2KTRB

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MSLTVEAYLLGKEEAAREIRRFSFSFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFAIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sequestosome-1
publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrB00
2LVOA 1XT9B 3ECIA 5CTRC 1WR6E 3DCGA 1SIFA 1ZGUB 1V2YA 2DZKA 2KKCA 2MX2A 2JY6A 1SGHA 2DYBA 1G6JA 4IM0A 4A3OA 3VTUA 2GMIC 2KTFA 3HK0A 4W9IA 5AZFA 5C1ZA 2N1WA 4F7ZA 4AWJA 1AARA 2EKEC 2MW5A 3VTWA 3UIPB 4FBJB 4MSQB 3NOBA 1E7VA 3ALBA 1C1YB 2JZ3B 2N1VA 2KQ7A 3MTNB 1WMHB 4WWPA 4ZRIA 1V5OA 1IYFA 4KSLC 1P1AA 2EMTA 2NBUA 2K1FA 2ZEQA 2XK5A 2IO2B 3APFA 3Q3FA 4TV3A 2JWZA 2BWFA 3M95A 2EMSA 4NAWB 4ANVA 1WRDB 4IM3A 4EFOA 3WA0A 1T0YA 4F1SA 4LDTD 1R4NI 4ANUA 1GJZA 4KIKB 3PRPB 1EUVB 1YJ1A 4DBGA 1H4RA 2GOWA 3H9DA 3JW0X 4JLCA 2O6VD 3H7PB 3WAMA 4F8CB 2GBNA 1WGGA 4LDTB 3ENEA 2KJ6A 3TIXA 1WZ0A 2AL3A 2MBEA 2QHOA 4TUUA 1Q1OA 2UWQA 2ZPNA 1EF1A 3S2AA 4FHJA 3SD5A 3W1YA 1UD7A 3QC8B 1GC6A 1R4MI 2O6VB 4J6IA 4DK5A 2HD5B 2K8HA 2L76A 5DPTA 3UINB 1OEYJ 3DBHI 3ZNGC 2MWSB 2ZVNA 4IG7B 2V3SA 3ML9A 4IWOA 1S3SG 4G50A 1OTRB 3ZO5B 4IC7B 4BBNC 2GBKA 4XC2A 1SE9A 5LXHA 2WDTB 2IO1B 1LFDA 3H7PA 1J0GA 4K7SA 4HDOA 2L7RA 2KMAA 2L00B 4ASWC 1WZ3A 3CSFA 2KZRA 3WAOA 3QQ8B 3HIZA 3GOEA 1OEYA 4CO7A 5L83A 3VHTC 3O65B 2WX1A 2O2VA 1M94A 4ZRKA 3TJPA 3LDZE 4FJYA 1LQBA 2L0TA 2D3GA 4HPLB 1OQYA 1UH6A 1WE7A 4IWQA 2KTRB 2MCNB 5G55A 4FN2A 3VVWB 2RD0A 2FCSA 2KDEB 2WYQA 2XBBC 2ZCCA 4GDLB 2LJ5A 1IPGA 3UQAA 2KJRA 3PPAA 3SDLC 2JT4B 4FA6A 1E90A 2OOBB 3N30A 4MH0E 1WXSA 4W9CA 5DPRA 5DPWA 1MG8A 1E8YA 2AWTA 4GN1A 3PVLA 1WJNA 4MJSB 5DPSA 2G3QB 2DYOA 3AI5A 3DVNU 2YLMA 2Z0DB 2A4ZA 3PTFC 3QHTA 3VQIA 3HM6X 3ZRFA 1JRUA 3KUZA 2OJRA 3PV1A 1E5WA 1VD2A 2KD0A 3L10B 4GDLA 2NVUI 2KLCA 4E3CA 4EEWA 1WXAA 4HLEA 2KDBA 3PRZA 4HVBA 5HKHA 2LGYA 3M63B 2LRWA 2K6QA 3AXCA 3ZNZB 2DAFA 4ANXA 2AYOB 5JH5C 2KC1A 4W9FA 3U7DA 2K39A 3B0AA 3DVGY 2J0JA 3PHXB 4X57B 2C9WB 3KYCD 3NZSA 2MRPA 2NBVB 1X1MA 1V6EA 2FIFA 1TBEA 3KUDB 2LXCA 1IP9A 3EHVA 3VH4B 2AEHA 2JVCA 3I3TB 3MJWA 5JHBA 3KVFB 4I6NB 3TBLD 4MGZE 2IBIB 5J17A 2MA9B 4II3B 4DHJB 2KDFB 4W9DA 2G45B 2LXAA 5D94A 3U8ZA 2D2QA 2XK5B 2DZIA 4GOCA 1Z2MA 2KC2A 3PS6A 3QA8A 2NS5A 4BVUC 3ZUNA 3CF6E 3V61A 3L16A 5FR6A 3H7SA 2YVCA 2GBRA 3T8MA 3X23A 2LWPA 2KANA 2ZCBA 3OAWA 4RM8A 3NY5A 1TGZB 4GDKB 2MBOA 4ICVA 4M0WB 1NBFC 1D3ZA 5E6NA 3DOWA 3IVFA 1XD3B 4NY0A 1C3TA 2Z0EB 1P0RA 2Y5BB 4M8NA 3AU5A 4WJPA 5JHAA 4DHZE 4MGIE 2FCQA 2Z59B 3DQVA 4II2B 4NQKE 4ZDVA 4CYEA 3QJZA 2RPQA 1TTNA 3A9KA 2GBMA 4AOFA 4KVGB 1H8CA 2PPHA 4G3XB 1Z5SB 2BYVE 4JIOU 2N9PC 4W9JA 3KH0A 1FXTB 5EDSA 2MSED 3PSEB 3DDCB 3L08A 1V81A 2VRRB 1WIAA 4JL9A 4K81A 5LLIA 3VUWA 4EZKA 3PHWB 5LXIB 2FNJB 3JSVA 1L2NA 2WX0A 4GDKA 3ZIMA 4KZCA 3TCAA 4HPMB 3W1SA 3HHMA 2KFKB 1L7YA 3RUIB 3A4RA 1NDDA 1YD8U 5L95C 3V6CB 3A33B 1UELA 3ZNID 3L13A 3R7QA 5D2MB 1LXDA 1WFYA 3MHSD 1P3QU 4IW0A 3VH3B 3W1SC 3OLMD 2O2VB 3ML8A 3H6NA 3QIJA 2KJHB 3AU4A 2A5UA 3RT3B 4N9F4 3NZUA 1ZKHA 2BYEA 1CMXB 1XQQA 3PLUA 3ZVVA 2ZVOA 4MM3A 4K7WA 4MDKE 2IY0B 2L8JA 4JGHB 4MELA 1KJTA 3PZDA 2KFKA 4MEMA 4W9KA 1WM2A 1RAXA 1E8XA 1LM8B 2BF8B 3B08A 2NCNA 2D07B 4XX5A 5AZHA 1E8ZA 2C7HA 2G4DB 3PREA 3R3MA 1S1QB 4AUQC 2PE6B 1Q5WB 5D7GA 4TQ1A 5DCNA 2KN5A 5CHWA 2B3AA 3V6EB 4BFRA 1Y8RC 2KHWB 2LVPA 3L54A 4KV2A 2MLBA 4TQ0A 3RCZA 4BKSA 3ZTCA 3IBEA 1P98A 3IG3A 4K1RB 3A9JB 1WXVA 2AL6A 4IWPA 2JPHA 2M8SA 2NPTA 2DZMA 2JXXA 3WAPA 4DHZB 2L05A 2LVQA 5TR5A 4FULA 3QAQA 1Q0WB 3WANA 4EUTA 2J0MA 1YQBA 2N7EA 3QCAA 5E6PA 4KDLB 4DDID 1WY8A 2CU1A 2KOXA 2JZZA 5D6JB 4LJOB 3RZFA 2N9XA 4GU2A 1WGYA 2DHZA 3CSTA 3ZRCA 2KXJA 2UYZB 4OVUA 4AJYB 3ZW3A 4ANWA 4IM2A 4HCPB 3N3KB 2D10A 3RULA 2KWVB 4DDGD 1ISNA 4EZJA 4I6PA 2XEWA 3NHEB 2GBJA 3A9JA 3HM3A 5JZEB 3H1UA 3T9LA 1I35A 4PYUA 5BO4B 2KX3A 4KSKC 4W9GA 1WXMA 2DX5B 2KNBA 4W9LA 2R2QA 4TKNA 1A5RA 2IO0B 4WWOA 3VXWA 4DHJD 2M4NA 2ZNVB 2MP2B 4WAAA 1WR1A 3AULA 1WJ6A 2LUEA 2BPSA 3V60A 3A4SC 5IA7A 3QK0A 2CKHB 1KLVA 4RM9A 2IO3B 2C7NB 4NJ6A 2MBQA 1QZEA 3KUCB 4EOYA 1RFAA 2LI5A 3L17A 3VDZA 3ZLZA 4BOZB 3A9KB 2FCMA 3U30A 3LJ3A 3KW5B 3ZTDA 1KM7A 2MP2A 2NBWB 3APDA 2MQJA 4GGQA 4B95A 4MGYE 3K9PB 3VTVA 2KDIA 2BGFA 2JRHA 1UGMA 1YX5B 1WX8A 2HE7A 3JSVB 1HE8A 5GMVA 1V80A 5CX3A 3VAWA 1KOTA 4NJ7A 5IAAC 4CHKA 4EKUA 2ZJDA 4PS7A 1WH3A 4ZRJA 2KO3A 2JUOA 1YX6B 2CR5A 2N7DA 4KZ0A 4FJVB 5AZGA 4FJZA 2CS4A 2KQSA 2FAZA 4LCDE 4XZ4A 1WI0A 3OJ4B 2LRUA 2RR9A 1GG3A 3X0WA 4BKTA 1WX9A 3UF8A 3QX1A 1F9JA 1V5TA 1WF9A 4GSWA 5E6OA 4EZLA 2C60A 4MSMB 2LGXA 5C23A 4BKSD 3WALA 1WGHA 2BWES 3TL5A 3N32A 4MGKE 4G0NB 2RSUA 2L3ZA 4NPNA 3DVNV 3PGEA 4K7UA 2DZJA 4GB9A 3RZWC 4B9KA 2C7MB 2PEAA 4HWIB 2LASA 3P2BA 4W9EA 4RMAA 1WYWB 3D32A 1EF5A 2KLGA 3GZNI 2J7QB 3OJ3A 2KWCA 4GMVA 4IUMB 3ZDMC 3RD2A 2M0XA 4DXAB 1YIWA 3Q3JA 4I6LB 4WJQA 3SU8X 3VFKA 2BYFA 2HTHA 3APCA 2IYDB 2NPTB 3EC8A 3DPDA 3PLVA 4LJPB 3ZNHB 1V9JA 1WMHA 2DYMA 2REXA 2W9NA 4WWNA 1UBQA 1GNUA 1TZ1A 2ZZPB 3BINA 4JQWC 3ZKJC 4M8MA 3QARA 4OVVA 4WJNA 3JVZX 1V86A 3EFUA 2K6DB 4NAWA 4W9HA 1OGWA 2KWUB 1J19A 3V62A 2D11A 4FHKA 3ZDTA 3R7RA 4PS8A 4KDIC 5KHQA 3A1QB 1ZW7A 2K25A 3L0WB 1E8WA 4KIKA 4HXDA 4BKGA 3R66C 5KHOA 4PS3A 2LGDA 2I1JA 3DVGX 1WGDA 2DENB 3IHPC 4URKA 4ICUA 2M1MA 2N4FA 3EECA 2CHWA 4A20A 4HDQA 2IY1B 3PT2B 4E74A 2HJ8A 4GIVA 3B1LX 3DBSA 4YL8A 3UGBB 4A3PA 2PE9A 2K8BA 2O6VA 1WJ4A 4DWFA 3QWZB 5J18A 2FUHB 1U4AA 2CHXA 4G11A 4FLHA 4HK2A 3A1QA 5AEKB 1UBIA 5CHFA 3ONSA 1P9DU 1UZXB 3K9OB 4ZYNA 2LZ6A 3BY4B 1NI2A 4NNJB 2ZPYA 2R2OA 1I42A 3NS8A 4AP4C 3M3JA 2JRIB 4WQOB 2DAJA 3C0RB 2CHZA 4BBNF 4AJWA 2PJHA 1V49A 4NQLB 5G2NA 3UQBA 2V4LA 1VCBA 2JF5A 2G4SA 1E7UA 2J0KA 3VUYA 1GUAB 2KTRA 2C5LC 2WWZA 3JYUA 2N9EB 4E71A 4HCNB 1WJUA 3DBRI 3CMMB 2MBBB 3KYDD 1WGRA 3RYTA 1WX7A 2IZVB 2RGFA 2KFJA 1K8RB 2K8CA 3UIOB 2BKRB 1WE6A 2M17A 1PQSA 4GXBA 3WIMA 1RRBA 2KX0A 1BT0A 1J8CA 3IFWB 2V1YA 3SHQA 4P7IA 2ASQA 1GC7A 1RLFA 2KVRA 5CHVC 2KK8A 4B6WA 2MBHA 4HJKA 2L0FA 4MJSA 2LD9A 4WJOA 3VUXA 2FIDA 3DBLI 3M62B 3PRMB 1WM3A 2I1KA 2NR2A 2BKFA 4FADA 2KMCA 4BOSC 5J2RA 3TMPB 1EO6A 2ZNVC 2FCNA 4PYZA
chains in the Genus database with same CATH superfamily
1XT9B 3ECIA 5CTRC 1YNTE 3Q8EA 1SIFA 1ZGUB 2DZKA 3AE6B 4A3OA 1NENB 2GMIC 5C1ZA 1SF0A 4AWJA 1F1HA 2WXKA 2YEPB 3FILB 3UIPB 4FBJB 2IGGA 1E7VA 3ALBA 3KQ4A 3MTNB 4WWPA 4D2KA 2HJ1A 3ZYYX 2IO2B 3APFA 3Q3FA 5IP4D 3M95A 3Q69A 4ANVA 4XYCA 4IM3A 2M56B 4F1SA 1R4NI 2E6XA 3FILA 1D4BA 1JWUD 3TEYA 2X8XX 1WGGA 3B9JA 4WH4A 4HROA 1WZ0A 2AL3A 2MBEA 4TUUA 4FHJA 1UD7A 1KRHA 2O6VB 2K8HA 2MWSB 3ZJTA 1ET9A 4IC7B 3NVZA 4XC2A 2INNE 1C76A 1J0GA 2LUMA 2L7RA 2KMAA 4ZRQA 5BYRA 3GOEA 4RGNA 1LQBA 2D3GA 1OQYA 3AE7B 3VVWB 3W5VB 3MC0B 1L0VB 4GDLB 1IPGA 2KJRA 3SDLC 1KLGD 2OOBB 4MH0E 1OQQA 5DPRA 1L0XB 3BIID 4JWSC 1E8YA 1SJHD 1TY2A 2VH2A 1AW7A 1FFVA 2GLSA 3AI5A 2A4ZA 3HM6X 1CQVA 1EWYC 2LHEA 3EA6A 3L10B 4GDLA 1VDVA 3GE3C 5HKHA 3CWIA 1HTQA 1GB4A 2DAFA 4ANXA 3U7DA 1C77A 2K39A 2CU3A 3PHXB 2C9WB 3KYCD 3NZSA 3AECB 2NBVB 2L32A 1F2RC 5D3IB 1V6EA 2W3SA 1TBEA 2LXCA 3BK1A 1F0ZA 2AEHA 5JHBA 2MA9B 2KDFB 2LXAA 3VRBB 4GOCA 2JX5A 2PKOA 1V1OA 1D6EC 3AE2B 1TS4A 2PIAA 2K0PA 3H7SA 2YVCA 4USAA 2G9HD 5IO9A 3AB5A 1UNSA 2KANA 2ZCBA 4FXCA 2DWQA 2V0GA 1NBFC 5E6NA 3DOWA 1QOFA 2LGIA 2N9LA 4WJPA 1HTOA 2Z59B 3DQVA 4ZDVA 2RPQA 2GRIA 2GBMA 1XLQA 4G3XB 4JIOU 1FXTB 1TJEA 3PSEB 3DDCB 4JL9A 5EE1A 4K81A 2EKIA 5LLIA 4P6VF 3JSVA 2WX0A 4KZCA 1NDDA 3I5JC 1V1PB 5IN7A 3L13A 4IW0A 2O2VB 3P63A 4M02A 2AX5A 4KGSA 2KJHB 3NZUA 1XQQA 2ZVOA 4JGHB 4HKZE 1N5XA 4MEMA 1JROA 1RAXA 2D07B 4XX5A 2C7HA 4RGMA 2PE6B 2INDC 4TQ1A 4L2YA 4BFRA 4YSXB 1Y8RC 2AQ2B 2MLBA 4BKSA 2J52A 2W82A 1JALA 1FRRA 1P98A 1ZOYB 3IG3A 3VR8B 2N9KA 2AL6A 4IWPA 2JPHA 3WAPA 2L05A 5TR5A 4KKJA 4EUTA 4KKIA 2W55A 1YQBA 5E6PA 4KDLB 2KOXA 2LGSA 1MPEA 1A70A 1WGYA 4RCOA 2WXGA 4JE3B 2KXJA 2L1AA 5TSSA 4AJYB 4ANWA 4IM2A 4DDGD 2KWVB 2XEWA 3V05A 5JZEB 1QOGA 2ON8A 5BO4B 4W9GA 1YMHE 1WXMA 3TEWA 3NG0A 4W9LA 2IO0B 2BB6A 3AEEB 4WWOA 4DHJD 2M4NA 4Q2JA 2QSDA 3AULA 2LUEA 4YSZB 4K3CA 1WSPA 1KLVA 2IPKD 3I63C 3T3OA 3L17A 1UF0A 2H88B 3C8YA 3VDZA 1T6BX 2J42A 2FCMA 2QC8A 3LJ3A 1JWSD 1PGBA 2V3NA 1KM7A 3APDA 4GGQA 3SFEB 5GMVA 2BGFA 2JRHA 2HE7A 1V80A 4C00A 4PS7A 4OHJA 2KO3A 4KZ0A 4FJVB 1HA5A 3AEDB 3DWMA 5JXVA 2KQSA 2FAZA 1HEZE 1WI0A 1SE3A 5G5HA 1GG3A 3QX1A 1F9JA 1V5TA 1JRPA 4MSMB 5C23A 2D3BA 2RSUA 1M4VA 4B9KA 4HWIB 2LASA 1XXGA 1NYRA 3GZNI 3OJ3A 4GMVA 4C80A 3RD2A 4A8XC 4WJQA 3SU8X 3VFKA 1MHHE 5FK9C 2IYDB 3BINA 3Q3MC 1V86A 4OVZA 2K6DB 4NAWA 5LNK1 2KWUB 2PTLA 4IKGA 4FHKA 3ZDTA 3L0WB 1E8WA 2RDBC 3R66C 5KHOA 2LGDA 4ACFA 2DENB 2M1MA 2ZW1A 2QIEB 1L4DB 1VZ6A 3ZJVA 1UWMA 4DWFA 1F52A 3EGRA 4C7YA 5CHFA 2LJIA 1P9DU 4ZYNA 1I4QA 1NI2A 4NNJB 2ZPYA 4AP4C 3M3JA 4WQOB 1YQ4B 1EU3A 1OFFA 2DAJA 3C0RB 4AJWA 4NQLB 2JSVX 4P16A 5G2NA 5D3DA 3UQBA 1FEHA 1VCBA 5C3JB 2G4SA 2WXIA 1BUIC 3FAHA 1RM6C 3VUYA 4E71A 2D3CA 3KYDD 1WGRA 1QILA 2JZPA 2WDRB 1EWCA 1K8RB 2K8CA 1JCKB 3Q3OC 1SEBD 4P7IA 1GC7A 1RLFA 3RNAC 4YTNB 4WJOA 2FIDA 3M62B 1PGXA 2NR2A 3MP9A 4O1NA 2BKFA 2KMCA 4RF0A 2FCNA 4RF1A 1WR6E 3DCGA 2KKCA 2MX2A 3Q8CA 2JY6A 1SGHA 2DYBA 3RNCC 4IM0A 4LNKA 2OJWA 3VTUA 5AZFA 4W9IA 2N1WA 2MW5A 3BVZA 1YQ3B 3VTWA 3E9SA 3NOBA 2JZ3B 2KQ7A 4KGTA 2K1FA 2XK5A 3AE8B 2BWFA 2RMMA 5BMGA 1WRDB 1T0YA 4KIKB 4DBGA 1CZPA 1H4RA 3P4QB 3JW0X 2IJ0A 2KDMA 4JLCA 4M0WA 3L4PA 2O6VD 3WAMA 1C79A 4F8CB 3PO0A 4LDTB 1MI0A 3PZ8A 3C19A 2ZPNA 4US9A 3S2AA 3W1YA 3QC8B 5BMHA 2JYEA 4J6IA 4DK5A 5DPTA 1OEYJ 3DBHI 2ZVNA 2VZKB 3N20C 4IG7B 2V3SA 1CJEA 4G50A 2GBKA 1SE9A 5LXHA 2IO1B 2WQYB 1I4HA 1C4AA 2K5PA 1WZ3A 1XEEA 2KZRA 3CSFA 1OEYA 4CO7A 3VHTC 4FJYA 2L0TA 2Y3AA 4HPLB 2BT6A 2MCNB 4FN2A 2RD0A 2WYQA 2ZCCA 1V97A 1L6VA 1UWXA 2ICIA 3MC9A 4FA6A 1JW9D 1PGAA 3AH7A 5DPWA 1MG8A 4HKQA 4GN1A 1WJNA 1I4GA 2G3QB 2DYOA 2KMMA 1JWAD 3DVNU 2J53A 2YLMA 2ZW0A 3QHTA 4OZCA 3KUZA 4M01A 4EEWA 1WXAA 2QILA 1TKGA 3TSSA 2MJ3A 2KDBA 2LRWA 3AE9B 2KC1A 4W9FA 2V3PA 2N0SB 1N61A 4X57B 2FIFA 5EE9A 1IP9A 1MG4A 3I3TB 3Q8AA 3KVFB 3TBLD 3AE4B 5J17A 3U8ZA 1Z2MA 3ZXRA 2AQ1B 2SEBD 1Y56A 5FR6A 2LWPA 3OAWA 4RM8A 2WXFA 4ICVA 4YSYB 1IGCA 4XDDA 1XD3B 4NY0A 2WHIA 2Z0EB 1P0RA 2Y5BB 4M8NA 2KACA 1C3TA 5JHAA 1N6ZA 2FCQA 4CYEA 1Z5SB 2N9PC 3Q3NC 3L08A 2VRRB 1GAQB 1WIAA 1STEA 4ARCA 2KFKB 5L95C 1UELA 3DBRB 5D2MB 1P3QU 3W1SC 1VRAB 2DBYA 1K52A 3KWLA 3ML8A 1WGKA 3AEFB 2BYEA 1CMXB 3AM9A 4MM3A 1PDXA 4K7WA 4MDKE 4N59A 4MELA 1KJTA 1P7EA 2KFKA 1UUPA 3IT4B 1WM2A 4AQ7A 1LM8B 2BF8B 3KWVA 3DBLB 2PMVA 3PZ7A 3AEAB 2BS3B 5AZHA 3R3MA 2KN5A 5CHWA 3V6EB 4HRSA 1IUEA 3RCZA 3ZTCA 4EE2A 3IBEA 4K1RB 3A9JB 1WXVA 1I4PA 2DZMA 2LVQA 3QAQA 3WANA 1LGRA 1C9FA 4YTMB 4LJOB 3BYYB 3BK2A 2E3TA 3CSTA 1XLOA 2UYZB 3ZW3A 3N3KB 1ISNA 3P4PB 4I6PA 2MEKA 3A9JA 3W2DA 3H1UA 3T9LA 4PYUA 4P1CC 1JWBD 2KX3A 1R4NB 3AE5B 2QJLA 1KFYB 4ARIA 2B76B 2BB5A 4DQOC 1A5RA 1K51A 3VXWA 2MP2B 1WJ6A 2BPSA 2OEDA 3A4SC 5IA7A 2WXNA 3LB8C 1E7PB 2C7NB 2IO3B 4NJ6A 1QZEA 5IOIA 1RFAA 1XCQL 4BOZB 2J4XA 2KAJA 4L23A 3LYYA 3KW5B 4B95A 2MP2A 2MQJA 1C4PA 3JSVB 1UGMA 5HFYA 1KOTA 5IAAC 4ZRJA 4LTUA 2JWUA 1K53A 2VH1A 2CS4A 1QQRA 4XZ4A 2RR9A 3X0WA 4WIPA 1J7CA 1N5WA 1WF9A 4GSWA 5E6OA 2C60A 3WCQA 3O13A 4OW0A 3N32A 2LFIA 4MGKE 4HPPA 3DVNV 2DZJA 4GB9A 5G5GA 3IT6B 3P2BA 1CK1A 5H92C 3D32A 2RPVA 3N1XC 1WYGA 4I6LB 2GB1A 2BYFA 2HTHA 2QDFA 1FM0D 1ZPSA 3EC8A 4LJPB 3AE1B 3ZNHB 1V9JA 1WMHA 1VLBA 1QF6A 1GNUA 1TKYA 2ZZPB 1I4XA 4JQWC 4M8MA 4WJNA 1PFDA 1SB3C 1OGWA 1J19A 3A1QB 3ABVB 3DHIC 4PS3A 3DVGX 1WGDA 4S0RA 3W5UB 3KLSX 4WAFA 5BYQA 1MVKA 4B0MA 2CHWA 3PT2B 4E74A 3DBSA 2YEPF 3RI7C 3UGBB 5J18A 2CHXA 4FLHA 2M0AA 3A1QA 3K9OB 2R2OA 3MJ5A 4BBNF 1V49A 2WDVB 2V4LA 2INCC 2JF5A 3IAS1 1E7UA 1GUAB 2KTRA 1QOAA 2C5LC 1SJED 1WX7A 2RGFA 2KFJA 2BKRB 1WE6A 4PK1A 2TSSA 4GXBA 1AWDA 1RRBA 1BT0A 1J8CA 1V8CA 2ASQA 2NMQA 2ONQA 2MBHA 4HJKA 2L0FA 4MJSA 1WM3A 1T0QC 1DGJA 5J2RA 1T0SC 1EO6A 4PYZA 2LVOA 1VZ7A 4GLSC 3BZDB 3AEGB 1G6JA 1D5ZC 4LNFA 2KTFA 3HK0A 5T8IA 1NI3A 1E9MA 1N60A 3SR6A 3V3XA 1R7SA 1B9RA 2D3AA 1P1AA 2EMTA 2NBUA 3IXSA 4NAWB 1DYQA 2MJEA 1ZDVA 1FNWA 4LDTD 4ANUA 1E10A 1YJ1A 2GOWA 1YN3A 3H9DA 3UI3A 3T3NA 1VJKA 2VZKD 2KJ6A 2WXRA 2QHOA 1Q1OA 2UWQA 4XDCA 3SD5A 1J7AA 2L76A 1JMLA 4IWOA 3ML9A 1S3SG 2GI9A 3ZO5B 3EFCA 4J3OD 3Q8FA 2LMCA 2WDTB 4RNAA 4WQMA 3R2TA 3R8BA 4JX1C 3QQ8B 3J9CA 3I9V1 2Q5WD 3O65B 2WX1A 2FUG1 4ZRKA 3LDZE 1KTKA 3P4RB 1UH6A 1WE7A 3OWEB 4IWQA 3AN1A 3MFGA 2L52A 3URYA 3UQAA 3GS2A 2JT4B 1QT9A 1E90A 4WWMA 3N30A 3U2SC 1SIJA 1C78A 4P1BC 3PVLA 4PT5A 2HTME 1WXQA 3PTFC 3ZRFA 3PV1A 1E5WA 1VD2A 2KD0A 3VRAB 4HLEA 4XWTA 1TYGB 3GZNB 4HVBA 2WU5B 2K6QA 3AXCA 3ZNZB 2L83A 2AYOB 5JH5C 3B0AA 2J0JA 4BAXA 4NZLB 1XLPA 4YWGG 3KUDB 1ZXHA 3EHVA 4H2AA 3RNEC 3MJWA 4IOIE 3P4SB 4II3B 4DHJB 1QLBB 3HUIA 2D2QA 2XK5B 2DZIA 2KC2A 3PS6A 3QA8A 2LEKA 2NS5A 3ZUNA 2M19A 3GP7A 1AN8A 3T8MA 3X23A 4YXDB 4GDKB 4M0WB 1D3ZA 3IVFA 3A9KA 4AOFA 3AMZA 4KVGB 1AYFA 5EE3A 2BYVE 2RDHA 2XN9C 2HDEA 3Q6BA 3KH0A 2BVCA 3VUWA 3PHWB 1F2RI 3SEBA 3U4EG 4GDKA 3W1SA 4HPMB 3HHMA 2KYWA 3RUIB 1YD8U 3A33B 1KH0A 3R7QA 3VH3B 3OLMD 2KWDA 1FIQA 2QEJC 3H6NA 3AU4A 2PVOD 3RT3B 4N9F4 2WXMA 1T0RC 3SFDB 3ZVVA 2OHFA 2SAKA 2IY0B 3NRZA 4W9KA 1ENFA 4RGTA 1E8XA 3B08A 2NCNA 1I7HA 2Y5PA 3DHHC 1ROEA 4ZHPA 1E8ZA 2G4DB 3ZJUA 2WXHA 5D7GA 5DCNA 2B3AA 3NVYA 1FRDA 2KHWB 1IBXA 3L54A 2MJDA 4TQ0A 1FCCC 1SBBB 3GB1A 3RNGC 4DHZB 2M8SA 2NPTA 2JXXA 1ET6A 1Q0WB 2N7EA 3QCAA 1TY0A 4C4VB 2JZZA 3RZFA 2QCZA 2N9XA 4GU2A 2D10A 1XO3A 2K3UA 1I35A 3NVVA 2WLBA 1FNUA 1ESFA 4DXFA 2KNBA 5GXGB 4NAMA 4C4VA 1SXTA 3AV8A 4TKNA 4WAAA 3V60A 3QK0A 2CKHB 4RM9A 2MBQA 1L0YB 3DBHB 1JQ4A 2MHJA 3MHZA 2LI5A 3RNFC 4EOYA 4KGRA 1RFKA 3U30A 2WNMA 2PVGC 2NBWB 3P42A 1SSNA 3K9PB 4MGYE 1OQRA 2KDIA 1WRIA 1WX8A 1HE8A 5CX3A 1D5XC 4CHKA 3DWGC 4EKUA 3H8HA 3E56A 2JUOA 1YX6B 2CR5A 2N7DA 2WDQB 4ZYSA 3I57A 4FJZA 4REZA 1SE2A 1GOZA 2CJNA 2LRUA 4MH8A 1T3QA 4MM3B 1VZ8A 1K50A 1J7BA 1TT5B 1C4CA 4BKSD 1PYWD 3WALA 2BWES 3BVGA 4NPNA 2I38A 3PGEA 4K7UA 4C56C 2DLBA 3FKYA 4RMAA 2KLGA 4IUMB 2J7QB 3ZDMC 2KWCA 1YIWA 3Q3JA 2W54A 3APCA 3DPDA 3PLVA 2WXPA 2WS3B 3TEZA 3Q14C 3ZKJC 3IAM1 3QARA 4OVVA 4LK0M 4M00A 3N1YC 3FC4A 2WXOA 4W9HA 3V62A 2D11A 3R7RA 4KDIC 1ZW7A 2K25A 1YN4A 4BKGA 3AE3B 2BS4B 4URKA 1NEKB 3BYTB 4ICUA 3B2FA 1L4ZB 3HRDD 3TUOA 3EECA 1BMLC 2IY1B 2HJ8A 3BVMA 3B1LX 4QAYA 4YL8A 1NYQA 2Y5CA 2PE9A 2K8BA 2O6VA 3QWZB 2FUHB 1U4AA 5AEKB 1UZXB 2BYTA 3BY4B 3ZQ4A 2I2YA 3MC8A 4L1BA 1RYJA 4A9AA 2PJHA 1DOIA 2WU2B 2WP9B 2JYTA 2J0KA 3Q8BA 3JYUA 5HG2A 1VR9A 2N9EB 4HCNB 5C2TB 3RYTA 5AUIA 2M17A 1SE4A 1PQSA 3WIMA 2KX0A 3IFWB 5BYSA 1HZ6A 5HHDG 2V1YA 3SHQA 3ZXVA 2KVRA 1F77A 2V9HA 5CHVC 4ZOHC 4TMAB 2LD9A 3EUB2 1TS5A 2I1KA 1PUTA 4BOSC 3RPFC 1ZE3D 1V2YA 2IDYA 2WXLA 4CQNA 2BBCA 3N1ZC 2PW9A 2NTTA 4F7ZA 1AARA 5MPOA 2EKEC 3NVWA 4MSQB 1FNVA 1N63A 1C1YB 2N1VA 4ZRIA 1WMHB 3ZGZA 1V5OA 1IYFA 4KSLC 2ZEQA 4TV3A 2JWZA 2EMSA 2K9XA 4YTPB 4EFOA 3WA0A 3RN9C 1GJZA 3PRPB 1EUVB 1FXAA 4OZAA 3H7PB 2GBNA 4HEA1 4TSSA 1FFUA 3ENEA 4ZRPA 1EF1A 1QOBA 1TKEA 1GC6A 1YJJA 1R4MI 3NS1A 2HD5B 2K22A 3UINB 3ZNGC 2BQQA 1OTRB 4JPSA 3HVDA 1MFWA 4BBNC 1LFDA 3H7PA 4K7SA 4HDOA 4A6QA 2L00B 4ASWC 1V1PA 3WAOA 3HIZA 3B2GA 5L83A 2O2VA 1M94A 3TJPA 4MT5A 2KTRB 1IGDA 5G55A 2FCSA 2KDEB 3GE8C 2XBBC 3VR9B 2LJ5A 3PPAA 2AQ3B 1FCLA 3U52E 1FXIA 2V4IB 4N6EB 3OG5A 1WXSA 3NZ3A 4W9CA 1L6UA 2EELA 1XCTL 5H8YE 2AWTA 1EM7A 4MJSB 2FBWB 5DPSA 1FMAD 5FR3A 1TIFA 2Z0DB 3VQIA 1JRUA 4ITKA 2OJRA 1ZUD2 4US8A 3CIRB 2NVUI 2KLCA 5HI1A 4E3CA 4N58A 1P7FA 3PRZA 1YN5A 1TZOA 2LHDA 2LGYA 3M63B 4R3DA 2FE8A 3DVGY 1WWTA 2MRPA 1ZXIA 1X1MA 3VH4B 2JVCA 1R4MB 4I6NB 4K3BA 4MGZE 2IBIB 1Q10A 2G45B 4W9DA 5D94A 5FKAC 4NJCA 4BVUC 3CF6E 1BXTA 3V61A 3L16A 2GBRA 3BWUD 1KF6B 3RNBC 1N62A 2RDGA 3NY5A 1TGZB 2MBOA 3AU5A 1NVID 4DHZE 4MGIE 4NQKE 4II2B 3QJZA 1B1ZA 5E6JA 1TTNA 1H8CA 2PPHA 4W9JA 2KVZA 5EDSA 2MSED 1YJIA 1V81A 1GB1A 3Q2AC 4EZKA 1TS2A 5LXIB 2FNJB 1L2NA 3ZIMA 3TCAA 1I4RA 1L7YA 3A4RA 4OZBA 4RFBA 3V6CB 2BTEA 3ZNID 2IGDA 4IDIA 1LXDA 1WFYA 3MHSD 2JXTA 3QIJA 2A5UA 1ZKHA 5BMIA 3PLUA 2WXJA 1KLUD 4S17A 2L8JA 2N7JA 3PZDA 4BZAA 1XF5L 1MJDA 3PREA 2H89B 1S1QB 4AUQC 1Q5WB 2LVPA 4RH6A 4KV2A 4ZHOA 2WGSA 4UDUC 2NTSA 2INPE 3ETRA 4KX6B 4FULA 3RFZB 2J0MA 2UU7A 4DDID 1WY8A 2CU1A 1FO4A 5D6JB 4XE0A 5I4DA 2DHZA 3ZRCA 4OVUA 2R61A 1JWMD 4HCPB 4EZJA 3RULA 3NHEB 3TEXA 2GBJA 2D5GA 3HM3A 1QKZA 4KSKC 4LNNA 2DX5B 1TS3A 1EU4A 2R2QA 1E6EB 1RWSA 4XGAB 2ZNVB 3R2IA 1WR1A 2KT7A 5IKCM 3KUCB 2ACZB 1HXYD 3ZLZA 3A9KB 3NJTA 4MACA 3W9CB 3ZTDA 2WXQA 3VTVA 5AUKA 1XLNA 1YX5B 4XWWA 3VAWA 4NJ7A 1DOXA 5EE0A 4A55A 2ZJDA 1WH3A 4JWUC 2IGHA 1LO5D 2G1EA 5AZGA 4DXGA 2QMTA 1FPYA 4LCDE 3NUHB 3OJ4B 2JQRB 4BKTA 1WX9A 3UF8A 3RMKC 3U7ZA 1DOYA 4EZLA 1HQRD 3N9YC 2LGXA 1WGHA 2X38A 3TL5A 4G0NB 2L3ZA 4RGOS 3DHGC 3RZWC 2C7MB 2PEAA 1IBXB 4W9EA 3HVZA 1WYWB 1EF5A 4HJGE 2W3RA 2JU6X 2M0XA 4DXAB 2KN4A 1ZDXA 2NPTB 2REXA 2DYMA 2W9NA 1YOVB 4WWNA 1UBQA 1TZ1A 3JVZX 2PLPA 3EFUA 4AS1A 4PS8A 5KHQA 1FD6A 1E0ZA 4KIKA 4HXDA 2I1JA 3IHPC 4B0EA 2N4FA 1MHXA 4A90A 4A20A 4HDQA 2Z8LA 4GIVA 4A3PA 2DNFA 2MH7A 1WJ4A 4G11A 4HK2A 3AEBB 1UBIA 3ONSA 2LZ6A 1GPXA 1I42A 3LXFA 2KQ4X 3NS8A 1HZ5A 2CJOA 2JRIB 2CHZA 2BS2B 4C7ZA 4WURA 4LNOA 2WWZA 4LLGM 1D5MC 1WJUA 3DBRI 3CMMB 2MBBB 1ACCA 2IZVB 3UIOB 3P1MA 1UGJA 1L5PA 1ZP0B 2KK8A 4B6WA 2BW2A 3VUXA 2XNAC 4YT0B 3DBLI 1T5XD 3PRMB 4LNIA 4FADA 3TMPB 2ZNVC 3TIXA
chains in the Genus database with same CATH topology
2LVOA 1XT9B 3ECIA 5CTRC 1WR6E 3DCGA 1SIFA 1ZGUB 1V2YA 2DZKA 2KKCA 2MX2A 2JY6A 1SGHA 2DYBA 1G6JA 4IM0A 4A3OA 3VTUA 2GMIC 2KTFA 3HK0A 4W9IA 5AZFA 5C1ZA 2N1WA 4F7ZA 4AWJA 1AARA 2EKEC 2MW5A 3VTWA 3UIPB 4FBJB 4MSQB 3NOBA 1E7VA 3ALBA 1C1YB 2JZ3B 2N1VA 2KQ7A 3MTNB 1WMHB 4WWPA 4ZRIA 1V5OA 1IYFA 4KSLC 1P1AA 2EMTA 2NBUA 2K1FA 2ZEQA 2XK5A 2IO2B 3APFA 3Q3FA 4TV3A 2JWZA 2BWFA 3M95A 2EMSA 4NAWB 4ANVA 1WRDB 4IM3A 4EFOA 3WA0A 1T0YA 4F1SA 4LDTD 1R4NI 4ANUA 1GJZA 4KIKB 3PRPB 1EUVB 1YJ1A 4DBGA 1H4RA 2GOWA 3H9DA 3JW0X 4JLCA 2O6VD 3H7PB 3WAMA 4F8CB 2GBNA 1WGGA 4LDTB 3ENEA 2KJ6A 3TIXA 1WZ0A 2AL3A 2MBEA 2QHOA 4TUUA 1Q1OA 2UWQA 2ZPNA 1EF1A 3S2AA 4FHJA 3SD5A 3W1YA 1UD7A 3QC8B 1GC6A 1R4MI 2O6VB 4J6IA 4DK5A 2HD5B 2K8HA 2L76A 5DPTA 3UINB 1OEYJ 3DBHI 3ZNGC 2MWSB 2ZVNA 4IG7B 2V3SA 3ML9A 4IWOA 1S3SG 4G50A 1OTRB 3ZO5B 4IC7B 4BBNC 2GBKA 4XC2A 1SE9A 5LXHA 2WDTB 2IO1B 1LFDA 3H7PA 1J0GA 4K7SA 4HDOA 2L7RA 2KMAA 2L00B 4ASWC 1WZ3A 3CSFA 2KZRA 3WAOA 3QQ8B 3HIZA 3GOEA 1OEYA 4CO7A 5L83A 3VHTC 3O65B 2WX1A 2O2VA 1M94A 4ZRKA 3TJPA 3LDZE 4FJYA 1LQBA 2L0TA 2D3GA 4HPLB 1OQYA 1UH6A 1WE7A 4IWQA 2KTRB 2MCNB 5G55A 4FN2A 3VVWB 2RD0A 2FCSA 2KDEB 2WYQA 2XBBC 2ZCCA 4GDLB 2LJ5A 1IPGA 3UQAA 2KJRA 3PPAA 3SDLC 2JT4B 4FA6A 1E90A 2OOBB 3N30A 4MH0E 1WXSA 4W9CA 5DPRA 5DPWA 1MG8A 1E8YA 2AWTA 4GN1A 3PVLA 1WJNA 4MJSB 5DPSA 2G3QB 2DYOA 3AI5A 3DVNU 2YLMA 2Z0DB 2A4ZA 3PTFC 3QHTA 3VQIA 3HM6X 3ZRFA 1JRUA 3KUZA 2OJRA 3PV1A 1E5WA 1VD2A 2KD0A 3L10B 4GDLA 2NVUI 2KLCA 4E3CA 4EEWA 1WXAA 4HLEA 2KDBA 3PRZA 4HVBA 5HKHA 2LGYA 3M63B 2LRWA 2K6QA 3AXCA 3ZNZB 2DAFA 4ANXA 2AYOB 5JH5C 2KC1A 4W9FA 3U7DA 2K39A 3B0AA 3DVGY 2J0JA 3PHXB 4X57B 2C9WB 3KYCD 3NZSA 2MRPA 2NBVB 1X1MA 1V6EA 2FIFA 1TBEA 3KUDB 2LXCA 1IP9A 3EHVA 3VH4B 2AEHA 2JVCA 3I3TB 3MJWA 5JHBA 3KVFB 4I6NB 3TBLD 4MGZE 2IBIB 5J17A 2MA9B 4II3B 4DHJB 2KDFB 4W9DA 2G45B 2LXAA 5D94A 3U8ZA 2D2QA 2XK5B 2DZIA 4GOCA 1Z2MA 2KC2A 3PS6A 3QA8A 2NS5A 4BVUC 3ZUNA 3CF6E 3V61A 3L16A 5FR6A 3H7SA 2YVCA 2GBRA 3T8MA 3X23A 2LWPA 2KANA 2ZCBA 3OAWA 4RM8A 3NY5A 1TGZB 4GDKB 2MBOA 4ICVA 4M0WB 1NBFC 1D3ZA 5E6NA 3DOWA 3IVFA 1XD3B 4NY0A 1C3TA 2Z0EB 1P0RA 2Y5BB 4M8NA 3AU5A 4WJPA 5JHAA 4DHZE 4MGIE 2FCQA 2Z59B 3DQVA 4II2B 4NQKE 4ZDVA 4CYEA 3QJZA 2RPQA 1TTNA 3A9KA 2GBMA 4AOFA 4KVGB 1H8CA 2PPHA 4G3XB 1Z5SB 2BYVE 4JIOU 2N9PC 4W9JA 3KH0A 1FXTB 5EDSA 2MSED 3PSEB 3DDCB 3L08A 1V81A 2VRRB 1WIAA 4JL9A 4K81A 5LLIA 3VUWA 4EZKA 3PHWB 5LXIB 2FNJB 3JSVA 1L2NA 2WX0A 4GDKA 3ZIMA 4KZCA 3TCAA 4HPMB 3W1SA 3HHMA 2KFKB 1L7YA 3RUIB 3A4RA 1NDDA 1YD8U 5L95C 3V6CB 3A33B 1UELA 3ZNID 3L13A 3R7QA 5D2MB 1LXDA 1WFYA 3MHSD 1P3QU 4IW0A 3VH3B 3W1SC 3OLMD 2O2VB 3ML8A 3H6NA 3QIJA 2KJHB 3AU4A 2A5UA 3RT3B 4N9F4 3NZUA 1ZKHA 2BYEA 1CMXB 1XQQA 3PLUA 3ZVVA 2ZVOA 4MM3A 4K7WA 4MDKE 2IY0B 2L8JA 4JGHB 4MELA 1KJTA 3PZDA 2KFKA 4MEMA 4W9KA 1WM2A 1RAXA 1E8XA 1LM8B 2BF8B 3B08A 2NCNA 2D07B 4XX5A 5AZHA 1E8ZA 2C7HA 2G4DB 3PREA 3R3MA 1S1QB 4AUQC 2PE6B 1Q5WB 5D7GA 4TQ1A 5DCNA 2KN5A 5CHWA 2B3AA 3V6EB 4BFRA 1Y8RC 2KHWB 2LVPA 3L54A 4KV2A 2MLBA 4TQ0A 3RCZA 4BKSA 3ZTCA 3IBEA 1P98A 3IG3A 4K1RB 3A9JB 1WXVA 2AL6A 4IWPA 2JPHA 2M8SA 2NPTA 2DZMA 2JXXA 3WAPA 4DHZB 2L05A 2LVQA 5TR5A 4FULA 3QAQA 1Q0WB 3WANA 4EUTA 2J0MA 1YQBA 2N7EA 3QCAA 5E6PA 4KDLB 4DDID 1WY8A 2CU1A 2KOXA 2JZZA 5D6JB 4LJOB 3RZFA 2N9XA 4GU2A 1WGYA 2DHZA 3CSTA 3ZRCA 2KXJA 2UYZB 4OVUA 4AJYB 3ZW3A 4ANWA 4IM2A 4HCPB 3N3KB 2D10A 3RULA 2KWVB 4DDGD 1ISNA 4EZJA 4I6PA 2XEWA 3NHEB 2GBJA 3A9JA 3HM3A 5JZEB 3H1UA 3T9LA 1I35A 4PYUA 5BO4B 2KX3A 4KSKC 4W9GA 1WXMA 2DX5B 2KNBA 4W9LA 2R2QA 4TKNA 1A5RA 2IO0B 4WWOA 3VXWA 4DHJD 2M4NA 2ZNVB 2MP2B 4WAAA 1WR1A 3AULA 1WJ6A 2LUEA 2BPSA 3V60A 3A4SC 5IA7A 3QK0A 2CKHB 1KLVA 4RM9A 2IO3B 2C7NB 4NJ6A 2MBQA 1QZEA 3KUCB 4EOYA 1RFAA 2LI5A 3L17A 3VDZA 3ZLZA 4BOZB 3A9KB 2FCMA 3U30A 3LJ3A 3KW5B 3ZTDA 1KM7A 2MP2A 2NBWB 3APDA 2MQJA 4GGQA 4B95A 4MGYE 3K9PB 3VTVA 2KDIA 2BGFA 2JRHA 1UGMA 1YX5B 1WX8A 2HE7A 3JSVB 1HE8A 5GMVA 1V80A 5CX3A 3VAWA 1KOTA 4NJ7A 5IAAC 4CHKA 4EKUA 2ZJDA 4PS7A 1WH3A 4ZRJA 2KO3A 2JUOA 1YX6B 2CR5A 2N7DA 4KZ0A 4FJVB 5AZGA 4FJZA 2CS4A 2KQSA 2FAZA 4LCDE 4XZ4A 1WI0A 3OJ4B 2LRUA 2RR9A 1GG3A 3X0WA 4BKTA 1WX9A 3UF8A 3QX1A 1F9JA 1V5TA 1WF9A 4GSWA 5E6OA 4EZLA 2C60A 4MSMB 2LGXA 5C23A 4BKSD 3WALA 1WGHA 2BWES 3TL5A 3N32A 4MGKE 4G0NB 2RSUA 2L3ZA 4NPNA 3DVNV 3PGEA 4K7UA 2DZJA 4GB9A 3RZWC 4B9KA 2C7MB 2PEAA 4HWIB 2LASA 3P2BA 4W9EA 4RMAA 1WYWB 3D32A 1EF5A 2KLGA 3GZNI 2J7QB 3OJ3A 2KWCA 4GMVA 4IUMB 3ZDMC 3RD2A 2M0XA 4DXAB 1YIWA 3Q3JA 4I6LB 4WJQA 3SU8X 3VFKA 2BYFA 2HTHA 3APCA 2IYDB 2NPTB 3EC8A 3DPDA 3PLVA 4LJPB 3ZNHB 1V9JA 1WMHA 2DYMA 2REXA 2W9NA 4WWNA 1UBQA 1GNUA 1TZ1A 2ZZPB 3BINA 4JQWC 3ZKJC 4M8MA 3QARA 4OVVA 4WJNA 3JVZX 1V86A 3EFUA 2K6DB 4NAWA 4W9HA 1OGWA 2KWUB 1J19A 3V62A 2D11A 4FHKA 3ZDTA 3R7RA 4PS8A 4KDIC 5KHQA 3A1QB 1ZW7A 2K25A 3L0WB 1E8WA 4KIKA 4HXDA 4BKGA 3R66C 5KHOA 4PS3A 2LGDA 2I1JA 3DVGX 1WGDA 2DENB 3IHPC 4URKA 4ICUA 2M1MA 2N4FA 3EECA 2CHWA 4A20A 4HDQA 2IY1B 3PT2B 4E74A 2HJ8A 4GIVA 3B1LX 3DBSA 4YL8A 3UGBB 4A3PA 2PE9A 2K8BA 2O6VA 1WJ4A 4DWFA 3QWZB 5J18A 2FUHB 1U4AA 2CHXA 4G11A 4FLHA 4HK2A 3A1QA 5AEKB 1UBIA 5CHFA 3ONSA 1P9DU 1UZXB 3K9OB 4ZYNA 2LZ6A 3BY4B 1NI2A 4NNJB 2ZPYA 2R2OA 1I42A 3NS8A 4AP4C 3M3JA 2JRIB 4WQOB 2DAJA 3C0RB 2CHZA 4BBNF 4AJWA 2PJHA 1V49A 4NQLB 5G2NA 3UQBA 2V4LA 1VCBA 2JF5A 2G4SA 1E7UA 2J0KA 3VUYA 1GUAB 2KTRA 2C5LC 2WWZA 3JYUA 2N9EB 4E71A 4HCNB 1WJUA 3DBRI 3CMMB 2MBBB 3KYDD 1WGRA 3RYTA 1WX7A 2IZVB 2RGFA 2KFJA 1K8RB 2K8CA 3UIOB 2BKRB 1WE6A 2M17A 1PQSA 4GXBA 3WIMA 1RRBA 2KX0A 1BT0A 1J8CA 3IFWB 2V1YA 3SHQA 4P7IA 2ASQA 1GC7A 1RLFA 2KVRA 5CHVC 2KK8A 4B6WA 2MBHA 4HJKA 2L0FA 4MJSA 2LD9A 4WJOA 3VUXA 2FIDA 3DBLI 3M62B 3PRMB 1WM3A 2I1KA 2NR2A 2BKFA 4FADA 2KMCA 4BOSC 5J2RA 3TMPB 1EO6A 2ZNVC 2FCNA 4PYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO A;  1XT9 B;  3ECI A;  5CTR C;  1WR6 E;  3DCG A;  1SIF A;  1ZGU B;  1V2Y A;  2DZK A;  2KKC A;  2MX2 A;  2JY6 A;  1SGH A;  2DYB A;  1G6J A;  4IM0 A;  4A3O A;  3VTU A;  2GMI C;  2KTF A;  3HK0 A;  4W9I A;  5AZF A;  5C1Z A;  2N1W A;  4F7Z A;  4AWJ A;  1AAR A;  2EKE C;  2MW5 A;  3VTW A;  3UIP B;  4FBJ B;  4MSQ B;  3NOB A;  1E7V A;  3ALB A;  1C1Y B;  2JZ3 B;  2N1V A;  2KQ7 A;  3MTN B;  1WMH B;  4WWP A;  4ZRI A;  1V5O A;  1IYF A;  4KSL C;  1P1A A;  2EMT A;  2NBU A;  2K1F A;  2ZEQ A;  2XK5 A;  2IO2 B;  3APF A;  3Q3F A;  4TV3 A;  2JWZ A;  2BWF A;  3M95 A;  2EMS A;  4NAW B;  4ANV A;  1WRD B;  4IM3 A;  4EFO A;  3WA0 A;  1T0Y A;  4F1S A;  4LDT D;  1R4N I;  4ANU A;  1GJZ A;  4KIK B;  3PRP B;  1EUV B;  1YJ1 A;  4DBG A;  1H4R A;  2GOW A;  3H9D A;  3JW0 X;  4JLC A;  2O6V D;  3H7P B;  3WAM A;  4F8C B;  2GBN A;  1WGG A;  4LDT B;  3ENE A;  2KJ6 A;  3TIX A;  1WZ0 A;  2AL3 A;  2MBE A;  2QHO A;  4TUU A;  1Q1O A;  2UWQ A;  2ZPN A;  1EF1 A;  3S2A A;  4FHJ A;  3SD5 A;  3W1Y A;  1UD7 A;  3QC8 B;  1GC6 A;  1R4M I;  2O6V B;  4J6I A;  4DK5 A;  2HD5 B;  2K8H A;  2L76 A;  5DPT A;  3UIN B;  1OEY J;  3DBH I;  3ZNG C;  2MWS B;  2ZVN A;  4IG7 B;  2V3S A;  3ML9 A;  4IWO A;  1S3S G;  4G50 A;  1OTR B;  3ZO5 B;  4IC7 B;  4BBN C;  2GBK A;  4XC2 A;  1SE9 A;  5LXH A;  2WDT B;  2IO1 B;  1LFD A;  3H7P A;  1J0G A;  4K7S A;  4HDO A;  2L7R A;  2KMA A;  2L00 B;  4ASW C;  1WZ3 A;  3CSF A;  2KZR A;  3WAO A;  3QQ8 B;  3HIZ A;  3GOE A;  1OEY A;  4CO7 A;  5L83 A;  3VHT C;  3O65 B;  2WX1 A;  2O2V A;  1M94 A;  4ZRK A;  3TJP A;  3LDZ E;  4FJY A;  1LQB A;  2L0T A;  2D3G A;  4HPL B;  1OQY A;  1UH6 A;  1WE7 A;  4IWQ A;  2KTR B;  2MCN B;  5G55 A;  4FN2 A;  3VVW B;  2RD0 A;  2FCS A;  2KDE B;  2WYQ A;  2XBB C;  2ZCC A;  4GDL B;  2LJ5 A;  1IPG A;  3UQA A;  2KJR A;  3PPA A;  3SDL C;  2JT4 B;  4FA6 A;  1E90 A;  2OOB B;  3N30 A;  4MH0 E;  1WXS A;  4W9C A;  5DPR A;  5DPW A;  1MG8 A;  1E8Y A;  2AWT A;  4GN1 A;  3PVL A;  1WJN A;  4MJS B;  5DPS A;  2G3Q B;  2DYO A;  3AI5 A;  3DVN U;  2YLM A;  2Z0D B;  2A4Z A;  3PTF C;  3QHT A;  3VQI A;  3HM6 X;  3ZRF A;  1JRU A;  3KUZ A;  2OJR A;  3PV1 A;  1E5W A;  1VD2 A;  2KD0 A;  3L10 B;  4GDL A;  2NVU I;  2KLC A;  4E3C A;  4EEW A;  1WXA A;  4HLE A;  2KDB A;  3PRZ A;  4HVB A;  5HKH A;  2LGY A;  3M63 B;  2LRW A;  2K6Q A;  3AXC A;  3ZNZ B;  2DAF A;  4ANX A;  2AYO B;  5JH5 C;  2KC1 A;  4W9F A;  3U7D A;  2K39 A;  3B0A A;  3DVG Y;  2J0J A;  3PHX B;  4X57 B;  2C9W B;  3KYC D;  3NZS A;  2MRP A;  2NBV B;  1X1M A;  1V6E A;  2FIF A;  1TBE A;  3KUD B;  2LXC A;  1IP9 A;  3EHV A;  3VH4 B;  2AEH A;  2JVC A;  3I3T B;  3MJW A;  5JHB A;  3KVF B;  4I6N B;  3TBL D;  4MGZ E;  2IBI B;  5J17 A;  2MA9 B;  4II3 B;  4DHJ B;  2KDF B;  4W9D A;  2G45 B;  2LXA A;  5D94 A;  3U8Z A;  2D2Q A;  2XK5 B;  2DZI A;  4GOC A;  1Z2M A;  2KC2 A;  3PS6 A;  3QA8 A;  2NS5 A;  4BVU C;  3ZUN A;  3CF6 E;  3V61 A;  3L16 A;  5FR6 A;  3H7S A;  2YVC A;  2GBR A;  3T8M A;  3X23 A;  2LWP A;  2KAN A;  2ZCB A;  3OAW A;  4RM8 A;  3NY5 A;  1TGZ B;  4GDK B;  2MBO A;  4ICV A;  4M0W B;  1NBF C;  1D3Z A;  5E6N A;  3DOW A;  3IVF A;  1XD3 B;  4NY0 A;  1C3T A;  2Z0E B;  1P0R A;  2Y5B B;  4M8N A;  3AU5 A;  4WJP A;  5JHA A;  4DHZ E;  4MGI E;  2FCQ A;  2Z59 B;  3DQV A;  4II2 B;  4NQK E;  4ZDV A;  4CYE A;  3QJZ A;  2RPQ A;  1TTN A;  3A9K A;  2GBM A;  4AOF A;  4KVG B;  1H8C A;  2PPH A;  4G3X B;  1Z5S B;  2BYV E;  4JIO U;  2N9P C;  4W9J A;  3KH0 A;  1FXT B;  5EDS A;  2MSE D;  3PSE B;  3DDC B;  3L08 A;  1V81 A;  2VRR B;  1WIA A;  4JL9 A;  4K81 A;  5LLI A;  3VUW A;  4EZK A;  3PHW B;  5LXI B;  2FNJ B;  3JSV A;  1L2N A;  2WX0 A;  4GDK A;  3ZIM A;  4KZC A;  3TCA A;  4HPM B;  3W1S A;  3HHM A;  2KFK B;  1L7Y A;  3RUI B;  3A4R A;  1NDD A;  1YD8 U;  5L95 C;  3V6C B;  3A33 B;  1UEL A;  3ZNI D;  3L13 A;  3R7Q A;  5D2M B;  1LXD A;  1WFY A;  3MHS D;  1P3Q U;  4IW0 A;  3VH3 B;  3W1S C;  3OLM D;  2O2V B;  3ML8 A;  3H6N A;  3QIJ A;  2KJH B;  3AU4 A;  2A5U A;  3RT3 B;  4N9F 4;  3NZU A;  1ZKH A;  2BYE A;  1CMX B;  1XQQ A;  3PLU A;  3ZVV A;  2ZVO A;  4MM3 A;  4K7W A;  4MDK E;  2IY0 B;  2L8J A;  4JGH B;  4MEL A;  1KJT A;  3PZD A;  2KFK A;  4MEM A;  4W9K A;  1WM2 A;  1RAX A;  1E8X A;  1LM8 B;  2BF8 B;  3B08 A;  2NCN A;  2D07 B;  4XX5 A;  5AZH A;  1E8Z A;  2C7H A;  2G4D B;  3PRE A;  3R3M A;  1S1Q B;  4AUQ C;  2PE6 B;  1Q5W B;  5D7G A;  4TQ1 A;  5DCN A;  2KN5 A;  5CHW A;  2B3A A;  3V6E B;  4BFR A;  1Y8R C;  2KHW B;  2LVP A;  3L54 A;  4KV2 A;  2MLB A;  4TQ0 A;  3RCZ A;  4BKS A;  3ZTC A;  3IBE A;  1P98 A;  3IG3 A;  4K1R B;  3A9J B;  1WXV A;  2AL6 A;  4IWP A;  2JPH A;  2M8S A;  2NPT A;  2DZM A;  2JXX A;  3WAP A;  4DHZ B;  2L05 A;  2LVQ A;  5TR5 A;  4FUL A;  3QAQ A;  1Q0W B;  3WAN A;  4EUT A;  2J0M A;  1YQB A;  2N7E A;  3QCA A;  5E6P A;  4KDL B;  4DDI D;  1WY8 A;  2CU1 A;  2KOX A;  2JZZ A;  5D6J B;  4LJO B;  3RZF A;  2N9X A;  4GU2 A;  1WGY A;  2DHZ A;  3CST A;  3ZRC A;  2KXJ A;  2UYZ B;  4OVU A;  4AJY B;  3ZW3 A;  4ANW A;  4IM2 A;  4HCP B;  3N3K B;  2D10 A;  3RUL A;  2KWV B;  4DDG D;  1ISN A;  4EZJ A;  4I6P A;  2XEW A;  3NHE B;  2GBJ A;  3A9J A;  3HM3 A;  5JZE B;  3H1U A;  3T9L A;  1I35 A;  4PYU A;  5BO4 B;  2KX3 A;  4KSK C;  4W9G A;  1WXM A;  2DX5 B;  2KNB A;  4W9L A;  2R2Q A;  4TKN A;  1A5R A;  2IO0 B;  4WWO A;  3VXW A;  4DHJ D;  2M4N A;  2ZNV B;  2MP2 B;  4WAA A;  1WR1 A;  3AUL A;  1WJ6 A;  2LUE A;  2BPS A;  3V60 A;  3A4S C;  5IA7 A;  3QK0 A;  2CKH B;  1KLV A;  4RM9 A;  2IO3 B;  2C7N B;  4NJ6 A;  2MBQ A;  1QZE A;  3KUC B;  4EOY A;  1RFA A;  2LI5 A;  3L17 A;  3VDZ A;  3ZLZ A;  4BOZ B;  3A9K B;  2FCM A;  3U30 A;  3LJ3 A;  3KW5 B;  3ZTD A;  1KM7 A;  2MP2 A;  2NBW B;  3APD A;  2MQJ A;  4GGQ A;  4B95 A;  4MGY E;  3K9P B;  3VTV A;  2KDI A;  2BGF A;  2JRH A;  1UGM A;  1YX5 B;  1WX8 A;  2HE7 A;  3JSV B;  1HE8 A;  5GMV A;  1V80 A;  5CX3 A;  3VAW A;  1KOT A;  4NJ7 A;  5IAA C;  4CHK A;  4EKU A;  2ZJD A;  4PS7 A;  1WH3 A;  4ZRJ A;  2KO3 A;  2JUO A;  1YX6 B;  2CR5 A;  2N7D A;  4KZ0 A;  4FJV B;  5AZG A;  4FJZ A;  2CS4 A;  2KQS A;  2FAZ A;  4LCD E;  4XZ4 A;  1WI0 A;  3OJ4 B;  2LRU A;  2RR9 A;  1GG3 A;  3X0W A;  4BKT A;  1WX9 A;  3UF8 A;  3QX1 A;  1F9J A;  1V5T A;  1WF9 A;  4GSW A;  5E6O A;  4EZL A;  2C60 A;  4MSM B;  2LGX A;  5C23 A;  4BKS D;  3WAL A;  1WGH A;  2BWE S;  3TL5 A;  3N32 A;  4MGK E;  4G0N B;  2RSU A;  2L3Z A;  4NPN A;  3DVN V;  3PGE A;  4K7U A;  2DZJ A;  4GB9 A;  3RZW C;  4B9K A;  2C7M B;  2PEA A;  4HWI B;  2LAS A;  3P2B A;  4W9E A;  4RMA A;  1WYW B;  3D32 A;  1EF5 A;  2KLG A;  3GZN I;  2J7Q B;  3OJ3 A;  2KWC A;  4GMV A;  4IUM B;  3ZDM C;  3RD2 A;  2M0X A;  4DXA B;  1YIW A;  3Q3J A;  4I6L B;  4WJQ A;  3SU8 X;  3VFK A;  2BYF A;  2HTH A;  3APC A;  2IYD B;  2NPT B;  3EC8 A;  3DPD A;  3PLV A;  4LJP B;  3ZNH B;  1V9J A;  1WMH A;  2DYM A;  2REX A;  2W9N A;  4WWN A;  1UBQ A;  1GNU A;  1TZ1 A;  2ZZP B;  3BIN A;  4JQW C;  3ZKJ C;  4M8M A;  3QAR A;  4OVV A;  4WJN A;  3JVZ X;  1V86 A;  3EFU A;  2K6D B;  4NAW A;  4W9H A;  1OGW A;  2KWU B;  1J19 A;  3V62 A;  2D11 A;  4FHK A;  3ZDT A;  3R7R A;  4PS8 A;  4KDI C;  5KHQ A;  3A1Q B;  1ZW7 A;  2K25 A;  3L0W B;  1E8W A;  4KIK A;  4HXD A;  4BKG A;  3R66 C;  5KHO A;  4PS3 A;  2LGD A;  2I1J A;  3DVG X;  1WGD A;  2DEN B;  3IHP C;  4URK A;  4ICU A;  2M1M A;  2N4F A;  3EEC A;  2CHW A;  4A20 A;  4HDQ A;  2IY1 B;  3PT2 B;  4E74 A;  2HJ8 A;  4GIV A;  3B1L X;  3DBS A;  4YL8 A;  3UGB B;  4A3P A;  2PE9 A;  2K8B A;  2O6V A;  1WJ4 A;  4DWF A;  3QWZ B;  5J18 A;  2FUH B;  1U4A A;  2CHX A;  4G11 A;  4FLH A;  4HK2 A;  3A1Q A;  5AEK B;  1UBI A;  5CHF A;  3ONS A;  1P9D U;  1UZX B;  3K9O B;  4ZYN A;  2LZ6 A;  3BY4 B;  1NI2 A;  4NNJ B;  2ZPY A;  2R2O A;  1I42 A;  3NS8 A;  4AP4 C;  3M3J A;  2JRI B;  4WQO B;  2DAJ A;  3C0R B;  2CHZ A;  4BBN F;  4AJW A;  2PJH A;  1V49 A;  4NQL B;  5G2N A;  3UQB A;  2V4L A;  1VCB A;  2JF5 A;  2G4S A;  1E7U A;  2J0K A;  3VUY A;  1GUA B;  2KTR A;  2C5L C;  2WWZ A;  3JYU A;  2N9E B;  4E71 A;  4HCN B;  1WJU A;  3DBR I;  3CMM B;  2MBB B;  3KYD D;  1WGR A;  3RYT A;  1WX7 A;  2IZV B;  2RGF A;  2KFJ A;  1K8R B;  2K8C A;  3UIO B;  2BKR B;  1WE6 A;  2M17 A;  1PQS A;  4GXB A;  3WIM A;  1RRB A;  2KX0 A;  1BT0 A;  1J8C A;  3IFW B;  2V1Y A;  3SHQ A;  4P7I A;  2ASQ A;  1GC7 A;  1RLF A;  2KVR A;  5CHV C;  2KK8 A;  4B6W A;  2MBH A;  4HJK A;  2L0F A;  4MJS A;  2LD9 A;  4WJO A;  3VUX A;  2FID A;  3DBL I;  3M62 B;  3PRM B;  1WM3 A;  2I1K A;  2NR2 A;  2BKF A;  4FAD A;  2KMC A;  4BOS C;  5J2R A;  3TMP B;  1EO6 A;  2ZNV C;  2FCN A;  4PYZ A; 
#chains in the Genus database with same CATH topology
 1XT9 B;  3ECI A;  5CTR C;  1YNT E;  3Q8E A;  1SIF A;  1ZGU B;  2DZK A;  3AE6 B;  4A3O A;  1NEN B;  2GMI C;  5C1Z A;  1SF0 A;  4AWJ A;  1F1H A;  2WXK A;  2YEP B;  3FIL B;  3UIP B;  4FBJ B;  2IGG A;  1E7V A;  3ALB A;  3KQ4 A;  3MTN B;  4WWP A;  4D2K A;  2HJ1 A;  3ZYY X;  2IO2 B;  3APF A;  3Q3F A;  5IP4 D;  3M95 A;  3Q69 A;  4ANV A;  4XYC A;  4IM3 A;  2M56 B;  4F1S A;  1R4N I;  2E6X A;  3FIL A;  1D4B A;  1JWU D;  3TEY A;  2X8X X;  1WGG A;  3B9J A;  4WH4 A;  4HRO A;  1WZ0 A;  2AL3 A;  2MBE A;  4TUU A;  4FHJ A;  1UD7 A;  1KRH A;  2O6V B;  2K8H A;  2MWS B;  3ZJT A;  1ET9 A;  4IC7 B;  3NVZ A;  4XC2 A;  2INN E;  1C76 A;  1J0G A;  2LUM A;  2L7R A;  2KMA A;  4ZRQ A;  5BYR A;  3GOE A;  4RGN A;  1LQB A;  2D3G A;  1OQY A;  3AE7 B;  3VVW B;  3W5V B;  3MC0 B;  1L0V B;  4GDL B;  1IPG A;  2KJR A;  3SDL C;  1KLG D;  2OOB B;  4MH0 E;  1OQQ A;  5DPR A;  1L0X B;  3BII D;  4JWS C;  1E8Y A;  1SJH D;  1TY2 A;  2VH2 A;  1AW7 A;  1FFV A;  2GLS A;  3AI5 A;  2A4Z A;  3HM6 X;  1CQV A;  1EWY C;  2LHE A;  3EA6 A;  3L10 B;  4GDL A;  1VDV A;  3GE3 C;  5HKH A;  3CWI A;  1HTQ A;  1GB4 A;  2DAF A;  4ANX A;  3U7D A;  1C77 A;  2K39 A;  2CU3 A;  3PHX B;  2C9W B;  3KYC D;  3NZS A;  3AEC B;  2NBV B;  2L32 A;  1F2R C;  5D3I B;  1V6E A;  2W3S A;  1TBE A;  2LXC A;  3BK1 A;  1F0Z A;  2AEH A;  5JHB A;  2MA9 B;  2KDF B;  2LXA A;  3VRB B;  4GOC A;  2JX5 A;  2PKO A;  1V1O A;  1D6E C;  3AE2 B;  1TS4 A;  2PIA A;  2K0P A;  3H7S A;  2YVC A;  4USA A;  2G9H D;  5IO9 A;  3AB5 A;  1UNS A;  2KAN A;  2ZCB A;  4FXC A;  2DWQ A;  2V0G A;  1NBF C;  5E6N A;  3DOW A;  1QOF A;  2LGI A;  2N9L A;  4WJP A;  1HTO A;  2Z59 B;  3DQV A;  4ZDV A;  2RPQ A;  2GRI A;  2GBM A;  1XLQ A;  4G3X B;  4JIO U;  1FXT B;  1TJE A;  3PSE B;  3DDC B;  4JL9 A;  5EE1 A;  4K81 A;  2EKI A;  5LLI A;  4P6V F;  3JSV A;  2WX0 A;  4KZC A;  1NDD A;  3I5J C;  1V1P B;  5IN7 A;  3L13 A;  4IW0 A;  2O2V B;  3P63 A;  4M02 A;  2AX5 A;  4KGS A;  2KJH B;  3NZU A;  1XQQ A;  2ZVO A;  4JGH B;  4HKZ E;  1N5X A;  4MEM A;  1JRO A;  1RAX A;  2D07 B;  4XX5 A;  2C7H A;  4RGM A;  2PE6 B;  2IND C;  4TQ1 A;  4L2Y A;  4BFR A;  4YSX B;  1Y8R C;  2AQ2 B;  2MLB A;  4BKS A;  2J52 A;  2W82 A;  1JAL A;  1FRR A;  1P98 A;  1ZOY B;  3IG3 A;  3VR8 B;  2N9K A;  2AL6 A;  4IWP A;  2JPH A;  3WAP A;  2L05 A;  5TR5 A;  4KKJ A;  4EUT A;  4KKI A;  2W55 A;  1YQB A;  5E6P A;  4KDL B;  2KOX A;  2LGS A;  1MPE A;  1A70 A;  1WGY A;  4RCO A;  2WXG A;  4JE3 B;  2KXJ A;  2L1A A;  5TSS A;  4AJY B;  4ANW A;  4IM2 A;  4DDG D;  2KWV B;  2XEW A;  3V05 A;  5JZE B;  1QOG A;  2ON8 A;  5BO4 B;  4W9G A;  1YMH E;  1WXM A;  3TEW A;  3NG0 A;  4W9L A;  2IO0 B;  2BB6 A;  3AEE B;  4WWO A;  4DHJ D;  2M4N A;  4Q2J A;  2QSD A;  3AUL A;  2LUE A;  4YSZ B;  4K3C A;  1WSP A;  1KLV A;  2IPK D;  3I63 C;  3T3O A;  3L17 A;  1UF0 A;  2H88 B;  3C8Y A;  3VDZ A;  1T6B X;  2J42 A;  2FCM A;  2QC8 A;  3LJ3 A;  1JWS D;  1PGB A;  2V3N A;  1KM7 A;  3APD A;  4GGQ A;  3SFE B;  5GMV A;  2BGF A;  2JRH A;  2HE7 A;  1V80 A;  4C00 A;  4PS7 A;  4OHJ A;  2KO3 A;  4KZ0 A;  4FJV B;  1HA5 A;  3AED B;  3DWM A;  5JXV A;  2KQS A;  2FAZ A;  1HEZ E;  1WI0 A;  1SE3 A;  5G5H A;  1GG3 A;  3QX1 A;  1F9J A;  1V5T A;  1JRP A;  4MSM B;  5C23 A;  2D3B A;  2RSU A;  1M4V A;  4B9K A;  4HWI B;  2LAS A;  1XXG A;  1NYR A;  3GZN I;  3OJ3 A;  4GMV A;  4C80 A;  3RD2 A;  4A8X C;  4WJQ A;  3SU8 X;  3VFK A;  1MHH E;  5FK9 C;  2IYD B;  3BIN A;  3Q3M C;  1V86 A;  4OVZ A;  2K6D B;  4NAW A;  5LNK 1;  2KWU B;  2PTL A;  4IKG A;  4FHK A;  3ZDT A;  3L0W B;  1E8W A;  2RDB C;  3R66 C;  5KHO A;  2LGD A;  4ACF A;  2DEN B;  2M1M A;  2ZW1 A;  2QIE B;  1L4D B;  1VZ6 A;  3ZJV A;  1UWM A;  4DWF A;  1F52 A;  3EGR A;  4C7Y A;  5CHF A;  2LJI A;  1P9D U;  4ZYN A;  1I4Q A;  1NI2 A;  4NNJ B;  2ZPY A;  4AP4 C;  3M3J A;  4WQO B;  1YQ4 B;  1EU3 A;  1OFF A;  2DAJ A;  3C0R B;  4AJW A;  4NQL B;  2JSV X;  4P16 A;  5G2N A;  5D3D A;  3UQB A;  1FEH A;  1VCB A;  5C3J B;  2G4S A;  2WXI A;  1BUI C;  3FAH A;  1RM6 C;  3VUY A;  4E71 A;  2D3C A;  3KYD D;  1WGR A;  1QIL A;  2JZP A;  2WDR B;  1EWC A;  1K8R B;  2K8C A;  1JCK B;  3Q3O C;  1SEB D;  4P7I A;  1GC7 A;  1RLF A;  3RNA C;  4YTN B;  4WJO A;  2FID A;  3M62 B;  1PGX A;  2NR2 A;  3MP9 A;  4O1N A;  2BKF A;  2KMC A;  4RF0 A;  2FCN A;  4RF1 A;  1WR6 E;  3DCG A;  2KKC A;  2MX2 A;  3Q8C A;  2JY6 A;  1SGH A;  2DYB A;  3RNC C;  4IM0 A;  4LNK A;  2OJW A;  3VTU A;  5AZF A;  4W9I A;  2N1W A;  2MW5 A;  3BVZ A;  1YQ3 B;  3VTW A;  3E9S A;  3NOB A;  2JZ3 B;  2KQ7 A;  4KGT A;  2K1F A;  2XK5 A;  3AE8 B;  2BWF A;  2RMM A;  5BMG A;  1WRD B;  1T0Y A;  4KIK B;  4DBG A;  1CZP A;  1H4R A;  3P4Q B;  3JW0 X;  2IJ0 A;  2KDM A;  4JLC A;  4M0W A;  3L4P A;  2O6V D;  3WAM A;  1C79 A;  4F8C B;  3PO0 A;  4LDT B;  1MI0 A;  3PZ8 A;  3C19 A;  2ZPN A;  4US9 A;  3S2A A;  3W1Y A;  3QC8 B;  5BMH A;  2JYE A;  4J6I A;  4DK5 A;  5DPT A;  1OEY J;  3DBH I;  2ZVN A;  2VZK B;  3N20 C;  4IG7 B;  2V3S A;  1CJE A;  4G50 A;  2GBK A;  1SE9 A;  5LXH A;  2IO1 B;  2WQY B;  1I4H A;  1C4A A;  2K5P A;  1WZ3 A;  1XEE A;  2KZR A;  3CSF A;  1OEY A;  4CO7 A;  3VHT C;  4FJY A;  2L0T A;  2Y3A A;  4HPL B;  2BT6 A;  2MCN B;  4FN2 A;  2RD0 A;  2WYQ A;  2ZCC A;  1V97 A;  1L6V A;  1UWX A;  2ICI A;  3MC9 A;  4FA6 A;  1JW9 D;  1PGA A;  3AH7 A;  5DPW A;  1MG8 A;  4HKQ A;  4GN1 A;  1WJN A;  1I4G A;  2G3Q B;  2DYO A;  2KMM A;  1JWA D;  3DVN U;  2J53 A;  2YLM A;  2ZW0 A;  3QHT A;  4OZC A;  3KUZ A;  4M01 A;  4EEW A;  1WXA A;  2QIL A;  1TKG A;  3TSS A;  2MJ3 A;  2KDB A;  2LRW A;  3AE9 B;  2KC1 A;  4W9F A;  2V3P A;  2N0S B;  1N61 A;  4X57 B;  2FIF A;  5EE9 A;  1IP9 A;  1MG4 A;  3I3T B;  3Q8A A;  3KVF B;  3TBL D;  3AE4 B;  5J17 A;  3U8Z A;  1Z2M A;  3ZXR A;  2AQ1 B;  2SEB D;  1Y56 A;  5FR6 A;  2LWP A;  3OAW A;  4RM8 A;  2WXF A;  4ICV A;  4YSY B;  1IGC A;  4XDD A;  1XD3 B;  4NY0 A;  2WHI A;  2Z0E B;  1P0R A;  2Y5B B;  4M8N A;  2KAC A;  1C3T A;  5JHA A;  1N6Z A;  2FCQ A;  4CYE A;  1Z5S B;  2N9P C;  3Q3N C;  3L08 A;  2VRR B;  1GAQ B;  1WIA A;  1STE A;  4ARC A;  2KFK B;  5L95 C;  1UEL A;  3DBR B;  5D2M B;  1P3Q U;  3W1S C;  1VRA B;  2DBY A;  1K52 A;  3KWL A;  3ML8 A;  1WGK A;  3AEF B;  2BYE A;  1CMX B;  3AM9 A;  4MM3 A;  1PDX A;  4K7W A;  4MDK E;  4N59 A;  4MEL A;  1KJT A;  1P7E A;  2KFK A;  1UUP A;  3IT4 B;  1WM2 A;  4AQ7 A;  1LM8 B;  2BF8 B;  3KWV A;  3DBL B;  2PMV A;  3PZ7 A;  3AEA B;  2BS3 B;  5AZH A;  3R3M A;  2KN5 A;  5CHW A;  3V6E B;  4HRS A;  1IUE A;  3RCZ A;  3ZTC A;  4EE2 A;  3IBE A;  4K1R B;  3A9J B;  1WXV A;  1I4P A;  2DZM A;  2LVQ A;  3QAQ A;  3WAN A;  1LGR A;  1C9F A;  4YTM B;  4LJO B;  3BYY B;  3BK2 A;  2E3T A;  3CST A;  1XLO A;  2UYZ B;  3ZW3 A;  3N3K B;  1ISN A;  3P4P B;  4I6P A;  2MEK A;  3A9J A;  3W2D A;  3H1U A;  3T9L A;  4PYU A;  4P1C C;  1JWB D;  2KX3 A;  1R4N B;  3AE5 B;  2QJL A;  1KFY B;  4ARI A;  2B76 B;  2BB5 A;  4DQO C;  1A5R A;  1K51 A;  3VXW A;  2MP2 B;  1WJ6 A;  2BPS A;  2OED A;  3A4S C;  5IA7 A;  2WXN A;  3LB8 C;  1E7P B;  2C7N B;  2IO3 B;  4NJ6 A;  1QZE A;  5IOI A;  1RFA A;  1XCQ L;  4BOZ B;  2J4X A;  2KAJ A;  4L23 A;  3LYY A;  3KW5 B;  4B95 A;  2MP2 A;  2MQJ A;  1C4P A;  3JSV B;  1UGM A;  5HFY A;  1KOT A;  5IAA C;  4ZRJ A;  4LTU A;  2JWU A;  1K53 A;  2VH1 A;  2CS4 A;  1QQR A;  4XZ4 A;  2RR9 A;  3X0W A;  4WIP A;  1J7C A;  1N5W A;  1WF9 A;  4GSW A;  5E6O A;  2C60 A;  3WCQ A;  3O13 A;  4OW0 A;  3N32 A;  2LFI A;  4MGK E;  4HPP A;  3DVN V;  2DZJ A;  4GB9 A;  5G5G A;  3IT6 B;  3P2B A;  1CK1 A;  5H92 C;  3D32 A;  2RPV A;  3N1X C;  1WYG A;  4I6L B;  2GB1 A;  2BYF A;  2HTH A;  2QDF A;  1FM0 D;  1ZPS A;  3EC8 A;  4LJP B;  3AE1 B;  3ZNH B;  1V9J A;  1WMH A;  1VLB A;  1QF6 A;  1GNU A;  1TKY A;  2ZZP B;  1I4X A;  4JQW C;  4M8M A;  4WJN A;  1PFD A;  1SB3 C;  1OGW A;  1J19 A;  3A1Q B;  3ABV B;  3DHI C;  4PS3 A;  3DVG X;  1WGD A;  4S0R A;  3W5U B;  3KLS X;  4WAF A;  5BYQ A;  1MVK A;  4B0M A;  2CHW A;  3PT2 B;  4E74 A;  3DBS A;  2YEP F;  3RI7 C;  3UGB B;  5J18 A;  2CHX A;  4FLH A;  2M0A A;  3A1Q A;  3K9O B;  2R2O A;  3MJ5 A;  4BBN F;  1V49 A;  2WDV B;  2V4L A;  2INC C;  2JF5 A;  3IAS 1;  1E7U A;  1GUA B;  2KTR A;  1QOA A;  2C5L C;  1SJE D;  1WX7 A;  2RGF A;  2KFJ A;  2BKR B;  1WE6 A;  4PK1 A;  2TSS A;  4GXB A;  1AWD A;  1RRB A;  1BT0 A;  1J8C A;  1V8C A;  2ASQ A;  2NMQ A;  2ONQ A;  2MBH A;  4HJK A;  2L0F A;  4MJS A;  1WM3 A;  1T0Q C;  1DGJ A;  5J2R A;  1T0S C;  1EO6 A;  4PYZ A;  2LVO A;  1VZ7 A;  4GLS C;  3BZD B;  3AEG B;  1G6J A;  1D5Z C;  4LNF A;  2KTF A;  3HK0 A;  5T8I A;  1NI3 A;  1E9M A;  1N60 A;  3SR6 A;  3V3X A;  1R7S A;  1B9R A;  2D3A A;  1P1A A;  2EMT A;  2NBU A;  3IXS A;  4NAW B;  1DYQ A;  2MJE A;  1ZDV A;  1FNW A;  4LDT D;  4ANU A;  1E10 A;  1YJ1 A;  2GOW A;  1YN3 A;  3H9D A;  3UI3 A;  3T3N A;  1VJK A;  2VZK D;  2KJ6 A;  2WXR A;  2QHO A;  1Q1O A;  2UWQ A;  4XDC A;  3SD5 A;  1J7A A;  2L76 A;  1JML A;  4IWO A;  3ML9 A;  1S3S G;  2GI9 A;  3ZO5 B;  3EFC A;  4J3O D;  3Q8F A;  2LMC A;  2WDT B;  4RNA A;  4WQM A;  3R2T A;  3R8B A;  4JX1 C;  3QQ8 B;  3J9C A;  3I9V 1;  2Q5W D;  3O65 B;  2WX1 A;  2FUG 1;  4ZRK A;  3LDZ E;  1KTK A;  3P4R B;  1UH6 A;  1WE7 A;  3OWE B;  4IWQ A;  3AN1 A;  3MFG A;  2L52 A;  3URY A;  3UQA A;  3GS2 A;  2JT4 B;  1QT9 A;  1E90 A;  4WWM A;  3N30 A;  3U2S C;  1SIJ A;  1C78 A;  4P1B C;  3PVL A;  4PT5 A;  2HTM E;  1WXQ A;  3PTF C;  3ZRF A;  3PV1 A;  1E5W A;  1VD2 A;  2KD0 A;  3VRA B;  4HLE A;  4XWT A;  1TYG B;  3GZN B;  4HVB A;  2WU5 B;  2K6Q A;  3AXC A;  3ZNZ B;  2L83 A;  2AYO B;  5JH5 C;  3B0A A;  2J0J A;  4BAX A;  4NZL B;  1XLP A;  4YWG G;  3KUD B;  1ZXH A;  3EHV A;  4H2A A;  3RNE C;  3MJW A;  4IOI E;  3P4S B;  4II3 B;  4DHJ B;  1QLB B;  3HUI A;  2D2Q A;  2XK5 B;  2DZI A;  2KC2 A;  3PS6 A;  3QA8 A;  2LEK A;  2NS5 A;  3ZUN A;  2M19 A;  3GP7 A;  1AN8 A;  3T8M A;  3X23 A;  4YXD B;  4GDK B;  4M0W B;  1D3Z A;  3IVF A;  3A9K A;  4AOF A;  3AMZ A;  4KVG B;  1AYF A;  5EE3 A;  2BYV E;  2RDH A;  2XN9 C;  2HDE A;  3Q6B A;  3KH0 A;  2BVC A;  3VUW A;  3PHW B;  1F2R I;  3SEB A;  3U4E G;  4GDK A;  3W1S A;  4HPM B;  3HHM A;  2KYW A;  3RUI B;  1YD8 U;  3A33 B;  1KH0 A;  3R7Q A;  3VH3 B;  3OLM D;  2KWD A;  1FIQ A;  2QEJ C;  3H6N A;  3AU4 A;  2PVO D;  3RT3 B;  4N9F 4;  2WXM A;  1T0R C;  3SFD B;  3ZVV A;  2OHF A;  2SAK A;  2IY0 B;  3NRZ A;  4W9K A;  1ENF A;  4RGT A;  1E8X A;  3B08 A;  2NCN A;  1I7H A;  2Y5P A;  3DHH C;  1ROE A;  4ZHP A;  1E8Z A;  2G4D B;  3ZJU A;  2WXH A;  5D7G A;  5DCN A;  2B3A A;  3NVY A;  1FRD A;  2KHW B;  1IBX A;  3L54 A;  2MJD A;  4TQ0 A;  1FCC C;  1SBB B;  3GB1 A;  3RNG C;  4DHZ B;  2M8S A;  2NPT A;  2JXX A;  1ET6 A;  1Q0W B;  2N7E A;  3QCA A;  1TY0 A;  4C4V B;  2JZZ A;  3RZF A;  2QCZ A;  2N9X A;  4GU2 A;  2D10 A;  1XO3 A;  2K3U A;  1I35 A;  3NVV A;  2WLB A;  1FNU A;  1ESF A;  4DXF A;  2KNB A;  5GXG B;  4NAM A;  4C4V A;  1SXT A;  3AV8 A;  4TKN A;  4WAA A;  3V60 A;  3QK0 A;  2CKH B;  4RM9 A;  2MBQ A;  1L0Y B;  3DBH B;  1JQ4 A;  2MHJ A;  3MHZ A;  2LI5 A;  3RNF C;  4EOY A;  4KGR A;  1RFK A;  3U30 A;  2WNM A;  2PVG C;  2NBW B;  3P42 A;  1SSN A;  3K9P B;  4MGY E;  1OQR A;  2KDI A;  1WRI A;  1WX8 A;  1HE8 A;  5CX3 A;  1D5X C;  4CHK A;  3DWG C;  4EKU A;  3H8H A;  3E56 A;  2JUO A;  1YX6 B;  2CR5 A;  2N7D A;  2WDQ B;  4ZYS A;  3I57 A;  4FJZ A;  4REZ A;  1SE2 A;  1GOZ A;  2CJN A;  2LRU A;  4MH8 A;  1T3Q A;  4MM3 B;  1VZ8 A;  1K50 A;  1J7B A;  1TT5 B;  1C4C A;  4BKS D;  1PYW D;  3WAL A;  2BWE S;  3BVG A;  4NPN A;  2I38 A;  3PGE A;  4K7U A;  4C56 C;  2DLB A;  3FKY A;  4RMA A;  2KLG A;  4IUM B;  2J7Q B;  3ZDM C;  2KWC A;  1YIW A;  3Q3J A;  2W54 A;  3APC A;  3DPD A;  3PLV A;  2WXP A;  2WS3 B;  3TEZ A;  3Q14 C;  3ZKJ C;  3IAM 1;  3QAR A;  4OVV A;  4LK0 M;  4M00 A;  3N1Y C;  3FC4 A;  2WXO A;  4W9H A;  3V62 A;  2D11 A;  3R7R A;  4KDI C;  1ZW7 A;  2K25 A;  1YN4 A;  4BKG A;  3AE3 B;  2BS4 B;  4URK A;  1NEK B;  3BYT B;  4ICU A;  3B2F A;  1L4Z B;  3HRD D;  3TUO A;  3EEC A;  1BML C;  2IY1 B;  2HJ8 A;  3BVM A;  3B1L X;  4QAY A;  4YL8 A;  1NYQ A;  2Y5C A;  2PE9 A;  2K8B A;  2O6V A;  3QWZ B;  2FUH B;  1U4A A;  5AEK B;  1UZX B;  2BYT A;  3BY4 B;  3ZQ4 A;  2I2Y A;  3MC8 A;  4L1B A;  1RYJ A;  4A9A A;  2PJH A;  1DOI A;  2WU2 B;  2WP9 B;  2JYT A;  2J0K A;  3Q8B A;  3JYU A;  5HG2 A;  1VR9 A;  2N9E B;  4HCN B;  5C2T B;  3RYT A;  5AUI A;  2M17 A;  1SE4 A;  1PQS A;  3WIM A;  2KX0 A;  3IFW B;  5BYS A;  1HZ6 A;  5HHD G;  2V1Y A;  3SHQ A;  3ZXV A;  2KVR A;  1F77 A;  2V9H A;  5CHV C;  4ZOH C;  4TMA B;  2LD9 A;  3EUB 2;  1TS5 A;  2I1K A;  1PUT A;  4BOS C;  3RPF C;  1ZE3 D;  1V2Y A;  2IDY A;  2WXL A;  4CQN A;  2BBC A;  3N1Z C;  2PW9 A;  2NTT A;  4F7Z A;  1AAR A;  5MPO A;  2EKE C;  3NVW A;  4MSQ B;  1FNV A;  1N63 A;  1C1Y B;  2N1V A;  4ZRI A;  1WMH B;  3ZGZ A;  1V5O A;  1IYF A;  4KSL C;  2ZEQ A;  4TV3 A;  2JWZ A;  2EMS A;  2K9X A;  4YTP B;  4EFO A;  3WA0 A;  3RN9 C;  1GJZ A;  3PRP B;  1EUV B;  1FXA A;  4OZA A;  3H7P B;  2GBN A;  4HEA 1;  4TSS A;  1FFU A;  3ENE A;  4ZRP A;  1EF1 A;  1QOB A;  1TKE A;  1GC6 A;  1YJJ A;  1R4M I;  3NS1 A;  2HD5 B;  2K22 A;  3UIN B;  3ZNG C;  2BQQ A;  1OTR B;  4JPS A;  3HVD A;  1MFW A;  4BBN C;  1LFD A;  3H7P A;  4K7S A;  4HDO A;  4A6Q A;  2L00 B;  4ASW C;  1V1P A;  3WAO A;  3HIZ A;  3B2G A;  5L83 A;  2O2V A;  1M94 A;  3TJP A;  4MT5 A;  2KTR B;  1IGD A;  5G55 A;  2FCS A;  2KDE B;  3GE8 C;  2XBB C;  3VR9 B;  2LJ5 A;  3PPA A;  2AQ3 B;  1FCL A;  3U52 E;  1FXI A;  2V4I B;  4N6E B;  3OG5 A;  1WXS A;  3NZ3 A;  4W9C A;  1L6U A;  2EEL A;  1XCT L;  5H8Y E;  2AWT A;  1EM7 A;  4MJS B;  2FBW B;  5DPS A;  1FMA D;  5FR3 A;  1TIF A;  2Z0D B;  3VQI A;  1JRU A;  4ITK A;  2OJR A;  1ZUD 2;  4US8 A;  3CIR B;  2NVU I;  2KLC A;  5HI1 A;  4E3C A;  4N58 A;  1P7F A;  3PRZ A;  1YN5 A;  1TZO A;  2LHD A;  2LGY A;  3M63 B;  4R3D A;  2FE8 A;  3DVG Y;  1WWT A;  2MRP A;  1ZXI A;  1X1M A;  3VH4 B;  2JVC A;  1R4M B;  4I6N B;  4K3B A;  4MGZ E;  2IBI B;  1Q10 A;  2G45 B;  4W9D A;  5D94 A;  5FKA C;  4NJC A;  4BVU C;  3CF6 E;  1BXT A;  3V61 A;  3L16 A;  2GBR A;  3BWU D;  1KF6 B;  3RNB C;  1N62 A;  2RDG A;  3NY5 A;  1TGZ B;  2MBO A;  3AU5 A;  1NVI D;  4DHZ E;  4MGI E;  4NQK E;  4II2 B;  3QJZ A;  1B1Z A;  5E6J A;  1TTN A;  1H8C A;  2PPH A;  4W9J A;  2KVZ A;  5EDS A;  2MSE D;  1YJI A;  1V81 A;  1GB1 A;  3Q2A C;  4EZK A;  1TS2 A;  5LXI B;  2FNJ B;  1L2N A;  3ZIM A;  3TCA A;  1I4R A;  1L7Y A;  3A4R A;  4OZB A;  4RFB A;  3V6C B;  2BTE A;  3ZNI D;  2IGD A;  4IDI A;  1LXD A;  1WFY A;  3MHS D;  2JXT A;  3QIJ A;  2A5U A;  1ZKH A;  5BMI A;  3PLU A;  2WXJ A;  1KLU D;  4S17 A;  2L8J A;  2N7J A;  3PZD A;  4BZA A;  1XF5 L;  1MJD A;  3PRE A;  2H89 B;  1S1Q B;  4AUQ C;  1Q5W B;  2LVP A;  4RH6 A;  4KV2 A;  4ZHO A;  2WGS A;  4UDU C;  2NTS A;  2INP E;  3ETR A;  4KX6 B;  4FUL A;  3RFZ B;  2J0M A;  2UU7 A;  4DDI D;  1WY8 A;  2CU1 A;  1FO4 A;  5D6J B;  4XE0 A;  5I4D A;  2DHZ A;  3ZRC A;  4OVU A;  2R61 A;  1JWM D;  4HCP B;  4EZJ A;  3RUL A;  3NHE B;  3TEX A;  2GBJ A;  2D5G A;  3HM3 A;  1QKZ A;  4KSK C;  4LNN A;  2DX5 B;  1TS3 A;  1EU4 A;  2R2Q A;  1E6E B;  1RWS A;  4XGA B;  2ZNV B;  3R2I A;  1WR1 A;  2KT7 A;  5IKC M;  3KUC B;  2ACZ B;  1HXY D;  3ZLZ A;  3A9K B;  3NJT A;  4MAC A;  3W9C B;  3ZTD A;  2WXQ A;  3VTV A;  5AUK A;  1XLN A;  1YX5 B;  4XWW A;  3VAW A;  4NJ7 A;  1DOX A;  5EE0 A;  4A55 A;  2ZJD A;  1WH3 A;  4JWU C;  2IGH A;  1LO5 D;  2G1E A;  5AZG A;  4DXG A;  2QMT A;  1FPY A;  4LCD E;  3NUH B;  3OJ4 B;  2JQR B;  4BKT A;  1WX9 A;  3UF8 A;  3RMK C;  3U7Z A;  1DOY A;  4EZL A;  1HQR D;  3N9Y C;  2LGX A;  1WGH A;  2X38 A;  3TL5 A;  4G0N B;  2L3Z A;  4RGO S;  3DHG C;  3RZW C;  2C7M B;  2PEA A;  1IBX B;  4W9E A;  3HVZ A;  1WYW B;  1EF5 A;  4HJG E;  2W3R A;  2JU6 X;  2M0X A;  4DXA B;  2KN4 A;  1ZDX A;  2NPT B;  2REX A;  2DYM A;  2W9N A;  1YOV B;  4WWN A;  1UBQ A;  1TZ1 A;  3JVZ X;  2PLP A;  3EFU A;  4AS1 A;  4PS8 A;  5KHQ A;  1FD6 A;  1E0Z A;  4KIK A;  4HXD A;  2I1J A;  3IHP C;  4B0E A;  2N4F A;  1MHX A;  4A90 A;  4A20 A;  4HDQ A;  2Z8L A;  4GIV A;  4A3P A;  2DNF A;  2MH7 A;  1WJ4 A;  4G11 A;  4HK2 A;  3AEB B;  1UBI A;  3ONS A;  2LZ6 A;  1GPX A;  1I42 A;  3LXF A;  2KQ4 X;  3NS8 A;  1HZ5 A;  2CJO A;  2JRI B;  2CHZ A;  2BS2 B;  4C7Z A;  4WUR A;  4LNO A;  2WWZ A;  4LLG M;  1D5M C;  1WJU A;  3DBR I;  3CMM B;  2MBB B;  1ACC A;  2IZV B;  3UIO B;  3P1M A;  1UGJ A;  1L5P A;  1ZP0 B;  2KK8 A;  4B6W A;  2BW2 A;  3VUX A;  2XNA C;  4YT0 B;  3DBL I;  1T5X D;  3PRM B;  4LNI A;  4FAD A;  3TMP B;  2ZNV C;  3TIX A; 
#chains in the Genus database with same CATH homology
 2LVO A;  1XT9 B;  3ECI A;  5CTR C;  1WR6 E;  3DCG A;  1SIF A;  1ZGU B;  1V2Y A;  2DZK A;  2KKC A;  2MX2 A;  2JY6 A;  1SGH A;  2DYB A;  1G6J A;  4IM0 A;  4A3O A;  3VTU A;  2GMI C;  2KTF A;  3HK0 A;  4W9I A;  5AZF A;  5C1Z A;  2N1W A;  4F7Z A;  4AWJ A;  1AAR A;  2EKE C;  2MW5 A;  3VTW A;  3UIP B;  4FBJ B;  4MSQ B;  3NOB A;  1E7V A;  3ALB A;  1C1Y B;  2JZ3 B;  2N1V A;  2KQ7 A;  3MTN B;  1WMH B;  4WWP A;  4ZRI A;  1V5O A;  1IYF A;  4KSL C;  1P1A A;  2EMT A;  2NBU A;  2K1F A;  2ZEQ A;  2XK5 A;  2IO2 B;  3APF A;  3Q3F A;  4TV3 A;  2JWZ A;  2BWF A;  3M95 A;  2EMS A;  4NAW B;  4ANV A;  1WRD B;  4IM3 A;  4EFO A;  3WA0 A;  1T0Y A;  4F1S A;  4LDT D;  1R4N I;  4ANU A;  1GJZ A;  4KIK B;  3PRP B;  1EUV B;  1YJ1 A;  4DBG A;  1H4R A;  2GOW A;  3H9D A;  3JW0 X;  4JLC A;  2O6V D;  3H7P B;  3WAM A;  4F8C B;  2GBN A;  1WGG A;  4LDT B;  3ENE A;  2KJ6 A;  3TIX A;  1WZ0 A;  2AL3 A;  2MBE A;  2QHO A;  4TUU A;  1Q1O A;  2UWQ A;  2ZPN A;  1EF1 A;  3S2A A;  4FHJ A;  3SD5 A;  3W1Y A;  1UD7 A;  3QC8 B;  1GC6 A;  1R4M I;  2O6V B;  4J6I A;  4DK5 A;  2HD5 B;  2K8H A;  2L76 A;  5DPT A;  3UIN B;  1OEY J;  3DBH I;  3ZNG C;  2MWS B;  2ZVN A;  4IG7 B;  2V3S A;  3ML9 A;  4IWO A;  1S3S G;  4G50 A;  1OTR B;  3ZO5 B;  4IC7 B;  4BBN C;  2GBK A;  4XC2 A;  1SE9 A;  5LXH A;  2WDT B;  2IO1 B;  1LFD A;  3H7P A;  1J0G A;  4K7S A;  4HDO A;  2L7R A;  2KMA A;  2L00 B;  4ASW C;  1WZ3 A;  3CSF A;  2KZR A;  3WAO A;  3QQ8 B;  3HIZ A;  3GOE A;  1OEY A;  4CO7 A;  5L83 A;  3VHT C;  3O65 B;  2WX1 A;  2O2V A;  1M94 A;  4ZRK A;  3TJP A;  3LDZ E;  4FJY A;  1LQB A;  2L0T A;  2D3G A;  4HPL B;  1OQY A;  1UH6 A;  1WE7 A;  4IWQ A;  2KTR B;  2MCN B;  5G55 A;  4FN2 A;  3VVW B;  2RD0 A;  2FCS A;  2KDE B;  2WYQ A;  2XBB C;  2ZCC A;  4GDL B;  2LJ5 A;  1IPG A;  3UQA A;  2KJR A;  3PPA A;  3SDL C;  2JT4 B;  4FA6 A;  1E90 A;  2OOB B;  3N30 A;  4MH0 E;  1WXS A;  4W9C A;  5DPR A;  5DPW A;  1MG8 A;  1E8Y A;  2AWT A;  4GN1 A;  3PVL A;  1WJN A;  4MJS B;  5DPS A;  2G3Q B;  2DYO A;  3AI5 A;  3DVN U;  2YLM A;  2Z0D B;  2A4Z A;  3PTF C;  3QHT A;  3VQI A;  3HM6 X;  3ZRF A;  1JRU A;  3KUZ A;  2OJR A;  3PV1 A;  1E5W A;  1VD2 A;  2KD0 A;  3L10 B;  4GDL A;  2NVU I;  2KLC A;  4E3C A;  4EEW A;  1WXA A;  4HLE A;  2KDB A;  3PRZ A;  4HVB A;  5HKH A;  2LGY A;  3M63 B;  2LRW A;  2K6Q A;  3AXC A;  3ZNZ B;  2DAF A;  4ANX A;  2AYO B;  5JH5 C;  2KC1 A;  4W9F A;  3U7D A;  2K39 A;  3B0A A;  3DVG Y;  2J0J A;  3PHX B;  4X57 B;  2C9W B;  3KYC D;  3NZS A;  2MRP A;  2NBV B;  1X1M A;  1V6E A;  2FIF A;  1TBE A;  3KUD B;  2LXC A;  1IP9 A;  3EHV A;  3VH4 B;  2AEH A;  2JVC A;  3I3T B;  3MJW A;  5JHB A;  3KVF B;  4I6N B;  3TBL D;  4MGZ E;  2IBI B;  5J17 A;  2MA9 B;  4II3 B;  4DHJ B;  2KDF B;  4W9D A;  2G45 B;  2LXA A;  5D94 A;  3U8Z A;  2D2Q A;  2XK5 B;  2DZI A;  4GOC A;  1Z2M A;  2KC2 A;  3PS6 A;  3QA8 A;  2NS5 A;  4BVU C;  3ZUN A;  3CF6 E;  3V61 A;  3L16 A;  5FR6 A;  3H7S A;  2YVC A;  2GBR A;  3T8M A;  3X23 A;  2LWP A;  2KAN A;  2ZCB A;  3OAW A;  4RM8 A;  3NY5 A;  1TGZ B;  4GDK B;  2MBO A;  4ICV A;  4M0W B;  1NBF C;  1D3Z A;  5E6N A;  3DOW A;  3IVF A;  1XD3 B;  4NY0 A;  1C3T A;  2Z0E B;  1P0R A;  2Y5B B;  4M8N A;  3AU5 A;  4WJP A;  5JHA A;  4DHZ E;  4MGI E;  2FCQ A;  2Z59 B;  3DQV A;  4II2 B;  4NQK E;  4ZDV A;  4CYE A;  3QJZ A;  2RPQ A;  1TTN A;  3A9K A;  2GBM A;  4AOF A;  4KVG B;  1H8C A;  2PPH A;  4G3X B;  1Z5S B;  2BYV E;  4JIO U;  2N9P C;  4W9J A;  3KH0 A;  1FXT B;  5EDS A;  2MSE D;  3PSE B;  3DDC B;  3L08 A;  1V81 A;  2VRR B;  1WIA A;  4JL9 A;  4K81 A;  5LLI A;  3VUW A;  4EZK A;  3PHW B;  5LXI B;  2FNJ B;  3JSV A;  1L2N A;  2WX0 A;  4GDK A;  3ZIM A;  4KZC A;  3TCA A;  4HPM B;  3W1S A;  3HHM A;  2KFK B;  1L7Y A;  3RUI B;  3A4R A;  1NDD A;  1YD8 U;  5L95 C;  3V6C B;  3A33 B;  1UEL A;  3ZNI D;  3L13 A;  3R7Q A;  5D2M B;  1LXD A;  1WFY A;  3MHS D;  1P3Q U;  4IW0 A;  3VH3 B;  3W1S C;  3OLM D;  2O2V B;  3ML8 A;  3H6N A;  3QIJ A;  2KJH B;  3AU4 A;  2A5U A;  3RT3 B;  4N9F 4;  3NZU A;  1ZKH A;  2BYE A;  1CMX B;  1XQQ A;  3PLU A;  3ZVV A;  2ZVO A;  4MM3 A;  4K7W A;  4MDK E;  2IY0 B;  2L8J A;  4JGH B;  4MEL A;  1KJT A;  3PZD A;  2KFK A;  4MEM A;  4W9K A;  1WM2 A;  1RAX A;  1E8X A;  1LM8 B;  2BF8 B;  3B08 A;  2NCN A;  2D07 B;  4XX5 A;  5AZH A;  1E8Z A;  2C7H A;  2G4D B;  3PRE A;  3R3M A;  1S1Q B;  4AUQ C;  2PE6 B;  1Q5W B;  5D7G A;  4TQ1 A;  5DCN A;  2KN5 A;  5CHW A;  2B3A A;  3V6E B;  4BFR A;  1Y8R C;  2KHW B;  2LVP A;  3L54 A;  4KV2 A;  2MLB A;  4TQ0 A;  3RCZ A;  4BKS A;  3ZTC A;  3IBE A;  1P98 A;  3IG3 A;  4K1R B;  3A9J B;  1WXV A;  2AL6 A;  4IWP A;  2JPH A;  2M8S A;  2NPT A;  2DZM A;  2JXX A;  3WAP A;  4DHZ B;  2L05 A;  2LVQ A;  5TR5 A;  4FUL A;  3QAQ A;  1Q0W B;  3WAN A;  4EUT A;  2J0M A;  1YQB A;  2N7E A;  3QCA A;  5E6P A;  4KDL B;  4DDI D;  1WY8 A;  2CU1 A;  2KOX A;  2JZZ A;  5D6J B;  4LJO B;  3RZF A;  2N9X A;  4GU2 A;  1WGY A;  2DHZ A;  3CST A;  3ZRC A;  2KXJ A;  2UYZ B;  4OVU A;  4AJY B;  3ZW3 A;  4ANW A;  4IM2 A;  4HCP B;  3N3K B;  2D10 A;  3RUL A;  2KWV B;  4DDG D;  1ISN A;  4EZJ A;  4I6P A;  2XEW A;  3NHE B;  2GBJ A;  3A9J A;  3HM3 A;  5JZE B;  3H1U A;  3T9L A;  1I35 A;  4PYU A;  5BO4 B;  2KX3 A;  4KSK C;  4W9G A;  1WXM A;  2DX5 B;  2KNB A;  4W9L A;  2R2Q A;  4TKN A;  1A5R A;  2IO0 B;  4WWO A;  3VXW A;  4DHJ D;  2M4N A;  2ZNV B;  2MP2 B;  4WAA A;  1WR1 A;  3AUL A;  1WJ6 A;  2LUE A;  2BPS A;  3V60 A;  3A4S C;  5IA7 A;  3QK0 A;  2CKH B;  1KLV A;  4RM9 A;  2IO3 B;  2C7N B;  4NJ6 A;  2MBQ A;  1QZE A;  3KUC B;  4EOY A;  1RFA A;  2LI5 A;  3L17 A;  3VDZ A;  3ZLZ A;  4BOZ B;  3A9K B;  2FCM A;  3U30 A;  3LJ3 A;  3KW5 B;  3ZTD A;  1KM7 A;  2MP2 A;  2NBW B;  3APD A;  2MQJ A;  4GGQ A;  4B95 A;  4MGY E;  3K9P B;  3VTV A;  2KDI A;  2BGF A;  2JRH A;  1UGM A;  1YX5 B;  1WX8 A;  2HE7 A;  3JSV B;  1HE8 A;  5GMV A;  1V80 A;  5CX3 A;  3VAW A;  1KOT A;  4NJ7 A;  5IAA C;  4CHK A;  4EKU A;  2ZJD A;  4PS7 A;  1WH3 A;  4ZRJ A;  2KO3 A;  2JUO A;  1YX6 B;  2CR5 A;  2N7D A;  4KZ0 A;  4FJV B;  5AZG A;  4FJZ A;  2CS4 A;  2KQS A;  2FAZ A;  4LCD E;  4XZ4 A;  1WI0 A;  3OJ4 B;  2LRU A;  2RR9 A;  1GG3 A;  3X0W A;  4BKT A;  1WX9 A;  3UF8 A;  3QX1 A;  1F9J A;  1V5T A;  1WF9 A;  4GSW A;  5E6O A;  4EZL A;  2C60 A;  4MSM B;  2LGX A;  5C23 A;  4BKS D;  3WAL A;  1WGH A;  2BWE S;  3TL5 A;  3N32 A;  4MGK E;  4G0N B;  2RSU A;  2L3Z A;  4NPN A;  3DVN V;  3PGE A;  4K7U A;  2DZJ A;  4GB9 A;  3RZW C;  4B9K A;  2C7M B;  2PEA A;  4HWI B;  2LAS A;  3P2B A;  4W9E A;  4RMA A;  1WYW B;  3D32 A;  1EF5 A;  2KLG A;  3GZN I;  2J7Q B;  3OJ3 A;  2KWC A;  4GMV A;  4IUM B;  3ZDM C;  3RD2 A;  2M0X A;  4DXA B;  1YIW A;  3Q3J A;  4I6L B;  4WJQ A;  3SU8 X;  3VFK A;  2BYF A;  2HTH A;  3APC A;  2IYD B;  2NPT B;  3EC8 A;  3DPD A;  3PLV A;  4LJP B;  3ZNH B;  1V9J A;  1WMH A;  2DYM A;  2REX A;  2W9N A;  4WWN A;  1UBQ A;  1GNU A;  1TZ1 A;  2ZZP B;  3BIN A;  4JQW C;  3ZKJ C;  4M8M A;  3QAR A;  4OVV A;  4WJN A;  3JVZ X;  1V86 A;  3EFU A;  2K6D B;  4NAW A;  4W9H A;  1OGW A;  2KWU B;  1J19 A;  3V62 A;  2D11 A;  4FHK A;  3ZDT A;  3R7R A;  4PS8 A;  4KDI C;  5KHQ A;  3A1Q B;  1ZW7 A;  2K25 A;  3L0W B;  1E8W A;  4KIK A;  4HXD A;  4BKG A;  3R66 C;  5KHO A;  4PS3 A;  2LGD A;  2I1J A;  3DVG X;  1WGD A;  2DEN B;  3IHP C;  4URK A;  4ICU A;  2M1M A;  2N4F A;  3EEC A;  2CHW A;  4A20 A;  4HDQ A;  2IY1 B;  3PT2 B;  4E74 A;  2HJ8 A;  4GIV A;  3B1L X;  3DBS A;  4YL8 A;  3UGB B;  4A3P A;  2PE9 A;  2K8B A;  2O6V A;  1WJ4 A;  4DWF A;  3QWZ B;  5J18 A;  2FUH B;  1U4A A;  2CHX A;  4G11 A;  4FLH A;  4HK2 A;  3A1Q A;  5AEK B;  1UBI A;  5CHF A;  3ONS A;  1P9D U;  1UZX B;  3K9O B;  4ZYN A;  2LZ6 A;  3BY4 B;  1NI2 A;  4NNJ B;  2ZPY A;  2R2O A;  1I42 A;  3NS8 A;  4AP4 C;  3M3J A;  2JRI B;  4WQO B;  2DAJ A;  3C0R B;  2CHZ A;  4BBN F;  4AJW A;  2PJH A;  1V49 A;  4NQL B;  5G2N A;  3UQB A;  2V4L A;  1VCB A;  2JF5 A;  2G4S A;  1E7U A;  2J0K A;  3VUY A;  1GUA B;  2KTR A;  2C5L C;  2WWZ A;  3JYU A;  2N9E B;  4E71 A;  4HCN B;  1WJU A;  3DBR I;  3CMM B;  2MBB B;  3KYD D;  1WGR A;  3RYT A;  1WX7 A;  2IZV B;  2RGF A;  2KFJ A;  1K8R B;  2K8C A;  3UIO B;  2BKR B;  1WE6 A;  2M17 A;  1PQS A;  4GXB A;  3WIM A;  1RRB A;  2KX0 A;  1BT0 A;  1J8C A;  3IFW B;  2V1Y A;  3SHQ A;  4P7I A;  2ASQ A;  1GC7 A;  1RLF A;  2KVR A;  5CHV C;  2KK8 A;  4B6W A;  2MBH A;  4HJK A;  2L0F A;  4MJS A;  2LD9 A;  4WJO A;  3VUX A;  2FID A;  3DBL I;  3M62 B;  3PRM B;  1WM3 A;  2I1K A;  2NR2 A;  2BKF A;  4FAD A;  2KMC A;  4BOS C;  5J2R A;  3TMP B;  1EO6 A;  2ZNV C;  2FCN A;  4PYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...