2KTRB

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'MSLTVEAYLLGKEEAAREIRRFSFSFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFAIYIKEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sequestosome-1
publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrB00
2MBQA 2KNBA 1EUVB 3DPDA 2KN5A 2K25A 3LDZE 2MCNB 3R66C 2KFJA 2Z0EB 3HHMA 3PT2B 2AL6A 4HVBA 3SHQA 4DWFA 3PPAA 1J19A 2ZJDA 2MBBB 1GG3A 1S1QB 3H6NA 4W9DA 4AJWA 5LXHA 2JRHA 1KJTA 2MRPA 4GU2A 1WFYA 2ZPNA 3H7PB 2FAZA 2JRIB 2LVQA 2DYOA 3H7PA 4G3XB 4NQLB 4GOCA 4RM9A 4FN2A 4K1RB 3BY4B 2L0FA 4K7UA 1J0GA 1WZ0A 4F7ZA 3ZTCA 4WJNA 2RD0A 5LXIB 3PHWB 4IM3A 5CTRC 3SDLC 5DPWA 2YLMA 5KHOA 4G11A 4MSQB 1Z5SB 2EKEC 4GGQA 3WALA 4EEWA 1H8CA 1ZKHA 4GDKB 1P3QU 2GBRA 1K8RB 2VRRB 3WAPA 1WR1A 4GDKA 1V86A 3ZDTA 4BKTA 3D32A 2K39A 2C7HA 1V5OA 5G55A 3VUXA 1XD3B 3HK0A 3AXCA 4A3PA 2ZCCA 3DQVA 3DBRI 5EDSA 5G2NA 3UIPB 2L0TA 4A20A 1RLFA 4E74A 2KQ7A 3DBHI 2XEWA 1RRBA 4MGYE 4ZRKA 4RM8A 5E6PA 3ZKJC 4MH0E 5JH5C 2MA9B 1M94A 4W9CA 2AYOB 1SIFA 4PYUA 1P0RA 5D2MB 1Q1OA 3VUWA 2M1MA 2PJHA 4IW0A 3M95A 4II3B 3HM3A 1R4NI 5CHVC 3IHPC 4HDOA 3NZUA 3Q3FA 2D10A 2N9EB 1CMXB 2KXJA 3TJPA 3JSVB 4FADA 4K7WA 2LD9A 3JW0X 3JVZX 1WRDB 3APFA 1LFDA 3B08A 3DVGX 2MSED 4JLCA 2NBUA 3AU4A 2ZCBA 2BYVE 4WWPA 3QQ8B 4IG7B 3UF8A 2KC1A 4J6IA 2O6VA 3R7RA 4IC7B 2WWZA 4KDLB 2FNJB 2D3GA 5AZFA 4HJKA 4W9GA 2KMAA 2OJRA 4ZRJA 3U30A 4ANUA 4EZJA 5LLIA 2O2VB 4KZCA 1EF1A 2FCSA 2BYEA 2QHOA 4DHJD 3N3KB 4JIOU 2ZNVC 1NDDA 3PSEB 3A9KB 3V6CB 4MGZE 2WX0A 4PS3A 2UYZB 2AL3A 3A9KA 2DX5B 3M62B 4I6NB 5GMVA 2KLCA 2L3ZA 1I35A 1YQBA 2MP2B 1E90A 2DENB 2ZPYA 1IP9A 1WGDA 3NZSA 3S2AA 1WR6E 3VXWA 2MP2A 3PRPB 3VFKA 5L95C 1C3TA 4TV3A 2ZVNA 4GDLB 2B3AA 2N4FA 4WJQA 2RR9A 3L54A 2FIDA 4GDLA 3X0WA 2V3SA 4ZDVA 3ZVVA 1GJZA 1S3SG 2HD5B 3EHVA 4G50A 5L83A 2MWSB 4FJVB 4FA6A 3QCAA 3U8ZA 1V6EA 4X57B 3PTFC 3KUDB 3A4SC 3TIXA 1A5RA 3ONSA 4JQWC 1H4RA 3PHXB 3M63B 2KWCA 5E6OA 4GSWA 4MM3A 3A1QA 1Z2MA 2V4LA 1I42A 2DAJA 1WX9A 2JVCA 4LCDE 4F8CB 2KQSA 3QWZB 1YJ1A 2JZ3B 1UH6A 2K8HA 2LVOA 2C7MB 4LDTD 3VUYA 4M0WB 2KD0A 4DDGD 2CKHB 3VHTC 3TMPB 3IG3A 4HCNB 2KDIA 3ZIMA 1WE7A 1WXMA 2EMSA 2N7DA 4YL8A 4EZLA 3QJZA 4P7IA 4BVUC 5HKHA 4MGIE 3L10B 3PV1A 1L2NA 1WJ4A 2ASQA 4KSKC 1WM3A 2NS5A 2M17A 3RULA 4URKA 3DVGY 2N7EA 1OEYA 2O6VD 4WAAA 3EC8A 3K9OB 2KJHB 4DHJB 3L0WB 3UQAA 1GC7A 4DDID 3OAWA 1VCBA 4FHJA 2BYFA 2GBKA 2DZMA 2Y5BB 3PREA 2KHWB 4KIKA 3OJ4B 2PE9A 2AWTA 4MELA 2KDBA 3WA0A 3VDZA 1J8CA 3RD2A 1IYFA 2IZVB 2JPHA 2MX2A 4GB9A 1TBEA 2WDTB 2UWQA 3QIJA 4IUMB 4W9IA 2YVCA 3PLUA 3IBEA 1LXDA 3DOWA 1WX8A 2LGXA 3A9JA 3RZFA 2KO3A 5IA7A 2JY6A 2KK8A 2MBEA 4XX5A 2MQJA 2HTHA 2CU1A 3A33B 4B9KA 2KX3A 4NY0A 3SU8X 3UGBB 1E8ZA 3WANA 3DBSA 4OVVA 3O65B 4BOSC 1RAXA 1WXAA 5C23A 2MBOA 4MSMB 4WWNA 1TZ1A 2GBNA 4I6PA 4DK5A 2DZKA 2A4ZA 4M8MA 1NI2A 3VVWB 1WX7A 1MG8A 2K8BA 2LXAA 1KM7A 2KDFB 3ZNID 1L7YA 5CHWA 4DHZE 2LJ5A 5E6NA 4KV2A 3K9PB 4KSLC 3RUIB 3WIMA 1V81A 2ZEQA 3QARA 2FIFA 4LDTB 1GC6A 3H7SA 3N30A 4GIVA 4IM0A 4LJOB 4EUTA 3RT3B 3WAMA 1E7UA 3VAWA 1WGRA 4K7SA 3VTWA 3VTVA 2KTRB 1WE6A 3ZO5B 1AARA 2IY1B 2KANA 1ISNA 4AJYB 2KTRA 4TKNA 2MW5A 2MLBA 4MGKE 3ZNZB 1SE9A 4KVGB 2RSUA 1P9DU 3M3JA 2O6VB 3DDCB 4NNJB 2NVUI 4HPMB 1TTNA 4BKSA 2BKRB 3KH0A 3UIOB 4AUQC 3CSTA 1WY8A 3DVNV 1WM2A 1OEYJ 4HXDA 2CS4A 1ZGUB 2WX1A 3QAQA 3PVLA 4HDQA 2G4SA 1RFAA 2WYQA 3CSFA 1GNUA 1XQQA 2JWZA 2PE6B 4BBNF 3ZLZA 2K6QA 2EMTA 2J7QB 1IPGA 4HCPB 1LM8B 2A5UA 2N1VA 4ICUA 4NJ7A 2XK5B 4IWPA 4B95A 4E3CA 4N9F4 2NCNA 2KDEB 1VD2A 4MJSB 3APDA 4GN1A 2BPSA 2XK5A 3RYTA 2GBMA 2L05A 3VH4B 1YX6B 1LQBA 4MJSA 3AU5A 4W9JA 1OGWA 5JHAA 2LI5A 2NPTB 2GBJA 3VQIA 5DPTA 4XZ4A 2NPTA 3QHTA 2JZZA 4A3OA 4HPLB 3W1SA 2LASA 3NOBA 3AULA 3KUCB 5AEKB 4MDKE 4ASWC 2CR5A 3EFUA 3L17A 1QZEA 2KOXA 3A1QB 2JF5A 2Z59B 4B6WA 2D11A 2V1YA 2BKFA 3JYUA 4CYEA 2I1KA 2J0MA 1P98A 3CMMB 3T9LA 2IO2B 2IO3B 3MHSD 4FHKA 3Q3JA 3PS6A 1NBFC 1UZXB 4FJYA 3VTUA 3ZTDA 1E7VA 1YIWA 3B0AA 1OTRB 4KDIC 4NJ6A 2DZIA 3HM6X 3ZDMC 2DHZA 2PPHA 2PEAA 2IBIB 2C5LC 2XBBC 1UELA 2DYBA 2AEHA 2KTFA 1U4AA 2N1WA 2N9XA 2ZZPB 3ECIA 3H9DA 4G0NB 4IWOA 4BKSD 5C1ZA 3ALBA 4CO7A 1WF9A 5D7GA 4BOZB 1F9JA 1WGHA 4KIKB 1HE8A 1V2YA 2NBWB 4ZRIA 4CHKA 2J0KA 3PGEA 2BWFA 2L00B 4OVUA 2M8SA 4W9HA 3SD5A 2I1JA 1UBQA 1C1YB 4ICVA 5IAAC 3V61A 1V9JA 2LGDA 2G45B 3OLMD 3IFWB 1V5TA 4FJZA 1UGMA 4II2B 4ANXA 2C9WB 4RMAA 2FCQA 3R7QA 3A9JB 3T8MA 4JGHB 3A4RA 2CHXA 4IM2A 1E5WA 4ANVA 2LZ6A 3MJWA 4MEMA 3GOEA 3APCA 3QK0A 4XC2A 3ZUNA 2JXXA 5DCNA 5J18A 3ZNGC 2Z0DB 4DXAB 4HLEA 1BT0A 1WGYA 3PRMB 3X23A 1T0YA 3KYDD 1TGZB 2C60A 1FXTB 2LWPA 4ZYNA 3ML8A 3OJ3A 4WWOA 3DCGA 1OQYA 2W9NA 4EOYA 4TUUA 3TBLD 3RZWC 3ZW3A 4TQ0A 1UD7A 2M4NA 2IY0B 3IVFA 3RCZA 4E71A 4EKUA 2GMIC 3C0RB 5KHQA 2KMCA 4FLHA 4NAWB 2L7RA 1WI0A 3DBLI 1GUAB 5TR5A 1KLVA 3VH3B 4K81A 4NAWA 1WMHB 3KW5B 2HE7A 1Y8RC 2K1FA 2K8CA 2K6DB 2R2OA 1WMHA 4EFOA 1ZW7A 3ZNHB 4WJOA 4AWJA 4BKGA 5D94A 1V49A 2KWUB 3QX1A 2G3QB 3UQBA 3U7DA 3B1LX 1X1MA 2M0XA 3QC8B 2NBVB 4IWQA 4BBNC 2KX0A 3L08A 4W9EA 3AI5A 2C7NB 2KZRA 2HJ8A 3PLVA 1WYWB 4FBJB 3QA8A 2BWES 4W9LA 1G6JA 1YD8U 1Q0WB 2DAFA 2LUEA 2CHZA 3ENEA 4LJPB 3PZDA 3W1YA 2LXCA 3ML9A 3L16A 3TL5A 1P1AA 3N32A 5AZHA 1E8XA 1PQSA 4PYZA 2OOBB 2KFKB 2NR2A 2LGYA 1WJ6A 5J17A 3JSVA 2RGFA 3NHEB 2KFKA 5AZGA 4DHZB 2JT4B 3ZRFA 3L13A 2G4DB 2N9PC 2L76A 3LJ3A 2J0JA 4WJPA 3V60A 2REXA 2FUHB 3BINA 5DPSA 1R4MI 3W1SC 3UINB 4PS7A 2KWVB 4HK2A 4BFRA 1WGGA 3KYCD 2LRUA 2O2VA 2LRWA 5BO4B 2MBHA 4EZKA 1Q5WB 2LVPA 2DYMA 3V62A 2KKCA 1EO6A 5FR6A 2IYDB 4F1SA 4WQOB 2ZNVB 3I3TB 4KZ0A 2R2QA 4AOFA 3HIZA 4HWIB 1KOTA 3GZNI 5DPRA 5JZEB 3KVFB 3P2BA 1WXSA 3MTNB 4GXBA 4AP4C 2JUOA 2GOWA 2IO0B 2BF8B 5CX3A 1WZ3A 3NY5A 2FCMA 4PS8A 1V80A 3DVNU 4NPNA 4DBGA 1E8WA 1WJNA 1WIAA 2KJRA 4TQ1A 4FULA 1WXVA 2IO1B 3KUZA 2CHWA 1XT9B 1WH3A 2DZJA 3TCAA 5JHBA 5J2RA 5CHFA 1YX5B 3NS8A 3R3MA 4NQKE 4W9KA 1JRUA 5D6JB 3ZRCA 1D3ZA 2D2QA 2FCNA 1E8YA 4JL9A 2RPQA 1EF5A 2BGFA 2D07B 2ZVOA 3WAOA 4I6LB 2KVRA 2KJ6A 3H1UA 4M8NA 2KLGA 1WJUA 3CF6E 3V6EB 1UBIA 2KC2A 3EECA 4W9FA 4GMVA 2L8JA 1SGHA 3PRZA 4ANWA
chains in the Genus database with same CATH superfamily
2MBQA 2KNBA 1EUVB 1QOBA 3HUIA 4K3CA 3RNEC 3R66C 2B76B 3P4QB 3AEDB 1S1QB 5LXHA 2MRPA 2JRIB 2N9KA 2FUG1 1FRRA 1M4VA 4RM9A 2PIAA 4LLGM 4WJNA 3H8HA 3EGRA 3PHWB 5LXIB 5DPWA 4L2YA 3RPFC 4G11A 3WALA 1H8CA 3NZ3A 1VRAB 1P3QU 3WAPA 2VRRB 2WXGA 1E6EB 4WQMA 3V05A 2LEKA 2C7HA 4YTPB 2X8XX 2WXIA 3AXCA 4A3PA 3U4EG 4RF0A 2WNMA 2X38A 4MGYE 4ZRKA 3V3XA 1M94A 4KKIA 5D2MB 1P0RA 1Q1OA 2PJHA 2WQYB 3M95A 1R4NI 4OZCA 1KLGD 5CHVC 3NZUA 2KXJA 1L0XB 1WYGA 4FADA 2W55A 3B9JA 2MSED 4JLCA 2NBUA 3AU4A 2ZCBA 5BYQA 2ZW0A 3UF8A 4IC7B 2WWZA 3SFDB 2RPVA 4N6EB 2MJDA 5AZFA 3AV8A 1JWUD 4KX6B 5LLIA 2EKIA 4L1BA 3PSEB 1PDXA 4PS3A 2AL3A 2DX5B 3M62B 2KLCA 1I35A 2MP2B 2ZPYA 1IP9A 2BS4B 3OWEB 3PRPB 4XDDA 5L95C 4GDLB 4ZRPA 1FMAD 3X0WA 2V3SA 1GJZA 1XLQA 1AN8A 3U2SC 5T8IA 2ICIA 4FJVB 3BVMA 4FA6A 1I4PA 1TKEA 3U8ZA 2D5GA 1A5RA 4MM3B 3ONSA 4JQWC 5E6OA 2KWCA 2GLSA 4GSWA 1I42A 2DAJA 1WX9A 3QWZB 1GPXA 2PLPA 2KD0A 4M0WA 4HCNB 5G5GA 2N7DA 2EMSA 1NYRA 5HKHA 1L2NA 1ESFA 3C8YA 3RULA 2N7EA 1YJJA 2O6VD 5FK9C 2CJNA 4DDID 2V9HA 2BYFA 3RFZB 2DZMA 1FEHA 3PREA 4KIKA 3OJ4B 2VH2A 3GB1A 2N7JA 1IYFA 2IZVB 4IUMB 1TBEA 4OW0A 3PLUA 3IBEA 1WX8A 2SEBD 2JY6A 2KK8A 4K3BA 2MBEA 5MPOA 2MQJA 2CU1A 3Q8CA 2Y5CA 5C23A 4MSMB 5FR3A 4WURA 4B0EA 3NRZA 4HRSA 2WDVB 1WX7A 4BAXA 3ZNID 4DHZE 3K9PB 3WIMA 2ZEQA 2FIFA 4S17A 1GC6A 3H7SA 3N30A 1DOYA 3AN1A 2L1AA 1MFWA 4K7SA 1C76A 2KANA 2L52A 2AQ1B 1QOFA 5H8YE 4HPMB 3KH0A 5H92C 1HTQA 3RN9C 3CSFA 1XQQA 3MFGA 4HCPB 4ZHPA 2XK5B 4IWPA 4E3CA 5D3DA 2KDEB 2BPSA 4O1NA 1YX6B 3AE2B 3CIRB 3AU5A 4W9JA 3N1YC 2LI5A 1NI3A 3VQIA 3ZQ4A 4XE0A 1MI0A 3QHTA 2JZZA 1WXQA 3W1SA 4HKQA 3KUCB 2CR5A 3EFUA 4JX1C 2KOXA 4H2AA 3NVZA 2Z59B 4CYEA 1OQRA 3CMMB 2IO3B 3MHSD 4FHKA 1NBFC 3DHGC 3ZTDA 1E7VA 1YIWA 1PGXA 2WDQB 2AQ3B 4IOIE 2DHZA 4HROA 4PT5A 2PEAA 2IBIB 1UELA 2DYBA 3AEEB 2AEHA 2KTFA 4BKSD 4G0NB 1WF9A 4KIKB 1ACCA 2J0KA 3BYTB 2M8SA 3SD5A 1UBQA 2LGDA 3OLMD 3IFWB 1F52A 1JWAD 4KGTA 3ZUNA 5HI1A 3BWUD 3ZNGC 1T0YA 4UDUC 1FXTB 4ZYNA 2JSVX 2WLBA 4WWOA 1YN3A 3DCGA 3TBLD 3RZWC 1KLUD 3ZW3A 4TQ0A 1UD7A 5IN7A 1TKGA 1CZPA 3IVFA 1XLNA 3C0RB 5KHQA 4NAWB 1JALA 4REZA 2WXFA 1WI0A 1K51A 1SJHD 1SE3A 3QX1A 3B1LX 3FC4A 2C7NB 4W9LA 1T6BX 1MHXA 3HVZA 4LJPB 3L16A 1P1AA 5AZHA 3ETRA 1PQSA 1V1PB 1KTKA 2KFKB 1WJ6A 3BVZA 5J17A 2D3BA 4AQ7A 5AZGA 2JT4B 1VZ6A 2L76A 2J0JA 2GI9A 2REXA 1QT9A 1D4BA 4RCOA 1C79A 2WGSA 4BFRA 2LUMA 2O2VA 3AE5B 2LVPA 3V62A 2KKCA 1EO6A 3N1XC 3ZJVA 2LFIA 3I3TB 4C00A 1HA5A 3DBRB 3HIZA 1KOTA 3KVFB 1WXSA 3MTNB 2GOWA 1F1HA 3DBHB 1ZXIA 5CX3A 4US9A 2FCMA 1V80A 3DVNU 2W3SA 1E8WA 1WJNA 1WIAA 2KJRA 1SEBD 2CHWA 1XT9B 1WH3A 2DZJA 4YSZB 5CHFA 3R3MA 3NS8A 3DWGC 3ZRCA 4TSSA 4XWWA 2FCNA 4RH6A 1RWSA 1TZOA 2KJ6A 1L4ZB 3RI7C 3B2GA 1RM6C 2Y3AA 2L8JA 2PW9A 1XEEA 3PRZA 1HZ6A 3R2IA 2SAKA 1ZXHA 4QAYA 3PT2B 2AL6A 1GG3A 2JRHA 2ZPNA 2LVQA 1SJED 1STEA 2LGSA 2KDMA 4GOCA 2BW2A 4K1RB 2L0FA 1ZE3D 3ZTCA 2RD0A 3NVVA 1Z5SB 1ZDXA 1J7BA 3DHIC 1K8RB 2QCZA 4JE3B 1V86A 2WXKA 3EA6A 4BKTA 4KGSA 2BBCA 2FE8A 3HK0A 3AE4B 2ZCCA 3DBRI 1YN4A 4P1BC 1JWMD 3IAS1 4A20A 3DBHI 2WXJA 2XEWA 4FXCA 4NZLB 1AWDA 3ZKJC 2NTSA 4IW0A 3HM3A 4WIPA 2D10A 1CMXB 5FKAC 2LD9A 4GLSC 4WWPA 2BYVE 3AE1B 4IG7B 5HG2A 3ZXRA 3SFEB 1UF0A 2FNJB 4ANUA 4HJKA 4W9GA 1C4PA 2OJRA 1L0VB 4ZRJA 2O2VB 1NDDA 3A9KB 4MGZE 5HFYA 1WGKA 1T3QA 2MH7A 4I6NB 2ON8A 2N9LA 1ET6A 3S2AA 1WR6E 1UGJA 2MP2A 5BMGA 1FNUA 2ZVNA 1I4QA 2B3AA 1P7FA 2N4FA 2ZW1A 4WJQA 4GDLA 3BK1A 1S3SG 2DNFA 2IGGA 3PTFC 3AE9B 1HXYD 3IXSA 4MM3A 1Z2MA 2V4LA 2JVCA 4F8CB 1YJ1A 2MJ3A 5LNK1 4DDGD 3IG3A 4MGIE 2JX5A 4KSKC 2NS5A 4URKA 3DVGY 3URYA 4OZAA 1EWCA 3TEWA 3K9OB 2KJHB 3LYYA 4FHJA 2NMQA 2KHWB 2G9HD 2PE9A 4MELA 5AUIA 2BYTA 3VDZA 3RD2A 4IKGA 1B1ZA 4GB9A 3N1ZC 2RMMA 4XYCA 4XX5A 4NY0A 3SU8X 4BZAA 1XLOA 3CWIA 4OVVA 4BOSC 2QIEB 2BTEA 1SB3C 2KT7A 4P6VF 4DK5A 2OJWA 1MG8A 2K8BA 5CHWA 5E6NA 4P1CC 1SBBB 5EE3A 3J9CA 1TS4A 4LDTB 4GIVA 4EUTA 2DBYA 4LNFA 3B2FA 3WAMA 3VAWA 4M02A 3VTVA 2KTRB 1WE6A 1MG4A 1N62A 1QQRA 1ISNA 1NVID 4AJYB 2MW5A 2MLBA 4KVGB 4HJGE 3TEXA 2V0GA 2MHJA 4LNOA 2D3CA 1T5XD 1WM2A 3DVNV 1FO4A 2CS4A 1ZGUB 2QSDA 4HDQA 5JXVA 2WHIA 3SEBA 2K0PA 2PMVA 1FCLA 2EMTA 1LM8B 4ICUA 5G5HA 3VRAB 1YJIA 4N9F4 1VD2A 4MJSB 2XK5A 3VH4B 5TSSA 3FAHA 3FILB 3AEFB 4ARCA 1D5XC 3NOBA 5AEKB 4ASWC 1DOIA 5IP4D 1QZEA 2QJLA 1VLBA 2V1YA 4C56C 2I1KA 3PZ7A 2J0MA 2KWDA 2IO2B 4FJYA 1HEZE 4JWSC 4KDIC 2IPKD 3LXFA 2DZIA 3HM6X 2PPHA 2GRIA 2N9XA 4KV2A 2N1WA 4CQNA 3ECIA 4ACFA 5C1ZA 4CO7A 1FXIA 4BOZB 3AM9A 1WGHA 4CHKA 1V2YA 5IO9A 3PGEA 1R4MB 3NVYA 1CJEA 3VRBB 1MHHE 2I1JA 4IDIA 1N63A 2AX5A 3AEGB 1XCTL 1HTOA 4RNAA 1V5TA 2H88B 5BYRA 1WSPA 3T8MA 4JGHB 3A4RA 1E5WA 2LZ6A 1SSNA 5DCNA 3GZNB 1VZ8A 1GOZA 3X23A 1WGYA 2C60A 2LWPA 3ML8A 4A9AA 4US8A 1OQYA 4EOYA 4TUUA 2WXNA 4TMAB 4LK0M 1I4RA 2WXHA 3MC0B 1IGDA 2L7RA 1GUAB 4NAWA 3KW5B 2R2OA 2E3TA 4WJOA 3W5UB 1X1MA 5BMHA 3HVDA 1WRIA 1HQRD 3IT6B 3L08A 4W9EA 1WYWB 1ZPSA 1TS3A 1UWMA 3Q3OC 1YD8U 2CHZA 2MEKA 3UI3A 1N5XA 2BVCA 3ML9A 4YTMB 1E10A 1I4HA 1IBXB 1GB1A 2GB1A 1V1PA 2RGFA 2KFKA 5IOIA 2G4DB 3LJ3A 4WJPA 3FKYA 1R4MI 2VZKB 2LRUA 2MBHA 1KFYB 1Q5WB 2V4IB 3SR6A 2IYDB 4F1SA 1DOXA 3DWMA 2R2QA 1JWBD 4HWIB 3GZNI 5JZEB 1I7HA 4A8XC 1JROA 4DBGA 2RDGA 4M01A 4C4VA 1VJKA 4TQ1A 2IO1B 3KUZA 5JHBA 3TCAA 1WWTA 1YX5B 1TYGB 4HEA1 1A70A 2KVRA 1WJUA 3CF6E 1UBIA 2K22A 3EECA 3MJ5A 3WCQA 1SGHA 2LHEA 4USAA 4LTUA 4ANWA 2KN5A 2MCNB 2Z0EB 3HHMA 4HVBA 2BQQA 3PPAA 1J19A 2ZJDA 2MBBB 4W9DA 3NS1A 1NENB 3H7PB 2FAZA 2JQRB 3NVWA 2DYOA 3I5JC 1D6EC 1J7CA 4G3XB 3MC9A 4LNNA 4FN2A 3BY4B 4K7UA 1J0GA 4YXDB 1JQ4A 3I57A 4F7ZA 2PVOD 3R2TA 4IM3A 3SDLC 3RNGC 1FD6A 2YLMA 4EEWA 1ZKHA 4GDKB 3L4PA 3U7ZA 1MJDA 1WR1A 4L23A 3VUXA 1XD3B 2LMCA 3T3NA 1YQ3B 2Z8LA 5EDSA 2L0TA 4E74A 2KQ7A 3IAM1 1LGRA 4RM8A 2I38A 4MH0E 5JH5C 2MA9B 1V8CA 3VUWA 1SIFA 2KN4A 1FFVA 4II3B 2Y5PA 3Q3FA 2N9EB 4DXGA 3Q3MC 3TJPA 4ARIA 3Q8AA 1LFDA 1RFKA 2K3UA 3QQ8B 3C19A 3AE7B 4J6IA 4KDLB 4EZJA 2J52A 1QLBB 2N0SB 3U52E 2FCSA 1QF6A 4JPSA 4JIOU 2ZNVC 2WX0A 3EUB2 4ITKA 3A9KA 4YSYB 5GMVA 1E0ZA 1PYWD 1ZP0B 2L3ZA 4J3OD 4C80A 2DENB 1WGDA 3NZSA 2EELA 3VXWA 3GE3C 1YOVB 3VFKA 1C3TA 4TV3A 4C4VB 2RR9A 3L54A 4ZDVA 3ZVVA 1B9RA 2DWQA 3EHVA 1IGCA 2MWSB 1MVKA 3MP9A 3NG0A 2QDFA 1V6EA 4X57B 3A4SC 3TIXA 1PFDA 1H4RA 3PHXB 3A1QA 1MPEA 2KYWA 2JZ3B 1UH6A 2K8HA 3O13A 4LDTD 1FCCC 3VHTC 3ZIMA 4EZLA 4S0RA 4YL8A 3QJZA 4P7IA 3W5VB 3L10B 1WJ4A 2KACA 4NJCA 4WAAA 1LO5D 2WDRB 4DHJB 1V97A 1JCKB 1GC7A 2GBKA 1D5MC 2KDBA 3Q2AC 1J8CA 3AEAB 2YEPF 4XDCA 3PZ8A 2JZPA 1ZDVA 1ROEA 1BUIC 2UWQA 3QIJA 4W9IA 2LGIA 3DOWA 1F0ZA 3RZFA 5IA7A 1SF0A 2IGHA 3A33B 2KX3A 2J4XA 3UGBB 1E8ZA 3WANA 3N20C 2GBNA 4I6PA 1TS2A 2DZKA 2BT6A 4M8MA 1NI2A 3VVWB 1KM7A 2KDFB 2D3AA 3GS2A 1L7YA 1QOGA 4M00A 3VR9B 4KSLC 3RUIB 1V81A 3QARA 4LJOB 3VR8B 4LNIA 3RT3B 1TKYA 3ZO5B 1AARA 2IY1B 2KTRA 4ZOHC 1C4CA 3ZNZB 4WH4A 1ENFA 3W9CB 2E6XA 2RSUA 1P9DU 3M3JA 4NNJB 1TTNA 2BKRB 3UIOB 2CU3A 5IKCM 3CSTA 1C4AA 1WY8A 2WP9B 4HXDA 3P42A 3PVLA 1RFAA 1ET9A 2INDC 2WYQA 1GNUA 2PE6B 2K6QA 4Q2JA 2J7QB 3KLSX 4NJ7A 5AUKA 3BVGA 2GBMA 2L05A 1LQBA 4MJSA 3TUOA 4D2KA 1I4GA 1YQ4B 3FILA 2NPTB 2GBJA 5BYSA 2YEPB 3AECB 1DYQA 2MJEA 1JRPA 4MDKE 1L6UA 3L17A 3A1QB 2JYEA 2JF5A 4B6WA 3ABVB 2BKFA 1P98A 3T9LA 1Q10A 1HZ5A 4KKJA 3VTUA 5D3IB 3KQ4A 4NJ6A 1XLPA 4ZHOA 1NEKB 1D5ZC 3AMZA 2ONQA 3H9DA 1U4AA 4IWOA 1FM0D 5D7GA 1F9JA 2R61A 1HE8A 2NBWB 2FBWB 2HTME 2BWFA 1XF5L 3BK2A 1EM7A 1C1YB 1BXTA 3BYYB 3V61A 1V9JA 2G45B 4FJZA 1FFUA 1L5PA 4ANXA 2C9WB 4RMAA 2FCQA 3R7QA 2CHXA 4MEMA 2WXMA 3QK0A 4XC2A 1L0YB 2JXXA 5J18A 4DXAB 4HLEA 1RYJA 1UNSA 4R3DA 1BT0A 2VZKD 3PRMB 3KYDD 1AYFA 3OJ3A 1ZOYB 2G1EA 3LB8C 2BS3B 1TY2A 2M4NA 2IY0B 3RCZA 2BB6A 2HDEA 4OVZA 2GMIC 2H89B 1UWXA 5EE0A 3Q69A 1WMHB 2K1FA 2W82A 3GE8C 1ZW7A 3ZNHB 4AWJA 4RF1A 1VR9A 3AE8B 3AH7A 1SE4A 2G3QB 4YSXB 3UQBA 5HHDG 2M0XA 3QC8B 4IWQA 4BBNC 3IT4B 2M56B 3Q6BA 1FRDA 2KZRA 2L32A 3PLVA 4FBJB 3QA8A 1L6VA 2BWES 1G6JA 2DAFA 1Q0WB 2OEDA 3ENEA 3PZDA 2OHFA 3TL5A 4ZYSA 2OOBB 1JW9D 2NR2A 2LGYA 4N58A 3JSVA 3NHEB 1IBXA 3N9YC 1K53A 3V60A 2FUHB 5DPSA 2UU7A 3I63C 3W1SC 3UINB 4PS7A 2KWVB 4HK2A 1WGGA 2LRWA 3I9V1 4WAFA 4EZKA 3TEZA 4A6QA 1TJEA 4N59A 4WQOB 2ZNVB 4MT5A 3RMKC 4KZ0A 4YWGG 2V3NA 3TSSA 2KQ4X 4AOFA 3HRDD 5DPRA 1TIFA 4AP4C 2JUOA 4JWUC 3EFCA 4PS8A 1QILA 4NPNA 2JYTA 2K9XA 3P4PB 1WXVA 2PKOA 4LNKA 5J2RA 4W9KA 4NQKE 1JRUA 5D6JB 1C78A 2D2QA 1E8YA 2IJ0A 2LHDA 2RPQA 2D07B 3WAOA 4OHJA 3H1UA 2BB5A 4M8NA 3RNFC 5I4DA 2KLGA 2WS3B 3ZJUA 3T3OA 1FXAA 2KC2A 4W9FA 1V1OA 1IUEA 3KWLA 3DPDA 2K25A 3LDZE 1K50A 2KFJA 2XNAC 2I2YA 1EU3A 3SHQA 4DWFA 4XWTA 4AJWA 3H6NA 1YNTE 1KJTA 1F77A 4GU2A 1WFYA 2XN9C 3P1MA 2WXRA 2WXLA 3H7PA 4NQLB 2RDBC 5GXGB 1WZ0A 1N61A 4DXFA 5CTRC 5KHOA 1FIQA 2W54A 4MSQB 2EKEC 3Q3NC 4GGQA 2GBRA 1BMLC 4GDKA 3ZDTA 1F2RC 3D32A 2K39A 5G55A 1V5OA 2M19A 3ZYYX 3DQVA 5G2NA 3UIPB 4MH8A 1GAQB 1RLFA 3OG5A 1RRBA 2NTTA 5E6PA 1PGBA 1L4DB 2W3RA 4W9CA 2AYOB 4PYUA 2M1MA 3KWVA 1YMHE 3P4RB 1VDVA 1NYQA 3IHPC 4HDOA 3JSVB 1EWYC 4K7WA 3E56A 3JW0X 1KF6B 3JVZX 1WRDB 3APFA 3B08A 3DVGX 3AEBB 1GB4A 2KC1A 2O6VA 3R7RA 1OFFA 1R7SA 2D3GA 3U30A 2KMAA 1TS5A 2L83A 4KZCA 1EF1A 4DHJD 2BYEA 2QHOA 3N3KB 3V6CB 4A90A 2UYZB 4A55A 1OQQA 1FPYA 3RNCC 3R8BA 1YQBA 3GP7A 1DGJA 1E90A 4HKZE 1XCQL 5EE9A 2AQ2B 2FIDA 1N60A 2HD5B 4G50A 2QC8A 1EU4A 5L83A 4OZBA 1AW7A 3QCAA 2INPE 4RGMA 3KUDB 3M63B 4LCDE 3RNAC 2WXQA 2KQSA 2LVOA 1QOAA 2C7MB 3VUYA 4M0WB 2CJOA 2CKHB 3TMPB 4BBNF 2JWUA 2KDIA 2KVZA 1WE7A 1WXMA 2JXTA 5C2TB 4BVUC 3PV1A 2ASQA 1SXTA 1WM3A 2M17A 1OEYA 2Q5WD 3EC8A 5C3JB 3L0WB 3UQAA 3OAWA 1VCBA 4B0MA 2Y5BB 1TT5B 4MACA 4EE2A 2AWTA 1P7EA 1KH0A 3DHHC 3WA0A 2JPHA 2MX2A 3RNBC 2WDTB 2YVCA 1JMLA 1LXDA 2LGXA 3A9JA 2KO3A 2DLBA 1T0RC 2HTHA 2INCC 4B9KA 3NUHB 3DBSA 3O65B 1RAXA 1J7AA 1WXAA 2MBOA 4WWNA 3Q14C 1TZ1A 2V3PA 2A4ZA 4NAMA 2LXAA 2LJ5A 2IGDA 3ZJTA 3ZGZA 4IM0A 4C7ZA 4C7YA 1C9FA 1E7UA 2LJIA 1WGRA 3VTWA 1E7PB 4TKNA 4MGKE 1XXGA 1SE9A 2O6VB 3DDCB 2NVUI 4BKSA 3W2DA 3NJTA 4AUQC 1PUTA 1OEYJ 2WX1A 3QAQA 2G4SA 2J42A 4WWMA 2JWZA 1Y56A 3ZLZA 1XO3A 1IPGA 4DQOC 2A5UA 2N1VA 4B95A 2INNE 3MC8A 2NCNA 3APDA 4GN1A 3RYTA 3Q8BA 1OGWA 5JHAA 5E6JA 5DPTA 4XZ4A 2NPTA 4A3OA 1PGAA 4HPLB 3DBLB 2LASA 3AULA 4XGAB 2PTLA 1SE2A 2D11A 3Q8FA 3JYUA 4RGNA 1N5WA 1I4XA 3Q3JA 3PS6A 1UZXB 3MHZA 1T0QC 3B0AA 1OTRB 2QMTA 1JWSD 3ZDMC 2C5LC 2XBBC 2ZZPB 1UUPA 5BMIA 3ALBA 2J53A 1CQVA 4ZRIA 1E9MA 3AE6B 2L00B 4OVUA 4RGTA 4W9HA 1VZ7A 2VH1A 4ICVA 5IAAC 4RFBA 1UGMA 4II2B 3TEYA 1SIJA 3A9JB 4IM2A 4RGOS 4ANVA 3MJWA 4PK1A 3Q8EA 3GOEA 3APCA 4YTNB 1FNVA 1TY0A 2M0AA 3P4SB 2Z0DB 2WXOA 1TGZB 2W9NA 4KGRA 1C77A 1YN5A 4E71A 4EKUA 1CK1A 2KMMA 2KMCA 4FLHA 3PO0A 2PVGC 3DBLI 5TR5A 1KLVA 3VH3B 4K81A 3BIID 4HPPA 2HE7A 1Y8RC 2K8CA 2K6DB 1WMHA 4EFOA 2ACZB 5D94A 1V49A 2HJ1A 2KAJA 2KWUB 4BKGA 1FNWA 3U7DA 2JU6X 2NBVB 2KX0A 4YT0B 3AI5A 2HJ8A 2QEJC 2LUEA 1KRHA 3W1YA 2LXCA 2TSSA 3N32A 5EE1A 1ZUD2 1E8XA 3AE3B 4PYZA 2WXPA 4DHZB 3ZRFA 3L13A 2N9PC 3BZDB 3BINA 3E9SA 1QKZA 1T0SC 3P63A 2IDYA 3KYCD 2QILA 5BO4B 2DYMA 2WU5B 4AS1A 5FR6A 2BS2B 3ZXVA 3P2BA 4GXBA 2IO0B 2BF8B 1K52A 1WZ3A 3NY5A 4FULA 2RDHA 1R4NB 1D3ZA 3AB5A 4P16A 2K5PA 4JL9A 1N6ZA 1EF5A 2BGFA 2ZVOA 2WU2B 4I6LB 3V6EB 1F2RI 4GMVA 4ZRQA
chains in the Genus database with same CATH topology
2MBQA 2KNBA 1EUVB 3DPDA 2KN5A 2K25A 3LDZE 2MCNB 3R66C 2KFJA 2Z0EB 3HHMA 3PT2B 2AL6A 4HVBA 3SHQA 4DWFA 3PPAA 1J19A 2ZJDA 2MBBB 1GG3A 1S1QB 3H6NA 4W9DA 4AJWA 5LXHA 2JRHA 1KJTA 2MRPA 4GU2A 1WFYA 2ZPNA 3H7PB 2FAZA 2JRIB 2LVQA 2DYOA 3H7PA 4G3XB 4NQLB 4GOCA 4RM9A 4FN2A 4K1RB 3BY4B 2L0FA 4K7UA 1J0GA 1WZ0A 4F7ZA 3ZTCA 4WJNA 2RD0A 5LXIB 3PHWB 4IM3A 5CTRC 3SDLC 5DPWA 2YLMA 5KHOA 4G11A 4MSQB 1Z5SB 2EKEC 4GGQA 3WALA 4EEWA 1H8CA 1ZKHA 4GDKB 1P3QU 2GBRA 1K8RB 2VRRB 3WAPA 1WR1A 4GDKA 1V86A 3ZDTA 4BKTA 3D32A 2K39A 2C7HA 1V5OA 5G55A 3VUXA 1XD3B 3HK0A 3AXCA 4A3PA 2ZCCA 3DQVA 3DBRI 5EDSA 5G2NA 3UIPB 2L0TA 4A20A 1RLFA 4E74A 2KQ7A 3DBHI 2XEWA 1RRBA 4MGYE 4ZRKA 4RM8A 5E6PA 3ZKJC 4MH0E 5JH5C 2MA9B 1M94A 4W9CA 2AYOB 1SIFA 4PYUA 1P0RA 5D2MB 1Q1OA 3VUWA 2M1MA 2PJHA 4IW0A 3M95A 4II3B 3HM3A 1R4NI 5CHVC 3IHPC 4HDOA 3NZUA 3Q3FA 2D10A 2N9EB 1CMXB 2KXJA 3TJPA 3JSVB 4FADA 4K7WA 2LD9A 3JW0X 3JVZX 1WRDB 3APFA 1LFDA 3B08A 3DVGX 2MSED 4JLCA 2NBUA 3AU4A 2ZCBA 2BYVE 4WWPA 3QQ8B 4IG7B 3UF8A 2KC1A 4J6IA 2O6VA 3R7RA 4IC7B 2WWZA 4KDLB 2FNJB 2D3GA 5AZFA 4HJKA 4W9GA 2KMAA 2OJRA 4ZRJA 3U30A 4ANUA 4EZJA 5LLIA 2O2VB 4KZCA 1EF1A 2FCSA 2BYEA 2QHOA 4DHJD 3N3KB 4JIOU 2ZNVC 1NDDA 3PSEB 3A9KB 3V6CB 4MGZE 2WX0A 4PS3A 2UYZB 2AL3A 3A9KA 2DX5B 3M62B 4I6NB 5GMVA 2KLCA 2L3ZA 1I35A 1YQBA 2MP2B 1E90A 2DENB 2ZPYA 1IP9A 1WGDA 3NZSA 3S2AA 1WR6E 3VXWA 2MP2A 3PRPB 3VFKA 5L95C 1C3TA 4TV3A 2ZVNA 4GDLB 2B3AA 2N4FA 4WJQA 2RR9A 3L54A 2FIDA 4GDLA 3X0WA 2V3SA 4ZDVA 3ZVVA 1GJZA 1S3SG 2HD5B 3EHVA 4G50A 5L83A 2MWSB 4FJVB 4FA6A 3QCAA 3U8ZA 1V6EA 4X57B 3PTFC 3KUDB 3A4SC 3TIXA 1A5RA 3ONSA 4JQWC 1H4RA 3PHXB 3M63B 2KWCA 5E6OA 4GSWA 4MM3A 3A1QA 1Z2MA 2V4LA 1I42A 2DAJA 1WX9A 2JVCA 4LCDE 4F8CB 2KQSA 3QWZB 1YJ1A 2JZ3B 1UH6A 2K8HA 2LVOA 2C7MB 4LDTD 3VUYA 4M0WB 2KD0A 4DDGD 2CKHB 3VHTC 3TMPB 3IG3A 4HCNB 2KDIA 3ZIMA 1WE7A 1WXMA 2EMSA 2N7DA 4YL8A 4EZLA 3QJZA 4P7IA 4BVUC 5HKHA 4MGIE 3L10B 3PV1A 1L2NA 1WJ4A 2ASQA 4KSKC 1WM3A 2NS5A 2M17A 3RULA 4URKA 3DVGY 2N7EA 1OEYA 2O6VD 4WAAA 3EC8A 3K9OB 2KJHB 4DHJB 3L0WB 3UQAA 1GC7A 4DDID 3OAWA 1VCBA 4FHJA 2BYFA 2GBKA 2DZMA 2Y5BB 3PREA 2KHWB 4KIKA 3OJ4B 2PE9A 2AWTA 4MELA 2KDBA 3WA0A 3VDZA 1J8CA 3RD2A 1IYFA 2IZVB 2JPHA 2MX2A 4GB9A 1TBEA 2WDTB 2UWQA 3QIJA 4IUMB 4W9IA 2YVCA 3PLUA 3IBEA 1LXDA 3DOWA 1WX8A 2LGXA 3A9JA 3RZFA 2KO3A 5IA7A 2JY6A 2KK8A 2MBEA 4XX5A 2MQJA 2HTHA 2CU1A 3A33B 4B9KA 2KX3A 4NY0A 3SU8X 3UGBB 1E8ZA 3WANA 3DBSA 4OVVA 3O65B 4BOSC 1RAXA 1WXAA 5C23A 2MBOA 4MSMB 4WWNA 1TZ1A 2GBNA 4I6PA 4DK5A 2DZKA 2A4ZA 4M8MA 1NI2A 3VVWB 1WX7A 1MG8A 2K8BA 2LXAA 1KM7A 2KDFB 3ZNID 1L7YA 5CHWA 4DHZE 2LJ5A 5E6NA 4KV2A 3K9PB 4KSLC 3RUIB 3WIMA 1V81A 2ZEQA 3QARA 2FIFA 4LDTB 1GC6A 3H7SA 3N30A 4GIVA 4IM0A 4LJOB 4EUTA 3RT3B 3WAMA 1E7UA 3VAWA 1WGRA 4K7SA 3VTWA 3VTVA 2KTRB 1WE6A 3ZO5B 1AARA 2IY1B 2KANA 1ISNA 4AJYB 2KTRA 4TKNA 2MW5A 2MLBA 4MGKE 3ZNZB 1SE9A 4KVGB 2RSUA 1P9DU 3M3JA 2O6VB 3DDCB 4NNJB 2NVUI 4HPMB 1TTNA 4BKSA 2BKRB 3KH0A 3UIOB 4AUQC 3CSTA 1WY8A 3DVNV 1WM2A 1OEYJ 4HXDA 2CS4A 1ZGUB 2WX1A 3QAQA 3PVLA 4HDQA 2G4SA 1RFAA 2WYQA 3CSFA 1GNUA 1XQQA 2JWZA 2PE6B 4BBNF 3ZLZA 2K6QA 2EMTA 2J7QB 1IPGA 4HCPB 1LM8B 2A5UA 2N1VA 4ICUA 4NJ7A 2XK5B 4IWPA 4B95A 4E3CA 4N9F4 2NCNA 2KDEB 1VD2A 4MJSB 3APDA 4GN1A 2BPSA 2XK5A 3RYTA 2GBMA 2L05A 3VH4B 1YX6B 1LQBA 4MJSA 3AU5A 4W9JA 1OGWA 5JHAA 2LI5A 2NPTB 2GBJA 3VQIA 5DPTA 4XZ4A 2NPTA 3QHTA 2JZZA 4A3OA 4HPLB 3W1SA 2LASA 3NOBA 3AULA 3KUCB 5AEKB 4MDKE 4ASWC 2CR5A 3EFUA 3L17A 1QZEA 2KOXA 3A1QB 2JF5A 2Z59B 4B6WA 2D11A 2V1YA 2BKFA 3JYUA 4CYEA 2I1KA 2J0MA 1P98A 3CMMB 3T9LA 2IO2B 2IO3B 3MHSD 4FHKA 3Q3JA 3PS6A 1NBFC 1UZXB 4FJYA 3VTUA 3ZTDA 1E7VA 1YIWA 3B0AA 1OTRB 4KDIC 4NJ6A 2DZIA 3HM6X 3ZDMC 2DHZA 2PPHA 2PEAA 2IBIB 2C5LC 2XBBC 1UELA 2DYBA 2AEHA 2KTFA 1U4AA 2N1WA 2N9XA 2ZZPB 3ECIA 3H9DA 4G0NB 4IWOA 4BKSD 5C1ZA 3ALBA 4CO7A 1WF9A 5D7GA 4BOZB 1F9JA 1WGHA 4KIKB 1HE8A 1V2YA 2NBWB 4ZRIA 4CHKA 2J0KA 3PGEA 2BWFA 2L00B 4OVUA 2M8SA 4W9HA 3SD5A 2I1JA 1UBQA 1C1YB 4ICVA 5IAAC 3V61A 1V9JA 2LGDA 2G45B 3OLMD 3IFWB 1V5TA 4FJZA 1UGMA 4II2B 4ANXA 2C9WB 4RMAA 2FCQA 3R7QA 3A9JB 3T8MA 4JGHB 3A4RA 2CHXA 4IM2A 1E5WA 4ANVA 2LZ6A 3MJWA 4MEMA 3GOEA 3APCA 3QK0A 4XC2A 3ZUNA 2JXXA 5DCNA 5J18A 3ZNGC 2Z0DB 4DXAB 4HLEA 1BT0A 1WGYA 3PRMB 3X23A 1T0YA 3KYDD 1TGZB 2C60A 1FXTB 2LWPA 4ZYNA 3ML8A 3OJ3A 4WWOA 3DCGA 1OQYA 2W9NA 4EOYA 4TUUA 3TBLD 3RZWC 3ZW3A 4TQ0A 1UD7A 2M4NA 2IY0B 3IVFA 3RCZA 4E71A 4EKUA 2GMIC 3C0RB 5KHQA 2KMCA 4FLHA 4NAWB 2L7RA 1WI0A 3DBLI 1GUAB 5TR5A 1KLVA 3VH3B 4K81A 4NAWA 1WMHB 3KW5B 2HE7A 1Y8RC 2K1FA 2K8CA 2K6DB 2R2OA 1WMHA 4EFOA 1ZW7A 3ZNHB 4WJOA 4AWJA 4BKGA 5D94A 1V49A 2KWUB 3QX1A 2G3QB 3UQBA 3U7DA 3B1LX 1X1MA 2M0XA 3QC8B 2NBVB 4IWQA 4BBNC 2KX0A 3L08A 4W9EA 3AI5A 2C7NB 2KZRA 2HJ8A 3PLVA 1WYWB 4FBJB 3QA8A 2BWES 4W9LA 1G6JA 1YD8U 1Q0WB 2DAFA 2LUEA 2CHZA 3ENEA 4LJPB 3PZDA 3W1YA 2LXCA 3ML9A 3L16A 3TL5A 1P1AA 3N32A 5AZHA 1E8XA 1PQSA 4PYZA 2OOBB 2KFKB 2NR2A 2LGYA 1WJ6A 5J17A 3JSVA 2RGFA 3NHEB 2KFKA 5AZGA 4DHZB 2JT4B 3ZRFA 3L13A 2G4DB 2N9PC 2L76A 3LJ3A 2J0JA 4WJPA 3V60A 2REXA 2FUHB 3BINA 5DPSA 1R4MI 3W1SC 3UINB 4PS7A 2KWVB 4HK2A 4BFRA 1WGGA 3KYCD 2LRUA 2O2VA 2LRWA 5BO4B 2MBHA 4EZKA 1Q5WB 2LVPA 2DYMA 3V62A 2KKCA 1EO6A 5FR6A 2IYDB 4F1SA 4WQOB 2ZNVB 3I3TB 4KZ0A 2R2QA 4AOFA 3HIZA 4HWIB 1KOTA 3GZNI 5DPRA 5JZEB 3KVFB 3P2BA 1WXSA 3MTNB 4GXBA 4AP4C 2JUOA 2GOWA 2IO0B 2BF8B 5CX3A 1WZ3A 3NY5A 2FCMA 4PS8A 1V80A 3DVNU 4NPNA 4DBGA 1E8WA 1WJNA 1WIAA 2KJRA 4TQ1A 4FULA 1WXVA 2IO1B 3KUZA 2CHWA 1XT9B 1WH3A 2DZJA 3TCAA 5JHBA 5J2RA 5CHFA 1YX5B 3NS8A 3R3MA 4NQKE 4W9KA 1JRUA 5D6JB 3ZRCA 1D3ZA 2D2QA 2FCNA 1E8YA 4JL9A 2RPQA 1EF5A 2BGFA 2D07B 2ZVOA 3WAOA 4I6LB 2KVRA 2KJ6A 3H1UA 4M8NA 2KLGA 1WJUA 3CF6E 3V6EB 1UBIA 2KC2A 3EECA 4W9FA 4GMVA 2L8JA 1SGHA 3PRZA 4ANWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBQ A;  2KNB A;  1EUV B;  3DPD A;  2KN5 A;  2K25 A;  3LDZ E;  2MCN B;  3R66 C;  2KFJ A;  2Z0E B;  3HHM A;  3PT2 B;  2AL6 A;  4HVB A;  3SHQ A;  4DWF A;  3PPA A;  1J19 A;  2ZJD A;  2MBB B;  1GG3 A;  1S1Q B;  3H6N A;  4W9D A;  4AJW A;  5LXH A;  2JRH A;  1KJT A;  2MRP A;  4GU2 A;  1WFY A;  2ZPN A;  3H7P B;  2FAZ A;  2JRI B;  2LVQ A;  2DYO A;  3H7P A;  4G3X B;  4NQL B;  4GOC A;  4RM9 A;  4FN2 A;  4K1R B;  3BY4 B;  2L0F A;  4K7U A;  1J0G A;  1WZ0 A;  4F7Z A;  3ZTC A;  4WJN A;  2RD0 A;  5LXI B;  3PHW B;  4IM3 A;  5CTR C;  3SDL C;  5DPW A;  2YLM A;  5KHO A;  4G11 A;  4MSQ B;  1Z5S B;  2EKE C;  4GGQ A;  3WAL A;  4EEW A;  1H8C A;  1ZKH A;  4GDK B;  1P3Q U;  2GBR A;  1K8R B;  2VRR B;  3WAP A;  1WR1 A;  4GDK A;  1V86 A;  3ZDT A;  4BKT A;  3D32 A;  2K39 A;  2C7H A;  1V5O A;  5G55 A;  3VUX A;  1XD3 B;  3HK0 A;  3AXC A;  4A3P A;  2ZCC A;  3DQV A;  3DBR I;  5EDS A;  5G2N A;  3UIP B;  2L0T A;  4A20 A;  1RLF A;  4E74 A;  2KQ7 A;  3DBH I;  2XEW A;  1RRB A;  4MGY E;  4ZRK A;  4RM8 A;  5E6P A;  3ZKJ C;  4MH0 E;  5JH5 C;  2MA9 B;  1M94 A;  4W9C A;  2AYO B;  1SIF A;  4PYU A;  1P0R A;  5D2M B;  1Q1O A;  3VUW A;  2M1M A;  2PJH A;  4IW0 A;  3M95 A;  4II3 B;  3HM3 A;  1R4N I;  5CHV C;  3IHP C;  4HDO A;  3NZU A;  3Q3F A;  2D10 A;  2N9E B;  1CMX B;  2KXJ A;  3TJP A;  3JSV B;  4FAD A;  4K7W A;  2LD9 A;  3JW0 X;  3JVZ X;  1WRD B;  3APF A;  1LFD A;  3B08 A;  3DVG X;  2MSE D;  4JLC A;  2NBU A;  3AU4 A;  2ZCB A;  2BYV E;  4WWP A;  3QQ8 B;  4IG7 B;  3UF8 A;  2KC1 A;  4J6I A;  2O6V A;  3R7R A;  4IC7 B;  2WWZ A;  4KDL B;  2FNJ B;  2D3G A;  5AZF A;  4HJK A;  4W9G A;  2KMA A;  2OJR A;  4ZRJ A;  3U30 A;  4ANU A;  4EZJ A;  5LLI A;  2O2V B;  4KZC A;  1EF1 A;  2FCS A;  2BYE A;  2QHO A;  4DHJ D;  3N3K B;  4JIO U;  2ZNV C;  1NDD A;  3PSE B;  3A9K B;  3V6C B;  4MGZ E;  2WX0 A;  4PS3 A;  2UYZ B;  2AL3 A;  3A9K A;  2DX5 B;  3M62 B;  4I6N B;  5GMV A;  2KLC A;  2L3Z A;  1I35 A;  1YQB A;  2MP2 B;  1E90 A;  2DEN B;  2ZPY A;  1IP9 A;  1WGD A;  3NZS A;  3S2A A;  1WR6 E;  3VXW A;  2MP2 A;  3PRP B;  3VFK A;  5L95 C;  1C3T A;  4TV3 A;  2ZVN A;  4GDL B;  2B3A A;  2N4F A;  4WJQ A;  2RR9 A;  3L54 A;  2FID A;  4GDL A;  3X0W A;  2V3S A;  4ZDV A;  3ZVV A;  1GJZ A;  1S3S G;  2HD5 B;  3EHV A;  4G50 A;  5L83 A;  2MWS B;  4FJV B;  4FA6 A;  3QCA A;  3U8Z A;  1V6E A;  4X57 B;  3PTF C;  3KUD B;  3A4S C;  3TIX A;  1A5R A;  3ONS A;  4JQW C;  1H4R A;  3PHX B;  3M63 B;  2KWC A;  5E6O A;  4GSW A;  4MM3 A;  3A1Q A;  1Z2M A;  2V4L A;  1I42 A;  2DAJ A;  1WX9 A;  2JVC A;  4LCD E;  4F8C B;  2KQS A;  3QWZ B;  1YJ1 A;  2JZ3 B;  1UH6 A;  2K8H A;  2LVO A;  2C7M B;  4LDT D;  3VUY A;  4M0W B;  2KD0 A;  4DDG D;  2CKH B;  3VHT C;  3TMP B;  3IG3 A;  4HCN B;  2KDI A;  3ZIM A;  1WE7 A;  1WXM A;  2EMS A;  2N7D A;  4YL8 A;  4EZL A;  3QJZ A;  4P7I A;  4BVU C;  5HKH A;  4MGI E;  3L10 B;  3PV1 A;  1L2N A;  1WJ4 A;  2ASQ A;  4KSK C;  1WM3 A;  2NS5 A;  2M17 A;  3RUL A;  4URK A;  3DVG Y;  2N7E A;  1OEY A;  2O6V D;  4WAA A;  3EC8 A;  3K9O B;  2KJH B;  4DHJ B;  3L0W B;  3UQA A;  1GC7 A;  4DDI D;  3OAW A;  1VCB A;  4FHJ A;  2BYF A;  2GBK A;  2DZM A;  2Y5B B;  3PRE A;  2KHW B;  4KIK A;  3OJ4 B;  2PE9 A;  2AWT A;  4MEL A;  2KDB A;  3WA0 A;  3VDZ A;  1J8C A;  3RD2 A;  1IYF A;  2IZV B;  2JPH A;  2MX2 A;  4GB9 A;  1TBE A;  2WDT B;  2UWQ A;  3QIJ A;  4IUM B;  4W9I A;  2YVC A;  3PLU A;  3IBE A;  1LXD A;  3DOW A;  1WX8 A;  2LGX A;  3A9J A;  3RZF A;  2KO3 A;  5IA7 A;  2JY6 A;  2KK8 A;  2MBE A;  4XX5 A;  2MQJ A;  2HTH A;  2CU1 A;  3A33 B;  4B9K A;  2KX3 A;  4NY0 A;  3SU8 X;  3UGB B;  1E8Z A;  3WAN A;  3DBS A;  4OVV A;  3O65 B;  4BOS C;  1RAX A;  1WXA A;  5C23 A;  2MBO A;  4MSM B;  4WWN A;  1TZ1 A;  2GBN A;  4I6P A;  4DK5 A;  2DZK A;  2A4Z A;  4M8M A;  1NI2 A;  3VVW B;  1WX7 A;  1MG8 A;  2K8B A;  2LXA A;  1KM7 A;  2KDF B;  3ZNI D;  1L7Y A;  5CHW A;  4DHZ E;  2LJ5 A;  5E6N A;  4KV2 A;  3K9P B;  4KSL C;  3RUI B;  3WIM A;  1V81 A;  2ZEQ A;  3QAR A;  2FIF A;  4LDT B;  1GC6 A;  3H7S A;  3N30 A;  4GIV A;  4IM0 A;  4LJO B;  4EUT A;  3RT3 B;  3WAM A;  1E7U A;  3VAW A;  1WGR A;  4K7S A;  3VTW A;  3VTV A;  2KTR B;  1WE6 A;  3ZO5 B;  1AAR A;  2IY1 B;  2KAN A;  1ISN A;  4AJY B;  2KTR A;  4TKN A;  2MW5 A;  2MLB A;  4MGK E;  3ZNZ B;  1SE9 A;  4KVG B;  2RSU A;  1P9D U;  3M3J A;  2O6V B;  3DDC B;  4NNJ B;  2NVU I;  4HPM B;  1TTN A;  4BKS A;  2BKR B;  3KH0 A;  3UIO B;  4AUQ C;  3CST A;  1WY8 A;  3DVN V;  1WM2 A;  1OEY J;  4HXD A;  2CS4 A;  1ZGU B;  2WX1 A;  3QAQ A;  3PVL A;  4HDQ A;  2G4S A;  1RFA A;  2WYQ A;  3CSF A;  1GNU A;  1XQQ A;  2JWZ A;  2PE6 B;  4BBN F;  3ZLZ A;  2K6Q A;  2EMT A;  2J7Q B;  1IPG A;  4HCP B;  1LM8 B;  2A5U A;  2N1V A;  4ICU A;  4NJ7 A;  2XK5 B;  4IWP A;  4B95 A;  4E3C A;  4N9F 4;  2NCN A;  2KDE B;  1VD2 A;  4MJS B;  3APD A;  4GN1 A;  2BPS A;  2XK5 A;  3RYT A;  2GBM A;  2L05 A;  3VH4 B;  1YX6 B;  1LQB A;  4MJS A;  3AU5 A;  4W9J A;  1OGW A;  5JHA A;  2LI5 A;  2NPT B;  2GBJ A;  3VQI A;  5DPT A;  4XZ4 A;  2NPT A;  3QHT A;  2JZZ A;  4A3O A;  4HPL B;  3W1S A;  2LAS A;  3NOB A;  3AUL A;  3KUC B;  5AEK B;  4MDK E;  4ASW C;  2CR5 A;  3EFU A;  3L17 A;  1QZE A;  2KOX A;  3A1Q B;  2JF5 A;  2Z59 B;  4B6W A;  2D11 A;  2V1Y A;  2BKF A;  3JYU A;  4CYE A;  2I1K A;  2J0M A;  1P98 A;  3CMM B;  3T9L A;  2IO2 B;  2IO3 B;  3MHS D;  4FHK A;  3Q3J A;  3PS6 A;  1NBF C;  1UZX B;  4FJY A;  3VTU A;  3ZTD A;  1E7V A;  1YIW A;  3B0A A;  1OTR B;  4KDI C;  4NJ6 A;  2DZI A;  3HM6 X;  3ZDM C;  2DHZ A;  2PPH A;  2PEA A;  2IBI B;  2C5L C;  2XBB C;  1UEL A;  2DYB A;  2AEH A;  2KTF A;  1U4A A;  2N1W A;  2N9X A;  2ZZP B;  3ECI A;  3H9D A;  4G0N B;  4IWO A;  4BKS D;  5C1Z A;  3ALB A;  4CO7 A;  1WF9 A;  5D7G A;  4BOZ B;  1F9J A;  1WGH A;  4KIK B;  1HE8 A;  1V2Y A;  2NBW B;  4ZRI A;  4CHK A;  2J0K A;  3PGE A;  2BWF A;  2L00 B;  4OVU A;  2M8S A;  4W9H A;  3SD5 A;  2I1J A;  1UBQ A;  1C1Y B;  4ICV A;  5IAA C;  3V61 A;  1V9J A;  2LGD A;  2G45 B;  3OLM D;  3IFW B;  1V5T A;  4FJZ A;  1UGM A;  4II2 B;  4ANX A;  2C9W B;  4RMA A;  2FCQ A;  3R7Q A;  3A9J B;  3T8M A;  4JGH B;  3A4R A;  2CHX A;  4IM2 A;  1E5W A;  4ANV A;  2LZ6 A;  3MJW A;  4MEM A;  3GOE A;  3APC A;  3QK0 A;  4XC2 A;  3ZUN A;  2JXX A;  5DCN A;  5J18 A;  3ZNG C;  2Z0D B;  4DXA B;  4HLE A;  1BT0 A;  1WGY A;  3PRM B;  3X23 A;  1T0Y A;  3KYD D;  1TGZ B;  2C60 A;  1FXT B;  2LWP A;  4ZYN A;  3ML8 A;  3OJ3 A;  4WWO A;  3DCG A;  1OQY A;  2W9N A;  4EOY A;  4TUU A;  3TBL D;  3RZW C;  3ZW3 A;  4TQ0 A;  1UD7 A;  2M4N A;  2IY0 B;  3IVF A;  3RCZ A;  4E71 A;  4EKU A;  2GMI C;  3C0R B;  5KHQ A;  2KMC A;  4FLH A;  4NAW B;  2L7R A;  1WI0 A;  3DBL I;  1GUA B;  5TR5 A;  1KLV A;  3VH3 B;  4K81 A;  4NAW A;  1WMH B;  3KW5 B;  2HE7 A;  1Y8R C;  2K1F A;  2K8C A;  2K6D B;  2R2O A;  1WMH A;  4EFO A;  1ZW7 A;  3ZNH B;  4WJO A;  4AWJ A;  4BKG A;  5D94 A;  1V49 A;  2KWU B;  3QX1 A;  2G3Q B;  3UQB A;  3U7D A;  3B1L X;  1X1M A;  2M0X A;  3QC8 B;  2NBV B;  4IWQ A;  4BBN C;  2KX0 A;  3L08 A;  4W9E A;  3AI5 A;  2C7N B;  2KZR A;  2HJ8 A;  3PLV A;  1WYW B;  4FBJ B;  3QA8 A;  2BWE S;  4W9L A;  1G6J A;  1YD8 U;  1Q0W B;  2DAF A;  2LUE A;  2CHZ A;  3ENE A;  4LJP B;  3PZD A;  3W1Y A;  2LXC A;  3ML9 A;  3L16 A;  3TL5 A;  1P1A A;  3N32 A;  5AZH A;  1E8X A;  1PQS A;  4PYZ A;  2OOB B;  2KFK B;  2NR2 A;  2LGY A;  1WJ6 A;  5J17 A;  3JSV A;  2RGF A;  3NHE B;  2KFK A;  5AZG A;  4DHZ B;  2JT4 B;  3ZRF A;  3L13 A;  2G4D B;  2N9P C;  2L76 A;  3LJ3 A;  2J0J A;  4WJP A;  3V60 A;  2REX A;  2FUH B;  3BIN A;  5DPS A;  1R4M I;  3W1S C;  3UIN B;  4PS7 A;  2KWV B;  4HK2 A;  4BFR A;  1WGG A;  3KYC D;  2LRU A;  2O2V A;  2LRW A;  5BO4 B;  2MBH A;  4EZK A;  1Q5W B;  2LVP A;  2DYM A;  3V62 A;  2KKC A;  1EO6 A;  5FR6 A;  2IYD B;  4F1S A;  4WQO B;  2ZNV B;  3I3T B;  4KZ0 A;  2R2Q A;  4AOF A;  3HIZ A;  4HWI B;  1KOT A;  3GZN I;  5DPR A;  5JZE B;  3KVF B;  3P2B A;  1WXS A;  3MTN B;  4GXB A;  4AP4 C;  2JUO A;  2GOW A;  2IO0 B;  2BF8 B;  5CX3 A;  1WZ3 A;  3NY5 A;  2FCM A;  4PS8 A;  1V80 A;  3DVN U;  4NPN A;  4DBG A;  1E8W A;  1WJN A;  1WIA A;  2KJR A;  4TQ1 A;  4FUL A;  1WXV A;  2IO1 B;  3KUZ A;  2CHW A;  1XT9 B;  1WH3 A;  2DZJ A;  3TCA A;  5JHB A;  5J2R A;  5CHF A;  1YX5 B;  3NS8 A;  3R3M A;  4NQK E;  4W9K A;  1JRU A;  5D6J B;  3ZRC A;  1D3Z A;  2D2Q A;  2FCN A;  1E8Y A;  4JL9 A;  2RPQ A;  1EF5 A;  2BGF A;  2D07 B;  2ZVO A;  3WAO A;  4I6L B;  2KVR A;  2KJ6 A;  3H1U A;  4M8N A;  2KLG A;  1WJU A;  3CF6 E;  3V6E B;  1UBI A;  2KC2 A;  3EEC A;  4W9F A;  4GMV A;  2L8J A;  1SGH A;  3PRZ A;  4ANW A; 
#chains in the Genus database with same CATH topology
 2MBQ A;  2KNB A;  1EUV B;  1QOB A;  3HUI A;  4K3C A;  3RNE C;  3R66 C;  2B76 B;  3P4Q B;  3AED B;  1S1Q B;  5LXH A;  2MRP A;  2JRI B;  2N9K A;  2FUG 1;  1FRR A;  1M4V A;  4RM9 A;  2PIA A;  4LLG M;  4WJN A;  3H8H A;  3EGR A;  3PHW B;  5LXI B;  5DPW A;  4L2Y A;  3RPF C;  4G11 A;  3WAL A;  1H8C A;  3NZ3 A;  1VRA B;  1P3Q U;  3WAP A;  2VRR B;  2WXG A;  1E6E B;  4WQM A;  3V05 A;  2LEK A;  2C7H A;  4YTP B;  2X8X X;  2WXI A;  3AXC A;  4A3P A;  3U4E G;  4RF0 A;  2WNM A;  2X38 A;  4MGY E;  4ZRK A;  3V3X A;  1M94 A;  4KKI A;  5D2M B;  1P0R A;  1Q1O A;  2PJH A;  2WQY B;  3M95 A;  1R4N I;  4OZC A;  1KLG D;  5CHV C;  3NZU A;  2KXJ A;  1L0X B;  1WYG A;  4FAD A;  2W55 A;  3B9J A;  2MSE D;  4JLC A;  2NBU A;  3AU4 A;  2ZCB A;  5BYQ A;  2ZW0 A;  3UF8 A;  4IC7 B;  2WWZ A;  3SFD B;  2RPV A;  4N6E B;  2MJD A;  5AZF A;  3AV8 A;  1JWU D;  4KX6 B;  5LLI A;  2EKI A;  4L1B A;  3PSE B;  1PDX A;  4PS3 A;  2AL3 A;  2DX5 B;  3M62 B;  2KLC A;  1I35 A;  2MP2 B;  2ZPY A;  1IP9 A;  2BS4 B;  3OWE B;  3PRP B;  4XDD A;  5L95 C;  4GDL B;  4ZRP A;  1FMA D;  3X0W A;  2V3S A;  1GJZ A;  1XLQ A;  1AN8 A;  3U2S C;  5T8I A;  2ICI A;  4FJV B;  3BVM A;  4FA6 A;  1I4P A;  1TKE A;  3U8Z A;  2D5G A;  1A5R A;  4MM3 B;  3ONS A;  4JQW C;  5E6O A;  2KWC A;  2GLS A;  4GSW A;  1I42 A;  2DAJ A;  1WX9 A;  3QWZ B;  1GPX A;  2PLP A;  2KD0 A;  4M0W A;  4HCN B;  5G5G A;  2N7D A;  2EMS A;  1NYR A;  5HKH A;  1L2N A;  1ESF A;  3C8Y A;  3RUL A;  2N7E A;  1YJJ A;  2O6V D;  5FK9 C;  2CJN A;  4DDI D;  2V9H A;  2BYF A;  3RFZ B;  2DZM A;  1FEH A;  3PRE A;  4KIK A;  3OJ4 B;  2VH2 A;  3GB1 A;  2N7J A;  1IYF A;  2IZV B;  4IUM B;  1TBE A;  4OW0 A;  3PLU A;  3IBE A;  1WX8 A;  2SEB D;  2JY6 A;  2KK8 A;  4K3B A;  2MBE A;  5MPO A;  2MQJ A;  2CU1 A;  3Q8C A;  2Y5C A;  5C23 A;  4MSM B;  5FR3 A;  4WUR A;  4B0E A;  3NRZ A;  4HRS A;  2WDV B;  1WX7 A;  4BAX A;  3ZNI D;  4DHZ E;  3K9P B;  3WIM A;  2ZEQ A;  2FIF A;  4S17 A;  1GC6 A;  3H7S A;  3N30 A;  1DOY A;  3AN1 A;  2L1A A;  1MFW A;  4K7S A;  1C76 A;  2KAN A;  2L52 A;  2AQ1 B;  1QOF A;  5H8Y E;  4HPM B;  3KH0 A;  5H92 C;  1HTQ A;  3RN9 C;  3CSF A;  1XQQ A;  3MFG A;  4HCP B;  4ZHP A;  2XK5 B;  4IWP A;  4E3C A;  5D3D A;  2KDE B;  2BPS A;  4O1N A;  1YX6 B;  3AE2 B;  3CIR B;  3AU5 A;  4W9J A;  3N1Y C;  2LI5 A;  1NI3 A;  3VQI A;  3ZQ4 A;  4XE0 A;  1MI0 A;  3QHT A;  2JZZ A;  1WXQ A;  3W1S A;  4HKQ A;  3KUC B;  2CR5 A;  3EFU A;  4JX1 C;  2KOX A;  4H2A A;  3NVZ A;  2Z59 B;  4CYE A;  1OQR A;  3CMM B;  2IO3 B;  3MHS D;  4FHK A;  1NBF C;  3DHG C;  3ZTD A;  1E7V A;  1YIW A;  1PGX A;  2WDQ B;  2AQ3 B;  4IOI E;  2DHZ A;  4HRO A;  4PT5 A;  2PEA A;  2IBI B;  1UEL A;  2DYB A;  3AEE B;  2AEH A;  2KTF A;  4BKS D;  4G0N B;  1WF9 A;  4KIK B;  1ACC A;  2J0K A;  3BYT B;  2M8S A;  3SD5 A;  1UBQ A;  2LGD A;  3OLM D;  3IFW B;  1F52 A;  1JWA D;  4KGT A;  3ZUN A;  5HI1 A;  3BWU D;  3ZNG C;  1T0Y A;  4UDU C;  1FXT B;  4ZYN A;  2JSV X;  2WLB A;  4WWO A;  1YN3 A;  3DCG A;  3TBL D;  3RZW C;  1KLU D;  3ZW3 A;  4TQ0 A;  1UD7 A;  5IN7 A;  1TKG A;  1CZP A;  3IVF A;  1XLN A;  3C0R B;  5KHQ A;  4NAW B;  1JAL A;  4REZ A;  2WXF A;  1WI0 A;  1K51 A;  1SJH D;  1SE3 A;  3QX1 A;  3B1L X;  3FC4 A;  2C7N B;  4W9L A;  1T6B X;  1MHX A;  3HVZ A;  4LJP B;  3L16 A;  1P1A A;  5AZH A;  3ETR A;  1PQS A;  1V1P B;  1KTK A;  2KFK B;  1WJ6 A;  3BVZ A;  5J17 A;  2D3B A;  4AQ7 A;  5AZG A;  2JT4 B;  1VZ6 A;  2L76 A;  2J0J A;  2GI9 A;  2REX A;  1QT9 A;  1D4B A;  4RCO A;  1C79 A;  2WGS A;  4BFR A;  2LUM A;  2O2V A;  3AE5 B;  2LVP A;  3V62 A;  2KKC A;  1EO6 A;  3N1X C;  3ZJV A;  2LFI A;  3I3T B;  4C00 A;  1HA5 A;  3DBR B;  3HIZ A;  1KOT A;  3KVF B;  1WXS A;  3MTN B;  2GOW A;  1F1H A;  3DBH B;  1ZXI A;  5CX3 A;  4US9 A;  2FCM A;  1V80 A;  3DVN U;  2W3S A;  1E8W A;  1WJN A;  1WIA A;  2KJR A;  1SEB D;  2CHW A;  1XT9 B;  1WH3 A;  2DZJ A;  4YSZ B;  5CHF A;  3R3M A;  3NS8 A;  3DWG C;  3ZRC A;  4TSS A;  4XWW A;  2FCN A;  4RH6 A;  1RWS A;  1TZO A;  2KJ6 A;  1L4Z B;  3RI7 C;  3B2G A;  1RM6 C;  2Y3A A;  2L8J A;  2PW9 A;  1XEE A;  3PRZ A;  1HZ6 A;  3R2I A;  2SAK A;  1ZXH A;  4QAY A;  3PT2 B;  2AL6 A;  1GG3 A;  2JRH A;  2ZPN A;  2LVQ A;  1SJE D;  1STE A;  2LGS A;  2KDM A;  4GOC A;  2BW2 A;  4K1R B;  2L0F A;  1ZE3 D;  3ZTC A;  2RD0 A;  3NVV A;  1Z5S B;  1ZDX A;  1J7B A;  3DHI C;  1K8R B;  2QCZ A;  4JE3 B;  1V86 A;  2WXK A;  3EA6 A;  4BKT A;  4KGS A;  2BBC A;  2FE8 A;  3HK0 A;  3AE4 B;  2ZCC A;  3DBR I;  1YN4 A;  4P1B C;  1JWM D;  3IAS 1;  4A20 A;  3DBH I;  2WXJ A;  2XEW A;  4FXC A;  4NZL B;  1AWD A;  3ZKJ C;  2NTS A;  4IW0 A;  3HM3 A;  4WIP A;  2D10 A;  1CMX B;  5FKA C;  2LD9 A;  4GLS C;  4WWP A;  2BYV E;  3AE1 B;  4IG7 B;  5HG2 A;  3ZXR A;  3SFE B;  1UF0 A;  2FNJ B;  4ANU A;  4HJK A;  4W9G A;  1C4P A;  2OJR A;  1L0V B;  4ZRJ A;  2O2V B;  1NDD A;  3A9K B;  4MGZ E;  5HFY A;  1WGK A;  1T3Q A;  2MH7 A;  4I6N B;  2ON8 A;  2N9L A;  1ET6 A;  3S2A A;  1WR6 E;  1UGJ A;  2MP2 A;  5BMG A;  1FNU A;  2ZVN A;  1I4Q A;  2B3A A;  1P7F A;  2N4F A;  2ZW1 A;  4WJQ A;  4GDL A;  3BK1 A;  1S3S G;  2DNF A;  2IGG A;  3PTF C;  3AE9 B;  1HXY D;  3IXS A;  4MM3 A;  1Z2M A;  2V4L A;  2JVC A;  4F8C B;  1YJ1 A;  2MJ3 A;  5LNK 1;  4DDG D;  3IG3 A;  4MGI E;  2JX5 A;  4KSK C;  2NS5 A;  4URK A;  3DVG Y;  3URY A;  4OZA A;  1EWC A;  3TEW A;  3K9O B;  2KJH B;  3LYY A;  4FHJ A;  2NMQ A;  2KHW B;  2G9H D;  2PE9 A;  4MEL A;  5AUI A;  2BYT A;  3VDZ A;  3RD2 A;  4IKG A;  1B1Z A;  4GB9 A;  3N1Z C;  2RMM A;  4XYC A;  4XX5 A;  4NY0 A;  3SU8 X;  4BZA A;  1XLO A;  3CWI A;  4OVV A;  4BOS C;  2QIE B;  2BTE A;  1SB3 C;  2KT7 A;  4P6V F;  4DK5 A;  2OJW A;  1MG8 A;  2K8B A;  5CHW A;  5E6N A;  4P1C C;  1SBB B;  5EE3 A;  3J9C A;  1TS4 A;  4LDT B;  4GIV A;  4EUT A;  2DBY A;  4LNF A;  3B2F A;  3WAM A;  3VAW A;  4M02 A;  3VTV A;  2KTR B;  1WE6 A;  1MG4 A;  1N62 A;  1QQR A;  1ISN A;  1NVI D;  4AJY B;  2MW5 A;  2MLB A;  4KVG B;  4HJG E;  3TEX A;  2V0G A;  2MHJ A;  4LNO A;  2D3C A;  1T5X D;  1WM2 A;  3DVN V;  1FO4 A;  2CS4 A;  1ZGU B;  2QSD A;  4HDQ A;  5JXV A;  2WHI A;  3SEB A;  2K0P A;  2PMV A;  1FCL A;  2EMT A;  1LM8 B;  4ICU A;  5G5H A;  3VRA B;  1YJI A;  4N9F 4;  1VD2 A;  4MJS B;  2XK5 A;  3VH4 B;  5TSS A;  3FAH A;  3FIL B;  3AEF B;  4ARC A;  1D5X C;  3NOB A;  5AEK B;  4ASW C;  1DOI A;  5IP4 D;  1QZE A;  2QJL A;  1VLB A;  2V1Y A;  4C56 C;  2I1K A;  3PZ7 A;  2J0M A;  2KWD A;  2IO2 B;  4FJY A;  1HEZ E;  4JWS C;  4KDI C;  2IPK D;  3LXF A;  2DZI A;  3HM6 X;  2PPH A;  2GRI A;  2N9X A;  4KV2 A;  2N1W A;  4CQN A;  3ECI A;  4ACF A;  5C1Z A;  4CO7 A;  1FXI A;  4BOZ B;  3AM9 A;  1WGH A;  4CHK A;  1V2Y A;  5IO9 A;  3PGE A;  1R4M B;  3NVY A;  1CJE A;  3VRB B;  1MHH E;  2I1J A;  4IDI A;  1N63 A;  2AX5 A;  3AEG B;  1XCT L;  1HTO A;  4RNA A;  1V5T A;  2H88 B;  5BYR A;  1WSP A;  3T8M A;  4JGH B;  3A4R A;  1E5W A;  2LZ6 A;  1SSN A;  5DCN A;  3GZN B;  1VZ8 A;  1GOZ A;  3X23 A;  1WGY A;  2C60 A;  2LWP A;  3ML8 A;  4A9A A;  4US8 A;  1OQY A;  4EOY A;  4TUU A;  2WXN A;  4TMA B;  4LK0 M;  1I4R A;  2WXH A;  3MC0 B;  1IGD A;  2L7R A;  1GUA B;  4NAW A;  3KW5 B;  2R2O A;  2E3T A;  4WJO A;  3W5U B;  1X1M A;  5BMH A;  3HVD A;  1WRI A;  1HQR D;  3IT6 B;  3L08 A;  4W9E A;  1WYW B;  1ZPS A;  1TS3 A;  1UWM A;  3Q3O C;  1YD8 U;  2CHZ A;  2MEK A;  3UI3 A;  1N5X A;  2BVC A;  3ML9 A;  4YTM B;  1E10 A;  1I4H A;  1IBX B;  1GB1 A;  2GB1 A;  1V1P A;  2RGF A;  2KFK A;  5IOI A;  2G4D B;  3LJ3 A;  4WJP A;  3FKY A;  1R4M I;  2VZK B;  2LRU A;  2MBH A;  1KFY B;  1Q5W B;  2V4I B;  3SR6 A;  2IYD B;  4F1S A;  1DOX A;  3DWM A;  2R2Q A;  1JWB D;  4HWI B;  3GZN I;  5JZE B;  1I7H A;  4A8X C;  1JRO A;  4DBG A;  2RDG A;  4M01 A;  4C4V A;  1VJK A;  4TQ1 A;  2IO1 B;  3KUZ A;  5JHB A;  3TCA A;  1WWT A;  1YX5 B;  1TYG B;  4HEA 1;  1A70 A;  2KVR A;  1WJU A;  3CF6 E;  1UBI A;  2K22 A;  3EEC A;  3MJ5 A;  3WCQ A;  1SGH A;  2LHE A;  4USA A;  4LTU A;  4ANW A;  2KN5 A;  2MCN B;  2Z0E B;  3HHM A;  4HVB A;  2BQQ A;  3PPA A;  1J19 A;  2ZJD A;  2MBB B;  4W9D A;  3NS1 A;  1NEN B;  3H7P B;  2FAZ A;  2JQR B;  3NVW A;  2DYO A;  3I5J C;  1D6E C;  1J7C A;  4G3X B;  3MC9 A;  4LNN A;  4FN2 A;  3BY4 B;  4K7U A;  1J0G A;  4YXD B;  1JQ4 A;  3I57 A;  4F7Z A;  2PVO D;  3R2T A;  4IM3 A;  3SDL C;  3RNG C;  1FD6 A;  2YLM A;  4EEW A;  1ZKH A;  4GDK B;  3L4P A;  3U7Z A;  1MJD A;  1WR1 A;  4L23 A;  3VUX A;  1XD3 B;  2LMC A;  3T3N A;  1YQ3 B;  2Z8L A;  5EDS A;  2L0T A;  4E74 A;  2KQ7 A;  3IAM 1;  1LGR A;  4RM8 A;  2I38 A;  4MH0 E;  5JH5 C;  2MA9 B;  1V8C A;  3VUW A;  1SIF A;  2KN4 A;  1FFV A;  4II3 B;  2Y5P A;  3Q3F A;  2N9E B;  4DXG A;  3Q3M C;  3TJP A;  4ARI A;  3Q8A A;  1LFD A;  1RFK A;  2K3U A;  3QQ8 B;  3C19 A;  3AE7 B;  4J6I A;  4KDL B;  4EZJ A;  2J52 A;  1QLB B;  2N0S B;  3U52 E;  2FCS A;  1QF6 A;  4JPS A;  4JIO U;  2ZNV C;  2WX0 A;  3EUB 2;  4ITK A;  3A9K A;  4YSY B;  5GMV A;  1E0Z A;  1PYW D;  1ZP0 B;  2L3Z A;  4J3O D;  4C80 A;  2DEN B;  1WGD A;  3NZS A;  2EEL A;  3VXW A;  3GE3 C;  1YOV B;  3VFK A;  1C3T A;  4TV3 A;  4C4V B;  2RR9 A;  3L54 A;  4ZDV A;  3ZVV A;  1B9R A;  2DWQ A;  3EHV A;  1IGC A;  2MWS B;  1MVK A;  3MP9 A;  3NG0 A;  2QDF A;  1V6E A;  4X57 B;  3A4S C;  3TIX A;  1PFD A;  1H4R A;  3PHX B;  3A1Q A;  1MPE A;  2KYW A;  2JZ3 B;  1UH6 A;  2K8H A;  3O13 A;  4LDT D;  1FCC C;  3VHT C;  3ZIM A;  4EZL A;  4S0R A;  4YL8 A;  3QJZ A;  4P7I A;  3W5V B;  3L10 B;  1WJ4 A;  2KAC A;  4NJC A;  4WAA A;  1LO5 D;  2WDR B;  4DHJ B;  1V97 A;  1JCK B;  1GC7 A;  2GBK A;  1D5M C;  2KDB A;  3Q2A C;  1J8C A;  3AEA B;  2YEP F;  4XDC A;  3PZ8 A;  2JZP A;  1ZDV A;  1ROE A;  1BUI C;  2UWQ A;  3QIJ A;  4W9I A;  2LGI A;  3DOW A;  1F0Z A;  3RZF A;  5IA7 A;  1SF0 A;  2IGH A;  3A33 B;  2KX3 A;  2J4X A;  3UGB B;  1E8Z A;  3WAN A;  3N20 C;  2GBN A;  4I6P A;  1TS2 A;  2DZK A;  2BT6 A;  4M8M A;  1NI2 A;  3VVW B;  1KM7 A;  2KDF B;  2D3A A;  3GS2 A;  1L7Y A;  1QOG A;  4M00 A;  3VR9 B;  4KSL C;  3RUI B;  1V81 A;  3QAR A;  4LJO B;  3VR8 B;  4LNI A;  3RT3 B;  1TKY A;  3ZO5 B;  1AAR A;  2IY1 B;  2KTR A;  4ZOH C;  1C4C A;  3ZNZ B;  4WH4 A;  1ENF A;  3W9C B;  2E6X A;  2RSU A;  1P9D U;  3M3J A;  4NNJ B;  1TTN A;  2BKR B;  3UIO B;  2CU3 A;  5IKC M;  3CST A;  1C4A A;  1WY8 A;  2WP9 B;  4HXD A;  3P42 A;  3PVL A;  1RFA A;  1ET9 A;  2IND C;  2WYQ A;  1GNU A;  2PE6 B;  2K6Q A;  4Q2J A;  2J7Q B;  3KLS X;  4NJ7 A;  5AUK A;  3BVG A;  2GBM A;  2L05 A;  1LQB A;  4MJS A;  3TUO A;  4D2K A;  1I4G A;  1YQ4 B;  3FIL A;  2NPT B;  2GBJ A;  5BYS A;  2YEP B;  3AEC B;  1DYQ A;  2MJE A;  1JRP A;  4MDK E;  1L6U A;  3L17 A;  3A1Q B;  2JYE A;  2JF5 A;  4B6W A;  3ABV B;  2BKF A;  1P98 A;  3T9L A;  1Q10 A;  1HZ5 A;  4KKJ A;  3VTU A;  5D3I B;  3KQ4 A;  4NJ6 A;  1XLP A;  4ZHO A;  1NEK B;  1D5Z C;  3AMZ A;  2ONQ A;  3H9D A;  1U4A A;  4IWO A;  1FM0 D;  5D7G A;  1F9J A;  2R61 A;  1HE8 A;  2NBW B;  2FBW B;  2HTM E;  2BWF A;  1XF5 L;  3BK2 A;  1EM7 A;  1C1Y B;  1BXT A;  3BYY B;  3V61 A;  1V9J A;  2G45 B;  4FJZ A;  1FFU A;  1L5P A;  4ANX A;  2C9W B;  4RMA A;  2FCQ A;  3R7Q A;  2CHX A;  4MEM A;  2WXM A;  3QK0 A;  4XC2 A;  1L0Y B;  2JXX A;  5J18 A;  4DXA B;  4HLE A;  1RYJ A;  1UNS A;  4R3D A;  1BT0 A;  2VZK D;  3PRM B;  3KYD D;  1AYF A;  3OJ3 A;  1ZOY B;  2G1E A;  3LB8 C;  2BS3 B;  1TY2 A;  2M4N A;  2IY0 B;  3RCZ A;  2BB6 A;  2HDE A;  4OVZ A;  2GMI C;  2H89 B;  1UWX A;  5EE0 A;  3Q69 A;  1WMH B;  2K1F A;  2W82 A;  3GE8 C;  1ZW7 A;  3ZNH B;  4AWJ A;  4RF1 A;  1VR9 A;  3AE8 B;  3AH7 A;  1SE4 A;  2G3Q B;  4YSX B;  3UQB A;  5HHD G;  2M0X A;  3QC8 B;  4IWQ A;  4BBN C;  3IT4 B;  2M56 B;  3Q6B A;  1FRD A;  2KZR A;  2L32 A;  3PLV A;  4FBJ B;  3QA8 A;  1L6V A;  2BWE S;  1G6J A;  2DAF A;  1Q0W B;  2OED A;  3ENE A;  3PZD A;  2OHF A;  3TL5 A;  4ZYS A;  2OOB B;  1JW9 D;  2NR2 A;  2LGY A;  4N58 A;  3JSV A;  3NHE B;  1IBX A;  3N9Y C;  1K53 A;  3V60 A;  2FUH B;  5DPS A;  2UU7 A;  3I63 C;  3W1S C;  3UIN B;  4PS7 A;  2KWV B;  4HK2 A;  1WGG A;  2LRW A;  3I9V 1;  4WAF A;  4EZK A;  3TEZ A;  4A6Q A;  1TJE A;  4N59 A;  4WQO B;  2ZNV B;  4MT5 A;  3RMK C;  4KZ0 A;  4YWG G;  2V3N A;  3TSS A;  2KQ4 X;  4AOF A;  3HRD D;  5DPR A;  1TIF A;  4AP4 C;  2JUO A;  4JWU C;  3EFC A;  4PS8 A;  1QIL A;  4NPN A;  2JYT A;  2K9X A;  3P4P B;  1WXV A;  2PKO A;  4LNK A;  5J2R A;  4W9K A;  4NQK E;  1JRU A;  5D6J B;  1C78 A;  2D2Q A;  1E8Y A;  2IJ0 A;  2LHD A;  2RPQ A;  2D07 B;  3WAO A;  4OHJ A;  3H1U A;  2BB5 A;  4M8N A;  3RNF C;  5I4D A;  2KLG A;  2WS3 B;  3ZJU A;  3T3O A;  1FXA A;  2KC2 A;  4W9F A;  1V1O A;  1IUE A;  3KWL A;  3DPD A;  2K25 A;  3LDZ E;  1K50 A;  2KFJ A;  2XNA C;  2I2Y A;  1EU3 A;  3SHQ A;  4DWF A;  4XWT A;  4AJW A;  3H6N A;  1YNT E;  1KJT A;  1F77 A;  4GU2 A;  1WFY A;  2XN9 C;  3P1M A;  2WXR A;  2WXL A;  3H7P A;  4NQL B;  2RDB C;  5GXG B;  1WZ0 A;  1N61 A;  4DXF A;  5CTR C;  5KHO A;  1FIQ A;  2W54 A;  4MSQ B;  2EKE C;  3Q3N C;  4GGQ A;  2GBR A;  1BML C;  4GDK A;  3ZDT A;  1F2R C;  3D32 A;  2K39 A;  5G55 A;  1V5O A;  2M19 A;  3ZYY X;  3DQV A;  5G2N A;  3UIP B;  4MH8 A;  1GAQ B;  1RLF A;  3OG5 A;  1RRB A;  2NTT A;  5E6P A;  1PGB A;  1L4D B;  2W3R A;  4W9C A;  2AYO B;  4PYU A;  2M1M A;  3KWV A;  1YMH E;  3P4R B;  1VDV A;  1NYQ A;  3IHP C;  4HDO A;  3JSV B;  1EWY C;  4K7W A;  3E56 A;  3JW0 X;  1KF6 B;  3JVZ X;  1WRD B;  3APF A;  3B08 A;  3DVG X;  3AEB B;  1GB4 A;  2KC1 A;  2O6V A;  3R7R A;  1OFF A;  1R7S A;  2D3G A;  3U30 A;  2KMA A;  1TS5 A;  2L83 A;  4KZC A;  1EF1 A;  4DHJ D;  2BYE A;  2QHO A;  3N3K B;  3V6C B;  4A90 A;  2UYZ B;  4A55 A;  1OQQ A;  1FPY A;  3RNC C;  3R8B A;  1YQB A;  3GP7 A;  1DGJ A;  1E90 A;  4HKZ E;  1XCQ L;  5EE9 A;  2AQ2 B;  2FID A;  1N60 A;  2HD5 B;  4G50 A;  2QC8 A;  1EU4 A;  5L83 A;  4OZB A;  1AW7 A;  3QCA A;  2INP E;  4RGM A;  3KUD B;  3M63 B;  4LCD E;  3RNA C;  2WXQ A;  2KQS A;  2LVO A;  1QOA A;  2C7M B;  3VUY A;  4M0W B;  2CJO A;  2CKH B;  3TMP B;  4BBN F;  2JWU A;  2KDI A;  2KVZ A;  1WE7 A;  1WXM A;  2JXT A;  5C2T B;  4BVU C;  3PV1 A;  2ASQ A;  1SXT A;  1WM3 A;  2M17 A;  1OEY A;  2Q5W D;  3EC8 A;  5C3J B;  3L0W B;  3UQA A;  3OAW A;  1VCB A;  4B0M A;  2Y5B B;  1TT5 B;  4MAC A;  4EE2 A;  2AWT A;  1P7E A;  1KH0 A;  3DHH C;  3WA0 A;  2JPH A;  2MX2 A;  3RNB C;  2WDT B;  2YVC A;  1JML A;  1LXD A;  2LGX A;  3A9J A;  2KO3 A;  2DLB A;  1T0R C;  2HTH A;  2INC C;  4B9K A;  3NUH B;  3DBS A;  3O65 B;  1RAX A;  1J7A A;  1WXA A;  2MBO A;  4WWN A;  3Q14 C;  1TZ1 A;  2V3P A;  2A4Z A;  4NAM A;  2LXA A;  2LJ5 A;  2IGD A;  3ZJT A;  3ZGZ A;  4IM0 A;  4C7Z A;  4C7Y A;  1C9F A;  1E7U A;  2LJI A;  1WGR A;  3VTW A;  1E7P B;  4TKN A;  4MGK E;  1XXG A;  1SE9 A;  2O6V B;  3DDC B;  2NVU I;  4BKS A;  3W2D A;  3NJT A;  4AUQ C;  1PUT A;  1OEY J;  2WX1 A;  3QAQ A;  2G4S A;  2J42 A;  4WWM A;  2JWZ A;  1Y56 A;  3ZLZ A;  1XO3 A;  1IPG A;  4DQO C;  2A5U A;  2N1V A;  4B95 A;  2INN E;  3MC8 A;  2NCN A;  3APD A;  4GN1 A;  3RYT A;  3Q8B A;  1OGW A;  5JHA A;  5E6J A;  5DPT A;  4XZ4 A;  2NPT A;  4A3O A;  1PGA A;  4HPL B;  3DBL B;  2LAS A;  3AUL A;  4XGA B;  2PTL A;  1SE2 A;  2D11 A;  3Q8F A;  3JYU A;  4RGN A;  1N5W A;  1I4X A;  3Q3J A;  3PS6 A;  1UZX B;  3MHZ A;  1T0Q C;  3B0A A;  1OTR B;  2QMT A;  1JWS D;  3ZDM C;  2C5L C;  2XBB C;  2ZZP B;  1UUP A;  5BMI A;  3ALB A;  2J53 A;  1CQV A;  4ZRI A;  1E9M A;  3AE6 B;  2L00 B;  4OVU A;  4RGT A;  4W9H A;  1VZ7 A;  2VH1 A;  4ICV A;  5IAA C;  4RFB A;  1UGM A;  4II2 B;  3TEY A;  1SIJ A;  3A9J B;  4IM2 A;  4RGO S;  4ANV A;  3MJW A;  4PK1 A;  3Q8E A;  3GOE A;  3APC A;  4YTN B;  1FNV A;  1TY0 A;  2M0A A;  3P4S B;  2Z0D B;  2WXO A;  1TGZ B;  2W9N A;  4KGR A;  1C77 A;  1YN5 A;  4E71 A;  4EKU A;  1CK1 A;  2KMM A;  2KMC A;  4FLH A;  3PO0 A;  2PVG C;  3DBL I;  5TR5 A;  1KLV A;  3VH3 B;  4K81 A;  3BII D;  4HPP A;  2HE7 A;  1Y8R C;  2K8C A;  2K6D B;  1WMH A;  4EFO A;  2ACZ B;  5D94 A;  1V49 A;  2HJ1 A;  2KAJ A;  2KWU B;  4BKG A;  1FNW A;  3U7D A;  2JU6 X;  2NBV B;  2KX0 A;  4YT0 B;  3AI5 A;  2HJ8 A;  2QEJ C;  2LUE A;  1KRH A;  3W1Y A;  2LXC A;  2TSS A;  3N32 A;  5EE1 A;  1ZUD 2;  1E8X A;  3AE3 B;  4PYZ A;  2WXP A;  4DHZ B;  3ZRF A;  3L13 A;  2N9P C;  3BZD B;  3BIN A;  3E9S A;  1QKZ A;  1T0S C;  3P63 A;  2IDY A;  3KYC D;  2QIL A;  5BO4 B;  2DYM A;  2WU5 B;  4AS1 A;  5FR6 A;  2BS2 B;  3ZXV A;  3P2B A;  4GXB A;  2IO0 B;  2BF8 B;  1K52 A;  1WZ3 A;  3NY5 A;  4FUL A;  2RDH A;  1R4N B;  1D3Z A;  3AB5 A;  4P16 A;  2K5P A;  4JL9 A;  1N6Z A;  1EF5 A;  2BGF A;  2ZVO A;  2WU2 B;  4I6L B;  3V6E B;  1F2R I;  4GMV A;  4ZRQ A; 
#chains in the Genus database with same CATH homology
 2MBQ A;  2KNB A;  1EUV B;  3DPD A;  2KN5 A;  2K25 A;  3LDZ E;  2MCN B;  3R66 C;  2KFJ A;  2Z0E B;  3HHM A;  3PT2 B;  2AL6 A;  4HVB A;  3SHQ A;  4DWF A;  3PPA A;  1J19 A;  2ZJD A;  2MBB B;  1GG3 A;  1S1Q B;  3H6N A;  4W9D A;  4AJW A;  5LXH A;  2JRH A;  1KJT A;  2MRP A;  4GU2 A;  1WFY A;  2ZPN A;  3H7P B;  2FAZ A;  2JRI B;  2LVQ A;  2DYO A;  3H7P A;  4G3X B;  4NQL B;  4GOC A;  4RM9 A;  4FN2 A;  4K1R B;  3BY4 B;  2L0F A;  4K7U A;  1J0G A;  1WZ0 A;  4F7Z A;  3ZTC A;  4WJN A;  2RD0 A;  5LXI B;  3PHW B;  4IM3 A;  5CTR C;  3SDL C;  5DPW A;  2YLM A;  5KHO A;  4G11 A;  4MSQ B;  1Z5S B;  2EKE C;  4GGQ A;  3WAL A;  4EEW A;  1H8C A;  1ZKH A;  4GDK B;  1P3Q U;  2GBR A;  1K8R B;  2VRR B;  3WAP A;  1WR1 A;  4GDK A;  1V86 A;  3ZDT A;  4BKT A;  3D32 A;  2K39 A;  2C7H A;  1V5O A;  5G55 A;  3VUX A;  1XD3 B;  3HK0 A;  3AXC A;  4A3P A;  2ZCC A;  3DQV A;  3DBR I;  5EDS A;  5G2N A;  3UIP B;  2L0T A;  4A20 A;  1RLF A;  4E74 A;  2KQ7 A;  3DBH I;  2XEW A;  1RRB A;  4MGY E;  4ZRK A;  4RM8 A;  5E6P A;  3ZKJ C;  4MH0 E;  5JH5 C;  2MA9 B;  1M94 A;  4W9C A;  2AYO B;  1SIF A;  4PYU A;  1P0R A;  5D2M B;  1Q1O A;  3VUW A;  2M1M A;  2PJH A;  4IW0 A;  3M95 A;  4II3 B;  3HM3 A;  1R4N I;  5CHV C;  3IHP C;  4HDO A;  3NZU A;  3Q3F A;  2D10 A;  2N9E B;  1CMX B;  2KXJ A;  3TJP A;  3JSV B;  4FAD A;  4K7W A;  2LD9 A;  3JW0 X;  3JVZ X;  1WRD B;  3APF A;  1LFD A;  3B08 A;  3DVG X;  2MSE D;  4JLC A;  2NBU A;  3AU4 A;  2ZCB A;  2BYV E;  4WWP A;  3QQ8 B;  4IG7 B;  3UF8 A;  2KC1 A;  4J6I A;  2O6V A;  3R7R A;  4IC7 B;  2WWZ A;  4KDL B;  2FNJ B;  2D3G A;  5AZF A;  4HJK A;  4W9G A;  2KMA A;  2OJR A;  4ZRJ A;  3U30 A;  4ANU A;  4EZJ A;  5LLI A;  2O2V B;  4KZC A;  1EF1 A;  2FCS A;  2BYE A;  2QHO A;  4DHJ D;  3N3K B;  4JIO U;  2ZNV C;  1NDD A;  3PSE B;  3A9K B;  3V6C B;  4MGZ E;  2WX0 A;  4PS3 A;  2UYZ B;  2AL3 A;  3A9K A;  2DX5 B;  3M62 B;  4I6N B;  5GMV A;  2KLC A;  2L3Z A;  1I35 A;  1YQB A;  2MP2 B;  1E90 A;  2DEN B;  2ZPY A;  1IP9 A;  1WGD A;  3NZS A;  3S2A A;  1WR6 E;  3VXW A;  2MP2 A;  3PRP B;  3VFK A;  5L95 C;  1C3T A;  4TV3 A;  2ZVN A;  4GDL B;  2B3A A;  2N4F A;  4WJQ A;  2RR9 A;  3L54 A;  2FID A;  4GDL A;  3X0W A;  2V3S A;  4ZDV A;  3ZVV A;  1GJZ A;  1S3S G;  2HD5 B;  3EHV A;  4G50 A;  5L83 A;  2MWS B;  4FJV B;  4FA6 A;  3QCA A;  3U8Z A;  1V6E A;  4X57 B;  3PTF C;  3KUD B;  3A4S C;  3TIX A;  1A5R A;  3ONS A;  4JQW C;  1H4R A;  3PHX B;  3M63 B;  2KWC A;  5E6O A;  4GSW A;  4MM3 A;  3A1Q A;  1Z2M A;  2V4L A;  1I42 A;  2DAJ A;  1WX9 A;  2JVC A;  4LCD E;  4F8C B;  2KQS A;  3QWZ B;  1YJ1 A;  2JZ3 B;  1UH6 A;  2K8H A;  2LVO A;  2C7M B;  4LDT D;  3VUY A;  4M0W B;  2KD0 A;  4DDG D;  2CKH B;  3VHT C;  3TMP B;  3IG3 A;  4HCN B;  2KDI A;  3ZIM A;  1WE7 A;  1WXM A;  2EMS A;  2N7D A;  4YL8 A;  4EZL A;  3QJZ A;  4P7I A;  4BVU C;  5HKH A;  4MGI E;  3L10 B;  3PV1 A;  1L2N A;  1WJ4 A;  2ASQ A;  4KSK C;  1WM3 A;  2NS5 A;  2M17 A;  3RUL A;  4URK A;  3DVG Y;  2N7E A;  1OEY A;  2O6V D;  4WAA A;  3EC8 A;  3K9O B;  2KJH B;  4DHJ B;  3L0W B;  3UQA A;  1GC7 A;  4DDI D;  3OAW A;  1VCB A;  4FHJ A;  2BYF A;  2GBK A;  2DZM A;  2Y5B B;  3PRE A;  2KHW B;  4KIK A;  3OJ4 B;  2PE9 A;  2AWT A;  4MEL A;  2KDB A;  3WA0 A;  3VDZ A;  1J8C A;  3RD2 A;  1IYF A;  2IZV B;  2JPH A;  2MX2 A;  4GB9 A;  1TBE A;  2WDT B;  2UWQ A;  3QIJ A;  4IUM B;  4W9I A;  2YVC A;  3PLU A;  3IBE A;  1LXD A;  3DOW A;  1WX8 A;  2LGX A;  3A9J A;  3RZF A;  2KO3 A;  5IA7 A;  2JY6 A;  2KK8 A;  2MBE A;  4XX5 A;  2MQJ A;  2HTH A;  2CU1 A;  3A33 B;  4B9K A;  2KX3 A;  4NY0 A;  3SU8 X;  3UGB B;  1E8Z A;  3WAN A;  3DBS A;  4OVV A;  3O65 B;  4BOS C;  1RAX A;  1WXA A;  5C23 A;  2MBO A;  4MSM B;  4WWN A;  1TZ1 A;  2GBN A;  4I6P A;  4DK5 A;  2DZK A;  2A4Z A;  4M8M A;  1NI2 A;  3VVW B;  1WX7 A;  1MG8 A;  2K8B A;  2LXA A;  1KM7 A;  2KDF B;  3ZNI D;  1L7Y A;  5CHW A;  4DHZ E;  2LJ5 A;  5E6N A;  4KV2 A;  3K9P B;  4KSL C;  3RUI B;  3WIM A;  1V81 A;  2ZEQ A;  3QAR A;  2FIF A;  4LDT B;  1GC6 A;  3H7S A;  3N30 A;  4GIV A;  4IM0 A;  4LJO B;  4EUT A;  3RT3 B;  3WAM A;  1E7U A;  3VAW A;  1WGR A;  4K7S A;  3VTW A;  3VTV A;  2KTR B;  1WE6 A;  3ZO5 B;  1AAR A;  2IY1 B;  2KAN A;  1ISN A;  4AJY B;  2KTR A;  4TKN A;  2MW5 A;  2MLB A;  4MGK E;  3ZNZ B;  1SE9 A;  4KVG B;  2RSU A;  1P9D U;  3M3J A;  2O6V B;  3DDC B;  4NNJ B;  2NVU I;  4HPM B;  1TTN A;  4BKS A;  2BKR B;  3KH0 A;  3UIO B;  4AUQ C;  3CST A;  1WY8 A;  3DVN V;  1WM2 A;  1OEY J;  4HXD A;  2CS4 A;  1ZGU B;  2WX1 A;  3QAQ A;  3PVL A;  4HDQ A;  2G4S A;  1RFA A;  2WYQ A;  3CSF A;  1GNU A;  1XQQ A;  2JWZ A;  2PE6 B;  4BBN F;  3ZLZ A;  2K6Q A;  2EMT A;  2J7Q B;  1IPG A;  4HCP B;  1LM8 B;  2A5U A;  2N1V A;  4ICU A;  4NJ7 A;  2XK5 B;  4IWP A;  4B95 A;  4E3C A;  4N9F 4;  2NCN A;  2KDE B;  1VD2 A;  4MJS B;  3APD A;  4GN1 A;  2BPS A;  2XK5 A;  3RYT A;  2GBM A;  2L05 A;  3VH4 B;  1YX6 B;  1LQB A;  4MJS A;  3AU5 A;  4W9J A;  1OGW A;  5JHA A;  2LI5 A;  2NPT B;  2GBJ A;  3VQI A;  5DPT A;  4XZ4 A;  2NPT A;  3QHT A;  2JZZ A;  4A3O A;  4HPL B;  3W1S A;  2LAS A;  3NOB A;  3AUL A;  3KUC B;  5AEK B;  4MDK E;  4ASW C;  2CR5 A;  3EFU A;  3L17 A;  1QZE A;  2KOX A;  3A1Q B;  2JF5 A;  2Z59 B;  4B6W A;  2D11 A;  2V1Y A;  2BKF A;  3JYU A;  4CYE A;  2I1K A;  2J0M A;  1P98 A;  3CMM B;  3T9L A;  2IO2 B;  2IO3 B;  3MHS D;  4FHK A;  3Q3J A;  3PS6 A;  1NBF C;  1UZX B;  4FJY A;  3VTU A;  3ZTD A;  1E7V A;  1YIW A;  3B0A A;  1OTR B;  4KDI C;  4NJ6 A;  2DZI A;  3HM6 X;  3ZDM C;  2DHZ A;  2PPH A;  2PEA A;  2IBI B;  2C5L C;  2XBB C;  1UEL A;  2DYB A;  2AEH A;  2KTF A;  1U4A A;  2N1W A;  2N9X A;  2ZZP B;  3ECI A;  3H9D A;  4G0N B;  4IWO A;  4BKS D;  5C1Z A;  3ALB A;  4CO7 A;  1WF9 A;  5D7G A;  4BOZ B;  1F9J A;  1WGH A;  4KIK B;  1HE8 A;  1V2Y A;  2NBW B;  4ZRI A;  4CHK A;  2J0K A;  3PGE A;  2BWF A;  2L00 B;  4OVU A;  2M8S A;  4W9H A;  3SD5 A;  2I1J A;  1UBQ A;  1C1Y B;  4ICV A;  5IAA C;  3V61 A;  1V9J A;  2LGD A;  2G45 B;  3OLM D;  3IFW B;  1V5T A;  4FJZ A;  1UGM A;  4II2 B;  4ANX A;  2C9W B;  4RMA A;  2FCQ A;  3R7Q A;  3A9J B;  3T8M A;  4JGH B;  3A4R A;  2CHX A;  4IM2 A;  1E5W A;  4ANV A;  2LZ6 A;  3MJW A;  4MEM A;  3GOE A;  3APC A;  3QK0 A;  4XC2 A;  3ZUN A;  2JXX A;  5DCN A;  5J18 A;  3ZNG C;  2Z0D B;  4DXA B;  4HLE A;  1BT0 A;  1WGY A;  3PRM B;  3X23 A;  1T0Y A;  3KYD D;  1TGZ B;  2C60 A;  1FXT B;  2LWP A;  4ZYN A;  3ML8 A;  3OJ3 A;  4WWO A;  3DCG A;  1OQY A;  2W9N A;  4EOY A;  4TUU A;  3TBL D;  3RZW C;  3ZW3 A;  4TQ0 A;  1UD7 A;  2M4N A;  2IY0 B;  3IVF A;  3RCZ A;  4E71 A;  4EKU A;  2GMI C;  3C0R B;  5KHQ A;  2KMC A;  4FLH A;  4NAW B;  2L7R A;  1WI0 A;  3DBL I;  1GUA B;  5TR5 A;  1KLV A;  3VH3 B;  4K81 A;  4NAW A;  1WMH B;  3KW5 B;  2HE7 A;  1Y8R C;  2K1F A;  2K8C A;  2K6D B;  2R2O A;  1WMH A;  4EFO A;  1ZW7 A;  3ZNH B;  4WJO A;  4AWJ A;  4BKG A;  5D94 A;  1V49 A;  2KWU B;  3QX1 A;  2G3Q B;  3UQB A;  3U7D A;  3B1L X;  1X1M A;  2M0X A;  3QC8 B;  2NBV B;  4IWQ A;  4BBN C;  2KX0 A;  3L08 A;  4W9E A;  3AI5 A;  2C7N B;  2KZR A;  2HJ8 A;  3PLV A;  1WYW B;  4FBJ B;  3QA8 A;  2BWE S;  4W9L A;  1G6J A;  1YD8 U;  1Q0W B;  2DAF A;  2LUE A;  2CHZ A;  3ENE A;  4LJP B;  3PZD A;  3W1Y A;  2LXC A;  3ML9 A;  3L16 A;  3TL5 A;  1P1A A;  3N32 A;  5AZH A;  1E8X A;  1PQS A;  4PYZ A;  2OOB B;  2KFK B;  2NR2 A;  2LGY A;  1WJ6 A;  5J17 A;  3JSV A;  2RGF A;  3NHE B;  2KFK A;  5AZG A;  4DHZ B;  2JT4 B;  3ZRF A;  3L13 A;  2G4D B;  2N9P C;  2L76 A;  3LJ3 A;  2J0J A;  4WJP A;  3V60 A;  2REX A;  2FUH B;  3BIN A;  5DPS A;  1R4M I;  3W1S C;  3UIN B;  4PS7 A;  2KWV B;  4HK2 A;  4BFR A;  1WGG A;  3KYC D;  2LRU A;  2O2V A;  2LRW A;  5BO4 B;  2MBH A;  4EZK A;  1Q5W B;  2LVP A;  2DYM A;  3V62 A;  2KKC A;  1EO6 A;  5FR6 A;  2IYD B;  4F1S A;  4WQO B;  2ZNV B;  3I3T B;  4KZ0 A;  2R2Q A;  4AOF A;  3HIZ A;  4HWI B;  1KOT A;  3GZN I;  5DPR A;  5JZE B;  3KVF B;  3P2B A;  1WXS A;  3MTN B;  4GXB A;  4AP4 C;  2JUO A;  2GOW A;  2IO0 B;  2BF8 B;  5CX3 A;  1WZ3 A;  3NY5 A;  2FCM A;  4PS8 A;  1V80 A;  3DVN U;  4NPN A;  4DBG A;  1E8W A;  1WJN A;  1WIA A;  2KJR A;  4TQ1 A;  4FUL A;  1WXV A;  2IO1 B;  3KUZ A;  2CHW A;  1XT9 B;  1WH3 A;  2DZJ A;  3TCA A;  5JHB A;  5J2R A;  5CHF A;  1YX5 B;  3NS8 A;  3R3M A;  4NQK E;  4W9K A;  1JRU A;  5D6J B;  3ZRC A;  1D3Z A;  2D2Q A;  2FCN A;  1E8Y A;  4JL9 A;  2RPQ A;  1EF5 A;  2BGF A;  2D07 B;  2ZVO A;  3WAO A;  4I6L B;  2KVR A;  2KJ6 A;  3H1U A;  4M8N A;  2KLG A;  1WJU A;  3CF6 E;  3V6E B;  1UBI A;  2KC2 A;  3EEC A;  4W9F A;  4GMV A;  2L8J A;  1SGH A;  3PRZ A;  4ANW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...