2KTRA

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'SLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRAERGDLVAFSSDEELTMAMSYVKDDIFRIYIKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sequestosome-1
publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrA00
3ZNZB 4EZKA 3ZRFA 2L8JA 4BOZB 1YQBA 4EOYA 2KNBA 2KFJA 1SE9A 2RPQA 2KDEB 4HPLB 3B0AA 3L08A 3R3MA 4EKUA 3KYDD 2JY6A 5G2NA 3ZO5B 3IHPC 4A3PA 2KTRB 3K9OB 1SIFA 1UH6A 3VUWA 2MRPA 1WM3A 3R7QA 3JSVB 1XT9B 1XD3B 3Q3FA 2CHWA 1WXAA 2WDTB 1V5TA 1WGRA 1RLFA 2HD5B 3RZWC 5AEKB 2BGFA 4GDLA 3EFUA 4FHKA 1V5OA 3VTVA 4WWNA 4BBNF 3R7RA 1J0GA 3AU5A 4K81A 4LCDE 4PYZA 3UF8A 4HDQA 5JH5C 5CHFA 2REXA 4IWPA 3RD2A 1LQBA 3QX1A 2KN5A 4ICVA 5CHVC 2VRRB 4ANUA 4HLEA 1NBFC 1RAXA 3QJZA 2LJ5A 4ANVA 2BYEA 1V6EA 3DDCB 1C3TA 3AXCA 2XEWA 4NNJB 2DYOA 2ZNVC 3PVLA 2M17A 4HVBA 2JZZA 1EF5A 2GBMA 2L3ZA 2LD9A 2WYQA 3ENEA 4TQ1A 4GGQA 2LVOA 1GC7A 1UGMA 1WI0A 4MJSB 3ML9A 3RULA 3WA0A 2HE7A 1Z2MA 2K8BA 3A4RA 3CSFA 2JXXA 3MJWA 2ZPYA 4MEMA 3VTWA 4FBJB 3ZNGC 3ZVVA 1WX7A 2KQSA 2FAZA 3JSVA 4JL9A 2NPTA 3DVGX 2D3GA 4KDIC 2MBBB 5E6NA 3S2AA 4BFRA 3VHTC 2KFKB 1WF9A 3A9KB 4K7UA 5C23A 1X1MA 1TTNA 2CKHB 5DPSA 3H1UA 4MELA 2J7QB 4MSMB 3DVGY 1J19A 2KHWB 1OQYA 4BOSC 2LASA 3PGEA 3VTUA 2EMTA 3B08A 4BKTA 1IP9A 2CR5A 3DBHI 3SDLC 1F9JA 2N1WA 4KV2A 2KC1A 2KLGA 5C1ZA 3DVNV 3QHTA 4MGYE 2NCNA 3KVFB 1P1AA 4KSKC 4ANWA 2IO3B 5FR6A 4ZRKA 3Q3JA 1G6JA 3QC8B 3A33B 3ONSA 4IUMB 1U4AA 4W9JA 2MA9B 1Y8RC 2KX0A 4IM2A 4MJSA 4M8NA 1BT0A 2DENB 4E74A 1I35A 3PT2B 1E7VA 2BF8B 2LXAA 2V3SA 2QHOA 4W9CA 3I3TB 4W9KA 4OVVA 2KFKA 3U7DA 1V2YA 2N1VA 4J6IA 1NDDA 5DPWA 4TV3A 2DZMA 2R2QA 1E7UA 3DQVA 3RZFA 2DHZA 2J0KA 2JRIB 1L2NA 2PPHA 2JT4B 1YJ1A 4PS7A 4MGIE 1I42A 3W1SC 4G50A 1VD2A 4W9EA 4K7WA 4W9DA 2N9XA 3H7PA 1WGYA 3IBEA 4M8MA 4EZJA 3AI5A 3APCA 3VUXA 2L76A 5IAAC 4FADA 2D07B 3LDZE 3DCGA 4AWJA 2MW5A 1ZKHA 4I6NB 3PHWB 4DHZB 2LI5A 3U8ZA 3CMMB 2MCNB 2WX0A 1WGHA 3PSEB 4ASWC 4X57B 1WX9A 1WR1A 2AYOB 4MDKE 5D7GA 2LUEA 3VFKA 3VXWA 3TJPA 1E8WA 2C7NB 2MBHA 4JLCA 5DCNA 5D94A 4OVUA 4W9HA 1KOTA 2FIDA 5AZHA 2OOBB 4NJ7A 1WJNA 2G4DB 2KMAA 3HM3A 2NPTB 4CYEA 2FNJB 3QIJA 3L0WB 3PS6A 2JZ3B 3DBRI 4PYUA 3T8MA 3WAMA 3PZDA 2DX5B 2CHZA 4GN1A 4I6PA 4EUTA 3RCZA 1WM2A 4ZYNA 1GC6A 4B6WA 1WE7A 4WAAA 2KZRA 2ZZPB 2I1KA 2L0FA 4NQKE 1FXTB 4W9GA 2Y5BB 3V62A 2ZJDA 2BPSA 3BINA 3MHSD 3ZRCA 2MSED 3SHQA 3W1YA 1TBEA 3M62B 3RUIB 4IM3A 1V80A 3UQBA 1E8XA 3PRPB 2CHXA 2LGYA 2K39A 4BVUC 2DZJA 4MM3A 4MH0E 3T9LA 1M94A 1WJUA 3A9JB 2NBVB 3HM6X 4JQWC 3TMPB 4GOCA 5KHQA 5E6PA 2K8CA 2NVUI 2A5UA 3DVNU 4GSWA 5IA7A 3K9PB 2ZVOA 1Z5SB 2GMIC 4FHJA 1E5WA 2KO3A 3NOBA 1ISNA 2PEAA 2KDFB 4DHJB 4ZRJA 1WR6E 3PRZA 2DAFA 2IY0B 2RR9A 1T0YA 2DZIA 2PE6B 4G0NB 3W1SA 4MSQB 4AJYB 2GBRA 2B3AA 4AP4C 2ZEQA 4IWOA 2D10A 2C60A 3UINB 1EO6A 2BWFA 3N32A 3ECIA 4M0WB 1E8ZA 2FCQA 1TZ1A 4KDLB 4NY0A 3PREA 2KD0A 2CU1A 2KWCA 2ZCCA 3VAWA 4AOFA 3IG3A 5EDSA 2WX1A 2ZVNA 4EZLA 2K1FA 2D11A 2DAJA 2I1JA 2K6DB 3QCAA 4BKGA 2ZNVB 2M1MA 5J17A 3H7PB 1V9JA 1UBQA 4HDOA 2Z59B 1WJ4A 2RD0A 2LZ6A 3ZW3A 3QQ8B 4GDKB 1CMXB 2KOXA 1GUAB 4HCPB 3H7SA 1KJTA 1IPGA 2KJ6A 2LRWA 4G3XB 3TIXA 1S1QB 1YIWA 1ZGUB 1EF1A 1WE6A 2Z0DB 3M95A 4IM0A 3V6EB 4EEWA 4ZDVA 2AL3A 2N7DA 3A9JA 2IYDB 2IBIB 4LJOB 5LLIA 3UIOB 3VVWB 1Q1OA 2NBUA 3EC8A 2MBOA 1Q0WB 2NS5A 2ZPNA 1TGZB 2GBKA 3APDA 2D2QA 2KVRA 3DOWA 1PQSA 4PS8A 2DYBA 2LGXA 2ZCBA 4B95A 4IW0A 3AU4A 2BWES 3WAOA 3ZDMC 4WJPA 4FULA 1R4NI 2AEHA 3ZKJC 2AL6A 1WGDA 4DDGD 2G4SA 2LWPA 4GIVA 4KZCA 4G11A 4LDTB 2V4LA 2EMSA 4HPMB 1WJ6A 3V6CB 2LRUA 4ICUA 3PRMB 3HK0A 2L00B 3JW0X 4FA6A 2IO0B 1EUVB 4WQOB 3R66C 1WH3A 2DZKA 2JF5A 4A20A 1R4MI 4TQ0A 4RM9A 2RGFA 5BO4B 4XX5A 5J2RA 2MQJA 1IYFA 3QAQA 4GU2A 4WJQA 4GMVA 4GDKA 4NAWB 1WYWB 4F8CB 2Z0EB 1HE8A 1KM7A 4JGHB 4FN2A 3HHMA 2DYMA 3SU8X 2XK5B 4IWQA 3EHVA 1UZXB 1WGGA 4K7SA 4ANXA 3N3KB 2OJRA 2JUOA 1H4RA 2PJHA 3D32A 1JRUA 2KKCA 2LVQA 4XZ4A 2J0MA 4F7ZA 5CTRC 4II2B 1V49A 1P9DU 4DDID 4HK2A 4EFOA 3M3JA 4DBGA 2N4FA 1WFYA 5LXHA 3NHEB 4II3B 2BKFA 4RM8A 2N9EB 3B1LX 4WWPA 5HKHA 1S3SG 3KUZA 3APFA 1P0RA 3PPAA 1WXMA 2O6VB 4NPNA 4AUQC 5LXIB 2G45B 3L13A 2V1YA 1GJZA 3LJ3A 2ASQA 3KW5B 1SGHA 4RMAA 2MLBA 1V81A 2A4ZA 3JYUA 4WJOA 2LVPA 5AZGA 1OEYA 2IY1B 3NZUA 3PLVA 4KIKB 3DPDA 4BKSA 2GBNA 4CO7A 4NAWA 5J18A 2MBEA 1YX6B 4W9IA 4E71A 3VUYA 5CX3A 2R2OA 3KUCB 2JRHA 3CSTA 3A1QA 2XK5A 3PLUA 1LM8B 3DBLI 2GOWA 2KJRA 4LJPB 3UGBB 1WY8A 3GZNI 2JWZA 5D6JB 2LGDA 3ZTDA 5JZEB 1AARA 1RFAA 2KLCA 2W9NA 2C5LC 3QWZB 2AWTA 4F1SA 3V60A 3ZDTA 4NQLB 3ZNID 2K25A 3PTFC 4DHJD 4FJZA 4BBNC 2CS4A 2IO2B 4DWFA 3H6NA 2KJHB 3WALA 1WX8A 4ZRIA 1WRDB 3KUDB 1NI2A 4TUUA 2M0XA 1LXDA 3ZNHB 1ZW7A 3TCAA 3U30A 4URKA 2IZVB 2M8SA 2O2VA 2JPHA 3X0WA 1WMHB 3X23A 2O6VA 1GG3A 1MG8A 3SD5A 2RSUA 2N9PC 4DK5A 3O65B 4GXBA 2MP2B 4B9KA 1P3QU 3PV1A 3PHXB 3UIPB 2FCMA 4MGKE 1VCBA 2NBWB 4KVGB 2KXJA 2KANA 5TR5A 5DPRA 5L83A 2NR2A 2MWSB 1YD8U 4KIKA 1OTRB 3AULA 2KTRA 4A3OA 3QK0A 4E3CA 2FCNA 1OGWA 2FCSA 2KTFA 4DXAB 1A5RA 1RRBA 1XQQA 2KWUB 5JHBA 2LXCA 1UELA 5AZFA 2M4NA 4GB9A 2UYZB 5E6OA 4HJKA 2L05A 4PS3A 1C1YB 1E90A 3EECA 3VH3B 1P98A 1UBIA 2EKEC 4AJWA 1WIAA 4YL8A 3ZUNA 3KYCD 2N7EA 3M63B 3NY5A 3HIZA 2HTHA 3IVFA 3VQIA 1WZ0A 2MBQA 4W9FA 1K8RB 2FIFA 3GOEA 3IFWB 4LDTD 1QZEA 3WAPA 2K6QA 4N9F4 4CHKA 1D3ZA 4JIOU 5CHWA 1YX5B 3C0RB 4FJYA 1WMHA 2L0TA 5L95C 3NS8A 3NZSA 3ZTCA 4HCNB 3QA8A 3ZIMA 5GMVA 4IC7B 2MP2A 1OEYJ 3BY4B 2BYVE 1UD7A 4MGZE 3RT3B 3TL5A 2YVCA 2KX3A 4KSLC 3ML8A 4HXDA 3CF6E 2YLMA 2HJ8A 3L54A 3N30A 2K8HA 5DPTA 3ALBA 3L16A 2WWZA 1LFDA 4TKNA 4BKSD 3V61A 1Q5WB 2L7RA 2C7MB 3P2BA 2BYFA 2KDBA 3JVZX 1WZ3A 3QARA 2KDIA 2C7HA 2KK8A 4XC2A 2JVCA 2C9WB 4K1RB 2FUHB 2KWVB 2BKRB 2MX2A 3A9KA 3H9DA 3L10B 3A1QB 1L7YA 1WXVA 2XBBC 3KH0A 3WANA 4FJVB 4P7IA 4FLHA 3UQAA 2G3QB 2KQ7A 2UWQA 3DBSA 4GDLB 2PE9A 3L17A 4I6LB 5KHOA 1H8CA 1KLVA 3RYTA 2GBJA 3VDZA 3OLMD 3VH4B 1V86A 2J0JA 2KC2A 3ZLZA 3OAWA 2KMCA 4WWOA 1GNUA 4NJ6A 4W9LA 1J8CA 3WIMA 4HWIB 2IO1B 3A4SC 3OJ3A 1WXSA 2O6VD 5G55A 4IG7B 4DHZE 3MTNB 2O2VB 4KZ0A 4WJNA 5D2MB 3OJ4B 5JHAA 3TBLD 1E8YA
chains in the Genus database with same CATH superfamily
4XDDA 3TEXA 3SEBA 4BOZB 3BYYB 4OHJA 4EOYA 2KFJA 2JXTA 3V3XA 4HPLB 3R3MA 4RF0A 5E6JA 2KTRB 1L6VA 2K3UA 3R7QA 3JSVB 1XT9B 3Q3FA 1WXAA 1ZXIA 4WQMA 2QEJC 2W3SA 4BBNF 3R7RA 1TJEA 1VJKA 4IWPA 4A90A 1LQBA 1WSPA 2ON8A 1NBFC 3OWEB 2LJ5A 4ANVA 3DDCB 2QILA 3AXCA 2WXMA 1KRHA 2V3NA 2DYOA 5BMGA 2M17A 3Q8BA 2B76B 1SB3C 2GBMA 5BYSA 2WYQA 4TQ1A 3FAHA 1WI0A 3TUOA 3RULA 2UU7A 3CSFA 1YMHE 5HI1A 3Q6BA 1J7BA 2KQSA 4JL9A 4YT0B 4A6QA 4K7UA 1KH0A 1TTNA 1HTOA 3IT6B 1OQYA 2IJ0A 3VTUA 2EMTA 3B08A 5IKCM 2RMMA 3DBHI 4MGYE 2NCNA 1JALA 5IO9A 2WXOA 5HFYA 4ZRKA 3Q3JA 1C9FA 3BYTB 1U4AA 4W9JA 4MJSA 3RN9C 2DENB 2BF8B 1I7HA 2QHOA 4W9KA 4OVVA 3AH7A 3AEDB 1STEA 5DPWA 4TV3A 2R2QA 3RZFA 1QOGA 3W1SC 1VD2A 4WURA 3IBEA 3AI5A 4FADA 3DBLB 5FKAC 4KGRA 4AWJA 4LLGM 4I6NB 1K53A 3CMMB 2WX0A 1WX9A 2AYOB 3DWMA 4MDKE 5MPOA 5D7GA 1OQRA 1ET9A 4LNNA 4JLCA 4OVUA 2FIDA 2OOBB 4NJ7A 2G4DB 2KMAA 3HM3A 3QIJA 3L0WB 3N1ZC 2JZ3B 3WAMA 3KWLA 1ZDVA 3RCZA 1WM2A 3N9YC 3BK2A 2M19A 2WP9B 1WE7A 3NVVA 2KZRA 2G1EA 2L0FA 4W9GA 3P1MA 3V62A 2ZJDA 4JE3B 2JYEA 3SHQA 1TBEA 3AEFB 3RUIB 1V80A 3AE7B 3HVZA 2V3PA 2CHXA 4WAFA 1K51A 4BVUC 4MM3A 1NYQA 1F1HA 4R3DA 2CJOA 4GOCA 1VR9A 2K8CA 4GSWA 1E6EB 4ZHPA 3K9PB 1TY2A 2GMIC 4FHJA 3NOBA 2KDFB 1ESFA 4DHJB 1EWCA 2RR9A 4G0NB 3W1SA 1QQRA 2B3AA 2XN9C 4IWOA 2D10A 3TEWA 1EO6A 2BWFA 2BTEA 1E8ZA 1KF6B 3PREA 2V0GA 3UI3A 2KD0A 2CU1A 2KWCA 2ZCCA 3IG3A 2QIEB 4EZLA 2I1JA 2K6DB 2M1MA 5J17A 1WJ4A 2LZ6A 1CMXB 2KOXA 2KJ6A 4G3XB 1S1QB 1YIWA 2HJ1A 1VLBA 3VVWB 2MBOA 4C7YA 1Q0WB 2ZPNA 1TGZB 2QCZA 3DOWA 3APDA 3B2FA 2KVRA 4WIPA 1PQSA 2ZCBA 4B95A 3WAOA 2W3RA 3ZKJC 2AL6A 1WGDA 4KZCA 2LWPA 4LDTB 4HPMB 1WJ6A 2LRUA 4TSSA 4FA6A 1DOYA 1IGDA 1WH3A 3HUIA 1R4MI 4YSYB 4A20A 2RGFA 2MQJA 1IYFA 4F8CB 1KM7A 2ICIA 3ZJTA 2XK5B 4JWSC 2RPVA 4MM3B 2Y5PA 3N3KB 2OJRA 3E56A 2PJHA 1ZP0B 4F7ZA 5CTRC 3Q2AC 3M3JA 2KWDA 4HKZE 1WFYA 4II3B 1AYFA 2BKFA 2N9EB 4RM8A 4OZBA 3AE4B 4LTUA 1P0RA 3EA6A 3PPAA 4XDCA 2O6VB 2G45B 1GJZA 3LJ3A 3Q8AA 3LB8C 1V81A 2LVPA 1QILA 1OQQA 2PKOA 3NZUA 1FFVA 1UGJA 1D5MC 3PLVA 4BKSA 4E71A 3VUYA 5CX3A 1I4QA 4LJPB 1SE2A 2KLCA 1CK1A 1L4DB 2W9NA 3V60A 1N63A 3ZNID 2K25A 1RYJA 3PTFC 2LJIA 2IO2B 3H6NA 3KUDB 2M0XA 3RNBC 1JMLA 2Q5WD 1JW9D 1MG8A 2IGDA 3O65B 4LNFA 2FCMA 4KVGB 2DWQA 5DPRA 5L83A 1OTRB 1PDXA 2FCNA 4AS1A 2PLPA 3NZ3A 4YWGG 2OHFA 3Q8CA 1P7EA 3EECA 1V1PB 2DBYA 2EKEC 2N7EA 3M63B 3HIZA 4JPSA 3W5VB 2WHIA 1WZ0A 2FIFA 2KVZA 3WAPA 4N9F4 1YJIA 4A8XC 1D3ZA 3C0RB 4FJYA 1A70A 2MHJA 3ZTCA 3ZIMA 4GLSC 3TL5A 2KX3A 1GOZA 1CZPA 3CF6E 2HJ8A 3N30A 3ALBA 1LFDA 3AE3B 1FD6A 1C4CA 3V61A 3P2BA 1T0SC 2BYFA 2LHEA 3JVZX 1WZ3A 2C7HA 1XEEA 2C9WB 4RH6A 2FUHB 3Q8EA 4RNAA 3H9DA 3VR8B 3NVWA 3CWIA 2NTTA 3UQAA 2V9HA 2UWQA 3DBSA 4I6LB 1ZPSA 2QJLA 4C4VA 2GBJA 3VH4B 1V86A 3ZLZA 3OAWA 4RGTA 3I57A 2DLBA 2KMCA 5FK9C 1R7SA 4N6EB 5G5HA 5G55A 1WWTA 3ZNZB 4REZA 3ZRFA 3J9CA 4K3BA 1YQBA 1TKYA 4DXFA 5H92C 2BB5A 2KDEB 1ZDXA 3B0AA 3L08A 4EKUA 3FILA 2WXNA 3ZXVA 2GI9A 3RPFC 1LO5D 1FM0D 3AEEB 1HTQA 4GDLA 1V5OA 2W82A 3VTVA 3RFZB 2WU5B 5JH5C 4RGNA 3RD2A 1ZXHA 2KN5A 2WLBA 1TY0A 2VRRB 4HLEA 1TT5B 1N6ZA 1HEZE 2BYEA 1V6EA 2CJNA 4NNJB 2ZNVC 3PVLA 4HVBA 4NAMA 2ZW1A 4LNIA 5D3DA 3ML9A 3WA0A 2HE7A 3A4RA 3MJWA 4MEMA 3ZVVA 3JSVA 2FAZA 3DVGX 4QAYA 1FCLA 4BFRA 3VHTC 2KFKB 1WF9A 3IAS1 1JWBD 5C3JB 4M02A 3PO0A 3DVGY 3T3OA 3AE8B 4C4VB 1YOVB 4FXCA 4BKTA 1FNVA 3SDLC 2IPKD 4KV2A 2KC1A 2KLGA 3QHTA 3BVGA 4ANWA 2GB1A 5BMIA 2WXIA 3ABVB 3ONSA 4IUMB 4C7ZA 2OJWA 3AEAB 2WDRB 2V3SA 4JWUC 3I3TB 2PVGC 3DHIC 1V2YA 2N1VA 1I4GA 2SEBD 1NDDA 2DZMA 2DHZA 2JRIB 1L2NA 1XF5L 1D5XC 4MGIE 1I42A 4G50A 4W9EA 4M8MA 3H7PA 1NI3A 2L76A 2D07B 4KKIA 1SJHD 3DCGA 1TS2A 4AQ7A 1MI0A 4KKJA 3PHWB 2XNAC 4X57B 1WR1A 4L2YA 5DCNA 5D94A 4W9HA 1XLOA 1YQ3B 1WXQA 3DBRI 3PZDA 2DX5B 3NJTA 4EUTA 1TS3A 2KMMA 1L6UA 2TSSA 2WXFA 4HKQA 2Y5BB 2BPSA 3MHSD 2WXPA 3PRPB 2LGYA 3A9JB 5KHQA 2WXLA 3WCQA 1WGKA 2PEAA 1T6BX 3PRZA 2DAFA 2QDFA 2DZIA 2PE6B 4H2AA 1C76A 4MSQB 4AP4C 1GB1A 3T3NA 3N32A 2WXGA 3VAWA 1XLPA 4D2KA 4ARCA 2D11A 2DAJA 2ZNVB 3H7PB 1V9JA 3ZW3A 5C1ZA 1GUAB 1KJTA 1IPGA 2LRWA 1ZGUB 1I35A 4IM0A 1WE6A 2L1AA 4ZDVA 2KDMA 3EFCA 2AL3A 2IBIB 4XWTA 3UIOB 1TS4A 1Q1OA 3AECB 1FIQA 1KFYB 2WXJA 5EE3A 3R2IA 4LNKA 2BWES 3ZDMC 3BVZA 4WJPA 1QF6A 4FULA 1R4NI 2AEHA 2DNFA 2EMSA 3P4RB 4ICUA 2JX5A 3AE5B 3HK0A 2L00B 3JW0X 3PRMB 1Q10A 2IO0B 1EUVB 1FPYA 1E7PB 4B0EA 4TQ0A 4YTPB 4GU2A 4GMVA 1C4AA 2Z0EB 2IGHA 3ETRA 1HE8A 2BW2A 3DBRB 4FN2A 3HHMA 4DQOC 3SU8X 4IWQA 1KLGD 1DOIA 1UZXB 4ZRPA 1SXTA 2WU2B 2LEKA 3D32A 2MEKA 5IP4D 2LVQA 3P42A 3GE8C 1P9DU 4DDID 1L0XB 1ENFA 4P6VF 2WGSA 4ARIA 4WWPA 5HKHA 1S3SG 3KUZA 3APFA 4PT5A 4NPNA 3L13A 1TS5A 1SGHA 4RGMA 4WJOA 3GB1A 5AZGA 1HZ6A 2BB6A 4KIKB 4CO7A 5J18A 1YX6B 2JRHA 3CSTA 4N59A 3PLUA 3A1QA 1XLNA 2XK5A 3RNCC 2GOWA 1WY8A 3Q14C 5D6JB 2LGDA 2WDVB 2E6XA 3AE6B 2AWTA 4F1SA 1N62A 4NQLB 5D3IB 1I4PA 3DBHB 3MC8A 1MVKA 1T0RC 1FO4A 4DWFA 1JCKB 3H8HA 4OZCA 2KQ4X 1NI2A 1ZW7A 3TCAA 1FRRA 4YTMB 4URKA 2IZVB 2M8SA 1FFUA 1RWSA 2O6VA 1GG3A 2RSUA 4J3OD 4DK5A 2MP2B 3PV1A 3UIPB 1QOBA 1F52A 2RDBC 2NR2A 1BXTA 2N0SB 4MACA 3I63C 2BYTA 1MHHE 1D4BA 1UELA 5AZFA 5EE0A 2UYZB 1HZ5A 4USAA 3U2SC 1XLQA 3VH3B 1WIAA 3ZUNA 3RNGC 5TSSA 4W9FA 2QMTA 1QZEA 4XYCA 1SSNA 1YX5B 1C4PA 5L95C 3NZSA 1BMLC 3VRAB 5GMVA 4IC7B 3BY4B 2YVCA 3ML8A 4RF1A 3L54A 2L52A 4TKNA 3L16A 5DPTA 3KWVA 2C7MB 3AE1B 4M00A 2LGSA 2KDIA 4MH8A 1F2RI 2ZW0A 2QC8A 3A1QB 3WANA 1JWUD 1WRIA 4FLHA 2IGGA 1V1PA 1JROA 4HROA 5HG2A 3NUHB 1ZOYB 2INNE 1GNUA 3WIMA 2JYTA 3A4SC 3BVMA 4DHZE 2JWUA 3OJ4B 3URYA 5JHAA 3TBLD 1E8YA 4EZKA 5BYRA 2BS4B 2L8JA 3IAM1 1QLBB 1SE9A 2FE8A 2WXRA 3AN1A 3KYDD 5G2NA 4A3PA 3IHPC 4B0MA 3K9OB 1M4VA 1WM3A 2MRPA 5EE1A 2WDTB 1TKEA 1RLFA 2HD5B 3RZWC 5AEKB 2BGFA 1EM7A 1I4RA 4FHKA 4MT5A 1J0GA 1CQVA 2BQQA 3AU5A 4LCDE 4PYZA 4P1CC 4UDUC 4ICVA 5G5GA 3ZGZA 4YSXB 5CHVC 3QJZA 2D5GA 1I4XA 1ET6A 5EE9A 1NEKB 2JZZA 1MHXA 2L3ZA 1V1OA 1C77A 2KYWA 4GGQA 1GC7A 1UGMA 2K8BA 3VTWA 2ZPYA 4WWMA 1PYWD 1T0QC 1WX7A 2L83A 2NPTA 2AQ1B 2Y5CA 3S2AA 2JZPA 3BZDB 1X1MA 1NENB 2CKHB 3H1UA 1R4MB 4MELA 4MSMB 1J19A 2KHWB 4BOSC 2LASA 2LFIA 2AQ2B 1ACCA 1IP9A 2N1WA 2X8XX 1EU3A 4M01A 1XXGA 2WXQA 2Z8LA 2IO3B 1G6JA 2D3CA 3QC8B 1QOFA 4KGSA 3P4QB 2INCC 3RNAC 2MA9B 4IM2A 2KX0A 1BT0A 3PT2B 2LXAA 4W9CA 1UWMA 2KFKA 3U7DA 2W55A 4J6IA 1E7UA 2PVOD 2J0KA 2PPHA 2JT4B 2LHDA 2D3BA 1QT9A 2RDHA 4K7WA 2N9XA 1WGYA 4EZJA 3AE2B 3APCA 2WNMA 3LDZE 2MW5A 1SJED 3BWUD 3RI7C 2LI5A 3HRDD 2MCNB 4ASWC 3PSEB 1VZ7A 4NJCA 3VFKA 1VZ6A 3VXWA 1E8WA 3P4SB 2BS2B 2Y3AA 2JQRB 1KTKA 1KOTA 1RFKA 4S17A 3U7ZA 1WJNA 2KT7A 2WXKA 3NVYA 2NPTB 4CYEA 1D5ZC 5IN7A 2CHZA 4KGTA 4ZYNA 4B6WA 1QOAA 5JXVA 2I1KA 4NQKE 1YN5A 3BINA 3ZRCA 2MSED 3UQBA 3Q3OC 2K39A 2E3TA 3HM6X 2NBVB 3TMPB 5E6PA 1IUEA 2NVUI 2A5UA 5IA7A 2ZVOA 1E5WA 2KO3A 1ISNA 1GPXA 1TZOA 1YN4A 1WR6E 2IY0B 1T0YA 2GBRA 2ZEQA 4ZRQA 2C60A 3UINB 4M0WB 2FCQA 3AM9A 1TZ1A 2BT6A 4AOFA 3ZJUA 3BK1A 2ZVNA 5AUKA 3QCAA 2Z59B 3W9CB 1GAQB 1MJDA 3QQ8B 4GDKB 4NY0A 5J2RA 4HCPB 3H7SA 3TIXA 1SIJA 2I2YA 4EEWA 2PMVA 2N7DA 3A9JA 2BS3B 1T3QA 2NS5A 2D2QA 3MP9A 4PS8A 2LGXA 3AU4A 2ONQA 1JWSD 4G11A 1KLUD 2V4LA 1L4ZB 1T5XD 3V6CB 3VR9B 2EELA 4WQOB 5H8YE 2DZKA 5BO4B 4XX5A 4L1BA 4WJQA 4O1NA 4OW0A 4NAWB 1WYWB 3N20C 4JGHB 1FNWA 4C00A 3AB5A 2OEDA 5AUIA 3EHVA 4YTNB 4ANXA 2MJEA 2WS3B 3P4PB 1JRUA 2KKCA 3VRBB 2J0MA 4II2B 2PW9A 4HK2A 3W2DA 4DBGA 2AQ3B 1SEBD 2N4FA 3TSSA 2M0AA 5LXHA 3NHEB 2NMQA 2SAKA 1VZ8A 5LXIB 2GRIA 2N7JA 2V1YA 1MFWA 2A4ZA 1YNTE 5HHDG 3DPDA 1VRAB 4JX1C 3TEZA 5FR3A 3KUCB 3GE3C 3L4PA 4S0RA 1LM8B 3DBLI 2KJRA 4ZHOA 3GZNI 2MJ3A 3ZTDA 2LMCA 2C5LC 3QWZB 4C80A 2N9LA 4ZOHC 1F0ZA 3ZDTA 1XO3A 3DWGC 1NVID 4FJZA 2L32A 2CS4A 3EUB2 3WALA 1WX8A 1WRDB 4TUUA 1LXDA 4IDIA 3U30A 1HXYD 1CJEA 3E9SA 3X0WA 1WMHB 3IXSA 3FC4A 4B9KA 1WYGA 1JRPA 2NBWB 2KXJA 1VDVA 1YD8U 4KIKA 4US9A 1UWXA 3QK0A 3BIID 2MJDA 2VZKD 2KTFA 3C8YA 1AN8A 1XQQA 2KWUB 4GB9A 1C1YB 1DYQA 1UBIA 1FNUA 4N58A 4YL8A 4ACFA 2RDGA 3KYCD 3VQIA 1C78A 3RMKC 3IFWB 2K6QA 3Q8FA 4CHKA 2WDQB 4JIOU 4C56C 3MFGA 2L0TA 3NS8A 1TIFA 3QA8A 2MP2A 1UD7A 3RT3B 2LUMA 4KSLC 1YN3A 4HXDA 3RNFC 4BKSD 2HDEA 2L7RA 4P16A 1J7AA 2R61A 4L23A 2KWVB 2WXHA 2MX2A 3A9KA 1HQRD 1L7YA 1WXVA 2BVCA 3MHZA 4FJVB 1FXIA 2G3QB 2KQ7A 1FEHA 3SR6A 1KLVA 3RYTA 1V8CA 4WWOA 4NJ6A 2YEPF 4W9LA 1J8CA 3GZNB 4HWIB 2IO1B 3OJ3A 1UF0A 3MTNB 4WJNA 5D2MB 1YJJA 3KQ4A 3B9JA 5GXGB 2KNBA 2K9XA 2RPQA 4KX6B 2JY6A 3ZO5B 4US8A 1SIFA 1UH6A 3VUWA 2KACA 3PZ8A 2H88B 1XD3B 3GP7A 2CHWA 1V5TA 1WGRA 3Q3NC 4HRSA 4ITKA 3EFUA 4WWNA 2J4XA 3UF8A 4K81A 4HDQA 5CHFA 2REXA 2YEPB 3LYYA 5IOIA 3QX1A 1I4HA 1RM6C 4OVZA 4ANUA 1RAXA 3B2GA 1N61A 3OG5A 5BYQA 1C3TA 2KN4A 2M56B 2XEWA 1F2RC 1EF5A 1P7FA 4ZYSA 2LD9A 1B1ZA 3ENEA 2EKIA 2LVOA 4MJSB 1K50A 2J42A 1R4NB 4TMAB 1Z2MA 2JU6X 2JXXA 3N1XC 4FBJB 3ZNGC 2D3GA 4KDIC 2MBBB 5E6NA 3A9KB 5C23A 5DPSA 4YSZB 2J7QB 4CQNA 4RGOS 1N5XA 1IBXA 3PGEA 4K3CA 1BUIC 1L0VB 2CR5A 1E10A 2PTLA 1F9JA 3DVNV 3KVFB 3PZ7A 1P1AA 3Q69A 4KSKC 3MC0B 5FR6A 2KAJA 1TKGA 3A33B 4LNOA 1PGAA 1Y8RC 3KLSX 4M8NA 4E74A 1E7VA 2FUG1 1XCTL 3IT4B 3U52E 4BAXA 3DQVA 1K52A 3MC9A 1DOXA 1FMAD 3DHHC 1YJ1A 3N1YC 4PS7A 4OZAA 1PGBA 4W9DA 3VUXA 3P63A 5IAAC 4XE0A 4LK0M 4EE2A 1ZKHA 4DHZB 3U8ZA 3W5UB 1WGHA 2MH7A 3ZJVA 1HA5A 2LUEA 3TJPA 2C7NB 2MBHA 1EWYC 2K5PA 4RCOA 5AZHA 1GB4A 2FNJB 3ZQ4A 1N60A 3PS6A 4PYUA 3T8MA 2FBWB 4PK1A 3CIRB 4GN1A 4I6PA 1GC6A 4WAAA 2X38A 3ZYYX 4YXDB 2ZZPB 1IBXB 1FXTB 5BMHA 1SF0A 3W1YA 1L0YB 3M62B 4IM3A 1E8XA 3ZXRA 1ROEA 2DZJA 4MH0E 3T9LA 1M94A 1WJUA 4JQWC 4A55A 3AV8A 4Q2JA 3AEBB 3DVNU 3O13A 2INPE 1Z5SB 2BBCA 2QSDA 4ZRJA 1FXAA 2HTME 4AJYB 1F77A 2CU3A 4BZAA 1E0ZA 3ECIA 4KDLB 3NS1A 3GS2A 5T8IA 5EDSA 2WX1A 2AX5A 2K1FA 3R2TA 1PFDA 1OFFA 4BKGA 1TYGB 1UBQA 4HDOA 2RD0A 2JSVX 2N9KA 3M95A 2VZKB 1EF1A 3V6EB 2Z0DB 1UUPA 1Y56A 2G9HD 2IYDB 4LJOB 5LLIA 3RNEC 2NBUA 3EC8A 4XGAB 2D3AA 2GBKA 2GLSA 2DYBA 1NYRA 4IW0A 1ZUD2 1MG4A 4DDGD 2G4SA 4GIVA 4DXGA 1SE4A 2ACZB 5LNK1 2K22A 4M0WA 4IOIE 3R66C 5I4DA 2JF5A 3Q3MC 4RM9A 3QAQA 2I38A 4GDKA 1SBBB 3NVZA 1E9MA 2DYMA 1V97A 2H89B 1WGGA 4K7SA 1PUTA 1D6EC 2JUOA 1H4RA 4HEA1 4XZ4A 3HVDA 4WH4A 1V49A 4EFOA 4HJGE 1B9RA 2IDYA 3B1LX 4NZLB 1WXMA 1YQ4B 4AUQC 2VH1A 2ASQA 3KW5B 4RMAA 2MLBA 3JYUA 3TEYA 1OEYA 2IY1B 2GBNA 4NAWA 2MBEA 1DGJA 2NTSA 4W9IA 2R2OA 3I5JC 2VH2A 3AE9B 1C79A 1L5PA 3UGBB 1FCCC 2JWZA 5JZEB 1AARA 1RFAA 4HPPA 4A9AA 1PGXA 3R8BA 4DHJD 4BBNC 1UNSA 2V4IB 2KJHB 4RFBA 3NRZA 4ZRIA 3U4EG 1J7CA 3ZNHB 2O2VA 2JPHA 3V05A 3X23A 3SD5A 2N9PC 4GXBA 3SFDB 1P3QU 3PHXB 4MGKE 1VCBA 5TR5A 2KANA 2MWSB 1AW7A 3AULA 4P1BC 2W54A 2KTRA 1LGRA 4A3OA 4E3CA 2LGIA 3C19A 1OGWA 2FCSA 4DXAB 1SE3A 1RRBA 1A5RA 5JHBA 2LXCA 2M4NA 5E6OA 4HJKA 2L05A 4PS3A 1E90A 1P98A 1EU4A 4AJWA 3NY5A 1XCQL 2HTHA 3IVFA 1JQ4A 1MPEA 2MBQA 3LXFA 1FRDA 1K8RB 3EGRA 3GOEA 1JWAD 4LDTD 1N5WA 1ZE3D 5CHWA 1WMHA 2WQYB 3FKYA 4IKGA 4HCNB 1OEYJ 3MJ5A 2BYVE 4MGZE 2PIAA 3I9V1 2YLMA 2K8HA 2WWZA 3AEGB 1Q5WB 3FILB 2KDBA 3QARA 3AMZA 2KK8A 4XC2A 2JVCA 4K1RB 2BKRB 3L10B 2J52A 2XBBC 3KH0A 5C2TB 1QKZA 4P7IA 2INDC 4GDLB 4XWWA 2PE9A 3L17A 5KHOA 1H8CA 3VDZA 3OLMD 2J0JA 1AWDA 2KC2A 3SFEB 3DHGC 1IGCA 1JWMD 2J53A 3NG0A 2K0PA 1WXSA 2O6VD 4IG7B 2O2VB 4KZ0A
chains in the Genus database with same CATH topology
3ZNZB 4EZKA 3ZRFA 2L8JA 4BOZB 1YQBA 4EOYA 2KNBA 2KFJA 1SE9A 2RPQA 2KDEB 4HPLB 3B0AA 3L08A 3R3MA 4EKUA 3KYDD 2JY6A 5G2NA 3ZO5B 3IHPC 4A3PA 2KTRB 3K9OB 1SIFA 1UH6A 3VUWA 2MRPA 1WM3A 3R7QA 3JSVB 1XT9B 1XD3B 3Q3FA 2CHWA 1WXAA 2WDTB 1V5TA 1WGRA 1RLFA 2HD5B 3RZWC 5AEKB 2BGFA 4GDLA 3EFUA 4FHKA 1V5OA 3VTVA 4WWNA 4BBNF 3R7RA 1J0GA 3AU5A 4K81A 4LCDE 4PYZA 3UF8A 4HDQA 5JH5C 5CHFA 2REXA 4IWPA 3RD2A 1LQBA 3QX1A 2KN5A 4ICVA 5CHVC 2VRRB 4ANUA 4HLEA 1NBFC 1RAXA 3QJZA 2LJ5A 4ANVA 2BYEA 1V6EA 3DDCB 1C3TA 3AXCA 2XEWA 4NNJB 2DYOA 2ZNVC 3PVLA 2M17A 4HVBA 2JZZA 1EF5A 2GBMA 2L3ZA 2LD9A 2WYQA 3ENEA 4TQ1A 4GGQA 2LVOA 1GC7A 1UGMA 1WI0A 4MJSB 3ML9A 3RULA 3WA0A 2HE7A 1Z2MA 2K8BA 3A4RA 3CSFA 2JXXA 3MJWA 2ZPYA 4MEMA 3VTWA 4FBJB 3ZNGC 3ZVVA 1WX7A 2KQSA 2FAZA 3JSVA 4JL9A 2NPTA 3DVGX 2D3GA 4KDIC 2MBBB 5E6NA 3S2AA 4BFRA 3VHTC 2KFKB 1WF9A 3A9KB 4K7UA 5C23A 1X1MA 1TTNA 2CKHB 5DPSA 3H1UA 4MELA 2J7QB 4MSMB 3DVGY 1J19A 2KHWB 1OQYA 4BOSC 2LASA 3PGEA 3VTUA 2EMTA 3B08A 4BKTA 1IP9A 2CR5A 3DBHI 3SDLC 1F9JA 2N1WA 4KV2A 2KC1A 2KLGA 5C1ZA 3DVNV 3QHTA 4MGYE 2NCNA 3KVFB 1P1AA 4KSKC 4ANWA 2IO3B 5FR6A 4ZRKA 3Q3JA 1G6JA 3QC8B 3A33B 3ONSA 4IUMB 1U4AA 4W9JA 2MA9B 1Y8RC 2KX0A 4IM2A 4MJSA 4M8NA 1BT0A 2DENB 4E74A 1I35A 3PT2B 1E7VA 2BF8B 2LXAA 2V3SA 2QHOA 4W9CA 3I3TB 4W9KA 4OVVA 2KFKA 3U7DA 1V2YA 2N1VA 4J6IA 1NDDA 5DPWA 4TV3A 2DZMA 2R2QA 1E7UA 3DQVA 3RZFA 2DHZA 2J0KA 2JRIB 1L2NA 2PPHA 2JT4B 1YJ1A 4PS7A 4MGIE 1I42A 3W1SC 4G50A 1VD2A 4W9EA 4K7WA 4W9DA 2N9XA 3H7PA 1WGYA 3IBEA 4M8MA 4EZJA 3AI5A 3APCA 3VUXA 2L76A 5IAAC 4FADA 2D07B 3LDZE 3DCGA 4AWJA 2MW5A 1ZKHA 4I6NB 3PHWB 4DHZB 2LI5A 3U8ZA 3CMMB 2MCNB 2WX0A 1WGHA 3PSEB 4ASWC 4X57B 1WX9A 1WR1A 2AYOB 4MDKE 5D7GA 2LUEA 3VFKA 3VXWA 3TJPA 1E8WA 2C7NB 2MBHA 4JLCA 5DCNA 5D94A 4OVUA 4W9HA 1KOTA 2FIDA 5AZHA 2OOBB 4NJ7A 1WJNA 2G4DB 2KMAA 3HM3A 2NPTB 4CYEA 2FNJB 3QIJA 3L0WB 3PS6A 2JZ3B 3DBRI 4PYUA 3T8MA 3WAMA 3PZDA 2DX5B 2CHZA 4GN1A 4I6PA 4EUTA 3RCZA 1WM2A 4ZYNA 1GC6A 4B6WA 1WE7A 4WAAA 2KZRA 2ZZPB 2I1KA 2L0FA 4NQKE 1FXTB 4W9GA 2Y5BB 3V62A 2ZJDA 2BPSA 3BINA 3MHSD 3ZRCA 2MSED 3SHQA 3W1YA 1TBEA 3M62B 3RUIB 4IM3A 1V80A 3UQBA 1E8XA 3PRPB 2CHXA 2LGYA 2K39A 4BVUC 2DZJA 4MM3A 4MH0E 3T9LA 1M94A 1WJUA 3A9JB 2NBVB 3HM6X 4JQWC 3TMPB 4GOCA 5KHQA 5E6PA 2K8CA 2NVUI 2A5UA 3DVNU 4GSWA 5IA7A 3K9PB 2ZVOA 1Z5SB 2GMIC 4FHJA 1E5WA 2KO3A 3NOBA 1ISNA 2PEAA 2KDFB 4DHJB 4ZRJA 1WR6E 3PRZA 2DAFA 2IY0B 2RR9A 1T0YA 2DZIA 2PE6B 4G0NB 3W1SA 4MSQB 4AJYB 2GBRA 2B3AA 4AP4C 2ZEQA 4IWOA 2D10A 2C60A 3UINB 1EO6A 2BWFA 3N32A 3ECIA 4M0WB 1E8ZA 2FCQA 1TZ1A 4KDLB 4NY0A 3PREA 2KD0A 2CU1A 2KWCA 2ZCCA 3VAWA 4AOFA 3IG3A 5EDSA 2WX1A 2ZVNA 4EZLA 2K1FA 2D11A 2DAJA 2I1JA 2K6DB 3QCAA 4BKGA 2ZNVB 2M1MA 5J17A 3H7PB 1V9JA 1UBQA 4HDOA 2Z59B 1WJ4A 2RD0A 2LZ6A 3ZW3A 3QQ8B 4GDKB 1CMXB 2KOXA 1GUAB 4HCPB 3H7SA 1KJTA 1IPGA 2KJ6A 2LRWA 4G3XB 3TIXA 1S1QB 1YIWA 1ZGUB 1EF1A 1WE6A 2Z0DB 3M95A 4IM0A 3V6EB 4EEWA 4ZDVA 2AL3A 2N7DA 3A9JA 2IYDB 2IBIB 4LJOB 5LLIA 3UIOB 3VVWB 1Q1OA 2NBUA 3EC8A 2MBOA 1Q0WB 2NS5A 2ZPNA 1TGZB 2GBKA 3APDA 2D2QA 2KVRA 3DOWA 1PQSA 4PS8A 2DYBA 2LGXA 2ZCBA 4B95A 4IW0A 3AU4A 2BWES 3WAOA 3ZDMC 4WJPA 4FULA 1R4NI 2AEHA 3ZKJC 2AL6A 1WGDA 4DDGD 2G4SA 2LWPA 4GIVA 4KZCA 4G11A 4LDTB 2V4LA 2EMSA 4HPMB 1WJ6A 3V6CB 2LRUA 4ICUA 3PRMB 3HK0A 2L00B 3JW0X 4FA6A 2IO0B 1EUVB 4WQOB 3R66C 1WH3A 2DZKA 2JF5A 4A20A 1R4MI 4TQ0A 4RM9A 2RGFA 5BO4B 4XX5A 5J2RA 2MQJA 1IYFA 3QAQA 4GU2A 4WJQA 4GMVA 4GDKA 4NAWB 1WYWB 4F8CB 2Z0EB 1HE8A 1KM7A 4JGHB 4FN2A 3HHMA 2DYMA 3SU8X 2XK5B 4IWQA 3EHVA 1UZXB 1WGGA 4K7SA 4ANXA 3N3KB 2OJRA 2JUOA 1H4RA 2PJHA 3D32A 1JRUA 2KKCA 2LVQA 4XZ4A 2J0MA 4F7ZA 5CTRC 4II2B 1V49A 1P9DU 4DDID 4HK2A 4EFOA 3M3JA 4DBGA 2N4FA 1WFYA 5LXHA 3NHEB 4II3B 2BKFA 4RM8A 2N9EB 3B1LX 4WWPA 5HKHA 1S3SG 3KUZA 3APFA 1P0RA 3PPAA 1WXMA 2O6VB 4NPNA 4AUQC 5LXIB 2G45B 3L13A 2V1YA 1GJZA 3LJ3A 2ASQA 3KW5B 1SGHA 4RMAA 2MLBA 1V81A 2A4ZA 3JYUA 4WJOA 2LVPA 5AZGA 1OEYA 2IY1B 3NZUA 3PLVA 4KIKB 3DPDA 4BKSA 2GBNA 4CO7A 4NAWA 5J18A 2MBEA 1YX6B 4W9IA 4E71A 3VUYA 5CX3A 2R2OA 3KUCB 2JRHA 3CSTA 3A1QA 2XK5A 3PLUA 1LM8B 3DBLI 2GOWA 2KJRA 4LJPB 3UGBB 1WY8A 3GZNI 2JWZA 5D6JB 2LGDA 3ZTDA 5JZEB 1AARA 1RFAA 2KLCA 2W9NA 2C5LC 3QWZB 2AWTA 4F1SA 3V60A 3ZDTA 4NQLB 3ZNID 2K25A 3PTFC 4DHJD 4FJZA 4BBNC 2CS4A 2IO2B 4DWFA 3H6NA 2KJHB 3WALA 1WX8A 4ZRIA 1WRDB 3KUDB 1NI2A 4TUUA 2M0XA 1LXDA 3ZNHB 1ZW7A 3TCAA 3U30A 4URKA 2IZVB 2M8SA 2O2VA 2JPHA 3X0WA 1WMHB 3X23A 2O6VA 1GG3A 1MG8A 3SD5A 2RSUA 2N9PC 4DK5A 3O65B 4GXBA 2MP2B 4B9KA 1P3QU 3PV1A 3PHXB 3UIPB 2FCMA 4MGKE 1VCBA 2NBWB 4KVGB 2KXJA 2KANA 5TR5A 5DPRA 5L83A 2NR2A 2MWSB 1YD8U 4KIKA 1OTRB 3AULA 2KTRA 4A3OA 3QK0A 4E3CA 2FCNA 1OGWA 2FCSA 2KTFA 4DXAB 1A5RA 1RRBA 1XQQA 2KWUB 5JHBA 2LXCA 1UELA 5AZFA 2M4NA 4GB9A 2UYZB 5E6OA 4HJKA 2L05A 4PS3A 1C1YB 1E90A 3EECA 3VH3B 1P98A 1UBIA 2EKEC 4AJWA 1WIAA 4YL8A 3ZUNA 3KYCD 2N7EA 3M63B 3NY5A 3HIZA 2HTHA 3IVFA 3VQIA 1WZ0A 2MBQA 4W9FA 1K8RB 2FIFA 3GOEA 3IFWB 4LDTD 1QZEA 3WAPA 2K6QA 4N9F4 4CHKA 1D3ZA 4JIOU 5CHWA 1YX5B 3C0RB 4FJYA 1WMHA 2L0TA 5L95C 3NS8A 3NZSA 3ZTCA 4HCNB 3QA8A 3ZIMA 5GMVA 4IC7B 2MP2A 1OEYJ 3BY4B 2BYVE 1UD7A 4MGZE 3RT3B 3TL5A 2YVCA 2KX3A 4KSLC 3ML8A 4HXDA 3CF6E 2YLMA 2HJ8A 3L54A 3N30A 2K8HA 5DPTA 3ALBA 3L16A 2WWZA 1LFDA 4TKNA 4BKSD 3V61A 1Q5WB 2L7RA 2C7MB 3P2BA 2BYFA 2KDBA 3JVZX 1WZ3A 3QARA 2KDIA 2C7HA 2KK8A 4XC2A 2JVCA 2C9WB 4K1RB 2FUHB 2KWVB 2BKRB 2MX2A 3A9KA 3H9DA 3L10B 3A1QB 1L7YA 1WXVA 2XBBC 3KH0A 3WANA 4FJVB 4P7IA 4FLHA 3UQAA 2G3QB 2KQ7A 2UWQA 3DBSA 4GDLB 2PE9A 3L17A 4I6LB 5KHOA 1H8CA 1KLVA 3RYTA 2GBJA 3VDZA 3OLMD 3VH4B 1V86A 2J0JA 2KC2A 3ZLZA 3OAWA 2KMCA 4WWOA 1GNUA 4NJ6A 4W9LA 1J8CA 3WIMA 4HWIB 2IO1B 3A4SC 3OJ3A 1WXSA 2O6VD 5G55A 4IG7B 4DHZE 3MTNB 2O2VB 4KZ0A 4WJNA 5D2MB 3OJ4B 5JHAA 3TBLD 1E8YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNZ B;  4EZK A;  3ZRF A;  2L8J A;  4BOZ B;  1YQB A;  4EOY A;  2KNB A;  2KFJ A;  1SE9 A;  2RPQ A;  2KDE B;  4HPL B;  3B0A A;  3L08 A;  3R3M A;  4EKU A;  3KYD D;  2JY6 A;  5G2N A;  3ZO5 B;  3IHP C;  4A3P A;  2KTR B;  3K9O B;  1SIF A;  1UH6 A;  3VUW A;  2MRP A;  1WM3 A;  3R7Q A;  3JSV B;  1XT9 B;  1XD3 B;  3Q3F A;  2CHW A;  1WXA A;  2WDT B;  1V5T A;  1WGR A;  1RLF A;  2HD5 B;  3RZW C;  5AEK B;  2BGF A;  4GDL A;  3EFU A;  4FHK A;  1V5O A;  3VTV A;  4WWN A;  4BBN F;  3R7R A;  1J0G A;  3AU5 A;  4K81 A;  4LCD E;  4PYZ A;  3UF8 A;  4HDQ A;  5JH5 C;  5CHF A;  2REX A;  4IWP A;  3RD2 A;  1LQB A;  3QX1 A;  2KN5 A;  4ICV A;  5CHV C;  2VRR B;  4ANU A;  4HLE A;  1NBF C;  1RAX A;  3QJZ A;  2LJ5 A;  4ANV A;  2BYE A;  1V6E A;  3DDC B;  1C3T A;  3AXC A;  2XEW A;  4NNJ B;  2DYO A;  2ZNV C;  3PVL A;  2M17 A;  4HVB A;  2JZZ A;  1EF5 A;  2GBM A;  2L3Z A;  2LD9 A;  2WYQ A;  3ENE A;  4TQ1 A;  4GGQ A;  2LVO A;  1GC7 A;  1UGM A;  1WI0 A;  4MJS B;  3ML9 A;  3RUL A;  3WA0 A;  2HE7 A;  1Z2M A;  2K8B A;  3A4R A;  3CSF A;  2JXX A;  3MJW A;  2ZPY A;  4MEM A;  3VTW A;  4FBJ B;  3ZNG C;  3ZVV A;  1WX7 A;  2KQS A;  2FAZ A;  3JSV A;  4JL9 A;  2NPT A;  3DVG X;  2D3G A;  4KDI C;  2MBB B;  5E6N A;  3S2A A;  4BFR A;  3VHT C;  2KFK B;  1WF9 A;  3A9K B;  4K7U A;  5C23 A;  1X1M A;  1TTN A;  2CKH B;  5DPS A;  3H1U A;  4MEL A;  2J7Q B;  4MSM B;  3DVG Y;  1J19 A;  2KHW B;  1OQY A;  4BOS C;  2LAS A;  3PGE A;  3VTU A;  2EMT A;  3B08 A;  4BKT A;  1IP9 A;  2CR5 A;  3DBH I;  3SDL C;  1F9J A;  2N1W A;  4KV2 A;  2KC1 A;  2KLG A;  5C1Z A;  3DVN V;  3QHT A;  4MGY E;  2NCN A;  3KVF B;  1P1A A;  4KSK C;  4ANW A;  2IO3 B;  5FR6 A;  4ZRK A;  3Q3J A;  1G6J A;  3QC8 B;  3A33 B;  3ONS A;  4IUM B;  1U4A A;  4W9J A;  2MA9 B;  1Y8R C;  2KX0 A;  4IM2 A;  4MJS A;  4M8N A;  1BT0 A;  2DEN B;  4E74 A;  1I35 A;  3PT2 B;  1E7V A;  2BF8 B;  2LXA A;  2V3S A;  2QHO A;  4W9C A;  3I3T B;  4W9K A;  4OVV A;  2KFK A;  3U7D A;  1V2Y A;  2N1V A;  4J6I A;  1NDD A;  5DPW A;  4TV3 A;  2DZM A;  2R2Q A;  1E7U A;  3DQV A;  3RZF A;  2DHZ A;  2J0K A;  2JRI B;  1L2N A;  2PPH A;  2JT4 B;  1YJ1 A;  4PS7 A;  4MGI E;  1I42 A;  3W1S C;  4G50 A;  1VD2 A;  4W9E A;  4K7W A;  4W9D A;  2N9X A;  3H7P A;  1WGY A;  3IBE A;  4M8M A;  4EZJ A;  3AI5 A;  3APC A;  3VUX A;  2L76 A;  5IAA C;  4FAD A;  2D07 B;  3LDZ E;  3DCG A;  4AWJ A;  2MW5 A;  1ZKH A;  4I6N B;  3PHW B;  4DHZ B;  2LI5 A;  3U8Z A;  3CMM B;  2MCN B;  2WX0 A;  1WGH A;  3PSE B;  4ASW C;  4X57 B;  1WX9 A;  1WR1 A;  2AYO B;  4MDK E;  5D7G A;  2LUE A;  3VFK A;  3VXW A;  3TJP A;  1E8W A;  2C7N B;  2MBH A;  4JLC A;  5DCN A;  5D94 A;  4OVU A;  4W9H A;  1KOT A;  2FID A;  5AZH A;  2OOB B;  4NJ7 A;  1WJN A;  2G4D B;  2KMA A;  3HM3 A;  2NPT B;  4CYE A;  2FNJ B;  3QIJ A;  3L0W B;  3PS6 A;  2JZ3 B;  3DBR I;  4PYU A;  3T8M A;  3WAM A;  3PZD A;  2DX5 B;  2CHZ A;  4GN1 A;  4I6P A;  4EUT A;  3RCZ A;  1WM2 A;  4ZYN A;  1GC6 A;  4B6W A;  1WE7 A;  4WAA A;  2KZR A;  2ZZP B;  2I1K A;  2L0F A;  4NQK E;  1FXT B;  4W9G A;  2Y5B B;  3V62 A;  2ZJD A;  2BPS A;  3BIN A;  3MHS D;  3ZRC A;  2MSE D;  3SHQ A;  3W1Y A;  1TBE A;  3M62 B;  3RUI B;  4IM3 A;  1V80 A;  3UQB A;  1E8X A;  3PRP B;  2CHX A;  2LGY A;  2K39 A;  4BVU C;  2DZJ A;  4MM3 A;  4MH0 E;  3T9L A;  1M94 A;  1WJU A;  3A9J B;  2NBV B;  3HM6 X;  4JQW C;  3TMP B;  4GOC A;  5KHQ A;  5E6P A;  2K8C A;  2NVU I;  2A5U A;  3DVN U;  4GSW A;  5IA7 A;  3K9P B;  2ZVO A;  1Z5S B;  2GMI C;  4FHJ A;  1E5W A;  2KO3 A;  3NOB A;  1ISN A;  2PEA A;  2KDF B;  4DHJ B;  4ZRJ A;  1WR6 E;  3PRZ A;  2DAF A;  2IY0 B;  2RR9 A;  1T0Y A;  2DZI A;  2PE6 B;  4G0N B;  3W1S A;  4MSQ B;  4AJY B;  2GBR A;  2B3A A;  4AP4 C;  2ZEQ A;  4IWO A;  2D10 A;  2C60 A;  3UIN B;  1EO6 A;  2BWF A;  3N32 A;  3ECI A;  4M0W B;  1E8Z A;  2FCQ A;  1TZ1 A;  4KDL B;  4NY0 A;  3PRE A;  2KD0 A;  2CU1 A;  2KWC A;  2ZCC A;  3VAW A;  4AOF A;  3IG3 A;  5EDS A;  2WX1 A;  2ZVN A;  4EZL A;  2K1F A;  2D11 A;  2DAJ A;  2I1J A;  2K6D B;  3QCA A;  4BKG A;  2ZNV B;  2M1M A;  5J17 A;  3H7P B;  1V9J A;  1UBQ A;  4HDO A;  2Z59 B;  1WJ4 A;  2RD0 A;  2LZ6 A;  3ZW3 A;  3QQ8 B;  4GDK B;  1CMX B;  2KOX A;  1GUA B;  4HCP B;  3H7S A;  1KJT A;  1IPG A;  2KJ6 A;  2LRW A;  4G3X B;  3TIX A;  1S1Q B;  1YIW A;  1ZGU B;  1EF1 A;  1WE6 A;  2Z0D B;  3M95 A;  4IM0 A;  3V6E B;  4EEW A;  4ZDV A;  2AL3 A;  2N7D A;  3A9J A;  2IYD B;  2IBI B;  4LJO B;  5LLI A;  3UIO B;  3VVW B;  1Q1O A;  2NBU A;  3EC8 A;  2MBO A;  1Q0W B;  2NS5 A;  2ZPN A;  1TGZ B;  2GBK A;  3APD A;  2D2Q A;  2KVR A;  3DOW A;  1PQS A;  4PS8 A;  2DYB A;  2LGX A;  2ZCB A;  4B95 A;  4IW0 A;  3AU4 A;  2BWE S;  3WAO A;  3ZDM C;  4WJP A;  4FUL A;  1R4N I;  2AEH A;  3ZKJ C;  2AL6 A;  1WGD A;  4DDG D;  2G4S A;  2LWP A;  4GIV A;  4KZC A;  4G11 A;  4LDT B;  2V4L A;  2EMS A;  4HPM B;  1WJ6 A;  3V6C B;  2LRU A;  4ICU A;  3PRM B;  3HK0 A;  2L00 B;  3JW0 X;  4FA6 A;  2IO0 B;  1EUV B;  4WQO B;  3R66 C;  1WH3 A;  2DZK A;  2JF5 A;  4A20 A;  1R4M I;  4TQ0 A;  4RM9 A;  2RGF A;  5BO4 B;  4XX5 A;  5J2R A;  2MQJ A;  1IYF A;  3QAQ A;  4GU2 A;  4WJQ A;  4GMV A;  4GDK A;  4NAW B;  1WYW B;  4F8C B;  2Z0E B;  1HE8 A;  1KM7 A;  4JGH B;  4FN2 A;  3HHM A;  2DYM A;  3SU8 X;  2XK5 B;  4IWQ A;  3EHV A;  1UZX B;  1WGG A;  4K7S A;  4ANX A;  3N3K B;  2OJR A;  2JUO A;  1H4R A;  2PJH A;  3D32 A;  1JRU A;  2KKC A;  2LVQ A;  4XZ4 A;  2J0M A;  4F7Z A;  5CTR C;  4II2 B;  1V49 A;  1P9D U;  4DDI D;  4HK2 A;  4EFO A;  3M3J A;  4DBG A;  2N4F A;  1WFY A;  5LXH A;  3NHE B;  4II3 B;  2BKF A;  4RM8 A;  2N9E B;  3B1L X;  4WWP A;  5HKH A;  1S3S G;  3KUZ A;  3APF A;  1P0R A;  3PPA A;  1WXM A;  2O6V B;  4NPN A;  4AUQ C;  5LXI B;  2G45 B;  3L13 A;  2V1Y A;  1GJZ A;  3LJ3 A;  2ASQ A;  3KW5 B;  1SGH A;  4RMA A;  2MLB A;  1V81 A;  2A4Z A;  3JYU A;  4WJO A;  2LVP A;  5AZG A;  1OEY A;  2IY1 B;  3NZU A;  3PLV A;  4KIK B;  3DPD A;  4BKS A;  2GBN A;  4CO7 A;  4NAW A;  5J18 A;  2MBE A;  1YX6 B;  4W9I A;  4E71 A;  3VUY A;  5CX3 A;  2R2O A;  3KUC B;  2JRH A;  3CST A;  3A1Q A;  2XK5 A;  3PLU A;  1LM8 B;  3DBL I;  2GOW A;  2KJR A;  4LJP B;  3UGB B;  1WY8 A;  3GZN I;  2JWZ A;  5D6J B;  2LGD A;  3ZTD A;  5JZE B;  1AAR A;  1RFA A;  2KLC A;  2W9N A;  2C5L C;  3QWZ B;  2AWT A;  4F1S A;  3V60 A;  3ZDT A;  4NQL B;  3ZNI D;  2K25 A;  3PTF C;  4DHJ D;  4FJZ A;  4BBN C;  2CS4 A;  2IO2 B;  4DWF A;  3H6N A;  2KJH B;  3WAL A;  1WX8 A;  4ZRI A;  1WRD B;  3KUD B;  1NI2 A;  4TUU A;  2M0X A;  1LXD A;  3ZNH B;  1ZW7 A;  3TCA A;  3U30 A;  4URK A;  2IZV B;  2M8S A;  2O2V A;  2JPH A;  3X0W A;  1WMH B;  3X23 A;  2O6V A;  1GG3 A;  1MG8 A;  3SD5 A;  2RSU A;  2N9P C;  4DK5 A;  3O65 B;  4GXB A;  2MP2 B;  4B9K A;  1P3Q U;  3PV1 A;  3PHX B;  3UIP B;  2FCM A;  4MGK E;  1VCB A;  2NBW B;  4KVG B;  2KXJ A;  2KAN A;  5TR5 A;  5DPR A;  5L83 A;  2NR2 A;  2MWS B;  1YD8 U;  4KIK A;  1OTR B;  3AUL A;  2KTR A;  4A3O A;  3QK0 A;  4E3C A;  2FCN A;  1OGW A;  2FCS A;  2KTF A;  4DXA B;  1A5R A;  1RRB A;  1XQQ A;  2KWU B;  5JHB A;  2LXC A;  1UEL A;  5AZF A;  2M4N A;  4GB9 A;  2UYZ B;  5E6O A;  4HJK A;  2L05 A;  4PS3 A;  1C1Y B;  1E90 A;  3EEC A;  3VH3 B;  1P98 A;  1UBI A;  2EKE C;  4AJW A;  1WIA A;  4YL8 A;  3ZUN A;  3KYC D;  2N7E A;  3M63 B;  3NY5 A;  3HIZ A;  2HTH A;  3IVF A;  3VQI A;  1WZ0 A;  2MBQ A;  4W9F A;  1K8R B;  2FIF A;  3GOE A;  3IFW B;  4LDT D;  1QZE A;  3WAP A;  2K6Q A;  4N9F 4;  4CHK A;  1D3Z A;  4JIO U;  5CHW A;  1YX5 B;  3C0R B;  4FJY A;  1WMH A;  2L0T A;  5L95 C;  3NS8 A;  3NZS A;  3ZTC A;  4HCN B;  3QA8 A;  3ZIM A;  5GMV A;  4IC7 B;  2MP2 A;  1OEY J;  3BY4 B;  2BYV E;  1UD7 A;  4MGZ E;  3RT3 B;  3TL5 A;  2YVC A;  2KX3 A;  4KSL C;  3ML8 A;  4HXD A;  3CF6 E;  2YLM A;  2HJ8 A;  3L54 A;  3N30 A;  2K8H A;  5DPT A;  3ALB A;  3L16 A;  2WWZ A;  1LFD A;  4TKN A;  4BKS D;  3V61 A;  1Q5W B;  2L7R A;  2C7M B;  3P2B A;  2BYF A;  2KDB A;  3JVZ X;  1WZ3 A;  3QAR A;  2KDI A;  2C7H A;  2KK8 A;  4XC2 A;  2JVC A;  2C9W B;  4K1R B;  2FUH B;  2KWV B;  2BKR B;  2MX2 A;  3A9K A;  3H9D A;  3L10 B;  3A1Q B;  1L7Y A;  1WXV A;  2XBB C;  3KH0 A;  3WAN A;  4FJV B;  4P7I A;  4FLH A;  3UQA A;  2G3Q B;  2KQ7 A;  2UWQ A;  3DBS A;  4GDL B;  2PE9 A;  3L17 A;  4I6L B;  5KHO A;  1H8C A;  1KLV A;  3RYT A;  2GBJ A;  3VDZ A;  3OLM D;  3VH4 B;  1V86 A;  2J0J A;  2KC2 A;  3ZLZ A;  3OAW A;  2KMC A;  4WWO A;  1GNU A;  4NJ6 A;  4W9L A;  1J8C A;  3WIM A;  4HWI B;  2IO1 B;  3A4S C;  3OJ3 A;  1WXS A;  2O6V D;  5G55 A;  4IG7 B;  4DHZ E;  3MTN B;  2O2V B;  4KZ0 A;  4WJN A;  5D2M B;  3OJ4 B;  5JHA A;  3TBL D;  1E8Y A; 
#chains in the Genus database with same CATH topology
 4XDD A;  3TEX A;  3SEB A;  4BOZ B;  3BYY B;  4OHJ A;  4EOY A;  2KFJ A;  2JXT A;  3V3X A;  4HPL B;  3R3M A;  4RF0 A;  5E6J A;  2KTR B;  1L6V A;  2K3U A;  3R7Q A;  3JSV B;  1XT9 B;  3Q3F A;  1WXA A;  1ZXI A;  4WQM A;  2QEJ C;  2W3S A;  4BBN F;  3R7R A;  1TJE A;  1VJK A;  4IWP A;  4A90 A;  1LQB A;  1WSP A;  2ON8 A;  1NBF C;  3OWE B;  2LJ5 A;  4ANV A;  3DDC B;  2QIL A;  3AXC A;  2WXM A;  1KRH A;  2V3N A;  2DYO A;  5BMG A;  2M17 A;  3Q8B A;  2B76 B;  1SB3 C;  2GBM A;  5BYS A;  2WYQ A;  4TQ1 A;  3FAH A;  1WI0 A;  3TUO A;  3RUL A;  2UU7 A;  3CSF A;  1YMH E;  5HI1 A;  3Q6B A;  1J7B A;  2KQS A;  4JL9 A;  4YT0 B;  4A6Q A;  4K7U A;  1KH0 A;  1TTN A;  1HTO A;  3IT6 B;  1OQY A;  2IJ0 A;  3VTU A;  2EMT A;  3B08 A;  5IKC M;  2RMM A;  3DBH I;  4MGY E;  2NCN A;  1JAL A;  5IO9 A;  2WXO A;  5HFY A;  4ZRK A;  3Q3J A;  1C9F A;  3BYT B;  1U4A A;  4W9J A;  4MJS A;  3RN9 C;  2DEN B;  2BF8 B;  1I7H A;  2QHO A;  4W9K A;  4OVV A;  3AH7 A;  3AED B;  1STE A;  5DPW A;  4TV3 A;  2R2Q A;  3RZF A;  1QOG A;  3W1S C;  1VD2 A;  4WUR A;  3IBE A;  3AI5 A;  4FAD A;  3DBL B;  5FKA C;  4KGR A;  4AWJ A;  4LLG M;  4I6N B;  1K53 A;  3CMM B;  2WX0 A;  1WX9 A;  2AYO B;  3DWM A;  4MDK E;  5MPO A;  5D7G A;  1OQR A;  1ET9 A;  4LNN A;  4JLC A;  4OVU A;  2FID A;  2OOB B;  4NJ7 A;  2G4D B;  2KMA A;  3HM3 A;  3QIJ A;  3L0W B;  3N1Z C;  2JZ3 B;  3WAM A;  3KWL A;  1ZDV A;  3RCZ A;  1WM2 A;  3N9Y C;  3BK2 A;  2M19 A;  2WP9 B;  1WE7 A;  3NVV A;  2KZR A;  2G1E A;  2L0F A;  4W9G A;  3P1M A;  3V62 A;  2ZJD A;  4JE3 B;  2JYE A;  3SHQ A;  1TBE A;  3AEF B;  3RUI B;  1V80 A;  3AE7 B;  3HVZ A;  2V3P A;  2CHX A;  4WAF A;  1K51 A;  4BVU C;  4MM3 A;  1NYQ A;  1F1H A;  4R3D A;  2CJO A;  4GOC A;  1VR9 A;  2K8C A;  4GSW A;  1E6E B;  4ZHP A;  3K9P B;  1TY2 A;  2GMI C;  4FHJ A;  3NOB A;  2KDF B;  1ESF A;  4DHJ B;  1EWC A;  2RR9 A;  4G0N B;  3W1S A;  1QQR A;  2B3A A;  2XN9 C;  4IWO A;  2D10 A;  3TEW A;  1EO6 A;  2BWF A;  2BTE A;  1E8Z A;  1KF6 B;  3PRE A;  2V0G A;  3UI3 A;  2KD0 A;  2CU1 A;  2KWC A;  2ZCC A;  3IG3 A;  2QIE B;  4EZL A;  2I1J A;  2K6D B;  2M1M A;  5J17 A;  1WJ4 A;  2LZ6 A;  1CMX B;  2KOX A;  2KJ6 A;  4G3X B;  1S1Q B;  1YIW A;  2HJ1 A;  1VLB A;  3VVW B;  2MBO A;  4C7Y A;  1Q0W B;  2ZPN A;  1TGZ B;  2QCZ A;  3DOW A;  3APD A;  3B2F A;  2KVR A;  4WIP A;  1PQS A;  2ZCB A;  4B95 A;  3WAO A;  2W3R A;  3ZKJ C;  2AL6 A;  1WGD A;  4KZC A;  2LWP A;  4LDT B;  4HPM B;  1WJ6 A;  2LRU A;  4TSS A;  4FA6 A;  1DOY A;  1IGD A;  1WH3 A;  3HUI A;  1R4M I;  4YSY B;  4A20 A;  2RGF A;  2MQJ A;  1IYF A;  4F8C B;  1KM7 A;  2ICI A;  3ZJT A;  2XK5 B;  4JWS C;  2RPV A;  4MM3 B;  2Y5P A;  3N3K B;  2OJR A;  3E56 A;  2PJH A;  1ZP0 B;  4F7Z A;  5CTR C;  3Q2A C;  3M3J A;  2KWD A;  4HKZ E;  1WFY A;  4II3 B;  1AYF A;  2BKF A;  2N9E B;  4RM8 A;  4OZB A;  3AE4 B;  4LTU A;  1P0R A;  3EA6 A;  3PPA A;  4XDC A;  2O6V B;  2G45 B;  1GJZ A;  3LJ3 A;  3Q8A A;  3LB8 C;  1V81 A;  2LVP A;  1QIL A;  1OQQ A;  2PKO A;  3NZU A;  1FFV A;  1UGJ A;  1D5M C;  3PLV A;  4BKS A;  4E71 A;  3VUY A;  5CX3 A;  1I4Q A;  4LJP B;  1SE2 A;  2KLC A;  1CK1 A;  1L4D B;  2W9N A;  3V60 A;  1N63 A;  3ZNI D;  2K25 A;  1RYJ A;  3PTF C;  2LJI A;  2IO2 B;  3H6N A;  3KUD B;  2M0X A;  3RNB C;  1JML A;  2Q5W D;  1JW9 D;  1MG8 A;  2IGD A;  3O65 B;  4LNF A;  2FCM A;  4KVG B;  2DWQ A;  5DPR A;  5L83 A;  1OTR B;  1PDX A;  2FCN A;  4AS1 A;  2PLP A;  3NZ3 A;  4YWG G;  2OHF A;  3Q8C A;  1P7E A;  3EEC A;  1V1P B;  2DBY A;  2EKE C;  2N7E A;  3M63 B;  3HIZ A;  4JPS A;  3W5V B;  2WHI A;  1WZ0 A;  2FIF A;  2KVZ A;  3WAP A;  4N9F 4;  1YJI A;  4A8X C;  1D3Z A;  3C0R B;  4FJY A;  1A70 A;  2MHJ A;  3ZTC A;  3ZIM A;  4GLS C;  3TL5 A;  2KX3 A;  1GOZ A;  1CZP A;  3CF6 E;  2HJ8 A;  3N30 A;  3ALB A;  1LFD A;  3AE3 B;  1FD6 A;  1C4C A;  3V61 A;  3P2B A;  1T0S C;  2BYF A;  2LHE A;  3JVZ X;  1WZ3 A;  2C7H A;  1XEE A;  2C9W B;  4RH6 A;  2FUH B;  3Q8E A;  4RNA A;  3H9D A;  3VR8 B;  3NVW A;  3CWI A;  2NTT A;  3UQA A;  2V9H A;  2UWQ A;  3DBS A;  4I6L B;  1ZPS A;  2QJL A;  4C4V A;  2GBJ A;  3VH4 B;  1V86 A;  3ZLZ A;  3OAW A;  4RGT A;  3I57 A;  2DLB A;  2KMC A;  5FK9 C;  1R7S A;  4N6E B;  5G5H A;  5G55 A;  1WWT A;  3ZNZ B;  4REZ A;  3ZRF A;  3J9C A;  4K3B A;  1YQB A;  1TKY A;  4DXF A;  5H92 C;  2BB5 A;  2KDE B;  1ZDX A;  3B0A A;  3L08 A;  4EKU A;  3FIL A;  2WXN A;  3ZXV A;  2GI9 A;  3RPF C;  1LO5 D;  1FM0 D;  3AEE B;  1HTQ A;  4GDL A;  1V5O A;  2W82 A;  3VTV A;  3RFZ B;  2WU5 B;  5JH5 C;  4RGN A;  3RD2 A;  1ZXH A;  2KN5 A;  2WLB A;  1TY0 A;  2VRR B;  4HLE A;  1TT5 B;  1N6Z A;  1HEZ E;  2BYE A;  1V6E A;  2CJN A;  4NNJ B;  2ZNV C;  3PVL A;  4HVB A;  4NAM A;  2ZW1 A;  4LNI A;  5D3D A;  3ML9 A;  3WA0 A;  2HE7 A;  3A4R A;  3MJW A;  4MEM A;  3ZVV A;  3JSV A;  2FAZ A;  3DVG X;  4QAY A;  1FCL A;  4BFR A;  3VHT C;  2KFK B;  1WF9 A;  3IAS 1;  1JWB D;  5C3J B;  4M02 A;  3PO0 A;  3DVG Y;  3T3O A;  3AE8 B;  4C4V B;  1YOV B;  4FXC A;  4BKT A;  1FNV A;  3SDL C;  2IPK D;  4KV2 A;  2KC1 A;  2KLG A;  3QHT A;  3BVG A;  4ANW A;  2GB1 A;  5BMI A;  2WXI A;  3ABV B;  3ONS A;  4IUM B;  4C7Z A;  2OJW A;  3AEA B;  2WDR B;  2V3S A;  4JWU C;  3I3T B;  2PVG C;  3DHI C;  1V2Y A;  2N1V A;  1I4G A;  2SEB D;  1NDD A;  2DZM A;  2DHZ A;  2JRI B;  1L2N A;  1XF5 L;  1D5X C;  4MGI E;  1I42 A;  4G50 A;  4W9E A;  4M8M A;  3H7P A;  1NI3 A;  2L76 A;  2D07 B;  4KKI A;  1SJH D;  3DCG A;  1TS2 A;  4AQ7 A;  1MI0 A;  4KKJ A;  3PHW B;  2XNA C;  4X57 B;  1WR1 A;  4L2Y A;  5DCN A;  5D94 A;  4W9H A;  1XLO A;  1YQ3 B;  1WXQ A;  3DBR I;  3PZD A;  2DX5 B;  3NJT A;  4EUT A;  1TS3 A;  2KMM A;  1L6U A;  2TSS A;  2WXF A;  4HKQ A;  2Y5B B;  2BPS A;  3MHS D;  2WXP A;  3PRP B;  2LGY A;  3A9J B;  5KHQ A;  2WXL A;  3WCQ A;  1WGK A;  2PEA A;  1T6B X;  3PRZ A;  2DAF A;  2QDF A;  2DZI A;  2PE6 B;  4H2A A;  1C76 A;  4MSQ B;  4AP4 C;  1GB1 A;  3T3N A;  3N32 A;  2WXG A;  3VAW A;  1XLP A;  4D2K A;  4ARC A;  2D11 A;  2DAJ A;  2ZNV B;  3H7P B;  1V9J A;  3ZW3 A;  5C1Z A;  1GUA B;  1KJT A;  1IPG A;  2LRW A;  1ZGU B;  1I35 A;  4IM0 A;  1WE6 A;  2L1A A;  4ZDV A;  2KDM A;  3EFC A;  2AL3 A;  2IBI B;  4XWT A;  3UIO B;  1TS4 A;  1Q1O A;  3AEC B;  1FIQ A;  1KFY B;  2WXJ A;  5EE3 A;  3R2I A;  4LNK A;  2BWE S;  3ZDM C;  3BVZ A;  4WJP A;  1QF6 A;  4FUL A;  1R4N I;  2AEH A;  2DNF A;  2EMS A;  3P4R B;  4ICU A;  2JX5 A;  3AE5 B;  3HK0 A;  2L00 B;  3JW0 X;  3PRM B;  1Q10 A;  2IO0 B;  1EUV B;  1FPY A;  1E7P B;  4B0E A;  4TQ0 A;  4YTP B;  4GU2 A;  4GMV A;  1C4A A;  2Z0E B;  2IGH A;  3ETR A;  1HE8 A;  2BW2 A;  3DBR B;  4FN2 A;  3HHM A;  4DQO C;  3SU8 X;  4IWQ A;  1KLG D;  1DOI A;  1UZX B;  4ZRP A;  1SXT A;  2WU2 B;  2LEK A;  3D32 A;  2MEK A;  5IP4 D;  2LVQ A;  3P42 A;  3GE8 C;  1P9D U;  4DDI D;  1L0X B;  1ENF A;  4P6V F;  2WGS A;  4ARI A;  4WWP A;  5HKH A;  1S3S G;  3KUZ A;  3APF A;  4PT5 A;  4NPN A;  3L13 A;  1TS5 A;  1SGH A;  4RGM A;  4WJO A;  3GB1 A;  5AZG A;  1HZ6 A;  2BB6 A;  4KIK B;  4CO7 A;  5J18 A;  1YX6 B;  2JRH A;  3CST A;  4N59 A;  3PLU A;  3A1Q A;  1XLN A;  2XK5 A;  3RNC C;  2GOW A;  1WY8 A;  3Q14 C;  5D6J B;  2LGD A;  2WDV B;  2E6X A;  3AE6 B;  2AWT A;  4F1S A;  1N62 A;  4NQL B;  5D3I B;  1I4P A;  3DBH B;  3MC8 A;  1MVK A;  1T0R C;  1FO4 A;  4DWF A;  1JCK B;  3H8H A;  4OZC A;  2KQ4 X;  1NI2 A;  1ZW7 A;  3TCA A;  1FRR A;  4YTM B;  4URK A;  2IZV B;  2M8S A;  1FFU A;  1RWS A;  2O6V A;  1GG3 A;  2RSU A;  4J3O D;  4DK5 A;  2MP2 B;  3PV1 A;  3UIP B;  1QOB A;  1F52 A;  2RDB C;  2NR2 A;  1BXT A;  2N0S B;  4MAC A;  3I63 C;  2BYT A;  1MHH E;  1D4B A;  1UEL A;  5AZF A;  5EE0 A;  2UYZ B;  1HZ5 A;  4USA A;  3U2S C;  1XLQ A;  3VH3 B;  1WIA A;  3ZUN A;  3RNG C;  5TSS A;  4W9F A;  2QMT A;  1QZE A;  4XYC A;  1SSN A;  1YX5 B;  1C4P A;  5L95 C;  3NZS A;  1BML C;  3VRA B;  5GMV A;  4IC7 B;  3BY4 B;  2YVC A;  3ML8 A;  4RF1 A;  3L54 A;  2L52 A;  4TKN A;  3L16 A;  5DPT A;  3KWV A;  2C7M B;  3AE1 B;  4M00 A;  2LGS A;  2KDI A;  4MH8 A;  1F2R I;  2ZW0 A;  2QC8 A;  3A1Q B;  3WAN A;  1JWU D;  1WRI A;  4FLH A;  2IGG A;  1V1P A;  1JRO A;  4HRO A;  5HG2 A;  3NUH B;  1ZOY B;  2INN E;  1GNU A;  3WIM A;  2JYT A;  3A4S C;  3BVM A;  4DHZ E;  2JWU A;  3OJ4 B;  3URY A;  5JHA A;  3TBL D;  1E8Y A;  4EZK A;  5BYR A;  2BS4 B;  2L8J A;  3IAM 1;  1QLB B;  1SE9 A;  2FE8 A;  2WXR A;  3AN1 A;  3KYD D;  5G2N A;  4A3P A;  3IHP C;  4B0M A;  3K9O B;  1M4V A;  1WM3 A;  2MRP A;  5EE1 A;  2WDT B;  1TKE A;  1RLF A;  2HD5 B;  3RZW C;  5AEK B;  2BGF A;  1EM7 A;  1I4R A;  4FHK A;  4MT5 A;  1J0G A;  1CQV A;  2BQQ A;  3AU5 A;  4LCD E;  4PYZ A;  4P1C C;  4UDU C;  4ICV A;  5G5G A;  3ZGZ A;  4YSX B;  5CHV C;  3QJZ A;  2D5G A;  1I4X A;  1ET6 A;  5EE9 A;  1NEK B;  2JZZ A;  1MHX A;  2L3Z A;  1V1O A;  1C77 A;  2KYW A;  4GGQ A;  1GC7 A;  1UGM A;  2K8B A;  3VTW A;  2ZPY A;  4WWM A;  1PYW D;  1T0Q C;  1WX7 A;  2L83 A;  2NPT A;  2AQ1 B;  2Y5C A;  3S2A A;  2JZP A;  3BZD B;  1X1M A;  1NEN B;  2CKH B;  3H1U A;  1R4M B;  4MEL A;  4MSM B;  1J19 A;  2KHW B;  4BOS C;  2LAS A;  2LFI A;  2AQ2 B;  1ACC A;  1IP9 A;  2N1W A;  2X8X X;  1EU3 A;  4M01 A;  1XXG A;  2WXQ A;  2Z8L A;  2IO3 B;  1G6J A;  2D3C A;  3QC8 B;  1QOF A;  4KGS A;  3P4Q B;  2INC C;  3RNA C;  2MA9 B;  4IM2 A;  2KX0 A;  1BT0 A;  3PT2 B;  2LXA A;  4W9C A;  1UWM A;  2KFK A;  3U7D A;  2W55 A;  4J6I A;  1E7U A;  2PVO D;  2J0K A;  2PPH A;  2JT4 B;  2LHD A;  2D3B A;  1QT9 A;  2RDH A;  4K7W A;  2N9X A;  1WGY A;  4EZJ A;  3AE2 B;  3APC A;  2WNM A;  3LDZ E;  2MW5 A;  1SJE D;  3BWU D;  3RI7 C;  2LI5 A;  3HRD D;  2MCN B;  4ASW C;  3PSE B;  1VZ7 A;  4NJC A;  3VFK A;  1VZ6 A;  3VXW A;  1E8W A;  3P4S B;  2BS2 B;  2Y3A A;  2JQR B;  1KTK A;  1KOT A;  1RFK A;  4S17 A;  3U7Z A;  1WJN A;  2KT7 A;  2WXK A;  3NVY A;  2NPT B;  4CYE A;  1D5Z C;  5IN7 A;  2CHZ A;  4KGT A;  4ZYN A;  4B6W A;  1QOA A;  5JXV A;  2I1K A;  4NQK E;  1YN5 A;  3BIN A;  3ZRC A;  2MSE D;  3UQB A;  3Q3O C;  2K39 A;  2E3T A;  3HM6 X;  2NBV B;  3TMP B;  5E6P A;  1IUE A;  2NVU I;  2A5U A;  5IA7 A;  2ZVO A;  1E5W A;  2KO3 A;  1ISN A;  1GPX A;  1TZO A;  1YN4 A;  1WR6 E;  2IY0 B;  1T0Y A;  2GBR A;  2ZEQ A;  4ZRQ A;  2C60 A;  3UIN B;  4M0W B;  2FCQ A;  3AM9 A;  1TZ1 A;  2BT6 A;  4AOF A;  3ZJU A;  3BK1 A;  2ZVN A;  5AUK A;  3QCA A;  2Z59 B;  3W9C B;  1GAQ B;  1MJD A;  3QQ8 B;  4GDK B;  4NY0 A;  5J2R A;  4HCP B;  3H7S A;  3TIX A;  1SIJ A;  2I2Y A;  4EEW A;  2PMV A;  2N7D A;  3A9J A;  2BS3 B;  1T3Q A;  2NS5 A;  2D2Q A;  3MP9 A;  4PS8 A;  2LGX A;  3AU4 A;  2ONQ A;  1JWS D;  4G11 A;  1KLU D;  2V4L A;  1L4Z B;  1T5X D;  3V6C B;  3VR9 B;  2EEL A;  4WQO B;  5H8Y E;  2DZK A;  5BO4 B;  4XX5 A;  4L1B A;  4WJQ A;  4O1N A;  4OW0 A;  4NAW B;  1WYW B;  3N20 C;  4JGH B;  1FNW A;  4C00 A;  3AB5 A;  2OED A;  5AUI A;  3EHV A;  4YTN B;  4ANX A;  2MJE A;  2WS3 B;  3P4P B;  1JRU A;  2KKC A;  3VRB B;  2J0M A;  4II2 B;  2PW9 A;  4HK2 A;  3W2D A;  4DBG A;  2AQ3 B;  1SEB D;  2N4F A;  3TSS A;  2M0A A;  5LXH A;  3NHE B;  2NMQ A;  2SAK A;  1VZ8 A;  5LXI B;  2GRI A;  2N7J A;  2V1Y A;  1MFW A;  2A4Z A;  1YNT E;  5HHD G;  3DPD A;  1VRA B;  4JX1 C;  3TEZ A;  5FR3 A;  3KUC B;  3GE3 C;  3L4P A;  4S0R A;  1LM8 B;  3DBL I;  2KJR A;  4ZHO A;  3GZN I;  2MJ3 A;  3ZTD A;  2LMC A;  2C5L C;  3QWZ B;  4C80 A;  2N9L A;  4ZOH C;  1F0Z A;  3ZDT A;  1XO3 A;  3DWG C;  1NVI D;  4FJZ A;  2L32 A;  2CS4 A;  3EUB 2;  3WAL A;  1WX8 A;  1WRD B;  4TUU A;  1LXD A;  4IDI A;  3U30 A;  1HXY D;  1CJE A;  3E9S A;  3X0W A;  1WMH B;  3IXS A;  3FC4 A;  4B9K A;  1WYG A;  1JRP A;  2NBW B;  2KXJ A;  1VDV A;  1YD8 U;  4KIK A;  4US9 A;  1UWX A;  3QK0 A;  3BII D;  2MJD A;  2VZK D;  2KTF A;  3C8Y A;  1AN8 A;  1XQQ A;  2KWU B;  4GB9 A;  1C1Y B;  1DYQ A;  1UBI A;  1FNU A;  4N58 A;  4YL8 A;  4ACF A;  2RDG A;  3KYC D;  3VQI A;  1C78 A;  3RMK C;  3IFW B;  2K6Q A;  3Q8F A;  4CHK A;  2WDQ B;  4JIO U;  4C56 C;  3MFG A;  2L0T A;  3NS8 A;  1TIF A;  3QA8 A;  2MP2 A;  1UD7 A;  3RT3 B;  2LUM A;  4KSL C;  1YN3 A;  4HXD A;  3RNF C;  4BKS D;  2HDE A;  2L7R A;  4P16 A;  1J7A A;  2R61 A;  4L23 A;  2KWV B;  2WXH A;  2MX2 A;  3A9K A;  1HQR D;  1L7Y A;  1WXV A;  2BVC A;  3MHZ A;  4FJV B;  1FXI A;  2G3Q B;  2KQ7 A;  1FEH A;  3SR6 A;  1KLV A;  3RYT A;  1V8C A;  4WWO A;  4NJ6 A;  2YEP F;  4W9L A;  1J8C A;  3GZN B;  4HWI B;  2IO1 B;  3OJ3 A;  1UF0 A;  3MTN B;  4WJN A;  5D2M B;  1YJJ A;  3KQ4 A;  3B9J A;  5GXG B;  2KNB A;  2K9X A;  2RPQ A;  4KX6 B;  2JY6 A;  3ZO5 B;  4US8 A;  1SIF A;  1UH6 A;  3VUW A;  2KAC A;  3PZ8 A;  2H88 B;  1XD3 B;  3GP7 A;  2CHW A;  1V5T A;  1WGR A;  3Q3N C;  4HRS A;  4ITK A;  3EFU A;  4WWN A;  2J4X A;  3UF8 A;  4K81 A;  4HDQ A;  5CHF A;  2REX A;  2YEP B;  3LYY A;  5IOI A;  3QX1 A;  1I4H A;  1RM6 C;  4OVZ A;  4ANU A;  1RAX A;  3B2G A;  1N61 A;  3OG5 A;  5BYQ A;  1C3T A;  2KN4 A;  2M56 B;  2XEW A;  1F2R C;  1EF5 A;  1P7F A;  4ZYS A;  2LD9 A;  1B1Z A;  3ENE A;  2EKI A;  2LVO A;  4MJS B;  1K50 A;  2J42 A;  1R4N B;  4TMA B;  1Z2M A;  2JU6 X;  2JXX A;  3N1X C;  4FBJ B;  3ZNG C;  2D3G A;  4KDI C;  2MBB B;  5E6N A;  3A9K B;  5C23 A;  5DPS A;  4YSZ B;  2J7Q B;  4CQN A;  4RGO S;  1N5X A;  1IBX A;  3PGE A;  4K3C A;  1BUI C;  1L0V B;  2CR5 A;  1E10 A;  2PTL A;  1F9J A;  3DVN V;  3KVF B;  3PZ7 A;  1P1A A;  3Q69 A;  4KSK C;  3MC0 B;  5FR6 A;  2KAJ A;  1TKG A;  3A33 B;  4LNO A;  1PGA A;  1Y8R C;  3KLS X;  4M8N A;  4E74 A;  1E7V A;  2FUG 1;  1XCT L;  3IT4 B;  3U52 E;  4BAX A;  3DQV A;  1K52 A;  3MC9 A;  1DOX A;  1FMA D;  3DHH C;  1YJ1 A;  3N1Y C;  4PS7 A;  4OZA A;  1PGB A;  4W9D A;  3VUX A;  3P63 A;  5IAA C;  4XE0 A;  4LK0 M;  4EE2 A;  1ZKH A;  4DHZ B;  3U8Z A;  3W5U B;  1WGH A;  2MH7 A;  3ZJV A;  1HA5 A;  2LUE A;  3TJP A;  2C7N B;  2MBH A;  1EWY C;  2K5P A;  4RCO A;  5AZH A;  1GB4 A;  2FNJ B;  3ZQ4 A;  1N60 A;  3PS6 A;  4PYU A;  3T8M A;  2FBW B;  4PK1 A;  3CIR B;  4GN1 A;  4I6P A;  1GC6 A;  4WAA A;  2X38 A;  3ZYY X;  4YXD B;  2ZZP B;  1IBX B;  1FXT B;  5BMH A;  1SF0 A;  3W1Y A;  1L0Y B;  3M62 B;  4IM3 A;  1E8X A;  3ZXR A;  1ROE A;  2DZJ A;  4MH0 E;  3T9L A;  1M94 A;  1WJU A;  4JQW C;  4A55 A;  3AV8 A;  4Q2J A;  3AEB B;  3DVN U;  3O13 A;  2INP E;  1Z5S B;  2BBC A;  2QSD A;  4ZRJ A;  1FXA A;  2HTM E;  4AJY B;  1F77 A;  2CU3 A;  4BZA A;  1E0Z A;  3ECI A;  4KDL B;  3NS1 A;  3GS2 A;  5T8I A;  5EDS A;  2WX1 A;  2AX5 A;  2K1F A;  3R2T A;  1PFD A;  1OFF A;  4BKG A;  1TYG B;  1UBQ A;  4HDO A;  2RD0 A;  2JSV X;  2N9K A;  3M95 A;  2VZK B;  1EF1 A;  3V6E B;  2Z0D B;  1UUP A;  1Y56 A;  2G9H D;  2IYD B;  4LJO B;  5LLI A;  3RNE C;  2NBU A;  3EC8 A;  4XGA B;  2D3A A;  2GBK A;  2GLS A;  2DYB A;  1NYR A;  4IW0 A;  1ZUD 2;  1MG4 A;  4DDG D;  2G4S A;  4GIV A;  4DXG A;  1SE4 A;  2ACZ B;  5LNK 1;  2K22 A;  4M0W A;  4IOI E;  3R66 C;  5I4D A;  2JF5 A;  3Q3M C;  4RM9 A;  3QAQ A;  2I38 A;  4GDK A;  1SBB B;  3NVZ A;  1E9M A;  2DYM A;  1V97 A;  2H89 B;  1WGG A;  4K7S A;  1PUT A;  1D6E C;  2JUO A;  1H4R A;  4HEA 1;  4XZ4 A;  3HVD A;  4WH4 A;  1V49 A;  4EFO A;  4HJG E;  1B9R A;  2IDY A;  3B1L X;  4NZL B;  1WXM A;  1YQ4 B;  4AUQ C;  2VH1 A;  2ASQ A;  3KW5 B;  4RMA A;  2MLB A;  3JYU A;  3TEY A;  1OEY A;  2IY1 B;  2GBN A;  4NAW A;  2MBE A;  1DGJ A;  2NTS A;  4W9I A;  2R2O A;  3I5J C;  2VH2 A;  3AE9 B;  1C79 A;  1L5P A;  3UGB B;  1FCC C;  2JWZ A;  5JZE B;  1AAR A;  1RFA A;  4HPP A;  4A9A A;  1PGX A;  3R8B A;  4DHJ D;  4BBN C;  1UNS A;  2V4I B;  2KJH B;  4RFB A;  3NRZ A;  4ZRI A;  3U4E G;  1J7C A;  3ZNH B;  2O2V A;  2JPH A;  3V05 A;  3X23 A;  3SD5 A;  2N9P C;  4GXB A;  3SFD B;  1P3Q U;  3PHX B;  4MGK E;  1VCB A;  5TR5 A;  2KAN A;  2MWS B;  1AW7 A;  3AUL A;  4P1B C;  2W54 A;  2KTR A;  1LGR A;  4A3O A;  4E3C A;  2LGI A;  3C19 A;  1OGW A;  2FCS A;  4DXA B;  1SE3 A;  1RRB A;  1A5R A;  5JHB A;  2LXC A;  2M4N A;  5E6O A;  4HJK A;  2L05 A;  4PS3 A;  1E90 A;  1P98 A;  1EU4 A;  4AJW A;  3NY5 A;  1XCQ L;  2HTH A;  3IVF A;  1JQ4 A;  1MPE A;  2MBQ A;  3LXF A;  1FRD A;  1K8R B;  3EGR A;  3GOE A;  1JWA D;  4LDT D;  1N5W A;  1ZE3 D;  5CHW A;  1WMH A;  2WQY B;  3FKY A;  4IKG A;  4HCN B;  1OEY J;  3MJ5 A;  2BYV E;  4MGZ E;  2PIA A;  3I9V 1;  2YLM A;  2K8H A;  2WWZ A;  3AEG B;  1Q5W B;  3FIL B;  2KDB A;  3QAR A;  3AMZ A;  2KK8 A;  4XC2 A;  2JVC A;  4K1R B;  2BKR B;  3L10 B;  2J52 A;  2XBB C;  3KH0 A;  5C2T B;  1QKZ A;  4P7I A;  2IND C;  4GDL B;  4XWW A;  2PE9 A;  3L17 A;  5KHO A;  1H8C A;  3VDZ A;  3OLM D;  2J0J A;  1AWD A;  2KC2 A;  3SFE B;  3DHG C;  1IGC A;  1JWM D;  2J53 A;  3NG0 A;  2K0P A;  1WXS A;  2O6V D;  4IG7 B;  2O2V B;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 3ZNZ B;  4EZK A;  3ZRF A;  2L8J A;  4BOZ B;  1YQB A;  4EOY A;  2KNB A;  2KFJ A;  1SE9 A;  2RPQ A;  2KDE B;  4HPL B;  3B0A A;  3L08 A;  3R3M A;  4EKU A;  3KYD D;  2JY6 A;  5G2N A;  3ZO5 B;  3IHP C;  4A3P A;  2KTR B;  3K9O B;  1SIF A;  1UH6 A;  3VUW A;  2MRP A;  1WM3 A;  3R7Q A;  3JSV B;  1XT9 B;  1XD3 B;  3Q3F A;  2CHW A;  1WXA A;  2WDT B;  1V5T A;  1WGR A;  1RLF A;  2HD5 B;  3RZW C;  5AEK B;  2BGF A;  4GDL A;  3EFU A;  4FHK A;  1V5O A;  3VTV A;  4WWN A;  4BBN F;  3R7R A;  1J0G A;  3AU5 A;  4K81 A;  4LCD E;  4PYZ A;  3UF8 A;  4HDQ A;  5JH5 C;  5CHF A;  2REX A;  4IWP A;  3RD2 A;  1LQB A;  3QX1 A;  2KN5 A;  4ICV A;  5CHV C;  2VRR B;  4ANU A;  4HLE A;  1NBF C;  1RAX A;  3QJZ A;  2LJ5 A;  4ANV A;  2BYE A;  1V6E A;  3DDC B;  1C3T A;  3AXC A;  2XEW A;  4NNJ B;  2DYO A;  2ZNV C;  3PVL A;  2M17 A;  4HVB A;  2JZZ A;  1EF5 A;  2GBM A;  2L3Z A;  2LD9 A;  2WYQ A;  3ENE A;  4TQ1 A;  4GGQ A;  2LVO A;  1GC7 A;  1UGM A;  1WI0 A;  4MJS B;  3ML9 A;  3RUL A;  3WA0 A;  2HE7 A;  1Z2M A;  2K8B A;  3A4R A;  3CSF A;  2JXX A;  3MJW A;  2ZPY A;  4MEM A;  3VTW A;  4FBJ B;  3ZNG C;  3ZVV A;  1WX7 A;  2KQS A;  2FAZ A;  3JSV A;  4JL9 A;  2NPT A;  3DVG X;  2D3G A;  4KDI C;  2MBB B;  5E6N A;  3S2A A;  4BFR A;  3VHT C;  2KFK B;  1WF9 A;  3A9K B;  4K7U A;  5C23 A;  1X1M A;  1TTN A;  2CKH B;  5DPS A;  3H1U A;  4MEL A;  2J7Q B;  4MSM B;  3DVG Y;  1J19 A;  2KHW B;  1OQY A;  4BOS C;  2LAS A;  3PGE A;  3VTU A;  2EMT A;  3B08 A;  4BKT A;  1IP9 A;  2CR5 A;  3DBH I;  3SDL C;  1F9J A;  2N1W A;  4KV2 A;  2KC1 A;  2KLG A;  5C1Z A;  3DVN V;  3QHT A;  4MGY E;  2NCN A;  3KVF B;  1P1A A;  4KSK C;  4ANW A;  2IO3 B;  5FR6 A;  4ZRK A;  3Q3J A;  1G6J A;  3QC8 B;  3A33 B;  3ONS A;  4IUM B;  1U4A A;  4W9J A;  2MA9 B;  1Y8R C;  2KX0 A;  4IM2 A;  4MJS A;  4M8N A;  1BT0 A;  2DEN B;  4E74 A;  1I35 A;  3PT2 B;  1E7V A;  2BF8 B;  2LXA A;  2V3S A;  2QHO A;  4W9C A;  3I3T B;  4W9K A;  4OVV A;  2KFK A;  3U7D A;  1V2Y A;  2N1V A;  4J6I A;  1NDD A;  5DPW A;  4TV3 A;  2DZM A;  2R2Q A;  1E7U A;  3DQV A;  3RZF A;  2DHZ A;  2J0K A;  2JRI B;  1L2N A;  2PPH A;  2JT4 B;  1YJ1 A;  4PS7 A;  4MGI E;  1I42 A;  3W1S C;  4G50 A;  1VD2 A;  4W9E A;  4K7W A;  4W9D A;  2N9X A;  3H7P A;  1WGY A;  3IBE A;  4M8M A;  4EZJ A;  3AI5 A;  3APC A;  3VUX A;  2L76 A;  5IAA C;  4FAD A;  2D07 B;  3LDZ E;  3DCG A;  4AWJ A;  2MW5 A;  1ZKH A;  4I6N B;  3PHW B;  4DHZ B;  2LI5 A;  3U8Z A;  3CMM B;  2MCN B;  2WX0 A;  1WGH A;  3PSE B;  4ASW C;  4X57 B;  1WX9 A;  1WR1 A;  2AYO B;  4MDK E;  5D7G A;  2LUE A;  3VFK A;  3VXW A;  3TJP A;  1E8W A;  2C7N B;  2MBH A;  4JLC A;  5DCN A;  5D94 A;  4OVU A;  4W9H A;  1KOT A;  2FID A;  5AZH A;  2OOB B;  4NJ7 A;  1WJN A;  2G4D B;  2KMA A;  3HM3 A;  2NPT B;  4CYE A;  2FNJ B;  3QIJ A;  3L0W B;  3PS6 A;  2JZ3 B;  3DBR I;  4PYU A;  3T8M A;  3WAM A;  3PZD A;  2DX5 B;  2CHZ A;  4GN1 A;  4I6P A;  4EUT A;  3RCZ A;  1WM2 A;  4ZYN A;  1GC6 A;  4B6W A;  1WE7 A;  4WAA A;  2KZR A;  2ZZP B;  2I1K A;  2L0F A;  4NQK E;  1FXT B;  4W9G A;  2Y5B B;  3V62 A;  2ZJD A;  2BPS A;  3BIN A;  3MHS D;  3ZRC A;  2MSE D;  3SHQ A;  3W1Y A;  1TBE A;  3M62 B;  3RUI B;  4IM3 A;  1V80 A;  3UQB A;  1E8X A;  3PRP B;  2CHX A;  2LGY A;  2K39 A;  4BVU C;  2DZJ A;  4MM3 A;  4MH0 E;  3T9L A;  1M94 A;  1WJU A;  3A9J B;  2NBV B;  3HM6 X;  4JQW C;  3TMP B;  4GOC A;  5KHQ A;  5E6P A;  2K8C A;  2NVU I;  2A5U A;  3DVN U;  4GSW A;  5IA7 A;  3K9P B;  2ZVO A;  1Z5S B;  2GMI C;  4FHJ A;  1E5W A;  2KO3 A;  3NOB A;  1ISN A;  2PEA A;  2KDF B;  4DHJ B;  4ZRJ A;  1WR6 E;  3PRZ A;  2DAF A;  2IY0 B;  2RR9 A;  1T0Y A;  2DZI A;  2PE6 B;  4G0N B;  3W1S A;  4MSQ B;  4AJY B;  2GBR A;  2B3A A;  4AP4 C;  2ZEQ A;  4IWO A;  2D10 A;  2C60 A;  3UIN B;  1EO6 A;  2BWF A;  3N32 A;  3ECI A;  4M0W B;  1E8Z A;  2FCQ A;  1TZ1 A;  4KDL B;  4NY0 A;  3PRE A;  2KD0 A;  2CU1 A;  2KWC A;  2ZCC A;  3VAW A;  4AOF A;  3IG3 A;  5EDS A;  2WX1 A;  2ZVN A;  4EZL A;  2K1F A;  2D11 A;  2DAJ A;  2I1J A;  2K6D B;  3QCA A;  4BKG A;  2ZNV B;  2M1M A;  5J17 A;  3H7P B;  1V9J A;  1UBQ A;  4HDO A;  2Z59 B;  1WJ4 A;  2RD0 A;  2LZ6 A;  3ZW3 A;  3QQ8 B;  4GDK B;  1CMX B;  2KOX A;  1GUA B;  4HCP B;  3H7S A;  1KJT A;  1IPG A;  2KJ6 A;  2LRW A;  4G3X B;  3TIX A;  1S1Q B;  1YIW A;  1ZGU B;  1EF1 A;  1WE6 A;  2Z0D B;  3M95 A;  4IM0 A;  3V6E B;  4EEW A;  4ZDV A;  2AL3 A;  2N7D A;  3A9J A;  2IYD B;  2IBI B;  4LJO B;  5LLI A;  3UIO B;  3VVW B;  1Q1O A;  2NBU A;  3EC8 A;  2MBO A;  1Q0W B;  2NS5 A;  2ZPN A;  1TGZ B;  2GBK A;  3APD A;  2D2Q A;  2KVR A;  3DOW A;  1PQS A;  4PS8 A;  2DYB A;  2LGX A;  2ZCB A;  4B95 A;  4IW0 A;  3AU4 A;  2BWE S;  3WAO A;  3ZDM C;  4WJP A;  4FUL A;  1R4N I;  2AEH A;  3ZKJ C;  2AL6 A;  1WGD A;  4DDG D;  2G4S A;  2LWP A;  4GIV A;  4KZC A;  4G11 A;  4LDT B;  2V4L A;  2EMS A;  4HPM B;  1WJ6 A;  3V6C B;  2LRU A;  4ICU A;  3PRM B;  3HK0 A;  2L00 B;  3JW0 X;  4FA6 A;  2IO0 B;  1EUV B;  4WQO B;  3R66 C;  1WH3 A;  2DZK A;  2JF5 A;  4A20 A;  1R4M I;  4TQ0 A;  4RM9 A;  2RGF A;  5BO4 B;  4XX5 A;  5J2R A;  2MQJ A;  1IYF A;  3QAQ A;  4GU2 A;  4WJQ A;  4GMV A;  4GDK A;  4NAW B;  1WYW B;  4F8C B;  2Z0E B;  1HE8 A;  1KM7 A;  4JGH B;  4FN2 A;  3HHM A;  2DYM A;  3SU8 X;  2XK5 B;  4IWQ A;  3EHV A;  1UZX B;  1WGG A;  4K7S A;  4ANX A;  3N3K B;  2OJR A;  2JUO A;  1H4R A;  2PJH A;  3D32 A;  1JRU A;  2KKC A;  2LVQ A;  4XZ4 A;  2J0M A;  4F7Z A;  5CTR C;  4II2 B;  1V49 A;  1P9D U;  4DDI D;  4HK2 A;  4EFO A;  3M3J A;  4DBG A;  2N4F A;  1WFY A;  5LXH A;  3NHE B;  4II3 B;  2BKF A;  4RM8 A;  2N9E B;  3B1L X;  4WWP A;  5HKH A;  1S3S G;  3KUZ A;  3APF A;  1P0R A;  3PPA A;  1WXM A;  2O6V B;  4NPN A;  4AUQ C;  5LXI B;  2G45 B;  3L13 A;  2V1Y A;  1GJZ A;  3LJ3 A;  2ASQ A;  3KW5 B;  1SGH A;  4RMA A;  2MLB A;  1V81 A;  2A4Z A;  3JYU A;  4WJO A;  2LVP A;  5AZG A;  1OEY A;  2IY1 B;  3NZU A;  3PLV A;  4KIK B;  3DPD A;  4BKS A;  2GBN A;  4CO7 A;  4NAW A;  5J18 A;  2MBE A;  1YX6 B;  4W9I A;  4E71 A;  3VUY A;  5CX3 A;  2R2O A;  3KUC B;  2JRH A;  3CST A;  3A1Q A;  2XK5 A;  3PLU A;  1LM8 B;  3DBL I;  2GOW A;  2KJR A;  4LJP B;  3UGB B;  1WY8 A;  3GZN I;  2JWZ A;  5D6J B;  2LGD A;  3ZTD A;  5JZE B;  1AAR A;  1RFA A;  2KLC A;  2W9N A;  2C5L C;  3QWZ B;  2AWT A;  4F1S A;  3V60 A;  3ZDT A;  4NQL B;  3ZNI D;  2K25 A;  3PTF C;  4DHJ D;  4FJZ A;  4BBN C;  2CS4 A;  2IO2 B;  4DWF A;  3H6N A;  2KJH B;  3WAL A;  1WX8 A;  4ZRI A;  1WRD B;  3KUD B;  1NI2 A;  4TUU A;  2M0X A;  1LXD A;  3ZNH B;  1ZW7 A;  3TCA A;  3U30 A;  4URK A;  2IZV B;  2M8S A;  2O2V A;  2JPH A;  3X0W A;  1WMH B;  3X23 A;  2O6V A;  1GG3 A;  1MG8 A;  3SD5 A;  2RSU A;  2N9P C;  4DK5 A;  3O65 B;  4GXB A;  2MP2 B;  4B9K A;  1P3Q U;  3PV1 A;  3PHX B;  3UIP B;  2FCM A;  4MGK E;  1VCB A;  2NBW B;  4KVG B;  2KXJ A;  2KAN A;  5TR5 A;  5DPR A;  5L83 A;  2NR2 A;  2MWS B;  1YD8 U;  4KIK A;  1OTR B;  3AUL A;  2KTR A;  4A3O A;  3QK0 A;  4E3C A;  2FCN A;  1OGW A;  2FCS A;  2KTF A;  4DXA B;  1A5R A;  1RRB A;  1XQQ A;  2KWU B;  5JHB A;  2LXC A;  1UEL A;  5AZF A;  2M4N A;  4GB9 A;  2UYZ B;  5E6O A;  4HJK A;  2L05 A;  4PS3 A;  1C1Y B;  1E90 A;  3EEC A;  3VH3 B;  1P98 A;  1UBI A;  2EKE C;  4AJW A;  1WIA A;  4YL8 A;  3ZUN A;  3KYC D;  2N7E A;  3M63 B;  3NY5 A;  3HIZ A;  2HTH A;  3IVF A;  3VQI A;  1WZ0 A;  2MBQ A;  4W9F A;  1K8R B;  2FIF A;  3GOE A;  3IFW B;  4LDT D;  1QZE A;  3WAP A;  2K6Q A;  4N9F 4;  4CHK A;  1D3Z A;  4JIO U;  5CHW A;  1YX5 B;  3C0R B;  4FJY A;  1WMH A;  2L0T A;  5L95 C;  3NS8 A;  3NZS A;  3ZTC A;  4HCN B;  3QA8 A;  3ZIM A;  5GMV A;  4IC7 B;  2MP2 A;  1OEY J;  3BY4 B;  2BYV E;  1UD7 A;  4MGZ E;  3RT3 B;  3TL5 A;  2YVC A;  2KX3 A;  4KSL C;  3ML8 A;  4HXD A;  3CF6 E;  2YLM A;  2HJ8 A;  3L54 A;  3N30 A;  2K8H A;  5DPT A;  3ALB A;  3L16 A;  2WWZ A;  1LFD A;  4TKN A;  4BKS D;  3V61 A;  1Q5W B;  2L7R A;  2C7M B;  3P2B A;  2BYF A;  2KDB A;  3JVZ X;  1WZ3 A;  3QAR A;  2KDI A;  2C7H A;  2KK8 A;  4XC2 A;  2JVC A;  2C9W B;  4K1R B;  2FUH B;  2KWV B;  2BKR B;  2MX2 A;  3A9K A;  3H9D A;  3L10 B;  3A1Q B;  1L7Y A;  1WXV A;  2XBB C;  3KH0 A;  3WAN A;  4FJV B;  4P7I A;  4FLH A;  3UQA A;  2G3Q B;  2KQ7 A;  2UWQ A;  3DBS A;  4GDL B;  2PE9 A;  3L17 A;  4I6L B;  5KHO A;  1H8C A;  1KLV A;  3RYT A;  2GBJ A;  3VDZ A;  3OLM D;  3VH4 B;  1V86 A;  2J0J A;  2KC2 A;  3ZLZ A;  3OAW A;  2KMC A;  4WWO A;  1GNU A;  4NJ6 A;  4W9L A;  1J8C A;  3WIM A;  4HWI B;  2IO1 B;  3A4S C;  3OJ3 A;  1WXS A;  2O6V D;  5G55 A;  4IG7 B;  4DHZ E;  3MTN B;  2O2V B;  4KZ0 A;  4WJN A;  5D2M B;  3OJ4 B;  5JHA A;  3TBL D;  1E8Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...