2KTRB

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MSLTVEAYLLGKEEAAREIRRFSFSFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFAIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrB00
3VUXA 2MBEA 1XT9B 2KDFB 4CHKA 2HD5B 1ZKHA 2MSED 1WGYA 3A1QB 3L54A 3PHXB 1WXAA 4RM9A 3QQ8B 1WIAA 1HE8A 3AXCA 1G6JA 2WWZA 1L2NA 2DZMA 3OAWA 3UQBA 1WX7A 3KH0A 3NOBA 2K1FA 1OTRB 2NBWB 3RD2A 2KK8A 2KVRA 2IO2B 2ZZPB 3SHQA 3VTWA 3PRMB 1A5RA 3W1YA 5C1ZA 2D3GA 4ASWC 3ZIMA 1RRBA 1Z5SB 2LASA 3JSVA 2MX2A 3QHTA 4FJYA 2ZCCA 3L10B 4DHZB 4KZCA 4MJSB 3H9DA 2JF5A 3TCAA 4MDKE 1EUVB 5CHWA 1IPGA 1R4NI 4IWPA 2LI5A 1RAXA 2L0TA 5G55A 5CTRC 2J7QB 2LWPA 1OGWA 4IWQA 2MLBA 2RPQA 3SD5A 3K9PB 4IUMB 4AP4C 1MG8A 5J17A 4IC7B 4E3CA 1D3ZA 1T0YA 3CSFA 3ZW3A 4DBGA 1WM2A 1E5WA 4G50A 2KANA 3V6CB 4KIKA 3S2AA 3L17A 3EFUA 2D07B 1R4MI 3T8MA 2LXAA 2WX1A 1RLFA 2GBJA 4LCDE 1WJNA 4HCPB 1V5OA 4K7UA 5JHBA 2C60A 2DYOA 3QIJA 2C7MB 2DENB 2REXA 3ZNGC 3ZKJC 5CHFA 4FULA 4XX5A 3A9KA 3L16A 4W9GA 3R7RA 1L7YA 4ZRJA 1I42A 3N3KB 2AEHA 3PT2B 3PPAA 1WMHA 3WANA 2KJRA 3WAOA 1WXMA 4W9HA 2ZVNA 4EOYA 4FJZA 2V3SA 3QCAA 2KFKA 2K39A 4GMVA 4ANXA 4G3XB 2KWCA 3VH4B 1V81A 4WWOA 2L3ZA 4HJKA 2L7RA 2EKEC 2KXJA 3PLUA 4LDTD 4EUTA 3QARA 2D2QA 1ZGUB 2L8JA 3NY5A 4FBJB 2ASQA 2DX5B 1LFDA 1UBIA 2G4SA 2IO0B 4NJ6A 5DPSA 2CHXA 2K8HA 4NAWA 3ALBA 1J19A 2AYOB 4MGKE 2HJ8A 3ZVVA 3DQVA 4MEMA 3VUWA 1OEYA 2LVOA 4B9KA 2R2QA 4XZ4A 2IZVB 2MBOA 2RGFA 3KW5B 4MSQB 2ZPNA 2VRRB 3AI5A 2V4LA 2KN5A 3QJZA 5KHOA 4HXDA 2GBKA 3CF6E 4HLEA 2NPTA 3PSEB 1WRDB 1WXSA 2FCSA 2NR2A 2YLMA 2JPHA 3ML9A 5L95C 1EF1A 3W1SA 1TBEA 2K6QA 2FNJB 2N7EA 2KTFA 3JSVB 2O6VB 3PHWB 4LDTB 4JQWC 4W9KA 3R3MA 5DPRA 2XEWA 2BYVE 1FXTB 2GBMA 2N9XA 2WX0A 4K1RB 3RZFA 3V6EB 2KOXA 4TUUA 5E6PA 5CHVC 1YQBA 4A3PA 4E71A 3PREA 3B08A 4A3OA 2MP2A 3VQIA 2K25A 3TJPA 2RR9A 2ZJDA 3CMMB 2QHOA 4KSLC 4NQKE 2KQ7A 2KTRB 1WY8A 4HCNB 4DWFA 2KJ6A 1I35A 1UD7A 4M8MA 3Q3FA 4PS3A 3PZDA 2IO3B 1SGHA 3VTVA 3ZTDA 4NQLB 5FR6A 2IY0B 3NZSA 4DHZE 4GU2A 1E7UA 5LXHA 2AL6A 4IM3A 3OJ4B 4KSKC 4DHJB 4BOSC 3CSTA 2G4DB 4IM0A 4WJNA 2K8BA 1TGZB 4AWJA 1V80A 4WJQA 4KIKB 1VD2A 2JRHA 3MTNB 1E7VA 2KZRA 4WQOB 4ANUA 2RSUA 4JLCA 2ZPYA 4ZRIA 4BOZB 2MRPA 2O6VD 3IVFA 4K81A 4WAAA 1Y8RC 2LVQA 2LVPA 5DPTA 4W9EA 2FCQA 2JVCA 3PVLA 4KDIC 4DDGD 1YIWA 3DBHI 2UWQA 2MBQA 2O6VA 4EZJA 3HM6X 1WGRA 4G0NB 4GOCA 4GB9A 3U7DA 1Q0WB 4F8CB 2JZZA 1UELA 3PV1A 2KFJA 2CHZA 3DBLI 2DHZA 1IYFA 3EHVA 1EF5A 3APCA 4GDKB 3B0AA 2GMIC 4FADA 2L76A 4GIVA 2K8CA 3ZRFA 2FCMA 1WM3A 4MM3A 2AWTA 1XD3B 1SE9A 3K9OB 5E6OA 2YVCA 1IP9A 2WYQA 3UIOB 1GC7A 1CMXB 4J6IA 4ZRKA 2R2OA 2CR5A 3A33B 3H7PB 5J2RA 2XK5B 2GBNA 1V9JA 2M0XA 2O2VA 3A4SC 3A9KB 3QX1A 4KV2A 4WWPA 2C9WB 2LRUA 4HWIB 1V5TA 3ENEA 3AU4A 3KYCD 5JHAA 2DYMA 3PRPB 2PE6B 3PLVA 2I1KA 3TBLD 3ML8A 3KUZA 2MW5A 2KC1A 2UYZB 3NS8A 1WGDA 1KLVA 3DVNV 1XQQA 4TKNA 4HK2A 3H7SA 3PS6A 3D32A 2BYEA 3A9JB 3U30A 3EC8A 4TV3A 2ZEQA 3L0WB 2M4NA 3QAQA 4MGZE 1V49A 2KKCA 3QK0A 5LXIB 3GZNI 2JWZA 2PJHA 1YJ1A 3WIMA 3V61A 2BPSA 2N9PC 4W9JA 3SU8X 4BKSD 3DVGX 3LJ3A 4NAWB 1M94A 4P7IA 3DCGA 2KX3A 1WZ3A 5AZGA 1ZW7A 2I1JA 2KDBA 3ECIA 4WJOA 3UIPB 3BINA 2IBIB 1JRUA 2LZ6A 1WGGA 1S1QB 3U8ZA 2EMTA 4XC2A 2MQJA 4NNJB 2NS5A 3BY4B 5BO4B 2NVUI 3Q3JA 2G3QB 4HPLB 5IA7A 3RZWC 1WR6E 1SIFA 4JIOU 2K6DB 4FJVB 3UF8A 3APFA 3RYTA 2M17A 1UGMA 1E8WA 2KTRA 5AEKB 3IG3A 4WJPA 3DBSA 2BYFA 5CX3A 3APDA 1F9JA 3TL5A 3VHTC 2RD0A 2DAFA 4OVVA 1GC6A 4N9F4 4MGIE 3VXWA 3HHMA 3DVNU 1OEYJ 3VTUA 3M62B 4EEWA 3A9JA 4NPNA 4EZLA 3VAWA 2N7DA 2C7HA 3QC8B 4BBNF 3WAPA 3ZNZB 2C7NB 2DZJA 1P98A 1PQSA 2KD0A 3ZNID 4EKUA 2LUEA 2Z0EB 4KZ0A 5AZFA 2O2VB 3ZLZA 1P9DU 2JY6A 3R66C 4DK5A 4HPMB 4FHJA 2C5LC 2Z0DB 4URKA 3UINB 2MBBB 3WALA 4PS8A 3W1SC 3VFKA 1AARA 2LXCA 4BFRA 5D94A 3H7PA 4II3B 4KDLB 1OQYA 1KJTA 1WXVA 1K8RB 4AUQC 4DHJD 5JZEB 3X0WA 4F7ZA 3L13A 4W9LA 2DZIA 5HKHA 1NDDA 1VCBA 1WMHB 4II2B 3KUDB 3MHSD 4ANWA 3N30A 3NHEB 2MWSB 3M3JA 2PE9A 2ZVOA 3DOWA 5D2MB 2Y5BB 4MSMB 4RM8A 2J0MA 2NBUA 2JRIB 4LJOB 4ZYNA 2KDIA 2Z59B 1WE7A 2HE7A 4E74A 4YL8A 3ZRCA 2JUOA 4JGHB 3UGBB 2MBHA 1YD8U 1GNUA 4ANVA 1LQBA 4I6LB 4DDID 3RULA 2PEAA 1UZXB 1P1AA 3IFWB 4AOFA 1V2YA 4MELA 1WJUA 2XK5A 2IY1B 2KMCA 3JW0X 3PTFC 3AU5A 1WH3A 1KOTA 2BF8B 3OJ3A 1YX5B 1TTNA 2NBVB 1WR1A 4IM2A 1E8ZA 2KLGA 2KNBA 3H1UA 2MCNB 4W9IA 4OVUA 1GUAB 2BKFA 2FUHB 2KDEB 3TIXA 3VVWB 2G45B 1TZ1A 2GOWA 2MP2B 2PPHA 3DDCB 4HDQA 4LJPB 5E6NA 4G11A 3IBEA 1WFYA 2NCNA 4IW0A 4ICUA 4CO7A 4W9CA 2JZ3B 3QWZB 2ZNVC 3LDZE 4NY0A 4GXBA 4BBNC 4GDLB 4RMAA 1LXDA 2N4FA 1P0RA 1E8YA 1WGHA 4M0WB 2D10A 5GMVA 1NI2A 2KO3A 5LLIA 3OLMD 2XBBC 2LGDA 5IAAC 3B1LX 2KWVB 5JH5C 4IG7B 3N32A 4MH0E 5EDSA 2WDTB 4HDOA 2EMSA 1WX9A 2L05A 4K7SA 4W9FA 4F1SA 2W9NA 4ZDVA 3V60A 4WWNA 1EO6A 4GSWA 1S3SG 2D11A 4TQ1A 4HVBA 1GG3A 2LJ5A 3ZUNA 2FIDA 2BWFA 2LGYA 5C23A 3X23A 3A1QA 1P3QU 3O65B 2KWUB 4X57B 1H4RA 5KHQA 3GOEA 2M8SA 3PGEA 2IYDB 1GJZA 3RUIB 3DVGY 4B95A 3C0RB 3HM3A 2J0KA 1J8CA 2ZNVB 2L00B 3VUYA 2KX0A 2LD9A 2IO1B 3DPDA 3KUCB 3PRZA 2J0JA 3SDLC 5AZHA 4GN1A 3ZDTA 2KMAA 4K7WA 2LRWA 2OJRA 3H6NA 1E90A 5D7GA 4KVGB 3ZTCA 4TQ0A 4NJ7A 4BKTA 3KVFB 3NZUA 4AJYB 1WX8A 1C1YB 2B3AA 2CS4A 3QA8A 3ZO5B 3DBRI 2LGXA 2BWES 2GBRA 3UQAA 1V6EA 2KFKB 1RFAA 4FA6A 2M1MA 4PYZA 1UH6A 3ONSA 4AJWA 4MJSA 1X1MA 2BGFA 3R7QA 3MJWA 1LM8B 4I6NB 4CYEA 3WAMA 2FAZA 4BKSA 5J18A 3VH3B 3VDZA 4M8NA 3ZDMC 2DYBA 4MGYE 1WJ6A 4FHKA 1ISNA 4W9DA 2KC2A 3RCZA 2CU1A 1YX6B 1Z2MA 4EFOA 4PYUA 3P2BA 3TMPB 4B6WA 4JL9A 3WA0A 3L08A 4IWOA 1Q5WB 4DXAB 1QZEA 2CKHB 4GDLA 2KJHB 2CHWA 3V62A 4FN2A 2N9EB 2ZCBA 1NBFC 5G2NA 1J0GA 2JXXA 2L0FA 1V86A 2AL3A 4FLHA 1H8CA 2A5UA 2BKRB 1Q1OA 3EECA 3JVZX 1WZ0A 2N1WA 5TR5A 4ICVA 5DPWA 1C3TA 3T9LA 2NPTB 4GGQA 2KLCA 1WI0A 3A4RA 5D6JB 2KHWB 1E8XA 3AULA 1WYWB 2FCNA 1KM7A 2FIFA 3I3TB 4I6PA 1WE6A 2DAJA 3HIZA 5DCNA 4BKGA 1WF9A 3IHPC 3M63B 3JYUA 5L83A 4PS7A 1UBQA 2KQSA 3M95A 4EZKA 2DZKA 2N1VA 3ZNHB 2HTHA 1WJ4A 1U4AA 2OOBB 4BVUC 3HK0A 2A4ZA 2JT4B 4A20A 2V1YA 3RT3B 2MA9B 4GDKA 3KYDD 1BT0A
chains in the Genus database with same CATH superfamily
3KQ4A 1FFVA 2MSED 1WGYA 1TKYA 3PHXB 1WXAA 1L4ZB 2V4IB 2K0PA 3OAWA 4RGOS 1OTRB 2KVRA 2ZZPB 3R2TA 2X38A 5C2TB 2ZCCA 4KZCA 3H9DA 4MDKE 4S17A 1R4NI 2TSSA 5G55A 4US9A 3AE8B 4IC7B 1UGJA 1XLOA 4D2KA 1E5WA 1ROEA 3W2DA 3EFUA 2INDC 1JRPA 2D07B 3AM9A 3MJ5A 4REZA 2WX1A 1RLFA 4OHJA 4K7UA 1D5ZC 1QQRA 2C60A 2C7MB 2LEKA 3ZNGC 4JPSA 1TKGA 3WANA 2KJRA 3V05A 4W9HA 1ESFA 2BW2A 3FC4A 1XLPA 1XCTL 2KN4A 3QCAA 3FAHA 2KWCA 1TYGB 2KXJA 4LDTD 3QARA 3T3OA 4GLSC 4KKIA 2ASQA 2CJOA 2RMMA 4NJ6A 2IO0B 5DPSA 1PGXA 2K9XA 2K8HA 1HZ6A 4BZAA 4ZHPA 4MEMA 1XEEA 2JQRB 4MSQB 2V4LA 1EWCA 2GBKA 2Y3AA 1WXSA 3ML9A 5L95C 3TEWA 4C80A 2KTFA 2N9KA 2NTSA 4TUUA 2J52A 4E71A 3SR6A 1JW9D 1K51A 1VZ8A 3DHHC 2NMQA 1FPYA 4KSLC 1K53A 4HCNB 2KJ6A 1I35A 2IGGA 3VTVA 2WXNA 5FR6A 5D3IB 5AUKA 2G1EA 1SE2A 4LNIA 1C4PA 1P7FA 5LXHA 3NZ3A 1TGZB 4WJQA 4KIKB 3MTNB 2RSUA 4XE0A 4BOZB 3IVFA 1GPXA 2JVCA 3ZGZA 1UUPA 3SEBA 1A70A 2KVZA 3RNCC 4GOCA 4GB9A 1Q0WB 1UELA 3PV1A 1XO3A 4JE3B 3EHVA 3BIID 3ZXRA 4NJCA 5IKCM 2OHFA 1XD3B 1SE9A 3K9OB 2YVCA 2WYQA 1GC7A 1CMXB 2YEPF 3AH7A 2R2OA 3H7PB 3A4SC 4KV2A 1SSNA 2C9WB 1AWDA 1V5TA 1AYFA 2DYMA 3PRPB 4KGSA 1KLVA 4TKNA 2BB5A 1F52A 4XWWA 3A9JB 3EC8A 1C78A 3QAQA 1SIJA 3GZNI 3VRBB 1V1OA 2HDEA 1IGCA 2BPSA 1LO5D 3LJ3A 4P7IA 5FKAC 3DCGA 5AZGA 1EWYC 1FFUA 2I1JA 1XLNA 1F77A 4XC2A 3I57A 4NNJB 2NVUI 3EFCA 4HPLB 1ZUD2 1WR6E 4JIOU 4Q2JA 4IOIE 2KTRA 1NI3A 1MVKA 3DBSA 5CX3A 3VHTC 2RD0A 2DAFA 4OVVA 4A8XC 3DVNU 3VTUA 1AW7A 4EEWA 4NPNA 2KQ4X 3QC8B 2OJWA 2DZJA 2LUEA 2Z0EB 5AZFA 2O2VB 2JY6A 4HPMB 2C5LC 2Z0DB 3UINB 3GS2A 4PS8A 5D94A 4OZCA 1WXVA 1C9FA 3GB1A 4W9LA 2DZIA 2DBYA 4QAYA 1TS3A 2VH2A 3KUDB 1D5XC 4LJOB 2Z59B 1WE7A 3MFGA 1ZPSA 4P16A 1UF0A 2HTME 4DDID 3L4PA 3OJ3A 5GXGB 4W9IA 1GUAB 2GOWA 2BBCA 1SXTA 2PPHA 3DDCB 2KACA 3Q3OC 4M0WA 2B76B 2JZ3B 2WXGA 1BXTA 4NY0A 1NYQA 3NRZA 5LNK1 2N4FA 1E8YA 5HFYA 1NI2A 2KO3A 3B2GA 5LLIA 1C4CA 3B1LX 2KWVB 5JH5C 4IG7B 1GB1A 1TY2A 4HDOA 2EMSA 1WX9A 4W9FA 4F1SA 2W9NA 1UNSA 1GG3A 1XLQA 2BWFA 2LGYA 3X23A 3A1QA 3AE9B 2AQ1B 5HHDG 5KHQA 3PGEA 2IYDB 5EE9A 4B95A 2PLPA 2KX0A 2IO1B 3DPDA 2KMAA 1N60A 2LRWA 3H6NA 1E90A 4TQ0A 4BKTA 3AB5A 3KVFB 2INCC 4AJYB 3OWEB 1C1YB 3QA8A 3SFEB 3IAS1 3TSSA 3ZO5B 2ZW1A 3UQAA 2KFKB 1RFAA 2J4XA 3AEFB 3ONSA 4MJSA 1X1MA 3R7QA 4KX6B 4I6NB 4MACA 3WAMA 3VH3B 1RWSA 3VDZA 3ZDMC 3Q14C 4FHKA 2L32A 1JWUD 3P4SB 2E3TA 4JL9A 3P4QB 1Q5WB 1EU3A 4DXAB 2CU3A 2N9EB 2ZCBA 1J0GA 1L4DB 1MFWA 1H8CA 2BKRB 1Q1OA 3NVWA 4L2YA 3EUB2 3A4RA 1KLUD 2MJDA 3AE7B 4LNKA 2VZKD 3MC8A 4K3CA 4I6PA 1IUEA 4BKGA 3IHPC 1SJHD 1E7PB 4FXCA 3AV8A 3ZNHB 1CK1A 2J42A 3HK0A 5FR3A 2RDBC 4A20A 4GDKA 5BYSA 4CHKA 2WDQB 1FO4A 2HD5B 1ZKHA 3L54A 4JX1C 1WIAA 1V8CA 3KH0A 4A55A 3SHQA 4C7ZA 2KK8A 3VTWA 2JX5A 1RYJA 5C1ZA 2LASA 3QHTA 1XCQL 1WXQA 4MJSB 4RF0A 3TCAA 1EUVB 2BT6A 1YOVB 4ARIA 4IWPA 1N62A 2LI5A 3KWVA 3Q8BA 1RAXA 4BAXA 2RPQA 3K9PB 4HJGE 5EE0A 5J17A 1T0YA 3CSFA 3AEDB 3V6CB 3L17A 2WXMA 2GBJA 1WJNA 5JHBA 2DYOA 3RNFC 5BYRA 3ZKJC 4XX5A 2M0AA 4ARCA 1I42A 1T6BX 3N3KB 3PT2B 4FJZA 4ANXA 2WXPA 3VH4B 4HJKA 2L7RA 4EUTA 4WIPA 3C8YA 3I9V1 2L8JA 2QIEB 1YN5A 3VR8B 4NAWA 3AN1A 3ALBA 1J19A 4KGRA 2HJ8A 2LGSA 5D3DA 4NZLB 1C77A 2R2QA 2WXOA 5G5GA 3AI5A 2LGIA 2KN5A 2LFIA 3CF6E 4HLEA 3PSEB 2FCSA 2NR2A 2JPHA 1N5WA 2FBWB 1TBEA 2K6QA 2FNJB 1TIFA 4LDTB 4W9KA 1XF5L 2M56B 2WX0A 2KOXA 5CHVC 2WXIA 3PREA 3B08A 2MP2A 2RR9A 1OQQA 1TT5B 2ZJDA 4NQKE 1E0ZA 3O13A 4PS3A 3ZJTA 4C4VB 2IO3B 3FILA 1JROA 4GU2A 1FD6A 2AL6A 3J9CA 4BOSC 3CSTA 4LLGM 3N9YC 1VD2A 1I4QA 4ZRIA 2SAKA 2MRPA 1DGJA 2O6VD 3E9SA 1DOIA 2WS3B 1YIWA 3DBHI 1HXYD 2UWQA 2MBQA 1QT9A 2D3AA 1D5MC 2JZZA 5IN7A 2I2YA 3DBLI 1PYWD 3P4PB 2IGHA 4XYCA 2GMIC 2MEKA 4GIVA 5FK9C 2K8CA 1OFFA 4J6IA 4ZRKA 2CR5A 5J2RA 4WWPA 2M19A 3P63A 4WH4A 3KYCD 3ENEA 3AU4A 5JHAA 3MHZA 3KUZA 2MW5A 2KC1A 3NS8A 4US8A 1XQQA 3CIRB 1I4GA 3PS6A 3D32A 2BYEA 1FNUA 5BMIA 3NVZA 4MGZE 4TSSA 2JWZA 2N9PC 4J3OD 4BKSD 1K50A 2KX3A 4YTNB 2R61A 4JWUC 1E10A 2Q5WD 1T3QA 4C7YA 2BB6A 4N6EB 2BTEA 4LK0M 2IBIB 1JRUA 2QMTA 1WGGA 1GOZA 2EMTA 1PFDA 5BO4B 1FXIA 5IA7A 1P7EA 4M00A 1SIFA 3NVVA 3APFA 1E8WA 1JWSD 1NEKB 1N5XA 2WXKA 3P42A 1J7BA 3M62B 3VAWA 4BBNF 3WAPA 1YMHE 2C7NB 3ZLZA 2FUG1 4ITKA 3BK2A 3WALA 3W1SC 3VFKA 2LXCA 2WXLA 1MHHE 4BFRA 4II3B 1OQYA 1K8RB 3Q8AA 4OZBA 1KRHA 3L13A 4YSZB 5JXVA 5EE1A 3AEBB 1WMHB 4II2B 4ANWA 3NHEB 2PE9A 4ZYNA 4RM8A 2JRIB 2KDIA 2X8XX 1GB4A 4YL8A 3ZRCA 4MM3B 2JUOA 1WRIA 3HVDA 1QKZA 2GLSA 2ON8A 1GNUA 2PEAA 1MPEA 1P1AA 3IFWB 4KGTA 2IY1B 2KMCA 1PDXA 3PTFC 1YX5B 2NBVB 1WR1A 4IM2A 2KNBA 2MCNB 2INPE 2KDEB 3TIXA 3VVWB 2GI9A 1TZ1A 2W55A 4HDQA 2V9HA 4G11A 3IBEA 2NCNA 1ENFA 4ICUA 3QWZB 3R2IA 4XGAB 4GXBA 4RMAA 4OZAA 5G5HA 4M0WB 5GMVA 2D10A 2XBBC 2LGDA 5IAAC 1YQ3B 3N32A 3LB8C 1VRAB 4ZDVA 2L05A 2ICIA 1QOBA 1JMLA 4WWNA 5I4DA 1C4AA 1R4MB 1EO6A 1S3SG 4HVBA 3ZUNA 2PW9A 2QJLA 1P3QU 2KWUB 1F2RI 2BS2B 2BS4B 1JWBD 2KMMA 2LMCA 2UU7A 1GJZA 4XDCA 3RUIB 3ZJUA 3T3NA 3C0RB 2CJNA 3ZDTA 2J0JA 3SDLC 3RPFC 3I5JC 4K7WA 1LGRA 5HG2A 4KVGB 2Z8LA 3ZTCA 3RNAC 3RFZB 1D4BA 1TS2A 2V0GA 1L5PA 2LGXA 2BWES 4WURA 4PYZA 3MJWA 1L0VB 2FAZA 1VZ6A 3Q6BA 4MGYE 4OVZA 2KC2A 1Y56A 1YX6B 4B6WA 3DBLB 2G9HD 2BYTA 1QZEA 2CKHB 3BVGA 4GDLA 2WXRA 2CHWA 2MHJA 2AL3A 2Y5CA 1WZ0A 2N1WA 4LNOA 5TR5A 4MH8A 1WI0A 2KHWB 1E8XA 3AULA 1K52A 2FCNA 2OEDA 1PGAA 1WF9A 3CWIA 3M63B 4PS7A 1UBQA 3M95A 4EZKA 2DZKA 2N1VA 1WJ4A 2OOBB 4BVUC 1BUIC 3PZ8A 2MA9B 3QX1A 3DHGC 1M4VA 3VUXA 3ZQ4A 1KTKA 1TS5A 2KDFB 2AQ2B 4RM9A 3A1QB 2KAJA 3N1XC 1EM7A 1TY0A 4HKQA 1HE8A 1L2NA 2DZMA 3UQBA 1WX7A 2DWQA 3DWGC 1J7CA 2K1FA 2NBWB 1A5RA 3PRMB 3ZIMA 4ASWC 1EU4A 1R7SA 1RRBA 1Z5SB 2D3BA 3JSVA 1VJKA 3L10B 4DHZB 3BK1A 1F0ZA 2JF5A 2K3UA 5CHWA 1GAQB 1SBBB 2SEBD 3MP9A 2L0TA 4B0EA 5CTRC 2LWPA 3TEXA 1OGWA 4IWQA 2MLBA 2N9LA 4E3CA 1D3ZA 3ZW3A 2LJIA 3W9CB 1WM2A 3W5VB 4G50A 3AEAB 3S2AA 1HQRD 3AE6B 1RM6C 1R4MI 2LXAA 4HCPB 4RGMA 2WXFA 4L23A 2DENB 4ZRQA 4FULA 3R7RA 1F1HA 2AEHA 3PPAA 1WMHA 3WAOA 3DHIC 4LNFA 2V3SA 2KWDA 4G3XB 1FXAA 4AQ7A 1NENB 2L3ZA 3PLUA 2D2QA 4HKZE 3NY5A 4FBJB 2DX5B 1UBIA 1HA5A 2G4SA 2CHXA 3Q69A 3NVYA 4MGKE 2JU6X 3ZVVA 5TSSA 3Q2AC 4HROA 2LVOA 4B9KA 2IZVB 2MBOA 3KW5B 4JWSC 2ZPNA 1HZ5A 2VRRB 3H8HA 2NPTA 1WRDB 2YLMA 1YN4A 1ZP0B 1T0SC 3Q8CA 4JQWC 5DPRA 2XEWA 2GBMA 1FXTB 2N9XA 2IJ0A 2PKOA 3RNEC 3V6EB 1JQ4A 5E6PA 1YQBA 4A3PA 1V1PB 2K25A 2XN9C 4HEA1 3CMMB 3TEZA 2QHOA 2KQ7A 2KTRB 1QILA 1UD7A 4M8MA 3Q3FA 3PZDA 2XNAC 3N20C 1SGHA 3ZTDA 1ACCA 3AE1B 1T0QC 4IM3A 4M01A 2WXHA 4KSKC 3DBHB 3LYYA 2G4DB 4IM0A 4WJNA 2K8BA 1QOAA 2KZRA 4ANUA 3NG0A 2ZPYA 5IO9A 3NUHB 4K81A 1Y8RC 2LVQA 2LVPA 2FCQA 3PVLA 4KDIC 3EGRA 2O6VA 4EZJA 3EA6A 4F8CB 4N58A 1QF6A 2E6XA 2CHZA 2DHZA 1V1PA 3BYYB 3B0AA 2L76A 3ZRFA 2FCMA 2RDGA 4MM3A 5H8YE 1RFKA 1L0YB 1FIQA 3ABVB 2BVCA 4NAMA 3BYTB 4PT5A 1WWTA 3A33B 2GBNA 2M0XA 2JZPA 4P1CC 4YTMB 4HWIB 1TJEA 2I1KA 3ML8A 1DOXA 4K3BA 1MJDA 1MG4A 4RNAA 3DVNV 4HK2A 3IAM1 1MHXA 2YEPB 1N61A 1FMAD 4TMAB 1KH0A 4TV3A 2ZEQA 3L0WB 3AEEB 3QK0A 2KKCA 5LXIB 2PJHA 1YJ1A 3WIMA 1L6UA 4WQMA 2FE8A 3SU8X 1M94A 1B1ZA 1ZW7A 1FM0D 2KDBA 3ECIA 4PK1A 2H88B 3BINA 2EELA 2LZ6A 3U8ZA 2PTLA 2NS5A 3BY4B 4YWGG 3RZWC 1YNTE 2K6DB 3PZ7A 4FJVB 2M17A 5AEKB 3IG3A 5C3JB 2WDVB 2BYFA 2WNMA 4MGIE 1IBXB 2MH7A 2N7DA 2C7HA 3ZNZB 1P98A 1JCKB 4KZ0A 1SB3C 1P9DU 3R66C 4LTUA 1AARA 2HJ1A 1ZXHA 1SF0A 1KJTA 4AUQC 5JZEB 3X0WA 1YN3A 1NDDA 1VCBA 2MJEA 3AE3B 3MHSD 1L0XB 1XXGA 3C19A 3M3JA 5D2MB 3DOWA 4MSMB 4LNNA 2J0MA 1ZOYB 2HE7A 4KKJA 3URYA 4JGHB 3UI3A 1VDVA 3UGBB 4ANVA 4WWMA 4I6LB 3RULA 1YQ4B 4XDDA 4MELA 1PGBA 3DWMA 3JW0X 1WH3A 2BF8B 2JYTA 1E8ZA 2KLGA 3H1UA 4OVUA 1B9RA 4RCOA 3RN9C 2IGDA 4C4VA 3I63C 4LJPB 4H2AA 1WFYA 4IW0A 3W5UB 4CO7A 4P6VF 4B0MA 4L1BA 3LDZE 2K5PA 3HVZA 4GDLB 4BBNC 2N7JA 5E6JA 1WGHA 3OLMD 4HPPA 4MH0E 2WDTB 3PO0A 5H92C 1FRDA 2H89B 2AX5A 2PVGC 1HEZE 4GSWA 2D11A 4N59A 4ZOHC 3O65B 3GOEA 2M8SA 2QEJC 3DVGY 3ZJVA 1HTQA 2ZNVB 2L00B 3VUYA 2LD9A 3PRZA 5AZHA 1R4NB 5AUIA 1UWMA 2OJRA 4NJ7A 3NZUA 1WX8A 2B3AA 2CS4A 4YSYB 1PUTA 2NTTA 4IKGA 2QILA 3DBRI 2GBRA 2WHIA 1V6EA 4FA6A 2M1MA 3N1ZC 2BGFA 2BS3B 4CYEA 4BKSA 5J18A 1SE3A 1OQRA 3U7ZA 1WJ6A 1ISNA 4W9DA 3BWUD 1E9MA 2CU1A 2BQQA 1Z2MA 3P2BA 2Y5PA 3WA0A 2GRIA 2KJHB 1JWMD 3V62A 4FN2A 4RFBA 2L0FA 2ONQA 1V86A 1NYRA 1V97A 1C3TA 3T9LA 4P1BC 5D6JB 1TZOA 1WYWB 1KM7A 2FIFA 3I3TB 3ZYYX 1WE6A 4YTPB 3HIZA 5DCNA 3R8BA 3HRDD 3JYUA 5L83A 1I4RA 2HTHA 1U4AA 2A4ZA 2JT4B 1BT0A 2MBEA 2GB1A 1XT9B 3Q8EA 4AS1A 3IXSA 3QQ8B 3AXCA 1G6JA 2WWZA 2JXTA 3NOBA 3RD2A 2IO2B 2WP9B 3W1YA 2W54A 3FILB 2D3GA 2V3NA 4YSXB 4ACFA 2MX2A 4FJYA 5BMGA 3Q3MC 1IPGA 2LHEA 1SE4A 2J7QB 4CQNA 3SD5A 4IUMB 3AE5B 4AP4C 1MG8A 2I38A 4DBGA 1KFYB 1YJJA 2KANA 4KIKA 2WU2B 2D3CA 1QOGA 3T8MA 1ZDXA 2QCZA 4LCDE 1V5OA 3QIJA 2J53A 2REXA 5CHFA 3A9KA 3L16A 4W9GA 1L7YA 4ZRJA 3BVZA 1SEBD 1NVID 3NS1A 1WXMA 2ZVNA 4MT5A 4EOYA 2IDYA 2KFKA 2K39A 4GMVA 3U2SC 1V81A 4WWOA 2EKEC 1T0RC 1ZGUB 3B9JA 3VRAB 1BMLC 2IPKD 1N6ZA 3RNBC 3HUIA 1WGKA 1LFDA 2AYOB 4USAA 1CZPA 3DQVA 2WGSA 2EKIA 1OEYA 3VUWA 4DXFA 4XZ4A 2RGFA 3QJZA 5KHOA 1CQVA 1KLGD 4HXDA 1N63A 1EF1A 3W1SA 2PIAA 2N7EA 2RPVA 3JSVB 3PHWB 2O6VB 3OG5A 3R3MA 4HRSA 1QOFA 2BYVE 4K1RB 2W3SA 4A3OA 3VQIA 3TJPA 4DXGA 1WY8A 4DWFA 2QDFA 2KT7A 1Q10A 1DYQA 1I4HA 4ZYSA 4NQLB 2IY0B 2WU5B 3NZSA 4DHZE 1E7UA 4RF1A 4RGTA 5IP4D 3V3XA 3OJ4B 4DHJB 2QC8A 3AE2B 3GP7A 1IBXA 3B2FA 1V80A 2N0SB 4AWJA 2JRHA 4WQOB 1E7VA 4A90A 4JLCA 1WSPA 4WAAA 4YT0B 5DPTA 4IDIA 4W9EA 4DDGD 3RNGC 1E6EB 3HM6X 1WGRA 4G0NB 3U7DA 2KFJA 1IYFA 1EF5A 3APCA 4GDKB 2JWUA 2K22A 4FADA 2RDHA 1WM3A 2AWTA 3AE4B 2ACZB 5E6OA 1IP9A 3UIOB 1C79A 3Q3NC 2XK5B 1V9JA 2O2VA 3A9KB 3E56A 1F2RC 2LRUA 3RI7C 1JALA 2PE6B 3PLVA 3TBLD 5HI1A 2UYZB 1WGDA 3AEGB 3H7SA 3U30A 4A6QA 2M4NA 1V49A 3RMKC 3V61A 4W9JA 2WXJA 3DVGX 4NAWB 5BMHA 1WZ3A 3GE3C 2JSVX 4O1NA 4WJOA 3UIPB 3AMZA 1I4PA 2INNE 2JYEA 2KDMA 1S1QB 1VR9A 2MQJA 3N1YC 4ZRPA 3Q3JA 2G3QB 1TKEA 3KLSX 3IT4B 1IGDA 3UF8A 3RYTA 1UGMA 3ETRA 4WJPA 3APDA 1F9JA 3DBRB 3WCQA 1SJED 3TL5A 1FEHA 1I4XA 1GC6A 3BVMA 3GZNB 4N9F4 4YXDB 2LUMA 3VXWA 3HHMA 4RH6A 1OEYJ 4OW0A 4EZLA 3A9JA 2VH1A 3KWLA 1PQSA 2KD0A 2DNFA 3ZNID 4EKUA 1L6VA 4DK5A 4FHJA 4URKA 2MBBB 1FNWA 3GE8C 1UWXA 1D6EC 3H7PA 4KDLB 1STEA 4UDUC 4DHJD 2L52A 2WXQA 1FNVA 2LHDA 4F7ZA 1DOYA 5HKHA 3N30A 2W3RA 2MWSB 4C56C 2ZVOA 3RZFA 2Y5BB 2NBUA 1KF6B 4E74A 2WDRB 1WYGA 2MBHA 1YD8U 1FCLA 1LQBA 1AN8A 5MPOA 5EE3A 1UZXB 4AOFA 1V2YA 3FKYA 1WJUA 2XK5A 3AU5A 1KOTA 1TTNA 2AQ3B 2BKFA 3VR9B 1YJIA 2FUHB 2G45B 3TUOA 5BYQA 2MP2B 1J7AA 4WAFA 5E6NA 2QSDA 1CJEA 2ZW0A 4W9CA 3BZDB 2ZNVC 1I7HA 4EE2A 1VZ7A 1LXDA 1JWAD 1P0RA 4ZHOA 4C00A 2WLBA 5EDSA 1C76A 2VZKB 4K7SA 1FCCC 1T5XD 1MI0A 3V60A 4TQ1A 4XWTA 3MC0B 2LJ5A 5T8IA 2FIDA 5C23A 3P1MA 1VLBA 4X57B 1H4RA 4S0RA 4M02A 3HM3A 2J0KA 1J8CA 3KUCB 2W82A 1ET6A 4GN1A 2L1AA 2L83A 4R3DA 5D7GA 3P4RB 4RGNA 3LXFA 3MC9A 2DLBA 4AJWA 1UH6A 3Q8FA 1LM8B 2PVOD 4M8NA 2DYBA 3AECB 3RCZA 5IOIA 4EFOA 4PYUA 3TMPB 2PMVA 1QLBB 1HTOA 3L08A 4IWOA 4DQOC 2KYWA 2V3PA 3U52E 1ZXIA 1FRRA 2WQYB 1NBFC 5G2NA 2JXXA 4FLHA 2D5GA 2A5UA 1TS4A 3EECA 3IT6B 3JVZX 4ICVA 5DPWA 1ZDVA 2NPTB 1ET9A 4GGQA 2KLCA 3ZXVA 3NJTA 1ZE3D 2DAJA 4A9AA 3U4EG 2KQSA 2MJ3A 3TEYA 3SFDB 2V1YA 3KYDD 3RT3B
chains in the Genus database with same CATH topology
3VUXA 2MBEA 1XT9B 2KDFB 4CHKA 2HD5B 1ZKHA 2MSED 1WGYA 3A1QB 3L54A 3PHXB 1WXAA 4RM9A 3QQ8B 1WIAA 1HE8A 3AXCA 1G6JA 2WWZA 1L2NA 2DZMA 3OAWA 3UQBA 1WX7A 3KH0A 3NOBA 2K1FA 1OTRB 2NBWB 3RD2A 2KK8A 2KVRA 2IO2B 2ZZPB 3SHQA 3VTWA 3PRMB 1A5RA 3W1YA 5C1ZA 2D3GA 4ASWC 3ZIMA 1RRBA 1Z5SB 2LASA 3JSVA 2MX2A 3QHTA 4FJYA 2ZCCA 3L10B 4DHZB 4KZCA 4MJSB 3H9DA 2JF5A 3TCAA 4MDKE 1EUVB 5CHWA 1IPGA 1R4NI 4IWPA 2LI5A 1RAXA 2L0TA 5G55A 5CTRC 2J7QB 2LWPA 1OGWA 4IWQA 2MLBA 2RPQA 3SD5A 3K9PB 4IUMB 4AP4C 1MG8A 5J17A 4IC7B 4E3CA 1D3ZA 1T0YA 3CSFA 3ZW3A 4DBGA 1WM2A 1E5WA 4G50A 2KANA 3V6CB 4KIKA 3S2AA 3L17A 3EFUA 2D07B 1R4MI 3T8MA 2LXAA 2WX1A 1RLFA 2GBJA 4LCDE 1WJNA 4HCPB 1V5OA 4K7UA 5JHBA 2C60A 2DYOA 3QIJA 2C7MB 2DENB 2REXA 3ZNGC 3ZKJC 5CHFA 4FULA 4XX5A 3A9KA 3L16A 4W9GA 3R7RA 1L7YA 4ZRJA 1I42A 3N3KB 2AEHA 3PT2B 3PPAA 1WMHA 3WANA 2KJRA 3WAOA 1WXMA 4W9HA 2ZVNA 4EOYA 4FJZA 2V3SA 3QCAA 2KFKA 2K39A 4GMVA 4ANXA 4G3XB 2KWCA 3VH4B 1V81A 4WWOA 2L3ZA 4HJKA 2L7RA 2EKEC 2KXJA 3PLUA 4LDTD 4EUTA 3QARA 2D2QA 1ZGUB 2L8JA 3NY5A 4FBJB 2ASQA 2DX5B 1LFDA 1UBIA 2G4SA 2IO0B 4NJ6A 5DPSA 2CHXA 2K8HA 4NAWA 3ALBA 1J19A 2AYOB 4MGKE 2HJ8A 3ZVVA 3DQVA 4MEMA 3VUWA 1OEYA 2LVOA 4B9KA 2R2QA 4XZ4A 2IZVB 2MBOA 2RGFA 3KW5B 4MSQB 2ZPNA 2VRRB 3AI5A 2V4LA 2KN5A 3QJZA 5KHOA 4HXDA 2GBKA 3CF6E 4HLEA 2NPTA 3PSEB 1WRDB 1WXSA 2FCSA 2NR2A 2YLMA 2JPHA 3ML9A 5L95C 1EF1A 3W1SA 1TBEA 2K6QA 2FNJB 2N7EA 2KTFA 3JSVB 2O6VB 3PHWB 4LDTB 4JQWC 4W9KA 3R3MA 5DPRA 2XEWA 2BYVE 1FXTB 2GBMA 2N9XA 2WX0A 4K1RB 3RZFA 3V6EB 2KOXA 4TUUA 5E6PA 5CHVC 1YQBA 4A3PA 4E71A 3PREA 3B08A 4A3OA 2MP2A 3VQIA 2K25A 3TJPA 2RR9A 2ZJDA 3CMMB 2QHOA 4KSLC 4NQKE 2KQ7A 2KTRB 1WY8A 4HCNB 4DWFA 2KJ6A 1I35A 1UD7A 4M8MA 3Q3FA 4PS3A 3PZDA 2IO3B 1SGHA 3VTVA 3ZTDA 4NQLB 5FR6A 2IY0B 3NZSA 4DHZE 4GU2A 1E7UA 5LXHA 2AL6A 4IM3A 3OJ4B 4KSKC 4DHJB 4BOSC 3CSTA 2G4DB 4IM0A 4WJNA 2K8BA 1TGZB 4AWJA 1V80A 4WJQA 4KIKB 1VD2A 2JRHA 3MTNB 1E7VA 2KZRA 4WQOB 4ANUA 2RSUA 4JLCA 2ZPYA 4ZRIA 4BOZB 2MRPA 2O6VD 3IVFA 4K81A 4WAAA 1Y8RC 2LVQA 2LVPA 5DPTA 4W9EA 2FCQA 2JVCA 3PVLA 4KDIC 4DDGD 1YIWA 3DBHI 2UWQA 2MBQA 2O6VA 4EZJA 3HM6X 1WGRA 4G0NB 4GOCA 4GB9A 3U7DA 1Q0WB 4F8CB 2JZZA 1UELA 3PV1A 2KFJA 2CHZA 3DBLI 2DHZA 1IYFA 3EHVA 1EF5A 3APCA 4GDKB 3B0AA 2GMIC 4FADA 2L76A 4GIVA 2K8CA 3ZRFA 2FCMA 1WM3A 4MM3A 2AWTA 1XD3B 1SE9A 3K9OB 5E6OA 2YVCA 1IP9A 2WYQA 3UIOB 1GC7A 1CMXB 4J6IA 4ZRKA 2R2OA 2CR5A 3A33B 3H7PB 5J2RA 2XK5B 2GBNA 1V9JA 2M0XA 2O2VA 3A4SC 3A9KB 3QX1A 4KV2A 4WWPA 2C9WB 2LRUA 4HWIB 1V5TA 3ENEA 3AU4A 3KYCD 5JHAA 2DYMA 3PRPB 2PE6B 3PLVA 2I1KA 3TBLD 3ML8A 3KUZA 2MW5A 2KC1A 2UYZB 3NS8A 1WGDA 1KLVA 3DVNV 1XQQA 4TKNA 4HK2A 3H7SA 3PS6A 3D32A 2BYEA 3A9JB 3U30A 3EC8A 4TV3A 2ZEQA 3L0WB 2M4NA 3QAQA 4MGZE 1V49A 2KKCA 3QK0A 5LXIB 3GZNI 2JWZA 2PJHA 1YJ1A 3WIMA 3V61A 2BPSA 2N9PC 4W9JA 3SU8X 4BKSD 3DVGX 3LJ3A 4NAWB 1M94A 4P7IA 3DCGA 2KX3A 1WZ3A 5AZGA 1ZW7A 2I1JA 2KDBA 3ECIA 4WJOA 3UIPB 3BINA 2IBIB 1JRUA 2LZ6A 1WGGA 1S1QB 3U8ZA 2EMTA 4XC2A 2MQJA 4NNJB 2NS5A 3BY4B 5BO4B 2NVUI 3Q3JA 2G3QB 4HPLB 5IA7A 3RZWC 1WR6E 1SIFA 4JIOU 2K6DB 4FJVB 3UF8A 3APFA 3RYTA 2M17A 1UGMA 1E8WA 2KTRA 5AEKB 3IG3A 4WJPA 3DBSA 2BYFA 5CX3A 3APDA 1F9JA 3TL5A 3VHTC 2RD0A 2DAFA 4OVVA 1GC6A 4N9F4 4MGIE 3VXWA 3HHMA 3DVNU 1OEYJ 3VTUA 3M62B 4EEWA 3A9JA 4NPNA 4EZLA 3VAWA 2N7DA 2C7HA 3QC8B 4BBNF 3WAPA 3ZNZB 2C7NB 2DZJA 1P98A 1PQSA 2KD0A 3ZNID 4EKUA 2LUEA 2Z0EB 4KZ0A 5AZFA 2O2VB 3ZLZA 1P9DU 2JY6A 3R66C 4DK5A 4HPMB 4FHJA 2C5LC 2Z0DB 4URKA 3UINB 2MBBB 3WALA 4PS8A 3W1SC 3VFKA 1AARA 2LXCA 4BFRA 5D94A 3H7PA 4II3B 4KDLB 1OQYA 1KJTA 1WXVA 1K8RB 4AUQC 4DHJD 5JZEB 3X0WA 4F7ZA 3L13A 4W9LA 2DZIA 5HKHA 1NDDA 1VCBA 1WMHB 4II2B 3KUDB 3MHSD 4ANWA 3N30A 3NHEB 2MWSB 3M3JA 2PE9A 2ZVOA 3DOWA 5D2MB 2Y5BB 4MSMB 4RM8A 2J0MA 2NBUA 2JRIB 4LJOB 4ZYNA 2KDIA 2Z59B 1WE7A 2HE7A 4E74A 4YL8A 3ZRCA 2JUOA 4JGHB 3UGBB 2MBHA 1YD8U 1GNUA 4ANVA 1LQBA 4I6LB 4DDID 3RULA 2PEAA 1UZXB 1P1AA 3IFWB 4AOFA 1V2YA 4MELA 1WJUA 2XK5A 2IY1B 2KMCA 3JW0X 3PTFC 3AU5A 1WH3A 1KOTA 2BF8B 3OJ3A 1YX5B 1TTNA 2NBVB 1WR1A 4IM2A 1E8ZA 2KLGA 2KNBA 3H1UA 2MCNB 4W9IA 4OVUA 1GUAB 2BKFA 2FUHB 2KDEB 3TIXA 3VVWB 2G45B 1TZ1A 2GOWA 2MP2B 2PPHA 3DDCB 4HDQA 4LJPB 5E6NA 4G11A 3IBEA 1WFYA 2NCNA 4IW0A 4ICUA 4CO7A 4W9CA 2JZ3B 3QWZB 2ZNVC 3LDZE 4NY0A 4GXBA 4BBNC 4GDLB 4RMAA 1LXDA 2N4FA 1P0RA 1E8YA 1WGHA 4M0WB 2D10A 5GMVA 1NI2A 2KO3A 5LLIA 3OLMD 2XBBC 2LGDA 5IAAC 3B1LX 2KWVB 5JH5C 4IG7B 3N32A 4MH0E 5EDSA 2WDTB 4HDOA 2EMSA 1WX9A 2L05A 4K7SA 4W9FA 4F1SA 2W9NA 4ZDVA 3V60A 4WWNA 1EO6A 4GSWA 1S3SG 2D11A 4TQ1A 4HVBA 1GG3A 2LJ5A 3ZUNA 2FIDA 2BWFA 2LGYA 5C23A 3X23A 3A1QA 1P3QU 3O65B 2KWUB 4X57B 1H4RA 5KHQA 3GOEA 2M8SA 3PGEA 2IYDB 1GJZA 3RUIB 3DVGY 4B95A 3C0RB 3HM3A 2J0KA 1J8CA 2ZNVB 2L00B 3VUYA 2KX0A 2LD9A 2IO1B 3DPDA 3KUCB 3PRZA 2J0JA 3SDLC 5AZHA 4GN1A 3ZDTA 2KMAA 4K7WA 2LRWA 2OJRA 3H6NA 1E90A 5D7GA 4KVGB 3ZTCA 4TQ0A 4NJ7A 4BKTA 3KVFB 3NZUA 4AJYB 1WX8A 1C1YB 2B3AA 2CS4A 3QA8A 3ZO5B 3DBRI 2LGXA 2BWES 2GBRA 3UQAA 1V6EA 2KFKB 1RFAA 4FA6A 2M1MA 4PYZA 1UH6A 3ONSA 4AJWA 4MJSA 1X1MA 2BGFA 3R7QA 3MJWA 1LM8B 4I6NB 4CYEA 3WAMA 2FAZA 4BKSA 5J18A 3VH3B 3VDZA 4M8NA 3ZDMC 2DYBA 4MGYE 1WJ6A 4FHKA 1ISNA 4W9DA 2KC2A 3RCZA 2CU1A 1YX6B 1Z2MA 4EFOA 4PYUA 3P2BA 3TMPB 4B6WA 4JL9A 3WA0A 3L08A 4IWOA 1Q5WB 4DXAB 1QZEA 2CKHB 4GDLA 2KJHB 2CHWA 3V62A 4FN2A 2N9EB 2ZCBA 1NBFC 5G2NA 1J0GA 2JXXA 2L0FA 1V86A 2AL3A 4FLHA 1H8CA 2A5UA 2BKRB 1Q1OA 3EECA 3JVZX 1WZ0A 2N1WA 5TR5A 4ICVA 5DPWA 1C3TA 3T9LA 2NPTB 4GGQA 2KLCA 1WI0A 3A4RA 5D6JB 2KHWB 1E8XA 3AULA 1WYWB 2FCNA 1KM7A 2FIFA 3I3TB 4I6PA 1WE6A 2DAJA 3HIZA 5DCNA 4BKGA 1WF9A 3IHPC 3M63B 3JYUA 5L83A 4PS7A 1UBQA 2KQSA 3M95A 4EZKA 2DZKA 2N1VA 3ZNHB 2HTHA 1WJ4A 1U4AA 2OOBB 4BVUC 3HK0A 2A4ZA 2JT4B 4A20A 2V1YA 3RT3B 2MA9B 4GDKA 3KYDD 1BT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VUX A;  2MBE A;  1XT9 B;  2KDF B;  4CHK A;  2HD5 B;  1ZKH A;  2MSE D;  1WGY A;  3A1Q B;  3L54 A;  3PHX B;  1WXA A;  4RM9 A;  3QQ8 B;  1WIA A;  1HE8 A;  3AXC A;  1G6J A;  2WWZ A;  1L2N A;  2DZM A;  3OAW A;  3UQB A;  1WX7 A;  3KH0 A;  3NOB A;  2K1F A;  1OTR B;  2NBW B;  3RD2 A;  2KK8 A;  2KVR A;  2IO2 B;  2ZZP B;  3SHQ A;  3VTW A;  3PRM B;  1A5R A;  3W1Y A;  5C1Z A;  2D3G A;  4ASW C;  3ZIM A;  1RRB A;  1Z5S B;  2LAS A;  3JSV A;  2MX2 A;  3QHT A;  4FJY A;  2ZCC A;  3L10 B;  4DHZ B;  4KZC A;  4MJS B;  3H9D A;  2JF5 A;  3TCA A;  4MDK E;  1EUV B;  5CHW A;  1IPG A;  1R4N I;  4IWP A;  2LI5 A;  1RAX A;  2L0T A;  5G55 A;  5CTR C;  2J7Q B;  2LWP A;  1OGW A;  4IWQ A;  2MLB A;  2RPQ A;  3SD5 A;  3K9P B;  4IUM B;  4AP4 C;  1MG8 A;  5J17 A;  4IC7 B;  4E3C A;  1D3Z A;  1T0Y A;  3CSF A;  3ZW3 A;  4DBG A;  1WM2 A;  1E5W A;  4G50 A;  2KAN A;  3V6C B;  4KIK A;  3S2A A;  3L17 A;  3EFU A;  2D07 B;  1R4M I;  3T8M A;  2LXA A;  2WX1 A;  1RLF A;  2GBJ A;  4LCD E;  1WJN A;  4HCP B;  1V5O A;  4K7U A;  5JHB A;  2C60 A;  2DYO A;  3QIJ A;  2C7M B;  2DEN B;  2REX A;  3ZNG C;  3ZKJ C;  5CHF A;  4FUL A;  4XX5 A;  3A9K A;  3L16 A;  4W9G A;  3R7R A;  1L7Y A;  4ZRJ A;  1I42 A;  3N3K B;  2AEH A;  3PT2 B;  3PPA A;  1WMH A;  3WAN A;  2KJR A;  3WAO A;  1WXM A;  4W9H A;  2ZVN A;  4EOY A;  4FJZ A;  2V3S A;  3QCA A;  2KFK A;  2K39 A;  4GMV A;  4ANX A;  4G3X B;  2KWC A;  3VH4 B;  1V81 A;  4WWO A;  2L3Z A;  4HJK A;  2L7R A;  2EKE C;  2KXJ A;  3PLU A;  4LDT D;  4EUT A;  3QAR A;  2D2Q A;  1ZGU B;  2L8J A;  3NY5 A;  4FBJ B;  2ASQ A;  2DX5 B;  1LFD A;  1UBI A;  2G4S A;  2IO0 B;  4NJ6 A;  5DPS A;  2CHX A;  2K8H A;  4NAW A;  3ALB A;  1J19 A;  2AYO B;  4MGK E;  2HJ8 A;  3ZVV A;  3DQV A;  4MEM A;  3VUW A;  1OEY A;  2LVO A;  4B9K A;  2R2Q A;  4XZ4 A;  2IZV B;  2MBO A;  2RGF A;  3KW5 B;  4MSQ B;  2ZPN A;  2VRR B;  3AI5 A;  2V4L A;  2KN5 A;  3QJZ A;  5KHO A;  4HXD A;  2GBK A;  3CF6 E;  4HLE A;  2NPT A;  3PSE B;  1WRD B;  1WXS A;  2FCS A;  2NR2 A;  2YLM A;  2JPH A;  3ML9 A;  5L95 C;  1EF1 A;  3W1S A;  1TBE A;  2K6Q A;  2FNJ B;  2N7E A;  2KTF A;  3JSV B;  2O6V B;  3PHW B;  4LDT B;  4JQW C;  4W9K A;  3R3M A;  5DPR A;  2XEW A;  2BYV E;  1FXT B;  2GBM A;  2N9X A;  2WX0 A;  4K1R B;  3RZF A;  3V6E B;  2KOX A;  4TUU A;  5E6P A;  5CHV C;  1YQB A;  4A3P A;  4E71 A;  3PRE A;  3B08 A;  4A3O A;  2MP2 A;  3VQI A;  2K25 A;  3TJP A;  2RR9 A;  2ZJD A;  3CMM B;  2QHO A;  4KSL C;  4NQK E;  2KQ7 A;  2KTR B;  1WY8 A;  4HCN B;  4DWF A;  2KJ6 A;  1I35 A;  1UD7 A;  4M8M A;  3Q3F A;  4PS3 A;  3PZD A;  2IO3 B;  1SGH A;  3VTV A;  3ZTD A;  4NQL B;  5FR6 A;  2IY0 B;  3NZS A;  4DHZ E;  4GU2 A;  1E7U A;  5LXH A;  2AL6 A;  4IM3 A;  3OJ4 B;  4KSK C;  4DHJ B;  4BOS C;  3CST A;  2G4D B;  4IM0 A;  4WJN A;  2K8B A;  1TGZ B;  4AWJ A;  1V80 A;  4WJQ A;  4KIK B;  1VD2 A;  2JRH A;  3MTN B;  1E7V A;  2KZR A;  4WQO B;  4ANU A;  2RSU A;  4JLC A;  2ZPY A;  4ZRI A;  4BOZ B;  2MRP A;  2O6V D;  3IVF A;  4K81 A;  4WAA A;  1Y8R C;  2LVQ A;  2LVP A;  5DPT A;  4W9E A;  2FCQ A;  2JVC A;  3PVL A;  4KDI C;  4DDG D;  1YIW A;  3DBH I;  2UWQ A;  2MBQ A;  2O6V A;  4EZJ A;  3HM6 X;  1WGR A;  4G0N B;  4GOC A;  4GB9 A;  3U7D A;  1Q0W B;  4F8C B;  2JZZ A;  1UEL A;  3PV1 A;  2KFJ A;  2CHZ A;  3DBL I;  2DHZ A;  1IYF A;  3EHV A;  1EF5 A;  3APC A;  4GDK B;  3B0A A;  2GMI C;  4FAD A;  2L76 A;  4GIV A;  2K8C A;  3ZRF A;  2FCM A;  1WM3 A;  4MM3 A;  2AWT A;  1XD3 B;  1SE9 A;  3K9O B;  5E6O A;  2YVC A;  1IP9 A;  2WYQ A;  3UIO B;  1GC7 A;  1CMX B;  4J6I A;  4ZRK A;  2R2O A;  2CR5 A;  3A33 B;  3H7P B;  5J2R A;  2XK5 B;  2GBN A;  1V9J A;  2M0X A;  2O2V A;  3A4S C;  3A9K B;  3QX1 A;  4KV2 A;  4WWP A;  2C9W B;  2LRU A;  4HWI B;  1V5T A;  3ENE A;  3AU4 A;  3KYC D;  5JHA A;  2DYM A;  3PRP B;  2PE6 B;  3PLV A;  2I1K A;  3TBL D;  3ML8 A;  3KUZ A;  2MW5 A;  2KC1 A;  2UYZ B;  3NS8 A;  1WGD A;  1KLV A;  3DVN V;  1XQQ A;  4TKN A;  4HK2 A;  3H7S A;  3PS6 A;  3D32 A;  2BYE A;  3A9J B;  3U30 A;  3EC8 A;  4TV3 A;  2ZEQ A;  3L0W B;  2M4N A;  3QAQ A;  4MGZ E;  1V49 A;  2KKC A;  3QK0 A;  5LXI B;  3GZN I;  2JWZ A;  2PJH A;  1YJ1 A;  3WIM A;  3V61 A;  2BPS A;  2N9P C;  4W9J A;  3SU8 X;  4BKS D;  3DVG X;  3LJ3 A;  4NAW B;  1M94 A;  4P7I A;  3DCG A;  2KX3 A;  1WZ3 A;  5AZG A;  1ZW7 A;  2I1J A;  2KDB A;  3ECI A;  4WJO A;  3UIP B;  3BIN A;  2IBI B;  1JRU A;  2LZ6 A;  1WGG A;  1S1Q B;  3U8Z A;  2EMT A;  4XC2 A;  2MQJ A;  4NNJ B;  2NS5 A;  3BY4 B;  5BO4 B;  2NVU I;  3Q3J A;  2G3Q B;  4HPL B;  5IA7 A;  3RZW C;  1WR6 E;  1SIF A;  4JIO U;  2K6D B;  4FJV B;  3UF8 A;  3APF A;  3RYT A;  2M17 A;  1UGM A;  1E8W A;  2KTR A;  5AEK B;  3IG3 A;  4WJP A;  3DBS A;  2BYF A;  5CX3 A;  3APD A;  1F9J A;  3TL5 A;  3VHT C;  2RD0 A;  2DAF A;  4OVV A;  1GC6 A;  4N9F 4;  4MGI E;  3VXW A;  3HHM A;  3DVN U;  1OEY J;  3VTU A;  3M62 B;  4EEW A;  3A9J A;  4NPN A;  4EZL A;  3VAW A;  2N7D A;  2C7H A;  3QC8 B;  4BBN F;  3WAP A;  3ZNZ B;  2C7N B;  2DZJ A;  1P98 A;  1PQS A;  2KD0 A;  3ZNI D;  4EKU A;  2LUE A;  2Z0E B;  4KZ0 A;  5AZF A;  2O2V B;  3ZLZ A;  1P9D U;  2JY6 A;  3R66 C;  4DK5 A;  4HPM B;  4FHJ A;  2C5L C;  2Z0D B;  4URK A;  3UIN B;  2MBB B;  3WAL A;  4PS8 A;  3W1S C;  3VFK A;  1AAR A;  2LXC A;  4BFR A;  5D94 A;  3H7P A;  4II3 B;  4KDL B;  1OQY A;  1KJT A;  1WXV A;  1K8R B;  4AUQ C;  4DHJ D;  5JZE B;  3X0W A;  4F7Z A;  3L13 A;  4W9L A;  2DZI A;  5HKH A;  1NDD A;  1VCB A;  1WMH B;  4II2 B;  3KUD B;  3MHS D;  4ANW A;  3N30 A;  3NHE B;  2MWS B;  3M3J A;  2PE9 A;  2ZVO A;  3DOW A;  5D2M B;  2Y5B B;  4MSM B;  4RM8 A;  2J0M A;  2NBU A;  2JRI B;  4LJO B;  4ZYN A;  2KDI A;  2Z59 B;  1WE7 A;  2HE7 A;  4E74 A;  4YL8 A;  3ZRC A;  2JUO A;  4JGH B;  3UGB B;  2MBH A;  1YD8 U;  1GNU A;  4ANV A;  1LQB A;  4I6L B;  4DDI D;  3RUL A;  2PEA A;  1UZX B;  1P1A A;  3IFW B;  4AOF A;  1V2Y A;  4MEL A;  1WJU A;  2XK5 A;  2IY1 B;  2KMC A;  3JW0 X;  3PTF C;  3AU5 A;  1WH3 A;  1KOT A;  2BF8 B;  3OJ3 A;  1YX5 B;  1TTN A;  2NBV B;  1WR1 A;  4IM2 A;  1E8Z A;  2KLG A;  2KNB A;  3H1U A;  2MCN B;  4W9I A;  4OVU A;  1GUA B;  2BKF A;  2FUH B;  2KDE B;  3TIX A;  3VVW B;  2G45 B;  1TZ1 A;  2GOW A;  2MP2 B;  2PPH A;  3DDC B;  4HDQ A;  4LJP B;  5E6N A;  4G11 A;  3IBE A;  1WFY A;  2NCN A;  4IW0 A;  4ICU A;  4CO7 A;  4W9C A;  2JZ3 B;  3QWZ B;  2ZNV C;  3LDZ E;  4NY0 A;  4GXB A;  4BBN C;  4GDL B;  4RMA A;  1LXD A;  2N4F A;  1P0R A;  1E8Y A;  1WGH A;  4M0W B;  2D10 A;  5GMV A;  1NI2 A;  2KO3 A;  5LLI A;  3OLM D;  2XBB C;  2LGD A;  5IAA C;  3B1L X;  2KWV B;  5JH5 C;  4IG7 B;  3N32 A;  4MH0 E;  5EDS A;  2WDT B;  4HDO A;  2EMS A;  1WX9 A;  2L05 A;  4K7S A;  4W9F A;  4F1S A;  2W9N A;  4ZDV A;  3V60 A;  4WWN A;  1EO6 A;  4GSW A;  1S3S G;  2D11 A;  4TQ1 A;  4HVB A;  1GG3 A;  2LJ5 A;  3ZUN A;  2FID A;  2BWF A;  2LGY A;  5C23 A;  3X23 A;  3A1Q A;  1P3Q U;  3O65 B;  2KWU B;  4X57 B;  1H4R A;  5KHQ A;  3GOE A;  2M8S A;  3PGE A;  2IYD B;  1GJZ A;  3RUI B;  3DVG Y;  4B95 A;  3C0R B;  3HM3 A;  2J0K A;  1J8C A;  2ZNV B;  2L00 B;  3VUY A;  2KX0 A;  2LD9 A;  2IO1 B;  3DPD A;  3KUC B;  3PRZ A;  2J0J A;  3SDL C;  5AZH A;  4GN1 A;  3ZDT A;  2KMA A;  4K7W A;  2LRW A;  2OJR A;  3H6N A;  1E90 A;  5D7G A;  4KVG B;  3ZTC A;  4TQ0 A;  4NJ7 A;  4BKT A;  3KVF B;  3NZU A;  4AJY B;  1WX8 A;  1C1Y B;  2B3A A;  2CS4 A;  3QA8 A;  3ZO5 B;  3DBR I;  2LGX A;  2BWE S;  2GBR A;  3UQA A;  1V6E A;  2KFK B;  1RFA A;  4FA6 A;  2M1M A;  4PYZ A;  1UH6 A;  3ONS A;  4AJW A;  4MJS A;  1X1M A;  2BGF A;  3R7Q A;  3MJW A;  1LM8 B;  4I6N B;  4CYE A;  3WAM A;  2FAZ A;  4BKS A;  5J18 A;  3VH3 B;  3VDZ A;  4M8N A;  3ZDM C;  2DYB A;  4MGY E;  1WJ6 A;  4FHK A;  1ISN A;  4W9D A;  2KC2 A;  3RCZ A;  2CU1 A;  1YX6 B;  1Z2M A;  4EFO A;  4PYU A;  3P2B A;  3TMP B;  4B6W A;  4JL9 A;  3WA0 A;  3L08 A;  4IWO A;  1Q5W B;  4DXA B;  1QZE A;  2CKH B;  4GDL A;  2KJH B;  2CHW A;  3V62 A;  4FN2 A;  2N9E B;  2ZCB A;  1NBF C;  5G2N A;  1J0G A;  2JXX A;  2L0F A;  1V86 A;  2AL3 A;  4FLH A;  1H8C A;  2A5U A;  2BKR B;  1Q1O A;  3EEC A;  3JVZ X;  1WZ0 A;  2N1W A;  5TR5 A;  4ICV A;  5DPW A;  1C3T A;  3T9L A;  2NPT B;  4GGQ A;  2KLC A;  1WI0 A;  3A4R A;  5D6J B;  2KHW B;  1E8X A;  3AUL A;  1WYW B;  2FCN A;  1KM7 A;  2FIF A;  3I3T B;  4I6P A;  1WE6 A;  2DAJ A;  3HIZ A;  5DCN A;  4BKG A;  1WF9 A;  3IHP C;  3M63 B;  3JYU A;  5L83 A;  4PS7 A;  1UBQ A;  2KQS A;  3M95 A;  4EZK A;  2DZK A;  2N1V A;  3ZNH B;  2HTH A;  1WJ4 A;  1U4A A;  2OOB B;  4BVU C;  3HK0 A;  2A4Z A;  2JT4 B;  4A20 A;  2V1Y A;  3RT3 B;  2MA9 B;  4GDK A;  3KYD D;  1BT0 A; 
#chains in the Genus database with same CATH topology
 3KQ4 A;  1FFV A;  2MSE D;  1WGY A;  1TKY A;  3PHX B;  1WXA A;  1L4Z B;  2V4I B;  2K0P A;  3OAW A;  4RGO S;  1OTR B;  2KVR A;  2ZZP B;  3R2T A;  2X38 A;  5C2T B;  2ZCC A;  4KZC A;  3H9D A;  4MDK E;  4S17 A;  1R4N I;  2TSS A;  5G55 A;  4US9 A;  3AE8 B;  4IC7 B;  1UGJ A;  1XLO A;  4D2K A;  1E5W A;  1ROE A;  3W2D A;  3EFU A;  2IND C;  1JRP A;  2D07 B;  3AM9 A;  3MJ5 A;  4REZ A;  2WX1 A;  1RLF A;  4OHJ A;  4K7U A;  1D5Z C;  1QQR A;  2C60 A;  2C7M B;  2LEK A;  3ZNG C;  4JPS A;  1TKG A;  3WAN A;  2KJR A;  3V05 A;  4W9H A;  1ESF A;  2BW2 A;  3FC4 A;  1XLP A;  1XCT L;  2KN4 A;  3QCA A;  3FAH A;  2KWC A;  1TYG B;  2KXJ A;  4LDT D;  3QAR A;  3T3O A;  4GLS C;  4KKI A;  2ASQ A;  2CJO A;  2RMM A;  4NJ6 A;  2IO0 B;  5DPS A;  1PGX A;  2K9X A;  2K8H A;  1HZ6 A;  4BZA A;  4ZHP A;  4MEM A;  1XEE A;  2JQR B;  4MSQ B;  2V4L A;  1EWC A;  2GBK A;  2Y3A A;  1WXS A;  3ML9 A;  5L95 C;  3TEW A;  4C80 A;  2KTF A;  2N9K A;  2NTS A;  4TUU A;  2J52 A;  4E71 A;  3SR6 A;  1JW9 D;  1K51 A;  1VZ8 A;  3DHH C;  2NMQ A;  1FPY A;  4KSL C;  1K53 A;  4HCN B;  2KJ6 A;  1I35 A;  2IGG A;  3VTV A;  2WXN A;  5FR6 A;  5D3I B;  5AUK A;  2G1E A;  1SE2 A;  4LNI A;  1C4P A;  1P7F A;  5LXH A;  3NZ3 A;  1TGZ B;  4WJQ A;  4KIK B;  3MTN B;  2RSU A;  4XE0 A;  4BOZ B;  3IVF A;  1GPX A;  2JVC A;  3ZGZ A;  1UUP A;  3SEB A;  1A70 A;  2KVZ A;  3RNC C;  4GOC A;  4GB9 A;  1Q0W B;  1UEL A;  3PV1 A;  1XO3 A;  4JE3 B;  3EHV A;  3BII D;  3ZXR A;  4NJC A;  5IKC M;  2OHF A;  1XD3 B;  1SE9 A;  3K9O B;  2YVC A;  2WYQ A;  1GC7 A;  1CMX B;  2YEP F;  3AH7 A;  2R2O A;  3H7P B;  3A4S C;  4KV2 A;  1SSN A;  2C9W B;  1AWD A;  1V5T A;  1AYF A;  2DYM A;  3PRP B;  4KGS A;  1KLV A;  4TKN A;  2BB5 A;  1F52 A;  4XWW A;  3A9J B;  3EC8 A;  1C78 A;  3QAQ A;  1SIJ A;  3GZN I;  3VRB B;  1V1O A;  2HDE A;  1IGC A;  2BPS A;  1LO5 D;  3LJ3 A;  4P7I A;  5FKA C;  3DCG A;  5AZG A;  1EWY C;  1FFU A;  2I1J A;  1XLN A;  1F77 A;  4XC2 A;  3I57 A;  4NNJ B;  2NVU I;  3EFC A;  4HPL B;  1ZUD 2;  1WR6 E;  4JIO U;  4Q2J A;  4IOI E;  2KTR A;  1NI3 A;  1MVK A;  3DBS A;  5CX3 A;  3VHT C;  2RD0 A;  2DAF A;  4OVV A;  4A8X C;  3DVN U;  3VTU A;  1AW7 A;  4EEW A;  4NPN A;  2KQ4 X;  3QC8 B;  2OJW A;  2DZJ A;  2LUE A;  2Z0E B;  5AZF A;  2O2V B;  2JY6 A;  4HPM B;  2C5L C;  2Z0D B;  3UIN B;  3GS2 A;  4PS8 A;  5D94 A;  4OZC A;  1WXV A;  1C9F A;  3GB1 A;  4W9L A;  2DZI A;  2DBY A;  4QAY A;  1TS3 A;  2VH2 A;  3KUD B;  1D5X C;  4LJO B;  2Z59 B;  1WE7 A;  3MFG A;  1ZPS A;  4P16 A;  1UF0 A;  2HTM E;  4DDI D;  3L4P A;  3OJ3 A;  5GXG B;  4W9I A;  1GUA B;  2GOW A;  2BBC A;  1SXT A;  2PPH A;  3DDC B;  2KAC A;  3Q3O C;  4M0W A;  2B76 B;  2JZ3 B;  2WXG A;  1BXT A;  4NY0 A;  1NYQ A;  3NRZ A;  5LNK 1;  2N4F A;  1E8Y A;  5HFY A;  1NI2 A;  2KO3 A;  3B2G A;  5LLI A;  1C4C A;  3B1L X;  2KWV B;  5JH5 C;  4IG7 B;  1GB1 A;  1TY2 A;  4HDO A;  2EMS A;  1WX9 A;  4W9F A;  4F1S A;  2W9N A;  1UNS A;  1GG3 A;  1XLQ A;  2BWF A;  2LGY A;  3X23 A;  3A1Q A;  3AE9 B;  2AQ1 B;  5HHD G;  5KHQ A;  3PGE A;  2IYD B;  5EE9 A;  4B95 A;  2PLP A;  2KX0 A;  2IO1 B;  3DPD A;  2KMA A;  1N60 A;  2LRW A;  3H6N A;  1E90 A;  4TQ0 A;  4BKT A;  3AB5 A;  3KVF B;  2INC C;  4AJY B;  3OWE B;  1C1Y B;  3QA8 A;  3SFE B;  3IAS 1;  3TSS A;  3ZO5 B;  2ZW1 A;  3UQA A;  2KFK B;  1RFA A;  2J4X A;  3AEF B;  3ONS A;  4MJS A;  1X1M A;  3R7Q A;  4KX6 B;  4I6N B;  4MAC A;  3WAM A;  3VH3 B;  1RWS A;  3VDZ A;  3ZDM C;  3Q14 C;  4FHK A;  2L32 A;  1JWU D;  3P4S B;  2E3T A;  4JL9 A;  3P4Q B;  1Q5W B;  1EU3 A;  4DXA B;  2CU3 A;  2N9E B;  2ZCB A;  1J0G A;  1L4D B;  1MFW A;  1H8C A;  2BKR B;  1Q1O A;  3NVW A;  4L2Y A;  3EUB 2;  3A4R A;  1KLU D;  2MJD A;  3AE7 B;  4LNK A;  2VZK D;  3MC8 A;  4K3C A;  4I6P A;  1IUE A;  4BKG A;  3IHP C;  1SJH D;  1E7P B;  4FXC A;  3AV8 A;  3ZNH B;  1CK1 A;  2J42 A;  3HK0 A;  5FR3 A;  2RDB C;  4A20 A;  4GDK A;  5BYS A;  4CHK A;  2WDQ B;  1FO4 A;  2HD5 B;  1ZKH A;  3L54 A;  4JX1 C;  1WIA A;  1V8C A;  3KH0 A;  4A55 A;  3SHQ A;  4C7Z A;  2KK8 A;  3VTW A;  2JX5 A;  1RYJ A;  5C1Z A;  2LAS A;  3QHT A;  1XCQ L;  1WXQ A;  4MJS B;  4RF0 A;  3TCA A;  1EUV B;  2BT6 A;  1YOV B;  4ARI A;  4IWP A;  1N62 A;  2LI5 A;  3KWV A;  3Q8B A;  1RAX A;  4BAX A;  2RPQ A;  3K9P B;  4HJG E;  5EE0 A;  5J17 A;  1T0Y A;  3CSF A;  3AED B;  3V6C B;  3L17 A;  2WXM A;  2GBJ A;  1WJN A;  5JHB A;  2DYO A;  3RNF C;  5BYR A;  3ZKJ C;  4XX5 A;  2M0A A;  4ARC A;  1I42 A;  1T6B X;  3N3K B;  3PT2 B;  4FJZ A;  4ANX A;  2WXP A;  3VH4 B;  4HJK A;  2L7R A;  4EUT A;  4WIP A;  3C8Y A;  3I9V 1;  2L8J A;  2QIE B;  1YN5 A;  3VR8 B;  4NAW A;  3AN1 A;  3ALB A;  1J19 A;  4KGR A;  2HJ8 A;  2LGS A;  5D3D A;  4NZL B;  1C77 A;  2R2Q A;  2WXO A;  5G5G A;  3AI5 A;  2LGI A;  2KN5 A;  2LFI A;  3CF6 E;  4HLE A;  3PSE B;  2FCS A;  2NR2 A;  2JPH A;  1N5W A;  2FBW B;  1TBE A;  2K6Q A;  2FNJ B;  1TIF A;  4LDT B;  4W9K A;  1XF5 L;  2M56 B;  2WX0 A;  2KOX A;  5CHV C;  2WXI A;  3PRE A;  3B08 A;  2MP2 A;  2RR9 A;  1OQQ A;  1TT5 B;  2ZJD A;  4NQK E;  1E0Z A;  3O13 A;  4PS3 A;  3ZJT A;  4C4V B;  2IO3 B;  3FIL A;  1JRO A;  4GU2 A;  1FD6 A;  2AL6 A;  3J9C A;  4BOS C;  3CST A;  4LLG M;  3N9Y C;  1VD2 A;  1I4Q A;  4ZRI A;  2SAK A;  2MRP A;  1DGJ A;  2O6V D;  3E9S A;  1DOI A;  2WS3 B;  1YIW A;  3DBH I;  1HXY D;  2UWQ A;  2MBQ A;  1QT9 A;  2D3A A;  1D5M C;  2JZZ A;  5IN7 A;  2I2Y A;  3DBL I;  1PYW D;  3P4P B;  2IGH A;  4XYC A;  2GMI C;  2MEK A;  4GIV A;  5FK9 C;  2K8C A;  1OFF A;  4J6I A;  4ZRK A;  2CR5 A;  5J2R A;  4WWP A;  2M19 A;  3P63 A;  4WH4 A;  3KYC D;  3ENE A;  3AU4 A;  5JHA A;  3MHZ A;  3KUZ A;  2MW5 A;  2KC1 A;  3NS8 A;  4US8 A;  1XQQ A;  3CIR B;  1I4G A;  3PS6 A;  3D32 A;  2BYE A;  1FNU A;  5BMI A;  3NVZ A;  4MGZ E;  4TSS A;  2JWZ A;  2N9P C;  4J3O D;  4BKS D;  1K50 A;  2KX3 A;  4YTN B;  2R61 A;  4JWU C;  1E10 A;  2Q5W D;  1T3Q A;  4C7Y A;  2BB6 A;  4N6E B;  2BTE A;  4LK0 M;  2IBI B;  1JRU A;  2QMT A;  1WGG A;  1GOZ A;  2EMT A;  1PFD A;  5BO4 B;  1FXI A;  5IA7 A;  1P7E A;  4M00 A;  1SIF A;  3NVV A;  3APF A;  1E8W A;  1JWS D;  1NEK B;  1N5X A;  2WXK A;  3P42 A;  1J7B A;  3M62 B;  3VAW A;  4BBN F;  3WAP A;  1YMH E;  2C7N B;  3ZLZ A;  2FUG 1;  4ITK A;  3BK2 A;  3WAL A;  3W1S C;  3VFK A;  2LXC A;  2WXL A;  1MHH E;  4BFR A;  4II3 B;  1OQY A;  1K8R B;  3Q8A A;  4OZB A;  1KRH A;  3L13 A;  4YSZ B;  5JXV A;  5EE1 A;  3AEB B;  1WMH B;  4II2 B;  4ANW A;  3NHE B;  2PE9 A;  4ZYN A;  4RM8 A;  2JRI B;  2KDI A;  2X8X X;  1GB4 A;  4YL8 A;  3ZRC A;  4MM3 B;  2JUO A;  1WRI A;  3HVD A;  1QKZ A;  2GLS A;  2ON8 A;  1GNU A;  2PEA A;  1MPE A;  1P1A A;  3IFW B;  4KGT A;  2IY1 B;  2KMC A;  1PDX A;  3PTF C;  1YX5 B;  2NBV B;  1WR1 A;  4IM2 A;  2KNB A;  2MCN B;  2INP E;  2KDE B;  3TIX A;  3VVW B;  2GI9 A;  1TZ1 A;  2W55 A;  4HDQ A;  2V9H A;  4G11 A;  3IBE A;  2NCN A;  1ENF A;  4ICU A;  3QWZ B;  3R2I A;  4XGA B;  4GXB A;  4RMA A;  4OZA A;  5G5H A;  4M0W B;  5GMV A;  2D10 A;  2XBB C;  2LGD A;  5IAA C;  1YQ3 B;  3N32 A;  3LB8 C;  1VRA B;  4ZDV A;  2L05 A;  2ICI A;  1QOB A;  1JML A;  4WWN A;  5I4D A;  1C4A A;  1R4M B;  1EO6 A;  1S3S G;  4HVB A;  3ZUN A;  2PW9 A;  2QJL A;  1P3Q U;  2KWU B;  1F2R I;  2BS2 B;  2BS4 B;  1JWB D;  2KMM A;  2LMC A;  2UU7 A;  1GJZ A;  4XDC A;  3RUI B;  3ZJU A;  3T3N A;  3C0R B;  2CJN A;  3ZDT A;  2J0J A;  3SDL C;  3RPF C;  3I5J C;  4K7W A;  1LGR A;  5HG2 A;  4KVG B;  2Z8L A;  3ZTC A;  3RNA C;  3RFZ B;  1D4B A;  1TS2 A;  2V0G A;  1L5P A;  2LGX A;  2BWE S;  4WUR A;  4PYZ A;  3MJW A;  1L0V B;  2FAZ A;  1VZ6 A;  3Q6B A;  4MGY E;  4OVZ A;  2KC2 A;  1Y56 A;  1YX6 B;  4B6W A;  3DBL B;  2G9H D;  2BYT A;  1QZE A;  2CKH B;  3BVG A;  4GDL A;  2WXR A;  2CHW A;  2MHJ A;  2AL3 A;  2Y5C A;  1WZ0 A;  2N1W A;  4LNO A;  5TR5 A;  4MH8 A;  1WI0 A;  2KHW B;  1E8X A;  3AUL A;  1K52 A;  2FCN A;  2OED A;  1PGA A;  1WF9 A;  3CWI A;  3M63 B;  4PS7 A;  1UBQ A;  3M95 A;  4EZK A;  2DZK A;  2N1V A;  1WJ4 A;  2OOB B;  4BVU C;  1BUI C;  3PZ8 A;  2MA9 B;  3QX1 A;  3DHG C;  1M4V A;  3VUX A;  3ZQ4 A;  1KTK A;  1TS5 A;  2KDF B;  2AQ2 B;  4RM9 A;  3A1Q B;  2KAJ A;  3N1X C;  1EM7 A;  1TY0 A;  4HKQ A;  1HE8 A;  1L2N A;  2DZM A;  3UQB A;  1WX7 A;  2DWQ A;  3DWG C;  1J7C A;  2K1F A;  2NBW B;  1A5R A;  3PRM B;  3ZIM A;  4ASW C;  1EU4 A;  1R7S A;  1RRB A;  1Z5S B;  2D3B A;  3JSV A;  1VJK A;  3L10 B;  4DHZ B;  3BK1 A;  1F0Z A;  2JF5 A;  2K3U A;  5CHW A;  1GAQ B;  1SBB B;  2SEB D;  3MP9 A;  2L0T A;  4B0E A;  5CTR C;  2LWP A;  3TEX A;  1OGW A;  4IWQ A;  2MLB A;  2N9L A;  4E3C A;  1D3Z A;  3ZW3 A;  2LJI A;  3W9C B;  1WM2 A;  3W5V B;  4G50 A;  3AEA B;  3S2A A;  1HQR D;  3AE6 B;  1RM6 C;  1R4M I;  2LXA A;  4HCP B;  4RGM A;  2WXF A;  4L23 A;  2DEN B;  4ZRQ A;  4FUL A;  3R7R A;  1F1H A;  2AEH A;  3PPA A;  1WMH A;  3WAO A;  3DHI C;  4LNF A;  2V3S A;  2KWD A;  4G3X B;  1FXA A;  4AQ7 A;  1NEN B;  2L3Z A;  3PLU A;  2D2Q A;  4HKZ E;  3NY5 A;  4FBJ B;  2DX5 B;  1UBI A;  1HA5 A;  2G4S A;  2CHX A;  3Q69 A;  3NVY A;  4MGK E;  2JU6 X;  3ZVV A;  5TSS A;  3Q2A C;  4HRO A;  2LVO A;  4B9K A;  2IZV B;  2MBO A;  3KW5 B;  4JWS C;  2ZPN A;  1HZ5 A;  2VRR B;  3H8H A;  2NPT A;  1WRD B;  2YLM A;  1YN4 A;  1ZP0 B;  1T0S C;  3Q8C A;  4JQW C;  5DPR A;  2XEW A;  2GBM A;  1FXT B;  2N9X A;  2IJ0 A;  2PKO A;  3RNE C;  3V6E B;  1JQ4 A;  5E6P A;  1YQB A;  4A3P A;  1V1P B;  2K25 A;  2XN9 C;  4HEA 1;  3CMM B;  3TEZ A;  2QHO A;  2KQ7 A;  2KTR B;  1QIL A;  1UD7 A;  4M8M A;  3Q3F A;  3PZD A;  2XNA C;  3N20 C;  1SGH A;  3ZTD A;  1ACC A;  3AE1 B;  1T0Q C;  4IM3 A;  4M01 A;  2WXH A;  4KSK C;  3DBH B;  3LYY A;  2G4D B;  4IM0 A;  4WJN A;  2K8B A;  1QOA A;  2KZR A;  4ANU A;  3NG0 A;  2ZPY A;  5IO9 A;  3NUH B;  4K81 A;  1Y8R C;  2LVQ A;  2LVP A;  2FCQ A;  3PVL A;  4KDI C;  3EGR A;  2O6V A;  4EZJ A;  3EA6 A;  4F8C B;  4N58 A;  1QF6 A;  2E6X A;  2CHZ A;  2DHZ A;  1V1P A;  3BYY B;  3B0A A;  2L76 A;  3ZRF A;  2FCM A;  2RDG A;  4MM3 A;  5H8Y E;  1RFK A;  1L0Y B;  1FIQ A;  3ABV B;  2BVC A;  4NAM A;  3BYT B;  4PT5 A;  1WWT A;  3A33 B;  2GBN A;  2M0X A;  2JZP A;  4P1C C;  4YTM B;  4HWI B;  1TJE A;  2I1K A;  3ML8 A;  1DOX A;  4K3B A;  1MJD A;  1MG4 A;  4RNA A;  3DVN V;  4HK2 A;  3IAM 1;  1MHX A;  2YEP B;  1N61 A;  1FMA D;  4TMA B;  1KH0 A;  4TV3 A;  2ZEQ A;  3L0W B;  3AEE B;  3QK0 A;  2KKC A;  5LXI B;  2PJH A;  1YJ1 A;  3WIM A;  1L6U A;  4WQM A;  2FE8 A;  3SU8 X;  1M94 A;  1B1Z A;  1ZW7 A;  1FM0 D;  2KDB A;  3ECI A;  4PK1 A;  2H88 B;  3BIN A;  2EEL A;  2LZ6 A;  3U8Z A;  2PTL A;  2NS5 A;  3BY4 B;  4YWG G;  3RZW C;  1YNT E;  2K6D B;  3PZ7 A;  4FJV B;  2M17 A;  5AEK B;  3IG3 A;  5C3J B;  2WDV B;  2BYF A;  2WNM A;  4MGI E;  1IBX B;  2MH7 A;  2N7D A;  2C7H A;  3ZNZ B;  1P98 A;  1JCK B;  4KZ0 A;  1SB3 C;  1P9D U;  3R66 C;  4LTU A;  1AAR A;  2HJ1 A;  1ZXH A;  1SF0 A;  1KJT A;  4AUQ C;  5JZE B;  3X0W A;  1YN3 A;  1NDD A;  1VCB A;  2MJE A;  3AE3 B;  3MHS D;  1L0X B;  1XXG A;  3C19 A;  3M3J A;  5D2M B;  3DOW A;  4MSM B;  4LNN A;  2J0M A;  1ZOY B;  2HE7 A;  4KKJ A;  3URY A;  4JGH B;  3UI3 A;  1VDV A;  3UGB B;  4ANV A;  4WWM A;  4I6L B;  3RUL A;  1YQ4 B;  4XDD A;  4MEL A;  1PGB A;  3DWM A;  3JW0 X;  1WH3 A;  2BF8 B;  2JYT A;  1E8Z A;  2KLG A;  3H1U A;  4OVU A;  1B9R A;  4RCO A;  3RN9 C;  2IGD A;  4C4V A;  3I63 C;  4LJP B;  4H2A A;  1WFY A;  4IW0 A;  3W5U B;  4CO7 A;  4P6V F;  4B0M A;  4L1B A;  3LDZ E;  2K5P A;  3HVZ A;  4GDL B;  4BBN C;  2N7J A;  5E6J A;  1WGH A;  3OLM D;  4HPP A;  4MH0 E;  2WDT B;  3PO0 A;  5H92 C;  1FRD A;  2H89 B;  2AX5 A;  2PVG C;  1HEZ E;  4GSW A;  2D11 A;  4N59 A;  4ZOH C;  3O65 B;  3GOE A;  2M8S A;  2QEJ C;  3DVG Y;  3ZJV A;  1HTQ A;  2ZNV B;  2L00 B;  3VUY A;  2LD9 A;  3PRZ A;  5AZH A;  1R4N B;  5AUI A;  1UWM A;  2OJR A;  4NJ7 A;  3NZU A;  1WX8 A;  2B3A A;  2CS4 A;  4YSY B;  1PUT A;  2NTT A;  4IKG A;  2QIL A;  3DBR I;  2GBR A;  2WHI A;  1V6E A;  4FA6 A;  2M1M A;  3N1Z C;  2BGF A;  2BS3 B;  4CYE A;  4BKS A;  5J18 A;  1SE3 A;  1OQR A;  3U7Z A;  1WJ6 A;  1ISN A;  4W9D A;  3BWU D;  1E9M A;  2CU1 A;  2BQQ A;  1Z2M A;  3P2B A;  2Y5P A;  3WA0 A;  2GRI A;  2KJH B;  1JWM D;  3V62 A;  4FN2 A;  4RFB A;  2L0F A;  2ONQ A;  1V86 A;  1NYR A;  1V97 A;  1C3T A;  3T9L A;  4P1B C;  5D6J B;  1TZO A;  1WYW B;  1KM7 A;  2FIF A;  3I3T B;  3ZYY X;  1WE6 A;  4YTP B;  3HIZ A;  5DCN A;  3R8B A;  3HRD D;  3JYU A;  5L83 A;  1I4R A;  2HTH A;  1U4A A;  2A4Z A;  2JT4 B;  1BT0 A;  2MBE A;  2GB1 A;  1XT9 B;  3Q8E A;  4AS1 A;  3IXS A;  3QQ8 B;  3AXC A;  1G6J A;  2WWZ A;  2JXT A;  3NOB A;  3RD2 A;  2IO2 B;  2WP9 B;  3W1Y A;  2W54 A;  3FIL B;  2D3G A;  2V3N A;  4YSX B;  4ACF A;  2MX2 A;  4FJY A;  5BMG A;  3Q3M C;  1IPG A;  2LHE A;  1SE4 A;  2J7Q B;  4CQN A;  3SD5 A;  4IUM B;  3AE5 B;  4AP4 C;  1MG8 A;  2I38 A;  4DBG A;  1KFY B;  1YJJ A;  2KAN A;  4KIK A;  2WU2 B;  2D3C A;  1QOG A;  3T8M A;  1ZDX A;  2QCZ A;  4LCD E;  1V5O A;  3QIJ A;  2J53 A;  2REX A;  5CHF A;  3A9K A;  3L16 A;  4W9G A;  1L7Y A;  4ZRJ A;  3BVZ A;  1SEB D;  1NVI D;  3NS1 A;  1WXM A;  2ZVN A;  4MT5 A;  4EOY A;  2IDY A;  2KFK A;  2K39 A;  4GMV A;  3U2S C;  1V81 A;  4WWO A;  2EKE C;  1T0R C;  1ZGU B;  3B9J A;  3VRA B;  1BML C;  2IPK D;  1N6Z A;  3RNB C;  3HUI A;  1WGK A;  1LFD A;  2AYO B;  4USA A;  1CZP A;  3DQV A;  2WGS A;  2EKI A;  1OEY A;  3VUW A;  4DXF A;  4XZ4 A;  2RGF A;  3QJZ A;  5KHO A;  1CQV A;  1KLG D;  4HXD A;  1N63 A;  1EF1 A;  3W1S A;  2PIA A;  2N7E A;  2RPV A;  3JSV B;  3PHW B;  2O6V B;  3OG5 A;  3R3M A;  4HRS A;  1QOF A;  2BYV E;  4K1R B;  2W3S A;  4A3O A;  3VQI A;  3TJP A;  4DXG A;  1WY8 A;  4DWF A;  2QDF A;  2KT7 A;  1Q10 A;  1DYQ A;  1I4H A;  4ZYS A;  4NQL B;  2IY0 B;  2WU5 B;  3NZS A;  4DHZ E;  1E7U A;  4RF1 A;  4RGT A;  5IP4 D;  3V3X A;  3OJ4 B;  4DHJ B;  2QC8 A;  3AE2 B;  3GP7 A;  1IBX A;  3B2F A;  1V80 A;  2N0S B;  4AWJ A;  2JRH A;  4WQO B;  1E7V A;  4A90 A;  4JLC A;  1WSP A;  4WAA A;  4YT0 B;  5DPT A;  4IDI A;  4W9E A;  4DDG D;  3RNG C;  1E6E B;  3HM6 X;  1WGR A;  4G0N B;  3U7D A;  2KFJ A;  1IYF A;  1EF5 A;  3APC A;  4GDK B;  2JWU A;  2K22 A;  4FAD A;  2RDH A;  1WM3 A;  2AWT A;  3AE4 B;  2ACZ B;  5E6O A;  1IP9 A;  3UIO B;  1C79 A;  3Q3N C;  2XK5 B;  1V9J A;  2O2V A;  3A9K B;  3E56 A;  1F2R C;  2LRU A;  3RI7 C;  1JAL A;  2PE6 B;  3PLV A;  3TBL D;  5HI1 A;  2UYZ B;  1WGD A;  3AEG B;  3H7S A;  3U30 A;  4A6Q A;  2M4N A;  1V49 A;  3RMK C;  3V61 A;  4W9J A;  2WXJ A;  3DVG X;  4NAW B;  5BMH A;  1WZ3 A;  3GE3 C;  2JSV X;  4O1N A;  4WJO A;  3UIP B;  3AMZ A;  1I4P A;  2INN E;  2JYE A;  2KDM A;  1S1Q B;  1VR9 A;  2MQJ A;  3N1Y C;  4ZRP A;  3Q3J A;  2G3Q B;  1TKE A;  3KLS X;  3IT4 B;  1IGD A;  3UF8 A;  3RYT A;  1UGM A;  3ETR A;  4WJP A;  3APD A;  1F9J A;  3DBR B;  3WCQ A;  1SJE D;  3TL5 A;  1FEH A;  1I4X A;  1GC6 A;  3BVM A;  3GZN B;  4N9F 4;  4YXD B;  2LUM A;  3VXW A;  3HHM A;  4RH6 A;  1OEY J;  4OW0 A;  4EZL A;  3A9J A;  2VH1 A;  3KWL A;  1PQS A;  2KD0 A;  2DNF A;  3ZNI D;  4EKU A;  1L6V A;  4DK5 A;  4FHJ A;  4URK A;  2MBB B;  1FNW A;  3GE8 C;  1UWX A;  1D6E C;  3H7P A;  4KDL B;  1STE A;  4UDU C;  4DHJ D;  2L52 A;  2WXQ A;  1FNV A;  2LHD A;  4F7Z A;  1DOY A;  5HKH A;  3N30 A;  2W3R A;  2MWS B;  4C56 C;  2ZVO A;  3RZF A;  2Y5B B;  2NBU A;  1KF6 B;  4E74 A;  2WDR B;  1WYG A;  2MBH A;  1YD8 U;  1FCL A;  1LQB A;  1AN8 A;  5MPO A;  5EE3 A;  1UZX B;  4AOF A;  1V2Y A;  3FKY A;  1WJU A;  2XK5 A;  3AU5 A;  1KOT A;  1TTN A;  2AQ3 B;  2BKF A;  3VR9 B;  1YJI A;  2FUH B;  2G45 B;  3TUO A;  5BYQ A;  2MP2 B;  1J7A A;  4WAF A;  5E6N A;  2QSD A;  1CJE A;  2ZW0 A;  4W9C A;  3BZD B;  2ZNV C;  1I7H A;  4EE2 A;  1VZ7 A;  1LXD A;  1JWA D;  1P0R A;  4ZHO A;  4C00 A;  2WLB A;  5EDS A;  1C76 A;  2VZK B;  4K7S A;  1FCC C;  1T5X D;  1MI0 A;  3V60 A;  4TQ1 A;  4XWT A;  3MC0 B;  2LJ5 A;  5T8I A;  2FID A;  5C23 A;  3P1M A;  1VLB A;  4X57 B;  1H4R A;  4S0R A;  4M02 A;  3HM3 A;  2J0K A;  1J8C A;  3KUC B;  2W82 A;  1ET6 A;  4GN1 A;  2L1A A;  2L83 A;  4R3D A;  5D7G A;  3P4R B;  4RGN A;  3LXF A;  3MC9 A;  2DLB A;  4AJW A;  1UH6 A;  3Q8F A;  1LM8 B;  2PVO D;  4M8N A;  2DYB A;  3AEC B;  3RCZ A;  5IOI A;  4EFO A;  4PYU A;  3TMP B;  2PMV A;  1QLB B;  1HTO A;  3L08 A;  4IWO A;  4DQO C;  2KYW A;  2V3P A;  3U52 E;  1ZXI A;  1FRR A;  2WQY B;  1NBF C;  5G2N A;  2JXX A;  4FLH A;  2D5G A;  2A5U A;  1TS4 A;  3EEC A;  3IT6 B;  3JVZ X;  4ICV A;  5DPW A;  1ZDV A;  2NPT B;  1ET9 A;  4GGQ A;  2KLC A;  3ZXV A;  3NJT A;  1ZE3 D;  2DAJ A;  4A9A A;  3U4E G;  2KQS A;  2MJ3 A;  3TEY A;  3SFD B;  2V1Y A;  3KYD D;  3RT3 B; 
#chains in the Genus database with same CATH homology
 3VUX A;  2MBE A;  1XT9 B;  2KDF B;  4CHK A;  2HD5 B;  1ZKH A;  2MSE D;  1WGY A;  3A1Q B;  3L54 A;  3PHX B;  1WXA A;  4RM9 A;  3QQ8 B;  1WIA A;  1HE8 A;  3AXC A;  1G6J A;  2WWZ A;  1L2N A;  2DZM A;  3OAW A;  3UQB A;  1WX7 A;  3KH0 A;  3NOB A;  2K1F A;  1OTR B;  2NBW B;  3RD2 A;  2KK8 A;  2KVR A;  2IO2 B;  2ZZP B;  3SHQ A;  3VTW A;  3PRM B;  1A5R A;  3W1Y A;  5C1Z A;  2D3G A;  4ASW C;  3ZIM A;  1RRB A;  1Z5S B;  2LAS A;  3JSV A;  2MX2 A;  3QHT A;  4FJY A;  2ZCC A;  3L10 B;  4DHZ B;  4KZC A;  4MJS B;  3H9D A;  2JF5 A;  3TCA A;  4MDK E;  1EUV B;  5CHW A;  1IPG A;  1R4N I;  4IWP A;  2LI5 A;  1RAX A;  2L0T A;  5G55 A;  5CTR C;  2J7Q B;  2LWP A;  1OGW A;  4IWQ A;  2MLB A;  2RPQ A;  3SD5 A;  3K9P B;  4IUM B;  4AP4 C;  1MG8 A;  5J17 A;  4IC7 B;  4E3C A;  1D3Z A;  1T0Y A;  3CSF A;  3ZW3 A;  4DBG A;  1WM2 A;  1E5W A;  4G50 A;  2KAN A;  3V6C B;  4KIK A;  3S2A A;  3L17 A;  3EFU A;  2D07 B;  1R4M I;  3T8M A;  2LXA A;  2WX1 A;  1RLF A;  2GBJ A;  4LCD E;  1WJN A;  4HCP B;  1V5O A;  4K7U A;  5JHB A;  2C60 A;  2DYO A;  3QIJ A;  2C7M B;  2DEN B;  2REX A;  3ZNG C;  3ZKJ C;  5CHF A;  4FUL A;  4XX5 A;  3A9K A;  3L16 A;  4W9G A;  3R7R A;  1L7Y A;  4ZRJ A;  1I42 A;  3N3K B;  2AEH A;  3PT2 B;  3PPA A;  1WMH A;  3WAN A;  2KJR A;  3WAO A;  1WXM A;  4W9H A;  2ZVN A;  4EOY A;  4FJZ A;  2V3S A;  3QCA A;  2KFK A;  2K39 A;  4GMV A;  4ANX A;  4G3X B;  2KWC A;  3VH4 B;  1V81 A;  4WWO A;  2L3Z A;  4HJK A;  2L7R A;  2EKE C;  2KXJ A;  3PLU A;  4LDT D;  4EUT A;  3QAR A;  2D2Q A;  1ZGU B;  2L8J A;  3NY5 A;  4FBJ B;  2ASQ A;  2DX5 B;  1LFD A;  1UBI A;  2G4S A;  2IO0 B;  4NJ6 A;  5DPS A;  2CHX A;  2K8H A;  4NAW A;  3ALB A;  1J19 A;  2AYO B;  4MGK E;  2HJ8 A;  3ZVV A;  3DQV A;  4MEM A;  3VUW A;  1OEY A;  2LVO A;  4B9K A;  2R2Q A;  4XZ4 A;  2IZV B;  2MBO A;  2RGF A;  3KW5 B;  4MSQ B;  2ZPN A;  2VRR B;  3AI5 A;  2V4L A;  2KN5 A;  3QJZ A;  5KHO A;  4HXD A;  2GBK A;  3CF6 E;  4HLE A;  2NPT A;  3PSE B;  1WRD B;  1WXS A;  2FCS A;  2NR2 A;  2YLM A;  2JPH A;  3ML9 A;  5L95 C;  1EF1 A;  3W1S A;  1TBE A;  2K6Q A;  2FNJ B;  2N7E A;  2KTF A;  3JSV B;  2O6V B;  3PHW B;  4LDT B;  4JQW C;  4W9K A;  3R3M A;  5DPR A;  2XEW A;  2BYV E;  1FXT B;  2GBM A;  2N9X A;  2WX0 A;  4K1R B;  3RZF A;  3V6E B;  2KOX A;  4TUU A;  5E6P A;  5CHV C;  1YQB A;  4A3P A;  4E71 A;  3PRE A;  3B08 A;  4A3O A;  2MP2 A;  3VQI A;  2K25 A;  3TJP A;  2RR9 A;  2ZJD A;  3CMM B;  2QHO A;  4KSL C;  4NQK E;  2KQ7 A;  2KTR B;  1WY8 A;  4HCN B;  4DWF A;  2KJ6 A;  1I35 A;  1UD7 A;  4M8M A;  3Q3F A;  4PS3 A;  3PZD A;  2IO3 B;  1SGH A;  3VTV A;  3ZTD A;  4NQL B;  5FR6 A;  2IY0 B;  3NZS A;  4DHZ E;  4GU2 A;  1E7U A;  5LXH A;  2AL6 A;  4IM3 A;  3OJ4 B;  4KSK C;  4DHJ B;  4BOS C;  3CST A;  2G4D B;  4IM0 A;  4WJN A;  2K8B A;  1TGZ B;  4AWJ A;  1V80 A;  4WJQ A;  4KIK B;  1VD2 A;  2JRH A;  3MTN B;  1E7V A;  2KZR A;  4WQO B;  4ANU A;  2RSU A;  4JLC A;  2ZPY A;  4ZRI A;  4BOZ B;  2MRP A;  2O6V D;  3IVF A;  4K81 A;  4WAA A;  1Y8R C;  2LVQ A;  2LVP A;  5DPT A;  4W9E A;  2FCQ A;  2JVC A;  3PVL A;  4KDI C;  4DDG D;  1YIW A;  3DBH I;  2UWQ A;  2MBQ A;  2O6V A;  4EZJ A;  3HM6 X;  1WGR A;  4G0N B;  4GOC A;  4GB9 A;  3U7D A;  1Q0W B;  4F8C B;  2JZZ A;  1UEL A;  3PV1 A;  2KFJ A;  2CHZ A;  3DBL I;  2DHZ A;  1IYF A;  3EHV A;  1EF5 A;  3APC A;  4GDK B;  3B0A A;  2GMI C;  4FAD A;  2L76 A;  4GIV A;  2K8C A;  3ZRF A;  2FCM A;  1WM3 A;  4MM3 A;  2AWT A;  1XD3 B;  1SE9 A;  3K9O B;  5E6O A;  2YVC A;  1IP9 A;  2WYQ A;  3UIO B;  1GC7 A;  1CMX B;  4J6I A;  4ZRK A;  2R2O A;  2CR5 A;  3A33 B;  3H7P B;  5J2R A;  2XK5 B;  2GBN A;  1V9J A;  2M0X A;  2O2V A;  3A4S C;  3A9K B;  3QX1 A;  4KV2 A;  4WWP A;  2C9W B;  2LRU A;  4HWI B;  1V5T A;  3ENE A;  3AU4 A;  3KYC D;  5JHA A;  2DYM A;  3PRP B;  2PE6 B;  3PLV A;  2I1K A;  3TBL D;  3ML8 A;  3KUZ A;  2MW5 A;  2KC1 A;  2UYZ B;  3NS8 A;  1WGD A;  1KLV A;  3DVN V;  1XQQ A;  4TKN A;  4HK2 A;  3H7S A;  3PS6 A;  3D32 A;  2BYE A;  3A9J B;  3U30 A;  3EC8 A;  4TV3 A;  2ZEQ A;  3L0W B;  2M4N A;  3QAQ A;  4MGZ E;  1V49 A;  2KKC A;  3QK0 A;  5LXI B;  3GZN I;  2JWZ A;  2PJH A;  1YJ1 A;  3WIM A;  3V61 A;  2BPS A;  2N9P C;  4W9J A;  3SU8 X;  4BKS D;  3DVG X;  3LJ3 A;  4NAW B;  1M94 A;  4P7I A;  3DCG A;  2KX3 A;  1WZ3 A;  5AZG A;  1ZW7 A;  2I1J A;  2KDB A;  3ECI A;  4WJO A;  3UIP B;  3BIN A;  2IBI B;  1JRU A;  2LZ6 A;  1WGG A;  1S1Q B;  3U8Z A;  2EMT A;  4XC2 A;  2MQJ A;  4NNJ B;  2NS5 A;  3BY4 B;  5BO4 B;  2NVU I;  3Q3J A;  2G3Q B;  4HPL B;  5IA7 A;  3RZW C;  1WR6 E;  1SIF A;  4JIO U;  2K6D B;  4FJV B;  3UF8 A;  3APF A;  3RYT A;  2M17 A;  1UGM A;  1E8W A;  2KTR A;  5AEK B;  3IG3 A;  4WJP A;  3DBS A;  2BYF A;  5CX3 A;  3APD A;  1F9J A;  3TL5 A;  3VHT C;  2RD0 A;  2DAF A;  4OVV A;  1GC6 A;  4N9F 4;  4MGI E;  3VXW A;  3HHM A;  3DVN U;  1OEY J;  3VTU A;  3M62 B;  4EEW A;  3A9J A;  4NPN A;  4EZL A;  3VAW A;  2N7D A;  2C7H A;  3QC8 B;  4BBN F;  3WAP A;  3ZNZ B;  2C7N B;  2DZJ A;  1P98 A;  1PQS A;  2KD0 A;  3ZNI D;  4EKU A;  2LUE A;  2Z0E B;  4KZ0 A;  5AZF A;  2O2V B;  3ZLZ A;  1P9D U;  2JY6 A;  3R66 C;  4DK5 A;  4HPM B;  4FHJ A;  2C5L C;  2Z0D B;  4URK A;  3UIN B;  2MBB B;  3WAL A;  4PS8 A;  3W1S C;  3VFK A;  1AAR A;  2LXC A;  4BFR A;  5D94 A;  3H7P A;  4II3 B;  4KDL B;  1OQY A;  1KJT A;  1WXV A;  1K8R B;  4AUQ C;  4DHJ D;  5JZE B;  3X0W A;  4F7Z A;  3L13 A;  4W9L A;  2DZI A;  5HKH A;  1NDD A;  1VCB A;  1WMH B;  4II2 B;  3KUD B;  3MHS D;  4ANW A;  3N30 A;  3NHE B;  2MWS B;  3M3J A;  2PE9 A;  2ZVO A;  3DOW A;  5D2M B;  2Y5B B;  4MSM B;  4RM8 A;  2J0M A;  2NBU A;  2JRI B;  4LJO B;  4ZYN A;  2KDI A;  2Z59 B;  1WE7 A;  2HE7 A;  4E74 A;  4YL8 A;  3ZRC A;  2JUO A;  4JGH B;  3UGB B;  2MBH A;  1YD8 U;  1GNU A;  4ANV A;  1LQB A;  4I6L B;  4DDI D;  3RUL A;  2PEA A;  1UZX B;  1P1A A;  3IFW B;  4AOF A;  1V2Y A;  4MEL A;  1WJU A;  2XK5 A;  2IY1 B;  2KMC A;  3JW0 X;  3PTF C;  3AU5 A;  1WH3 A;  1KOT A;  2BF8 B;  3OJ3 A;  1YX5 B;  1TTN A;  2NBV B;  1WR1 A;  4IM2 A;  1E8Z A;  2KLG A;  2KNB A;  3H1U A;  2MCN B;  4W9I A;  4OVU A;  1GUA B;  2BKF A;  2FUH B;  2KDE B;  3TIX A;  3VVW B;  2G45 B;  1TZ1 A;  2GOW A;  2MP2 B;  2PPH A;  3DDC B;  4HDQ A;  4LJP B;  5E6N A;  4G11 A;  3IBE A;  1WFY A;  2NCN A;  4IW0 A;  4ICU A;  4CO7 A;  4W9C A;  2JZ3 B;  3QWZ B;  2ZNV C;  3LDZ E;  4NY0 A;  4GXB A;  4BBN C;  4GDL B;  4RMA A;  1LXD A;  2N4F A;  1P0R A;  1E8Y A;  1WGH A;  4M0W B;  2D10 A;  5GMV A;  1NI2 A;  2KO3 A;  5LLI A;  3OLM D;  2XBB C;  2LGD A;  5IAA C;  3B1L X;  2KWV B;  5JH5 C;  4IG7 B;  3N32 A;  4MH0 E;  5EDS A;  2WDT B;  4HDO A;  2EMS A;  1WX9 A;  2L05 A;  4K7S A;  4W9F A;  4F1S A;  2W9N A;  4ZDV A;  3V60 A;  4WWN A;  1EO6 A;  4GSW A;  1S3S G;  2D11 A;  4TQ1 A;  4HVB A;  1GG3 A;  2LJ5 A;  3ZUN A;  2FID A;  2BWF A;  2LGY A;  5C23 A;  3X23 A;  3A1Q A;  1P3Q U;  3O65 B;  2KWU B;  4X57 B;  1H4R A;  5KHQ A;  3GOE A;  2M8S A;  3PGE A;  2IYD B;  1GJZ A;  3RUI B;  3DVG Y;  4B95 A;  3C0R B;  3HM3 A;  2J0K A;  1J8C A;  2ZNV B;  2L00 B;  3VUY A;  2KX0 A;  2LD9 A;  2IO1 B;  3DPD A;  3KUC B;  3PRZ A;  2J0J A;  3SDL C;  5AZH A;  4GN1 A;  3ZDT A;  2KMA A;  4K7W A;  2LRW A;  2OJR A;  3H6N A;  1E90 A;  5D7G A;  4KVG B;  3ZTC A;  4TQ0 A;  4NJ7 A;  4BKT A;  3KVF B;  3NZU A;  4AJY B;  1WX8 A;  1C1Y B;  2B3A A;  2CS4 A;  3QA8 A;  3ZO5 B;  3DBR I;  2LGX A;  2BWE S;  2GBR A;  3UQA A;  1V6E A;  2KFK B;  1RFA A;  4FA6 A;  2M1M A;  4PYZ A;  1UH6 A;  3ONS A;  4AJW A;  4MJS A;  1X1M A;  2BGF A;  3R7Q A;  3MJW A;  1LM8 B;  4I6N B;  4CYE A;  3WAM A;  2FAZ A;  4BKS A;  5J18 A;  3VH3 B;  3VDZ A;  4M8N A;  3ZDM C;  2DYB A;  4MGY E;  1WJ6 A;  4FHK A;  1ISN A;  4W9D A;  2KC2 A;  3RCZ A;  2CU1 A;  1YX6 B;  1Z2M A;  4EFO A;  4PYU A;  3P2B A;  3TMP B;  4B6W A;  4JL9 A;  3WA0 A;  3L08 A;  4IWO A;  1Q5W B;  4DXA B;  1QZE A;  2CKH B;  4GDL A;  2KJH B;  2CHW A;  3V62 A;  4FN2 A;  2N9E B;  2ZCB A;  1NBF C;  5G2N A;  1J0G A;  2JXX A;  2L0F A;  1V86 A;  2AL3 A;  4FLH A;  1H8C A;  2A5U A;  2BKR B;  1Q1O A;  3EEC A;  3JVZ X;  1WZ0 A;  2N1W A;  5TR5 A;  4ICV A;  5DPW A;  1C3T A;  3T9L A;  2NPT B;  4GGQ A;  2KLC A;  1WI0 A;  3A4R A;  5D6J B;  2KHW B;  1E8X A;  3AUL A;  1WYW B;  2FCN A;  1KM7 A;  2FIF A;  3I3T B;  4I6P A;  1WE6 A;  2DAJ A;  3HIZ A;  5DCN A;  4BKG A;  1WF9 A;  3IHP C;  3M63 B;  3JYU A;  5L83 A;  4PS7 A;  1UBQ A;  2KQS A;  3M95 A;  4EZK A;  2DZK A;  2N1V A;  3ZNH B;  2HTH A;  1WJ4 A;  1U4A A;  2OOB B;  4BVU C;  3HK0 A;  2A4Z A;  2JT4 B;  4A20 A;  2V1Y A;  3RT3 B;  2MA9 B;  4GDK A;  3KYD D;  1BT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...