 2KFKA 4GOCA 2N1VA 2JRHA 1WGDA 3X23A 2LGXA 3RD2A 3EC8A 2DZJA 3KH0A 2N1WA 4E3CA 4GSWA 2UWQA 3UINB 5JHAA 3VUYA 3R66C 4MDKE 2MP2B 3P2BA 1Z2MA 3ZRCA 2KHWB 1KJTA 3VVWB 2QHOA 3BY4B 1TGZB 4WJQA 1YX5B 3IG3A 1A5RA 1TZ1A 3QAQA 3TMPB 2O2VB 4NAWA 4AUQC 3L10B 3D32A 4FN2A 2CKHB 2BWFA 2KXJA 4IUMB 4HCPB 4PS7A 3U7DA 3A1QB 4IWQA 1WZ0A 1P98A 2IYDB 4ANUA 2BGFA 3KYDD 1LQBA 4II3B 2LVQA 3A4RA 3IFWB 1E7UA 2MQJA 4I6NB 3RYTA 1P3QU 2IBIB 2MBQA 2XK5A 4W9LA 3W1YA 1WXAA 2KX3A 2LRUA 1ZKHA 1OEYA 3I3TB 2L3ZA 3ZKJC 1LXDA 3M63B 1H8CA 1WGGA 4PYUA 2KOXA 2KC2A 4IW0A 1P0RA 2K1FA 5AEKB 3VHTC 2KDEB 1WRDB 4WAAA 4TUUA 3V62A 3O65B 1UD7A 2C7HA 5D2MB 2MX2A 2FUHB 1E90A 3KUZA 1WGYA 1SIFA 3KYCD 3MJWA 4B6WA 2IO1B 3B08A 1NDDA 2GMIC 4K81A 1WMHA 4MSMB 2MBHA 4GU2A 3ZO5B 4HJKA 4MJSA 3L16A 4AJWA 3ZTCA 2KO3A 2ZZPB 2ZVOA 1Q5WB 1WH3A 3VH4B 4F7ZA 5DCNA 3PRMB 2G3QB 2N7DA 2PE6B 2BKFA 4BKSD 2RD0A 4W9FA 2FCSA 2EMSA 3OJ4B 4WQOB 2DAFA 4W9CA 4I6PA 4B95A 4BOSC 2VRRB 2LZ6A 2RR9A 4K7UA 2NBUA 1J19A 1V9JA 2DZKA 2EMTA 4GDLA 1S3SG 1FXTB 4BKTA 2LUEA 4EZJA 2GBNA 2KTRA 2RSUA 1YD8U 3ZNID 1WXSA 3QHTA 4FHJA 4LJPB 2FNJB 4DWFA 5L95C 3DQVA 3A33B 1UH6A 3HM6X 3SU8X 2JRIB 1P9DU 3PTFC 4E71A 2DX5B 4FJZA 2L76A 1S1QB 3W1SA 4FJVB 2V1YA 1SE9A 2D11A 4RM8A 4XZ4A 5CHWA 2KK8A 3EHVA 2L0FA 4HK2A 4OVUA 2YLMA 3KVFB 2CS4A 2C9WB 3WANA 4HXDA 2AL6A 4XC2A 1ISNA 4HCNB 4KIKB 4MEMA 2I1JA 1WI0A 3JSVA 4FA6A 3EFUA 4HDOA 4IG7B 2DYBA 2FIDA 1RAXA 2JUOA 2Z0EB 3PT2B 3PZDA 4TKNA 2CHWA 2PEAA 2ASQA 2MBEA 4IM0A 4ASWC 2KDIA 3T8MA 3AXCA 1ZW7A 1GC6A 4GDKB 2KLGA 3ZNGC 3T9LA 2NVUI 2ZNVB 2MP2A 1R4MI 3DOWA 3H7SA 3PLVA 3PREA 4EOYA 3S2AA 4HLEA 2M17A 2IO3B 2AEHA 2O6VD 4FULA 2O2VA 2KKCA 1I42A 4K1RB 3WAPA 4GMVA 2MBOA 3U8ZA 2ZNVC 4PS3A 5DPSA 1UBIA 1QZEA 3A1QA 4MGZE 1T0YA 3DBSA 3WIMA 3MHSD 2AL3A 3ECIA 3K9OB 4F1SA 1OTRB 2J7QB 5IAAC 3V61A 1V86A 4BBNC 4I6LB 2DZMA 3ZLZA 2MCNB 3IBEA 4KDLB 3ZNHB 1GJZA 3DPDA 1WGHA 2HD5B 2KTFA 3DVGY 4A3OA 4JGHB 3UIOB 4BFRA 1JRUA 4KSKC 4DHZE 1PQSA 3PPAA 4IM3A 3H6NA 3VTWA 1WX7A 4MH0E 1EUVB 3IHPC 5D7GA 4ZRKA 4ANWA 4BVUC 4HVBA 2O6VB 2LI5A 5D6JB 3AI5A 2MLBA 3APFA 2J0KA 4K7SA 4E74A 2KJ6A 3RZWC 4KZCA 2KC1A 3RUIB 4A20A 2K8BA 3ONSA 4MGYE 4A3PA 4AWJA 3OLMD 2KVRA 4OVVA 4FLHA 2CHXA 5AZGA 5TR5A 4MSQB 2KN5A 4BOZB 2UYZB 5E6NA 4PS8A 3VTUA 2AWTA 4IWPA 2D10A 1WX8A 3DCGA 3HM3A 2PJHA 2L05A 2RPQA 4MELA 3N30A 3KW5B 4WWOA 2BWES 2KQSA 4JQWC 4BKGA 1U4AA 2FAZA 1WY8A 4TQ1A 3RT3B 4RM9A 2HJ8A 4MGKE 1TBEA 2GBJA 1YJ1A 2CHZA 2G4DB 3A4SC 3ZW3A 1VCBA 2Z59B 3APDA 4EFOA 1YQBA 3AU5A 4GIVA 1WJ6A 3VQIA 4LCDE 2JZZA 3VFKA 4NJ7A 4FHKA 2KQ7A 1V81A 2R2QA 4W9KA 4NNJB 1WM3A 3SD5A 3MTNB 2MSED 2LVOA 3KUCB 2I1KA 3QQ8B 4IC7B 2JWZA 1UGMA 1WR1A 2ZPNA 1GC7A 5G2NA 5JZEB 2NS5A 3NS8A 3WALA 3AU4A 2KMAA 2LGYA 4JIOU 4CHKA 4EEWA 3ENEA 2IY0B 3TIXA 3PSEB 1L7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BKS A;  4EZK A;  2LXA A;  4KIK A;  2KNB A;  2KLC A;  4KZ0 A;  3QAR A;  3TCA A;  5EDS A;  4W9G A;  1GNU A;  4HPM B;  3NY5 A;  4II2 B;  3V6E B;  4EZL A;  1WM2 A;  2FCN A;  2REX A;  3L17 A;  4HPL B;  3UF8 A;  3N32 A;  3SHQ A;  3NZU A;  3Q3F A;  1OQY A;  4AJY B;  2PE9 A;  2JXX A;  4GDK A;  3TL5 A;  2XEW A;  3PLU A;  3ZDT A;  2NR2 A;  3IVF A;  4FJY A;  3ML8 A;  3VTV A;  2ZPY A;  5AZH A;  1WJN A;  2D2Q A;  3PHX B;  1KOT A;  2V3S A;  2JZ3 B;  5AZF A;  2EKE C;  1E7V A;  3LDZ E;  2OJR A;  3QIJ A;  1X1M A;  1WX9 A;  1KM7 A;  4G11 A;  3QC8 B;  4EUT A;  4NQK E;  2KX0 A;  4KV2 A;  5J2R A;  4GGQ A;  3ML9 A;  2KDF B;  1V49 A;  3ALB A;  3UQB A;  3R3M A;  4XX5 A;  2JY6 A;  1VD2 A;  1WMH B;  3NHE B;  3ZRF A;  2CU1 A;  3PGE A;  2BKR B;  5C1Z A;  1V6E A;  2KJH B;  3A9K B;  1P1A A;  2KJR A;  2WX0 A;  3M3J A;  4DBG A;  4HDQ A;  2NBV B;  2DEN B;  1Y8R C;  3CST A;  1GUA B;  1IP9 A;  2Z0D B;  2LD9 A;  3R7Q A;  3HHM A;  1TTN A;  4URK A;  1HE8 A;  2FCM A;  4WWN A;  2K6D B;  2L8J A;  1WFY A;  2M4N A;  4DDI D;  1G6J A;  2MW5 A;  3QX1 A;  2C7M B;  2MRP A;  5DPW A;  2K6Q A;  4RMA A;  4IWO A;  3UQA A;  2DYO A;  3H7P B;  5CTR C;  2D07 B;  2CR5 A;  1OEY J;  3APC A;  5C23 A;  1EF1 A;  3VAW A;  4W9D A;  1J0G A;  1WXM A;  2NPT B;  5LLI A;  1V80 A;  5JHB A;  1SGH A;  3A9J B;  4FAD A;  2MWS B;  2ZCB A;  3L13 A;  1MG8 A;  3PV1 A;  4K7W A;  4FBJ B;  1V5T A;  4WJO A;  3RZF A;  2BPS A;  4ICU A;  2R2O A;  4YL8 A;  4LJO B;  4B9K A;  1J8C A;  3GOE A;  4HWI B;  4ZYN A;  2C60 A;  2GOW A;  1CMX B;  1UEL A;  2GBR A;  2KDB A;  2JVC A;  5J17 A;  5L83 A;  4J6I A;  2N4F A;  2DAJ A;  2M0X A;  5J18 A;  1LFD A;  4X57 B;  4NPN A;  4CYE A;  1R4N I;  2WX1 A;  1WE7 A;  5GMV A;  5E6P A;  3M95 A;  1RRB A;  2JF5 A;  3QK0 A;  5G55 A;  2C5L C;  2KWC A;  2Y5B B;  3H9D A;  4MGI E;  2M8S A;  3QA8 A;  4F8C B;  4ZRI A;  2M1M A;  3WAM A;  2KMC A;  4M8M A;  5BO4 B;  4ICV A;  2LGD A;  1RLF A;  4LDT D;  1AAR A;  1K8R B;  3C0R B;  3TJP A;  5KHQ A;  3JVZ X;  1YIW A;  4KVG B;  2B3A A;  2D3G A;  3TBL D;  2FIF A;  4GXB A;  3L08 A;  2JPH A;  4M0W B;  4G50 A;  3L0W B;  2MA9 B;  4KSL C;  3RCZ A;  5KHO A;  1EF5 A;  3KUD B;  5CHF A;  1LM8 B;  2HE7 A;  2YVC A;  3DVG X;  4ZRJ A;  4CO7 A;  1V2Y A;  1C1Y B;  1WGR A;  1M94 A;  2DHZ A;  3X0W A;  2IY1 B;  2KFK B;  4WJN A;  3DVN V;  4WWP A;  2FCQ A;  3VXW A;  2LVP A;  2IO0 B;  1Z5S B;  2KWV B;  3SDL C;  2WYQ A;  3K9P B;  3AUL A;  2J0M A;  2ZVN A;  1KLV A;  2W9N A;  2G45 B;  2BYV E;  5CHV C;  4ANV A;  4DXA B;  1WYW B;  3VDZ A;  1YX6 B;  4W9H A;  2RGF A;  4LDT B;  1E8Z A;  2JT4 B;  2DZI A;  4NAW B;  2WWZ A;  3DVN U;  1H4R A;  2IO2 B;  4ANX A;  1NBF C;  3RUL A;  1GG3 A;  1BT0 A;  1F9J A;  3ZUN A;  2LWP A;  2XBB C;  2LAS A;  4GB9 A;  2L7R A;  4W9J A;  4GN1 A;  4JL9 A;  4WJP A;  5LXI B;  2BF8 B;  3GZN I;  4NY0 A;  1UZX B;  2KD0 A;  3CSF A;  4P7I A;  3UIP B;  3M62 B;  5FR6 A;  1E8W A;  3BIN A;  2XK5 B;  3HK0 A;  4DK5 A;  3QWZ B;  4G3X B;  4W9I A;  3A9K A;  3PVL A;  4MM3 A;  2G4S A;  2PPH A;  1D3Z A;  1WE6 A;  3DBR I;  5D94 A;  3B0A A;  3EEC A;  3VUX A;  5CX3 A;  2NCN A;  3HIZ A;  3CF6 E;  3L54 A;  1L2N A;  2N9P C;  2MBB B;  3ZVV A;  4EKU A;  1WJ4 A;  3JW0 X;  4W9E A;  4N9F 4;  3QJZ A;  2ZEQ A;  4M8N A;  1NI2 A;  3WAO A;  3OAW A;  2HTH A;  2DYM A;  1E5W A;  3H7P A;  3Q3J A;  1UBQ A;  3DDC B;  4DHJ D;  2GBK A;  1WZ3 A;  1E8X A;  1WXV A;  2BYF A;  2KFJ A;  2K39 A;  4AP4 C;  2NPT A;  1RFA A;  5DPR A;  5HKH A;  3A9J A;  4MJS B;  3OJ3 A;  2BYE A;  2ZJD A;  4AOF A;  1IYF A;  2J0J A;  2N7E A;  2A5U A;  3DBL I;  4IM2 A;  4BBN F;  1E8Y A;  3NZS A;  2L00 B;  3ZDM C;  2K25 A;  3PHW B;  3PRP B;  3ZNZ B;  2KWU B;  4TQ0 A;  1Q0W B;  3WA0 A;  2K8C A;  3NOB A;  3ZTD A;  3UGB B;  5DPT A;  1EO6 A;  2C7N B;  2O6V A;  4GDL B;  2OOB B;  1XD3 B;  5LXH A;  2KTR B;  2A4Z A;  2AYO B;  2N9X A;  4DHJ B;  2KZR A;  2LJ5 A;  2K8H A;  3VH3 B;  1V5O A;  2L0T A;  3DBH I;  3LJ3 A;  3H1U A;  1WIA A;  4JLC A;  3ZIM A;  2LXC A;  2IZV B;  2WDT B;  3N3K B;  3B1L X;  1I35 A;  4G0N B;  2V4L A;  4ZDV A;  3PS6 A;  2KAN A;  3R7R A;  2N9E B;  3V6C B;  3VUW A;  4DDG D;  1OGW A;  4NQL B;  4NJ6 A;  4KDI C;  4DHZ B;  5IA7 A;  1IPG A;  1Q1O A;  2NBW B;  1C3T A;  1WJU A;  1XQQ A;  1WR6 E;  4PYZ A;  3W1S C;  1ZGU B;  1XT9 B;  3PRZ A;  3JSV B;  3U30 A;  3V60 A;  5JH5 C;  2LRW A;  2ZCC A;  3CMM B;  4TV3 A;  5E6O A;  1WF9 A;  3JYU A;  2GBM A;  3QCA A;  2KFK A;  4GOC A;  2N1V A;  2JRH A;  1WGD A;  3X23 A;  2LGX A;  3RD2 A;  3EC8 A;  2DZJ A;  3KH0 A;  2N1W A;  4E3C A;  4GSW A;  2UWQ A;  3UIN B;  5JHA A;  3VUY A;  3R66 C;  4MDK E;  2MP2 B;  3P2B A;  1Z2M A;  3ZRC A;  2KHW B;  1KJT A;  3VVW B;  2QHO A;  3BY4 B;  1TGZ B;  4WJQ A;  1YX5 B;  3IG3 A;  1A5R A;  1TZ1 A;  3QAQ A;  3TMP B;  2O2V B;  4NAW A;  4AUQ C;  3L10 B;  3D32 A;  4FN2 A;  2CKH B;  2BWF A;  2KXJ A;  4IUM B;  4HCP B;  4PS7 A;  3U7D A;  3A1Q B;  4IWQ A;  1WZ0 A;  1P98 A;  2IYD B;  4ANU A;  2BGF A;  3KYD D;  1LQB A;  4II3 B;  2LVQ A;  3A4R A;  3IFW B;  1E7U A;  2MQJ A;  4I6N B;  3RYT A;  1P3Q U;  2IBI B;  2MBQ A;  2XK5 A;  4W9L A;  3W1Y A;  1WXA A;  2KX3 A;  2LRU A;  1ZKH A;  1OEY A;  3I3T B;  2L3Z A;  3ZKJ C;  1LXD A;  3M63 B;  1H8C A;  1WGG A;  4PYU A;  2KOX A;  2KC2 A;  4IW0 A;  1P0R A;  2K1F A;  5AEK B;  3VHT C;  2KDE B;  1WRD B;  4WAA A;  4TUU A;  3V62 A;  3O65 B;  1UD7 A;  2C7H A;  5D2M B;  2MX2 A;  2FUH B;  1E90 A;  3KUZ A;  1WGY A;  1SIF A;  3KYC D;  3MJW A;  4B6W A;  2IO1 B;  3B08 A;  1NDD A;  2GMI C;  4K81 A;  1WMH A;  4MSM B;  2MBH A;  4GU2 A;  3ZO5 B;  4HJK A;  4MJS A;  3L16 A;  4AJW A;  3ZTC A;  2KO3 A;  2ZZP B;  2ZVO A;  1Q5W B;  1WH3 A;  3VH4 B;  4F7Z A;  5DCN A;  3PRM B;  2G3Q B;  2N7D A;  2PE6 B;  2BKF A;  4BKS D;  2RD0 A;  4W9F A;  2FCS A;  2EMS A;  3OJ4 B;  4WQO B;  2DAF A;  4W9C A;  4I6P A;  4B95 A;  4BOS C;  2VRR B;  2LZ6 A;  2RR9 A;  4K7U A;  2NBU A;  1J19 A;  1V9J A;  2DZK A;  2EMT A;  4GDL A;  1S3S G;  1FXT B;  4BKT A;  2LUE A;  4EZJ A;  2GBN A;  2KTR A;  2RSU A;  1YD8 U;  3ZNI D;  1WXS A;  3QHT A;  4FHJ A;  4LJP B;  2FNJ B;  4DWF A;  5L95 C;  3DQV A;  3A33 B;  1UH6 A;  3HM6 X;  3SU8 X;  2JRI B;  1P9D U;  3PTF C;  4E71 A;  2DX5 B;  4FJZ A;  2L76 A;  1S1Q B;  3W1S A;  4FJV B;  2V1Y A;  1SE9 A;  2D11 A;  4RM8 A;  4XZ4 A;  5CHW A;  2KK8 A;  3EHV A;  2L0F A;  4HK2 A;  4OVU A;  2YLM A;  3KVF B;  2CS4 A;  2C9W B;  3WAN A;  4HXD A;  2AL6 A;  4XC2 A;  1ISN A;  4HCN B;  4KIK B;  4MEM A;  2I1J A;  1WI0 A;  3JSV A;  4FA6 A;  3EFU A;  4HDO A;  4IG7 B;  2DYB A;  2FID A;  1RAX A;  2JUO A;  2Z0E B;  3PT2 B;  3PZD A;  4TKN A;  2CHW A;  2PEA A;  2ASQ A;  2MBE A;  4IM0 A;  4ASW C;  2KDI A;  3T8M A;  3AXC A;  1ZW7 A;  1GC6 A;  4GDK B;  2KLG A;  3ZNG C;  3T9L A;  2NVU I;  2ZNV B;  2MP2 A;  1R4M I;  3DOW A;  3H7S A;  3PLV A;  3PRE A;  4EOY A;  3S2A A;  4HLE A;  2M17 A;  2IO3 B;  2AEH A;  2O6V D;  4FUL A;  2O2V A;  2KKC A;  1I42 A;  4K1R B;  3WAP A;  4GMV A;  2MBO A;  3U8Z A;  2ZNV C;  4PS3 A;  5DPS A;  1UBI A;  1QZE A;  3A1Q A;  4MGZ E;  1T0Y A;  3DBS A;  3WIM A;  3MHS D;  2AL3 A;  3ECI A;  3K9O B;  4F1S A;  1OTR B;  2J7Q B;  5IAA C;  3V61 A;  1V86 A;  4BBN C;  4I6L B;  2DZM A;  3ZLZ A;  2MCN B;  3IBE A;  4KDL B;  3ZNH B;  1GJZ A;  3DPD A;  1WGH A;  2HD5 B;  2KTF A;  3DVG Y;  4A3O A;  4JGH B;  3UIO B;  4BFR A;  1JRU A;  4KSK C;  4DHZ E;  1PQS A;  3PPA A;  4IM3 A;  3H6N A;  3VTW A;  1WX7 A;  4MH0 E;  1EUV B;  3IHP C;  5D7G A;  4ZRK A;  4ANW A;  4BVU C;  4HVB A;  2O6V B;  2LI5 A;  5D6J B;  3AI5 A;  2MLB A;  3APF A;  2J0K A;  4K7S A;  4E74 A;  2KJ6 A;  3RZW C;  4KZC A;  2KC1 A;  3RUI B;  4A20 A;  2K8B A;  3ONS A;  4MGY E;  4A3P A;  4AWJ A;  3OLM D;  2KVR A;  4OVV A;  4FLH A;  2CHX A;  5AZG A;  5TR5 A;  4MSQ B;  2KN5 A;  4BOZ B;  2UYZ B;  5E6N A;  4PS8 A;  3VTU A;  2AWT A;  4IWP A;  2D10 A;  1WX8 A;  3DCG A;  3HM3 A;  2PJH A;  2L05 A;  2RPQ A;  4MEL A;  3N30 A;  3KW5 B;  4WWO A;  2BWE S;  2KQS A;  4JQW C;  4BKG A;  1U4A A;  2FAZ A;  1WY8 A;  4TQ1 A;  3RT3 B;  4RM9 A;  2HJ8 A;  4MGK E;  1TBE A;  2GBJ A;  1YJ1 A;  2CHZ A;  2G4D B;  3A4S C;  3ZW3 A;  1VCB A;  2Z59 B;  3APD A;  4EFO A;  1YQB A;  3AU5 A;  4GIV A;  1WJ6 A;  3VQI A;  4LCD E;  2JZZ A;  3VFK A;  4NJ7 A;  4FHK A;  2KQ7 A;  1V81 A;  2R2Q A;  4W9K A;  4NNJ B;  1WM3 A;  3SD5 A;  3MTN B;  2MSE D;  2LVO A;  3KUC B;  2I1K A;  3QQ8 B;  4IC7 B;  2JWZ A;  1UGM A;  1WR1 A;  2ZPN A;  1GC7 A;  5G2N A;  5JZE B;  2NS5 A;  3NS8 A;  3WAL A;  3AU4 A;  2KMA A;  2LGY A;  4JIO U;  4CHK A;  4EEW A;  3ENE A;  2IY0 B;  3TIX A;  3PSE B;  1L7Y A; 
#chains in the Genus database with same CATH topology
 4EZK A;  2KLC A;  3L17 A;  4HPL B;  3SHQ A;  3NZU A;  1OQY A;  2PE9 A;  5AUK A;  2NR2 A;  4FJY A;  3ML8 A;  5AZH A;  1KOT A;  3P4P B;  2OJR A;  4C80 A;  1I4H A;  4NQK E;  4CQN A;  1I4X A;  4GGQ A;  3ZRF A;  4Q2J A;  4DBG A;  4XYC A;  1E7P B;  2Z0D B;  2KMM A;  1HE8 A;  2DBY A;  2ONQ A;  3B2F A;  3UQA A;  3H8H A;  5CTR C;  2CR5 A;  3IT4 B;  1WXM A;  4HRS A;  4FAD A;  2IND C;  4FBJ B;  5BYR A;  1V5T A;  1D5X C;  1PGX A;  2BPS A;  1SXT A;  4M02 A;  1UEL A;  2GBR A;  1JQ4 A;  3N1Y C;  2JVC A;  5L83 A;  1JML A;  1LFD A;  1MVK A;  2WX1 A;  1WE7 A;  5G55 A;  1SJH D;  2KWC A;  3B9J A;  2M8S A;  1MJD A;  4WH4 A;  5BO4 B;  1AAR A;  1K8R B;  3V3X A;  1TS2 A;  2WXN A;  2QIL A;  3JVZ X;  2KVZ A;  2AQ1 B;  4G50 A;  4KSL C;  3RCZ A;  4KX6 B;  5KHO A;  1EF5 A;  3DHG C;  4CO7 A;  3X0W A;  2IY1 B;  4HPP A;  3NJT A;  1A70 A;  3VXW A;  3P42 A;  4MT5 A;  2IO0 B;  1Z5S B;  5AUI A;  2ZVN A;  2W9N A;  5CHV C;  1WYW B;  2JQR B;  2RGF A;  4LDT B;  1H4R A;  4ANX A;  3RUL A;  4LK0 M;  1QIL A;  1F9J A;  3ZUN A;  5E6J A;  4W9J A;  4YXD B;  3GZN I;  1UZX B;  3CSF A;  3M62 B;  2BTE A;  3Q3N C;  3BIN A;  4DXG A;  3QWZ B;  4OZA A;  3J9C A;  1ROE A;  4L23 A;  4O1N A;  3C19 A;  1MG4 A;  1WE6 A;  3EEC A;  3VUX A;  3L54 A;  1L2N A;  2PLP A;  3ZVV A;  1WJ4 A;  1LO5 D;  4N9F 4;  1UWM A;  1XXG A;  3WAO A;  2HTH A;  1E5W A;  1ZE3 D;  4DHJ D;  1UBQ A;  1WYG A;  1E8X A;  1WXV A;  2YEP B;  2K39 A;  3AE6 B;  5DPR A;  1FRR A;  3OJ3 A;  2ZJD A;  2J0J A;  3DBL I;  4BBN F;  1Q10 A;  4A9A A;  2K25 A;  2QJL A;  3PHW B;  3PRP B;  4TQ0 A;  3ZTD A;  3NOB A;  3UGB B;  4N58 A;  3RNG C;  4IOI E;  1XD3 B;  2A4Z A;  2AYO B;  3NVZ A;  2LJ5 A;  2K8H A;  3DBH I;  3ZIM A;  4A6Q A;  2GB1 A;  1YN5 A;  2V4L A;  1NVI D;  2KAN A;  1K50 A;  3VUW A;  4NQL B;  5IA7 A;  1IPG A;  2JZP A;  1WR6 E;  3I63 C;  1ZUD 2;  2W3S A;  5JH5 C;  2LHE A;  1F2R C;  4TV3 A;  4YT0 B;  3QCA A;  1WGD A;  3X23 A;  2LGX A;  1I4G A;  4EE2 A;  4OVZ A;  2CU3 A;  3ETR A;  4MDK E;  1Z2M A;  3BY4 B;  1YX5 B;  3R8B A;  1TY0 A;  1UNS A;  3L10 B;  2LGI A;  2IDY A;  2KXJ A;  1R4N B;  3U7D A;  3A1Q B;  2IYD B;  4ANU A;  1LQB A;  1EWY C;  3KQ4 A;  3N1Z C;  1PYW D;  4OZC A;  3A4R A;  3KWL A;  1E7U A;  4I6N B;  4S17 A;  2KX3 A;  5H8Y E;  3DWG C;  2L3Z A;  3M63 B;  1WGG A;  4LNF A;  4PYU A;  4YSY B;  1L6V A;  2K1F A;  2JYE A;  2KDE B;  1WRD B;  3AN1 A;  2PVG C;  2EEL A;  2KDM A;  3V62 A;  1FNW A;  1UD7 A;  5D3D A;  1BML C;  1CQV A;  1SIJ A;  3E9S A;  4ZRQ A;  2QCZ A;  1WGY A;  1SIF A;  2IO1 B;  1NDD A;  2GMI C;  4H2A A;  4MSM B;  1C79 A;  1GPX A;  2K5P A;  2ZZP B;  3HVD A;  1WH3 A;  3VH4 B;  3PRM B;  2G3Q B;  1KLU D;  2PE6 B;  4BKS D;  2RD0 A;  2WS3 B;  2DAF A;  2LZ6 A;  2RR9 A;  5MPO A;  2DZK A;  5EE3 A;  2RSU A;  3T3O A;  1HTO A;  1RFK A;  4FHJ A;  2FNJ B;  3SU8 X;  2IGG A;  3U2S C;  3PTF C;  1D6E C;  2DX5 B;  1ACC A;  3AED B;  3HUI A;  2BB5 A;  4XZ4 A;  3EHV A;  2WXR A;  4YWG G;  1QOG A;  2L0F A;  3KVF B;  1GAQ B;  4XC2 A;  2RMM A;  1YN4 A;  4MEM A;  1WI0 A;  3N1X C;  4FA6 A;  5JXV A;  2XN9 C;  1RAX A;  2RDB C;  1VDV A;  3U52 E;  3TSS A;  3R2T A;  5BMH A;  2X8X X;  3WCQ A;  1F2R I;  3DOW A;  3AE1 B;  3H7S A;  2WU5 B;  2WXP A;  3NZ3 A;  4K1R B;  5G5H A;  3WAP A;  2MBO A;  4PT5 A;  1UBI A;  3A1Q A;  4MGZ E;  3WIM A;  3K9O B;  4F1S A;  1C4A A;  1J7C A;  4I6L B;  3ZLZ A;  4UDU C;  2WXF A;  1KLG D;  4A3O A;  1DGJ A;  3UIO B;  4C4V B;  4KSK C;  4DHZ E;  1NYQ A;  1WX7 A;  3VR9 B;  4MH0 E;  1EUV B;  3AEF B;  4ZRK A;  4ANW A;  2O6V B;  2LI5 A;  3FC4 A;  1TKG A;  2MLB A;  4TSS A;  1WRI A;  5EE9 A;  1L0Y B;  3ONS A;  4AWJ A;  4FLH A;  3RFZ B;  1UWX A;  3AE3 B;  2AWT A;  2GRI A;  2WXI A;  2PJH A;  1F77 A;  1FFU A;  2QMT A;  1WY8 A;  2E6X A;  1TBE A;  2GBJ A;  3NVV A;  3KWV A;  1T0R C;  1YQB A;  3AU5 A;  1WJ6 A;  3VFK A;  3O13 A;  2Y3A A;  4FHK A;  1SE2 A;  2KQ7 A;  4XWT A;  1V81 A;  4W9K A;  1WM3 A;  2MSE D;  2LVO A;  1KF6 B;  4IC7 B;  2MJ3 A;  3NVY A;  5FR3 A;  5JZE B;  1GC7 A;  3WAL A;  2LMC A;  3ENE A;  2IY0 B;  3TIX A;  2Y5C A;  1L7Y A;  3DHI C;  2D5G A;  1FRD A;  2JYT A;  5EDS A;  2K22 A;  4W9G A;  1GNU A;  1B1Z A;  1ET9 A;  3N32 A;  1PGB A;  4AJY B;  4PK1 A;  1J7B A;  2W54 A;  3IVF A;  4IDI A;  1WJN A;  2V3S A;  1E7V A;  1ZP0 B;  3QIJ A;  1X1M A;  1WX9 A;  2KAC A;  2KX0 A;  3ML9 A;  2KDF B;  1VD2 A;  1V6E A;  2WX0 A;  4MM3 B;  1TKE A;  4HDQ A;  2NBV B;  1YQ3 B;  2FCM A;  2M56 B;  4AS1 A;  2M4N A;  4RMA A;  3PZ7 A;  1NI3 A;  1JAL A;  1OEY J;  1JWS D;  1EF1 A;  3AV8 A;  5C23 A;  4W9D A;  3VAW A;  2D3B A;  5LLI A;  4XGA B;  4US8 A;  4RGN A;  4P1C C;  3L13 A;  5HHD G;  1MG8 A;  3PV1 A;  5TSS A;  1J8C A;  4YL8 A;  1R4M B;  4ZYN A;  1YOV B;  2UU7 A;  2GOW A;  2WXK A;  4RGO S;  5J17 A;  1N6Z A;  4J6I A;  5HG2 A;  4XE0 A;  1V1O A;  1HZ6 A;  3QK0 A;  1F1H A;  4MGI E;  4F8C B;  2KMC A;  2WXH A;  2FUG 1;  2I2Y A;  4NZL B;  3C0R B;  2LGS A;  5BMI A;  3TJP A;  1C4C A;  1YIW A;  3TEY A;  1EWC A;  3TBL D;  1JWU D;  1OQQ A;  4TMA B;  3L0W B;  4ARI A;  3L4P A;  3DVG X;  3FAH A;  4RGM A;  1WGR A;  2WXQ A;  2DHZ A;  1TKY A;  2LVP A;  2WYQ A;  2J0M A;  2BYV E;  4ANV A;  4AQ7 A;  3GE8 C;  3BVZ A;  1YX6 B;  2DZI A;  3DVN U;  1NBF C;  2SEB D;  3DWM A;  2GI9 A;  2LAS A;  2KYW A;  5LXI B;  2BF8 B;  2AQ2 B;  3UIP B;  2QC8 A;  3AEB B;  2H88 B;  4DK5 A;  1C4P A;  1D4B A;  1K53 A;  4MM3 A;  1D3Z A;  4ZHO A;  1FEH A;  3P4S B;  1C78 A;  3CF6 E;  1F52 A;  3JW0 X;  3QJZ A;  2DYM A;  3Q3J A;  2CJN A;  3P4Q B;  1VJK A;  2SAK A;  2QEJ C;  2BYF A;  1HTQ A;  1RFA A;  2JWU A;  3Q8F A;  1KH0 A;  1UF0 A;  2N7E A;  4N6E B;  3ZDM C;  1YMH E;  2BS3 B;  3ZNZ B;  2K8C A;  5DPT A;  3P63 A;  2RDH A;  5LXH A;  4DHJ B;  4YSZ B;  1V5O A;  2L0T A;  1K52 A;  1WIA A;  3BZD B;  1FNU A;  1FCC C;  4A55 A;  3AB5 A;  3B1L X;  4US9 A;  3DBL B;  4ZDV A;  3PS6 A;  4OZB A;  1ENF A;  1OGW A;  4M01 A;  4KDI C;  4DHZ B;  1JRO A;  2LHD A;  2NBW B;  1XQQ A;  2K3U A;  2WDR B;  2PKO A;  4PYZ A;  1D5Z C;  1XT9 B;  3PRZ A;  3JSV B;  3V60 A;  4B0M A;  2LRW A;  2ZCC A;  4MH8 A;  1N63 A;  2KT7 A;  2N1V A;  2DZJ A;  3KH0 A;  2N1W A;  4GSW A;  5BYQ A;  5JHA A;  3VUY A;  3ZRC A;  3N20 C;  4WJQ A;  3QAQ A;  3TMP B;  3TUO A;  3MP9 A;  2N7J A;  3AEE B;  1DOI A;  1SE3 A;  1WZ0 A;  1P98 A;  1EU4 A;  1V8C A;  4RH6 A;  1XLN A;  2BGF A;  1EM7 A;  4REZ A;  2MQJ A;  2IBI B;  4DQO C;  1WXA A;  2LRU A;  3I3T B;  3ZKJ C;  1LXD A;  2BW2 A;  3MC0 B;  3N9Y C;  2KOX A;  4IW0 A;  1I7H A;  1LGR A;  3VHT C;  1XLQ A;  4TUU A;  3MJ5 A;  2WXO A;  2MX2 A;  3KYC D;  4K81 A;  2MJD A;  3ZO5 B;  4HJK A;  3EFC A;  5D3I B;  5C2T B;  4AJW A;  1FPY A;  1OQR A;  4LTU A;  4KGS A;  2ZVO A;  1TS4 A;  1M4V A;  4W9C A;  4I6P A;  2VRR B;  4K7U A;  1J19 A;  1V9J A;  2V3N A;  1S3S G;  1FXT B;  1QQR A;  3DQV A;  1L4Z B;  1UH6 A;  1CK1 A;  1BXT A;  1SE9 A;  2D11 A;  2OJW A;  1PDX A;  3P1M A;  2PVO D;  1ISN A;  2I1J A;  3JSV A;  3MC8 A;  2DYB A;  2JUO A;  3GS2 A;  1MHX A;  2CHW A;  3UI3 A;  5G5G A;  2KDI A;  1MPE A;  3TEW A;  2ICI A;  4GDK B;  3ZNG C;  4ITK A;  2ZNV B;  4K3B A;  4HLE A;  2J42 A;  4FUL A;  2WDQ B;  2ZNV C;  1QZE A;  3DBS A;  2V4I B;  2AL3 A;  4LLG M;  1OTR B;  2J7Q B;  1KTK A;  2MCN B;  3IBE A;  5HFY A;  1GJZ A;  1WGH A;  1YJJ A;  4BFR A;  3PZ8 A;  2ZW1 A;  4ZOH C;  4BVU C;  2WNM A;  4ZRP A;  3ZJT A;  3AI5 A;  3APF A;  2J0K A;  4NJC A;  3URY A;  2KJ6 A;  2KC1 A;  3RUI B;  4A20 A;  4A3P A;  1YQ4 B;  2KVR A;  2M0A A;  2KN5 A;  4PS8 A;  5BYS A;  3DCG A;  2RPQ A;  4MEL A;  3N30 A;  4BKG A;  1U4A A;  4TQ1 A;  4RM9 A;  2HJ8 A;  4KGR A;  4MGK E;  1B9R A;  1CJE A;  3ZW3 A;  3ZJU A;  4GIV A;  4LCD E;  2JZZ A;  4NJ7 A;  1ZDX A;  2R2Q A;  1CZP A;  2OHF A;  4YTM B;  1JRP A;  2ZPN A;  2NS5 A;  3NS8 A;  2KMA A;  2LGY A;  1OFF A;  4JIO U;  2YEP F;  3FKY A;  4EEW A;  1I4R A;  4B95 A;  4BKS A;  2LXA A;  4KZ0 A;  3QAR A;  2Z8L A;  1L6U A;  5IO9 A;  1SSN A;  3NY5 A;  3V6E B;  2FCN A;  2REX A;  2L1A A;  2JX5 A;  3Q3F A;  2J53 A;  1FCL A;  1XO3 A;  2JXX A;  4GDK A;  2DNF A;  2XEW A;  3ZDT A;  1N5W A;  2ZPY A;  1QT9 A;  2LUM A;  2INN E;  2EKE C;  1QLB B;  3CWI A;  4HJG E;  3LDZ E;  4HKZ E;  1KM7 A;  3QC8 B;  4EUT A;  1SBB B;  4KV2 A;  2QSD A;  2LEK A;  1WMH B;  2CU1 A;  3PGE A;  2BKR B;  2BS2 B;  5C1Z A;  2KJH B;  1P1A A;  2KJR A;  5LNK 1;  3CST A;  1GUA B;  1IP9 A;  1STE A;  2LD9 A;  3HHM A;  4URK A;  4DDI D;  1G6J A;  2C7M B;  2MRP A;  2K6Q A;  2DYO A;  4C7Z A;  1J0G A;  3I57 A;  2NPT B;  1V80 A;  3A9J B;  3EUB 2;  3MFG A;  2ZCB A;  3E56 A;  3I9V 1;  3AEA B;  4WJO A;  3AE5 B;  4ICU A;  2XNA C;  2BQQ A;  1FMA D;  4LJO B;  3GOE A;  2C60 A;  4ZYS A;  4YTP B;  1FO4 A;  2KDB A;  1RYJ A;  1HEZ E;  5J18 A;  1AWD A;  4X57 B;  4NPN A;  1R4N I;  5GMV A;  2B76 B;  5E6P A;  1PFD A;  1RRB A;  2JF5 A;  3M95 A;  3U7Z A;  2C5L C;  1T0Q C;  4JWU C;  2Y5B B;  3C8Y A;  3H9D A;  2M1M A;  1ZOY B;  3TEZ A;  2LGD A;  2BBC A;  3V05 A;  4KVG B;  2B3A A;  2D3G A;  2BVC A;  2FIF A;  1RM6 C;  2JPH A;  4M0W B;  3BK1 A;  2MA9 B;  3HVZ A;  1ZDV A;  2YVC A;  4ZRJ A;  1C1Y B;  1M94 A;  2KFK B;  2L52 A;  3HRD D;  4WJN A;  3DVN V;  4WWP A;  1Y56 A;  3GE3 C;  3K9P B;  3AUL A;  4FXC A;  1KLV A;  3AEC B;  2G45 B;  1AN8 A;  2V0G A;  1VR9 A;  3VDZ A;  1NEK B;  4W9H A;  1TS5 A;  1E8Z A;  2JT4 B;  4NAW B;  2IO2 B;  2MHJ A;  1GG3 A;  1I4Q A;  5IOI A;  2LWP A;  2L7R A;  4WJP A;  4GN1 A;  4JL9 A;  1DOX A;  1L5P A;  4WWM A;  3ZYY X;  4IKG A;  2KD0 A;  4P7I A;  3AE8 B;  5FR6 A;  1E8W A;  1QOB A;  2LFI A;  4JX1 C;  4W9I A;  4G3X B;  3PVL A;  3AE7 B;  2G4S A;  2VZK D;  2PPH A;  4ZHP A;  3DBR I;  4L2Y A;  5D94 A;  4RFB A;  2NCN A;  2N9P C;  2MBB B;  4W9E A;  3NG0 A;  3Q8C A;  4YTN B;  4M8N A;  2AX5 A;  3EA6 A;  2KFJ A;  1TJE A;  4AP4 C;  2NPT A;  1YNT E;  5HKH A;  1TY2 A;  3A9J A;  4C00 A;  4MJS B;  4USA A;  4AOF A;  1IYF A;  3B2G A;  1QKZ A;  2NTT A;  1GOZ A;  4C4V A;  4YSX B;  4BZA A;  2JXT A;  2KWU B;  3WA0 A;  2HJ1 A;  1FIQ A;  2C7N B;  2O6V A;  2OOB B;  2KTR B;  3BVG A;  2N9X A;  1C77 A;  2KZR A;  2WGS A;  1AW7 A;  1ZPS A;  1T6B X;  2LXC A;  2WXM A;  2WDT B;  3N3K B;  1GB1 A;  4DDG D;  2N9E B;  1QOF A;  4M0W A;  3U30 A;  3CMM B;  4R3D A;  2FE8 A;  5E6O A;  3VRA B;  1WF9 A;  2KN4 A;  4KGT A;  2KFK A;  2IPK D;  1JWB D;  3EC8 A;  4JWS C;  1WGK A;  1TS3 A;  2UWQ A;  3R66 C;  5EE0 A;  2KHW B;  1K51 A;  2QHO A;  1PGA A;  3AE4 B;  3IG3 A;  1TZ1 A;  2O2V B;  3Q14 C;  4NAW A;  4AUQ C;  4RCO A;  4FN2 A;  2CKH B;  2BWF A;  4IUM B;  4PS7 A;  1VLB A;  3OWE B;  4HCP B;  5H92 C;  1QF6 A;  2AQ3 B;  1VZ8 A;  3Q8A A;  4DXF A;  2K9X A;  3RYT A;  1P3Q U;  4W9L A;  4P1B C;  4XDC A;  1OEY A;  1KFY B;  3LYY A;  2V9H A;  1TIF A;  2KAJ A;  2KC2 A;  3NVW A;  1SEB D;  2MJE A;  4WAA A;  3O65 B;  2JSV X;  3ZXR A;  5D2M B;  3AE2 B;  3NUH B;  2FUH B;  1E90 A;  3RI7 C;  3KUZ A;  3MJW A;  4B6W A;  1XF5 L;  2MBH A;  4MJS A;  3ZXV A;  3ZTC A;  2KO3 A;  2BYT A;  1Q5W B;  2BKF A;  1C76 A;  4W9F A;  2FCS A;  2EMS A;  4WQO B;  2W3R A;  1QOA A;  2NBU A;  3GZN B;  2EMT A;  1WXQ A;  4EZJ A;  2KTR A;  3Q6B A;  2INC C;  1I4P A;  1WXS A;  3QHT A;  5I4D A;  4DWF A;  3A33 B;  4FJZ A;  2L76 A;  1S1Q B;  4FJV B;  2V1Y A;  1DYQ A;  1F0Z A;  4RM8 A;  5CHW A;  2KK8 A;  5IKC M;  4OVU A;  2YLM A;  2CS4 A;  2BT6 A;  3WAN A;  4HXD A;  3R2I A;  4HCN B;  4KIK B;  1T3Q A;  1MHH E;  4HDO A;  4IG7 B;  1WWT A;  4TKN A;  2LJI A;  5BMG A;  2PEA A;  2ASQ A;  1N60 A;  2MBE A;  4ASW C;  3AXC A;  1GC6 A;  1SE4 A;  1R4M I;  2WLB A;  1KRH A;  2M17 A;  2AEH A;  2CJO A;  2O2V A;  1I42 A;  1EU3 A;  2HTM E;  3U8Z A;  3FIL B;  2PMV A;  5DPS A;  1J7A A;  2WP9 B;  2D3A A;  3MHS D;  3ECI A;  3DBH B;  5IAA C;  1E0Z A;  3V61 A;  2D3C A;  4BBN C;  3ZNH B;  3DPD A;  2HD5 B;  2KTF A;  1JCK B;  1JRU A;  1TT5 B;  1JWA D;  2L32 A;  3VR8 B;  3CIR B;  5D6J B;  1V97 A;  4LNI A;  4K7S A;  3RZW C;  4KZC A;  1TZO A;  4MGY E;  4OVV A;  5AZG A;  2I38 A;  2CHX A;  5TR5 A;  1XCQ L;  2UYZ B;  1XCT L;  2X38 A;  5E6N A;  3VTU A;  4JE3 B;  1JW9 D;  4IWP A;  2RDG A;  3DHH C;  3HM3 A;  4OHJ A;  2L05 A;  4WWO A;  4JQW C;  3VRB B;  3P4R B;  2MH7 A;  4NAM A;  2G4D B;  2CHZ A;  5FKA C;  2OED A;  1IUE A;  3RNF C;  2IJ0 A;  3MTN B;  2I1K A;  1UGM A;  1WR1 A;  3AU4 A;  1HQR D;  1JWM D;  2L83 A;  2G9H D;  4KIK A;  2KNB A;  3TCA A;  1FM0 D;  4HPM B;  4EZL A;  4II2 B;  1A5R A;  1WM2 A;  2IGD A;  3UF8 A;  4KKJ A;  1E6E B;  2WXG A;  3IAM 1;  3TL5 A;  3PLU A;  5IN7 A;  3T3N A;  1XLO A;  3VTV A;  2D2Q A;  2WHI A;  3PHX B;  2JZ3 B;  5AZF A;  2MEK A;  2R61 A;  3MHZ A;  3RPF C;  4G11 A;  3W5V B;  1GB4 A;  5J2R A;  3FIL A;  1V49 A;  3ALB A;  5GXG B;  1ESF A;  3UQB A;  3R3M A;  4XX5 A;  2JY6 A;  2PTL A;  3NHE B;  3AH7 A;  3ZQ4 A;  1SF0 A;  3Q3M C;  3A9K B;  4D2K A;  4A8X C;  4P16 A;  3M3J A;  4LNN A;  4RF0 A;  1P7F A;  2DEN B;  1Y8R C;  4J3O D;  2N9K A;  3R7Q A;  1SJE D;  1TTN A;  2DLB A;  4WWN A;  2K6D B;  2L8J A;  1WFY A;  2INP E;  2MW5 A;  3QX1 A;  5DPW A;  2M19 A;  3Q69 A;  4IWO A;  5HI1 A;  2HDE A;  3H7P B;  3KLS X;  4L1B A;  2D07 B;  4LNK A;  3APC A;  3AM9 A;  2J52 A;  3BWU D;  1YJI A;  5JHB A;  1SGH A;  4HEA 1;  2MWS B;  3BK2 A;  4K7W A;  3RZF A;  2R2O A;  1FNV A;  4S0R A;  4B9K A;  4HWI B;  1CMX B;  3GB1 A;  2N4F A;  4JPS A;  2DAJ A;  2M0X A;  4CYE A;  1V1P B;  2FBW B;  2PW9 A;  5FK9 C;  3QA8 A;  4ZRI A;  3WAM A;  4M8M A;  4XDD A;  1VRA B;  4ICV A;  1RLF A;  4LDT D;  1IBX B;  5KHQ A;  4GXB A;  3L08 A;  1SB3 C;  3I5J C;  1FXA A;  3KUD B;  5CHF A;  1LM8 B;  2HE7 A;  3BYY B;  1V2Y A;  3SFD B;  4RNA A;  1FXI A;  2FCQ A;  1E10 A;  3SDL C;  2KWV B;  1N5X A;  1IGD A;  3RN9 C;  4DXA B;  2WWZ A;  2Y5P A;  1BT0 A;  1XEE A;  1VZ7 A;  2XBB C;  4GB9 A;  3RMK C;  4NY0 A;  4OW0 A;  2NTS A;  2XK5 B;  3HK0 A;  1T0S C;  4MAC A;  2IGH A;  3A9K A;  4XWW A;  3RNC C;  5C3J B;  2ON8 A;  3B0A A;  5CX3 A;  3HIZ A;  4EKU A;  1HZ5 A;  2J4X A;  2ZEQ A;  5T8I A;  1NI2 A;  3OAW A;  3H7P A;  3ZGZ A;  3DDC B;  2GBK A;  1WZ3 A;  3SEB A;  2BYE A;  2QIE B;  2A5U A;  3DBR B;  4IM2 A;  1E8Y A;  2VZK B;  3NZS A;  2L00 B;  1ZXH A;  1Q0W B;  1L0X B;  3RNA C;  1EO6 A;  1V1P A;  2VH1 A;  4GDL B;  3W5U B;  1NEN B;  3VH3 B;  3LJ3 A;  4JLC A;  3H1U A;  4GLS C;  2IZV B;  4LNO A;  4RGT A;  1I35 A;  4G0N B;  4N59 A;  3R7R A;  3V6C B;  1IBX A;  1XLP A;  2JU6 X;  4NJ6 A;  1Q1O A;  4B0E A;  1C3T A;  1WJU A;  2BB6 A;  3W1S C;  1ZGU B;  3Q8B A;  3JYU A;  4WIP A;  2GBM A;  1T5X D;  4GOC A;  2PIA A;  2JRH A;  4WAF A;  1PUT A;  3RD2 A;  3MC9 A;  4E3C A;  2H89 B;  3UIN B;  1N62 A;  1R7S A;  2MP2 B;  3P2B A;  1KJT A;  3VVW B;  1TGZ B;  4M00 A;  2V3P A;  3D32 A;  4IWQ A;  2WDV B;  2Q5W D;  3KYD D;  2NMQ A;  3Q8E A;  1DOY A;  1ZXI A;  4II3 B;  3AMZ A;  2LVQ A;  3IFW B;  3LB8 C;  2MBQ A;  2XK5 A;  3EGR A;  3W1Y A;  1ZKH A;  1FD6 A;  1L4D B;  2E3T A;  1H8C A;  2TSS A;  3Q2A C;  2N0S B;  3NS1 A;  1P0R A;  5AEK B;  3AEG B;  2C7H A;  4KKI A;  2G1E A;  1VZ6 A;  2BS4 B;  3B08 A;  3IT6 B;  1WMH A;  3GP7 A;  3NRZ A;  4GU2 A;  1E9M A;  3L16 A;  1N61 A;  2WXL A;  2W82 A;  4F7Z A;  1UGJ A;  5DCN A;  2N7D A;  3OJ4 B;  2ZW0 A;  4HKQ A;  4BOS C;  2ACZ B;  4GDL A;  4BKT A;  1WSP A;  2LUE A;  3SR6 A;  2GBN A;  1UUP A;  1YD8 U;  3ZNI D;  4LJP B;  5L95 C;  3ZJV A;  2DWQ A;  3HM6 X;  1YN3 A;  1P9D U;  2JRI B;  2KWD A;  3IAS 1;  4E71 A;  3OG5 A;  3BVM A;  3W1S A;  1D5M C;  4WQM A;  1HA5 A;  4HK2 A;  4HRO A;  2WQY B;  2C9W B;  1C9F A;  2AL6 A;  3EFU A;  4C56 C;  2FID A;  2Z0E B;  3PT2 B;  3PZD A;  1RWS A;  3RNE C;  4BAX A;  4IM0 A;  2N9L A;  3T8M A;  1ZW7 A;  2KLG A;  2WU2 B;  3T9L A;  3TEX A;  2NVU I;  1TYG B;  2MP2 A;  3PLV A;  3PRE A;  4EOY A;  3S2A A;  2GLS A;  2IO3 B;  2O6V D;  2KKC A;  4GMV A;  4PS3 A;  4ARC A;  1T0Y A;  1HXY D;  4C7Y A;  3W2D A;  4QAY A;  3U4E G;  1AYF A;  1V86 A;  2RPV A;  2DZM A;  4KDL B;  2QDF A;  3DVG Y;  4JGH B;  1ET6 A;  5IP4 D;  4K3C A;  1PQS A;  2WXJ A;  3PPA A;  4IM3 A;  3H6N A;  3VTW A;  4A90 A;  5EE1 A;  4WUR A;  3IHP C;  5D7G A;  4P6V F;  2EKI A;  4HVB A;  3PO0 A;  4RF1 A;  4E74 A;  1MI0 A;  3LXF A;  3BII D;  3AE9 B;  2K8B A;  3OLM D;  4MSQ B;  4BOZ B;  3BYT B;  1FFV A;  2W55 A;  2D10 A;  1WX8 A;  1NYR A;  1P7E A;  3KW5 B;  2BWE S;  2KQS A;  2K0P A;  2FAZ A;  3RT3 B;  1YJ1 A;  2KQ4 X;  3A4S C;  1VCB A;  2Z59 B;  3APD A;  1IGC A;  3Q3O C;  4EFO A;  3VQI A;  2VH2 A;  3RNB C;  3W9C B;  4NNJ B;  3SD5 A;  3KUC B;  3QQ8 B;  2JWZ A;  1L0V B;  5G2N A;  3SFE B;  3IXS A;  4ACF A;  1MFW A;  4CHK A;  3ABV B;  3PSE B;  1BUI C; 
#chains in the Genus database with same CATH homology
 4BKS A;  4EZK A;  2LXA A;  4KIK A;  2KNB A;  2KLC A;  4KZ0 A;  3QAR A;  3TCA A;  5EDS A;  4W9G A;  1GNU A;  4HPM B;  3NY5 A;  4II2 B;  3V6E B;  4EZL A;  1WM2 A;  2FCN A;  2REX A;  3L17 A;  4HPL B;  3UF8 A;  3N32 A;  3SHQ A;  3NZU A;  3Q3F A;  1OQY A;  4AJY B;  2PE9 A;  2JXX A;  4GDK A;  3TL5 A;  2XEW A;  3PLU A;  3ZDT A;  2NR2 A;  3IVF A;  4FJY A;  3ML8 A;  3VTV A;  2ZPY A;  5AZH A;  1WJN A;  2D2Q A;  3PHX B;  1KOT A;  2V3S A;  2JZ3 B;  5AZF A;  2EKE C;  1E7V A;  3LDZ E;  2OJR A;  3QIJ A;  1X1M A;  1WX9 A;  1KM7 A;  4G11 A;  3QC8 B;  4EUT A;  4NQK E;  2KX0 A;  4KV2 A;  5J2R A;  4GGQ A;  3ML9 A;  2KDF B;  1V49 A;  3ALB A;  3UQB A;  3R3M A;  4XX5 A;  2JY6 A;  1VD2 A;  1WMH B;  3NHE B;  3ZRF A;  2CU1 A;  3PGE A;  2BKR B;  5C1Z A;  1V6E A;  2KJH B;  3A9K B;  1P1A A;  2KJR A;  2WX0 A;  3M3J A;  4DBG A;  4HDQ A;  2NBV B;  2DEN B;  1Y8R C;  3CST A;  1GUA B;  1IP9 A;  2Z0D B;  2LD9 A;  3R7Q A;  3HHM A;  1TTN A;  4URK A;  1HE8 A;  2FCM A;  4WWN A;  2K6D B;  2L8J A;  1WFY A;  2M4N A;  4DDI D;  1G6J A;  2MW5 A;  3QX1 A;  2C7M B;  2MRP A;  5DPW A;  2K6Q A;  4RMA A;  4IWO A;  3UQA A;  2DYO A;  3H7P B;  5CTR C;  2D07 B;  2CR5 A;  1OEY J;  3APC A;  5C23 A;  1EF1 A;  3VAW A;  4W9D A;  1J0G A;  1WXM A;  2NPT B;  5LLI A;  1V80 A;  5JHB A;  1SGH A;  3A9J B;  4FAD A;  2MWS B;  2ZCB A;  3L13 A;  1MG8 A;  3PV1 A;  4K7W A;  4FBJ B;  1V5T A;  4WJO A;  3RZF A;  2BPS A;  4ICU A;  2R2O A;  4YL8 A;  4LJO B;  4B9K A;  1J8C A;  3GOE A;  4HWI B;  4ZYN A;  2C60 A;  2GOW A;  1CMX B;  1UEL A;  2GBR A;  2KDB A;  2JVC A;  5J17 A;  5L83 A;  4J6I A;  2N4F A;  2DAJ A;  2M0X A;  5J18 A;  1LFD A;  4X57 B;  4NPN A;  4CYE A;  1R4N I;  2WX1 A;  1WE7 A;  5GMV A;  5E6P A;  3M95 A;  1RRB A;  2JF5 A;  3QK0 A;  5G55 A;  2C5L C;  2KWC A;  2Y5B B;  3H9D A;  4MGI E;  2M8S A;  3QA8 A;  4F8C B;  4ZRI A;  2M1M A;  3WAM A;  2KMC A;  4M8M A;  5BO4 B;  4ICV A;  2LGD A;  1RLF A;  4LDT D;  1AAR A;  1K8R B;  3C0R B;  3TJP A;  5KHQ A;  3JVZ X;  1YIW A;  4KVG B;  2B3A A;  2D3G A;  3TBL D;  2FIF A;  4GXB A;  3L08 A;  2JPH A;  4M0W B;  4G50 A;  3L0W B;  2MA9 B;  4KSL C;  3RCZ A;  5KHO A;  1EF5 A;  3KUD B;  5CHF A;  1LM8 B;  2HE7 A;  2YVC A;  3DVG X;  4ZRJ A;  4CO7 A;  1V2Y A;  1C1Y B;  1WGR A;  1M94 A;  2DHZ A;  3X0W A;  2IY1 B;  2KFK B;  4WJN A;  3DVN V;  4WWP A;  2FCQ A;  3VXW A;  2LVP A;  2IO0 B;  1Z5S B;  2KWV B;  3SDL C;  2WYQ A;  3K9P B;  3AUL A;  2J0M A;  2ZVN A;  1KLV A;  2W9N A;  2G45 B;  2BYV E;  5CHV C;  4ANV A;  4DXA B;  1WYW B;  3VDZ A;  1YX6 B;  4W9H A;  2RGF A;  4LDT B;  1E8Z A;  2JT4 B;  2DZI A;  4NAW B;  2WWZ A;  3DVN U;  1H4R A;  2IO2 B;  4ANX A;  1NBF C;  3RUL A;  1GG3 A;  1BT0 A;  1F9J A;  3ZUN A;  2LWP A;  2XBB C;  2LAS A;  4GB9 A;  2L7R A;  4W9J A;  4GN1 A;  4JL9 A;  4WJP A;  5LXI B;  2BF8 B;  3GZN I;  4NY0 A;  1UZX B;  2KD0 A;  3CSF A;  4P7I A;  3UIP B;  3M62 B;  5FR6 A;  1E8W A;  3BIN A;  2XK5 B;  3HK0 A;  4DK5 A;  3QWZ B;  4G3X B;  4W9I A;  3A9K A;  3PVL A;  4MM3 A;  2G4S A;  2PPH A;  1D3Z A;  1WE6 A;  3DBR I;  5D94 A;  3B0A A;  3EEC A;  3VUX A;  5CX3 A;  2NCN A;  3HIZ A;  3CF6 E;  3L54 A;  1L2N A;  2N9P C;  2MBB B;  3ZVV A;  4EKU A;  1WJ4 A;  3JW0 X;  4W9E A;  4N9F 4;  3QJZ A;  2ZEQ A;  4M8N A;  1NI2 A;  3WAO A;  3OAW A;  2HTH A;  2DYM A;  1E5W A;  3H7P A;  3Q3J A;  1UBQ A;  3DDC B;  4DHJ D;  2GBK A;  1WZ3 A;  1E8X A;  1WXV A;  2BYF A;  2KFJ A;  2K39 A;  4AP4 C;  2NPT A;  1RFA A;  5DPR A;  5HKH A;  3A9J A;  4MJS B;  3OJ3 A;  2BYE A;  2ZJD A;  4AOF A;  1IYF A;  2J0J A;  2N7E A;  2A5U A;  3DBL I;  4IM2 A;  4BBN F;  1E8Y A;  3NZS A;  2L00 B;  3ZDM C;  2K25 A;  3PHW B;  3PRP B;  3ZNZ B;  2KWU B;  4TQ0 A;  1Q0W B;  3WA0 A;  2K8C A;  3NOB A;  3ZTD A;  3UGB B;  5DPT A;  1EO6 A;  2C7N B;  2O6V A;  4GDL B;  2OOB B;  1XD3 B;  5LXH A;  2KTR B;  2A4Z A;  2AYO B;  2N9X A;  4DHJ B;  2KZR A;  2LJ5 A;  2K8H A;  3VH3 B;  1V5O A;  2L0T A;  3DBH I;  3LJ3 A;  3H1U A;  1WIA A;  4JLC A;  3ZIM A;  2LXC A;  2IZV B;  2WDT B;  3N3K B;  3B1L X;  1I35 A;  4G0N B;  2V4L A;  4ZDV A;  3PS6 A;  2KAN A;  3R7R A;  2N9E B;  3V6C B;  3VUW A;  4DDG D;  1OGW A;  4NQL B;  4NJ6 A;  4KDI C;  4DHZ B;  5IA7 A;  1IPG A;  1Q1O A;  2NBW B;  1C3T A;  1WJU A;  1XQQ A;  1WR6 E;  4PYZ A;  3W1S C;  1ZGU B;  1XT9 B;  3PRZ A;  3JSV B;  3U30 A;  3V60 A;  5JH5 C;  2LRW A;  2ZCC A;  3CMM B;  4TV3 A;  5E6O A;  1WF9 A;  3JYU A;  2GBM A;  3QCA A;  2KFK A;  4GOC A;  2N1V A;  2JRH A;  1WGD A;  3X23 A;  2LGX A;  3RD2 A;  3EC8 A;  2DZJ A;  3KH0 A;  2N1W A;  4E3C A;  4GSW A;  2UWQ A;  3UIN B;  5JHA A;  3VUY A;  3R66 C;  4MDK E;  2MP2 B;  3P2B A;  1Z2M A;  3ZRC A;  2KHW B;  1KJT A;  3VVW B;  2QHO A;  3BY4 B;  1TGZ B;  4WJQ A;  1YX5 B;  3IG3 A;  1A5R A;  1TZ1 A;  3QAQ A;  3TMP B;  2O2V B;  4NAW A;  4AUQ C;  3L10 B;  3D32 A;  4FN2 A;  2CKH B;  2BWF A;  2KXJ A;  4IUM B;  4HCP B;  4PS7 A;  3U7D A;  3A1Q B;  4IWQ A;  1WZ0 A;  1P98 A;  2IYD B;  4ANU A;  2BGF A;  3KYD D;  1LQB A;  4II3 B;  2LVQ A;  3A4R A;  3IFW B;  1E7U A;  2MQJ A;  4I6N B;  3RYT A;  1P3Q U;  2IBI B;  2MBQ A;  2XK5 A;  4W9L A;  3W1Y A;  1WXA A;  2KX3 A;  2LRU A;  1ZKH A;  1OEY A;  3I3T B;  2L3Z A;  3ZKJ C;  1LXD A;  3M63 B;  1H8C A;  1WGG A;  4PYU A;  2KOX A;  2KC2 A;  4IW0 A;  1P0R A;  2K1F A;  5AEK B;  3VHT C;  2KDE B;  1WRD B;  4WAA A;  4TUU A;  3V62 A;  3O65 B;  1UD7 A;  2C7H A;  5D2M B;  2MX2 A;  2FUH B;  1E90 A;  3KUZ A;  1WGY A;  1SIF A;  3KYC D;  3MJW A;  4B6W A;  2IO1 B;  3B08 A;  1NDD A;  2GMI C;  4K81 A;  1WMH A;  4MSM B;  2MBH A;  4GU2 A;  3ZO5 B;  4HJK A;  4MJS A;  3L16 A;  4AJW A;  3ZTC A;  2KO3 A;  2ZZP B;  2ZVO A;  1Q5W B;  1WH3 A;  3VH4 B;  4F7Z A;  5DCN A;  3PRM B;  2G3Q B;  2N7D A;  2PE6 B;  2BKF A;  4BKS D;  2RD0 A;  4W9F A;  2FCS A;  2EMS A;  3OJ4 B;  4WQO B;  2DAF A;  4W9C A;  4I6P A;  4B95 A;  4BOS C;  2VRR B;  2LZ6 A;  2RR9 A;  4K7U A;  2NBU A;  1J19 A;  1V9J A;  2DZK A;  2EMT A;  4GDL A;  1S3S G;  1FXT B;  4BKT A;  2LUE A;  4EZJ A;  2GBN A;  2KTR A;  2RSU A;  1YD8 U;  3ZNI D;  1WXS A;  3QHT A;  4FHJ A;  4LJP B;  2FNJ B;  4DWF A;  5L95 C;  3DQV A;  3A33 B;  1UH6 A;  3HM6 X;  3SU8 X;  2JRI B;  1P9D U;  3PTF C;  4E71 A;  2DX5 B;  4FJZ A;  2L76 A;  1S1Q B;  3W1S A;  4FJV B;  2V1Y A;  1SE9 A;  2D11 A;  4RM8 A;  4XZ4 A;  5CHW A;  2KK8 A;  3EHV A;  2L0F A;  4HK2 A;  4OVU A;  2YLM A;  3KVF B;  2CS4 A;  2C9W B;  3WAN A;  4HXD A;  2AL6 A;  4XC2 A;  1ISN A;  4HCN B;  4KIK B;  4MEM A;  2I1J A;  1WI0 A;  3JSV A;  4FA6 A;  3EFU A;  4HDO A;  4IG7 B;  2DYB A;  2FID A;  1RAX A;  2JUO A;  2Z0E B;  3PT2 B;  3PZD A;  4TKN A;  2CHW A;  2PEA A;  2ASQ A;  2MBE A;  4IM0 A;  4ASW C;  2KDI A;  3T8M A;  3AXC A;  1ZW7 A;  1GC6 A;  4GDK B;  2KLG A;  3ZNG C;  3T9L A;  2NVU I;  2ZNV B;  2MP2 A;  1R4M I;  3DOW A;  3H7S A;  3PLV A;  3PRE A;  4EOY A;  3S2A A;  4HLE A;  2M17 A;  2IO3 B;  2AEH A;  2O6V D;  4FUL A;  2O2V A;  2KKC A;  1I42 A;  4K1R B;  3WAP A;  4GMV A;  2MBO A;  3U8Z A;  2ZNV C;  4PS3 A;  5DPS A;  1UBI A;  1QZE A;  3A1Q A;  4MGZ E;  1T0Y A;  3DBS A;  3WIM A;  3MHS D;  2AL3 A;  3ECI A;  3K9O B;  4F1S A;  1OTR B;  2J7Q B;  5IAA C;  3V61 A;  1V86 A;  4BBN C;  4I6L B;  2DZM A;  3ZLZ A;  2MCN B;  3IBE A;  4KDL B;  3ZNH B;  1GJZ A;  3DPD A;  1WGH A;  2HD5 B;  2KTF A;  3DVG Y;  4A3O A;  4JGH B;  3UIO B;  4BFR A;  1JRU A;  4KSK C;  4DHZ E;  1PQS A;  3PPA A;  4IM3 A;  3H6N A;  3VTW A;  1WX7 A;  4MH0 E;  1EUV B;  3IHP C;  5D7G A;  4ZRK A;  4ANW A;  4BVU C;  4HVB A;  2O6V B;  2LI5 A;  5D6J B;  3AI5 A;  2MLB A;  3APF A;  2J0K A;  4K7S A;  4E74 A;  2KJ6 A;  3RZW C;  4KZC A;  2KC1 A;  3RUI B;  4A20 A;  2K8B A;  3ONS A;  4MGY E;  4A3P A;  4AWJ A;  3OLM D;  2KVR A;  4OVV A;  4FLH A;  2CHX A;  5AZG A;  5TR5 A;  4MSQ B;  2KN5 A;  4BOZ B;  2UYZ B;  5E6N A;  4PS8 A;  3VTU A;  2AWT A;  4IWP A;  2D10 A;  1WX8 A;  3DCG A;  3HM3 A;  2PJH A;  2L05 A;  2RPQ A;  4MEL A;  3N30 A;  3KW5 B;  4WWO A;  2BWE S;  2KQS A;  4JQW C;  4BKG A;  1U4A A;  2FAZ A;  1WY8 A;  4TQ1 A;  3RT3 B;  4RM9 A;  2HJ8 A;  4MGK E;  1TBE A;  2GBJ A;  1YJ1 A;  2CHZ A;  2G4D B;  3A4S C;  3ZW3 A;  1VCB A;  2Z59 B;  3APD A;  4EFO A;  1YQB A;  3AU5 A;  4GIV A;  1WJ6 A;  3VQI A;  4LCD E;  2JZZ A;  3VFK A;  4NJ7 A;  4FHK A;  2KQ7 A;  1V81 A;  2R2Q A;  4W9K A;  4NNJ B;  1WM3 A;  3SD5 A;  3MTN B;  2MSE D;  2LVO A;  3KUC B;  2I1K A;  3QQ8 B;  4IC7 B;  2JWZ A;  1UGM A;  1WR1 A;  2ZPN A;  1GC7 A;  5G2N A;  5JZE B;  2NS5 A;  3NS8 A;  3WAL A;  3AU4 A;  2KMA A;  2LGY A;  4JIO U;  4CHK A;  4EEW A;  3ENE A;  2IY0 B;  3TIX A;  3PSE B;  1L7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...