2KTRB

Nmr structure of p62 pb1 dimer determined based on pcs
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
MSLTVEAYLLGKEEAAREIRRFSFSFSPEPEAEAAAGPGPSERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFAIYIKEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title PCS-based structure determination of protein-protein complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein, transport protein
molecule keywords Sequestosome-1
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ktrB00
1SE9A 4X57B 2BWFA 2XK5B 3ML9A 2G45B 4MJSA 5CHVC 3NZUA 5DPWA 2N9PC 4CO7A 5JHBA 2MRPA 2WX0A 3TMPB 1SGHA 3RZFA 2C7NB 2FCQA 1P1AA 3VUWA 4G3XB 1LXDA 1YX6B 3DVNU 1BT0A 3JYUA 3PHWB 4GU2A 4IM0A 4DBGA 4GOCA 5DPRA 3WIMA 5BO4B 4GMVA 4DXAB 5KHOA 3N30A 4EZLA 3H9DA 3N32A 3ZVVA 2OOBB 4KIKB 3QJZA 1VD2A 4MDKE 1Q5WB 1WFYA 2HD5B 4I6NB 5D7GA 2BWES 3KW5B 4B95A 1R4NI 2KFKA 4K7WA 2JZ3B 3RYTA 3OJ4B 2HTHA 4BBNC 2LVQA 3PRPB 4EKUA 3VUXA 3QHTA 1WX9A 4TKNA 3VTVA 3A9JA 3EFUA 4M8MA 5LXHA 1V49A 3ALBA 2KWCA 2V3SA 3W1SA 3OLMD 2I1JA 2MQJA 4KSLC 3U8ZA 2R2QA 1EO6A 2C7HA 2MWSB 3VDZA 2G3QB 4II2B 2AYOB 2PJHA 2C5LC 4HCPB 2JUOA 3ZUNA 4ASWC 1Z2MA 1Q1OA 1SIFA 1TTNA 1WIAA 2GOWA 4NAWA 4ICVA 4RM9A 3HHMA 4BKSA 5DCNA 2DAFA 4K7SA 2YLMA 3IHPC 5D2MB 1KM7A 2KO3A 2ZJDA 4ZRJA 3WAPA 4EFOA 4KSKC 2DENB 3CSTA 4M0WB 2PE9A 1UGMA 3MHSD 4ZRIA 3QC8B 5LXIB 3H7PB 1YX5B 2V4LA 2NCNA 4W9JA 3A4RA 2FIFA 4CYEA 4DDID 1IYFA 1XQQA 2IBIB 1ZW7A 2DAJA 3N3KB 3R3MA 1C1YB 3EC8A 3P2BA 1WY8A 3B08A 3HIZA 2JT4B 3LDZE 4FHJA 2G4DB 1E8XA 4F7ZA 2MA9B 3VVWB 2KFJA 1WGHA 1ISNA 3AU5A 1GNUA 5AZFA 2MBHA 3TCAA 4G0NB 4TV3A 2YVCA 2LI5A 2JRHA 4W9EA 2Z59B 2IY1B 1E8ZA 1WI0A 2Z0DB 5AZGA 2M8SA 5J17A 1NI2A 3SU8X 1CMXB 2IY0B 4FULA 4JQWC 1YD8U 2BGFA 3SHQA 3VTUA 2N9EB 4FHKA 3VHTC 4IW0A 4WWPA 4EEWA 1NDDA 3Q3FA 3ZDMC 4E71A 2B3AA 1UZXB 1VCBA 1NBFC 3KYDD 5E6NA 3V62A 2KTRA 2JRIB 3L16A 4GXBA 4MH0E 2PPHA 3A9KB 2JZZA 4JGHB 2MLBA 1WX8A 3EECA 4YL8A 3NY5A 4MGYE 2CKHB 2KKCA 3W1YA 2KQ7A 4BKGA 1IP9A 3DCGA 3ZTCA 2FAZA 1WMHB 4ANUA 4AJYB 1V5TA 3UIOB 1LQBA 2IYDB 4F8CB 2LZ6A 4NNJB 3W1SC 3RCZA 2K8CA 1K8RB 1OGWA 3AU4A 3QARA 3PVLA 2CU1A 4EZKA 2MCNB 2RSUA 4RM8A 2MBOA 4GDLB 2ZNVB 3TJPA 3U30A 4TQ1A 2DZJA 3ZRCA 2KXJA 2KK8A 2KJ6A 2K6DB 4CHKA 2KDIA 2BYVE 1L2NA 3Q3JA 4W9GA 2XK5A 4MJSB 5AZHA 4EOYA 4WWNA 5CHWA 2D10A 2Z0EB 4WAAA 2V1YA 4AJWA 1V81A 3NZSA 5J18A 3DVNV 3TIXA 4IWOA 3S2AA 4W9HA 4HCNB 2NS5A 3GOEA 4EZJA 3QIJA 4KV2A 1WF9A 1WM3A 2GMIC 4KVGB 5CTRC 3BY4B 4HXDA 5GMVA 4A3OA 2IO1B 2NVUI 4KZCA 1WJ4A 2LRWA 4A3PA 2ZEQA 3M3JA 3AI5A 4KDLB 1S1QB 2KHWB 2FCNA 2LGXA 5DPSA 3ZDTA 4G11A 4WJNA 4ZRKA 4K1RB 3ZTDA 4URKA 3PGEA 5CHFA 2LRUA 4XX5A 2MW5A 2D11A 4GN1A 2ZZPB 2HJ8A 4FLHA 2JVCA 2KOXA 2REXA 3PLUA 1XD3B 2CHZA 2FIDA 2KVRA 3O65B 4IC7B 4NQKE 2L0FA 3PSEB 3EHVA 4ANVA 3IFWB 4FADA 2DHZA 2KTFA 1Y8RC 4HWIB 2ZPNA 4PS8A 5G55A 5LLIA 1P3QU 4WWOA 1D3ZA 1WGDA 2WDTB 3PHXB 4WJOA 4IG7B 2J0MA 3DBHI 4FJVB 1HE8A 1UBQA 1EF5A 3IBEA 3L54A 3RD2A 4NAWB 3V6CB 1V80A 3V60A 1C3TA 2DX5B 2KD0A 1WR6E 2RGFA 2LXAA 3WAMA 4MEMA 4KDIC 5J2RA 2KTRB 1P0RA 5D94A 4PYUA 5E6OA 3A9KA 4MSMB 2KWVB 1QZEA 2PEAA 2W9NA 1E8WA 3ECIA 3H7PA 3HM6X 3PRMB 2PE6B 1A5RA 3APDA 1KOTA 2L7RA 4G50A 2K8BA 2I1KA 1KLVA 2JXXA 4E3CA 2DZIA 3X0WA 4GIVA 2KQSA 4XZ4A 2ZCBA 1WM2A 2O6VB 4P7IA 2BF8B 5DPTA 4B6WA 1WE7A 2MP2B 1LFDA 1UH6A 4J6IA 2M17A 4XC2A 3PV1A 4JLCA 3QCAA 4W9KA 5FR6A 2FCMA 2GBJA 2KJHB 3CMMB 3UQBA 2KMCA 4II3B 2KLGA 4GDKB 2IO2B 2LVOA 1WXVA 2LASA 4MGIE 4FN2A 2A5UA 4MM3A 2J0KA 3M62B 4PS7A 4HLEA 1UBIA 1GC6A 1UELA 4BKTA 2GBNA 1OTRB 3ZNHB 4HVBA 1RRBA 5AEKB 4NQLB 1E5WA 1KJTA 2NPTB 4OVVA 3A4SC 2DYMA 2N4FA 3WALA 2XBBC 1I35A 4TQ0A 2NBUA 4HPMB 3VXWA 5JHAA 2KDFB 2C7MB 2K8HA 4TUUA 3PPAA 2RR9A 1WE6A 3VFKA 3QQ8B 3U7DA 3RULA 2KJRA 3QX1A 4HK2A 2CR5A 2MSED 4LJPB 3RZWC 2FCSA 3DBLI 3KUCB 1WJNA 1OQYA 1LM8B 2ZVNA 5E6PA 2KLCA 5EDSA 1XT9B 3QA8A 3DQVA 1T0YA 1H4RA 2J0JA 2KDBA 3K9OB 2MBEA 1H8CA 4ANXA 1OEYJ 4GDLA 4FJYA 2K39A 2R2OA 4NJ6A 3V6EB 2RPQA 3LJ3A 2N7EA 1YQBA 4AOFA 2D07B 2WX1A 3VH3B 3NS8A 4HDQA 5D6JB 1WR1A 4MSQB 1E7VA 1V5OA 1WX7A 3V61A 2CHWA 3VH4B 2CHXA 2J7QB 3PS6A 1RAXA 2LD9A 2LGYA 3L0WB 3MTNB 4HJKA 3ZNGC 2AL6A 3VAWA 1YIWA 3WAOA 2KC2A 2WYQA 2LXCA 2GBMA 2LGDA 3QAQA 4AWJA 1WGGA 5L83A 2L76A 3R66C 1V6EA 3AXCA 3PTFC 2NR2A 4WJPA 3ENEA 3ZKJC 1GC7A 2LUEA 2ZCCA 3NHEB 4HPLB 3BINA 2IZVB 3L08A 4BFRA 2L05A 3C0RB 1JRUA 1WH3A 2NBWB 3H1UA 1GG3A 2L00B 1WZ3A 4KZ0A 2HE7A 2GBKA 2K1FA 1E7UA 3CSFA 3DDCB 5C23A 2K25A 3X23A 3K9PB 4FJZA 3ZNZB 2AWTA 3R7QA 2DZKA 2O6VA 2L8JA 2BYEA 3JSVA 1Q0WB 1WZ0A 4NY0A 2BKRB 2MP2A 4GSWA 1I42A 3UF8A 1V86A 2RD0A 3TL5A 2O2VA 3L17A 4M8NA 1G6JA 4LJOB 1TGZB 4GDKA 3CF6E 4NJ7A 4W9DA 3HK0A 3ZRFA 4A20A 2NBVB 4OVUA 3A1QA 3WANA 2G4SA 1WYWB 2OJRA 3L13A 4AP4C 3JW0X 1L7YA 2N1VA 3RT3B 3PLVA 3ZO5B 5IAAC 3KH0A 1TZ1A 3HM3A 2NPTA 2C60A 2DZMA 3AULA 4W9LA 5L95C 3SDLC 2XEWA 4LCDE 2N7DA 2N1WA 4ZYNA 2KN5A 2LWPA 3ZIMA 3DVGY 4JL9A 2FNJB 3DPDA 5G2NA 1GJZA 2ZNVC 2JWZA 3JVZX 4HDOA 4KIKA 3ZNID 2EKEC 1RLFA 3APCA 4DHJD 1F9JA 1E8YA 2O6VD 3QWZB 1IPGA 2A4ZA 2D2QA 4N9F4 2KFKB 4PYZA 3VTWA 2KDEB 4WJQA 3TBLD 1RFAA 1EF1A 1WJUA 4I6LB 4DHJB 5IA7A 3DBRI 1ZGUB 4LDTB 2AEHA 3I3TB 4BOSC 2JY6A 3A9JB 3DVGX 3OAWA 4W9IA 4BBNF 2QHOA 4IM2A 1U4AA 3GZNI 4IM3A 2DYBA 2L0TA 4EUTA 2M1MA 4IWPA 4K7UA 4ICUA 3UGBB 3R7RA 3H6NA 1M94A 1P9DU 1WGRA 4B9KA 2FUHB 2IO3B 4DHZE 2MBQA 2VRRB 1WXMA 2AL3A 2WWZA 3PREA 4W9FA 2JF5A 2EMTA 5KHQA 2JPHA 4BKSD 1YJ1A 4I6PA 4BOZB 2ZVOA 2M4NA 1PQSA 4MGZE 3T9LA 4DWFA 3DOWA 2MBBB 2UWQA 3MJWA 2ZPYA 2L3ZA 4IUMB 5HKHA 3H7SA 5JH5C 2KX0A 3ZLZA 4DHZB 3PT2B 1E90A 2BYFA 4RMAA 4MELA 4FA6A 3D32A 5CX3A 2M0XA 2MX2A 5JZEB 2KWUB 3L10B 3A33B 4GB9A 2C9WB 1GUAB 2KZRA 3M63B 5TR5A 4ANWA 4JIOU 3IVFA 2LVPA 3VQIA 1WRDB 1AARA 4GGQA 2D3GA 1WXAA 3M95A 4DDGD 2LJ5A 3RUIB 1WJ6A 1V9JA 3T8MA 2GBRA 4W9CA 2EMSA 3ONSA 1J8CA 1OEYA 3DBSA 4F1SA 3A1QB 1V2YA 3ML8A 1MG8A 1J19A 4PS3A 2KANA 3UIPB 1EUVB 3IG3A 4DK5A 4ZDVA 2BPSA 2DYOA 2KNBA 2K6QA 1X1MA 4WQOB 3UQAA 3PRZA 4BVUC 3WA0A 1WMHA 3ZW3A 3KUZA 1TBEA 2CS4A 3OJ3A 1P98A 4E74A 3B0AA 2ASQA 2UYZB 2KC1A 3APFA 4NPNA 1J0GA 4IWQA 1R4MI 1WXSA 3PZDA 2IO0B 3QK0A 1ZKHA 4K81A 3VUYA 3JSVB 1WGYA 1FXTB 3KYCD 4MGKE 2KMAA 3KVFB 2Y5BB 3NOBA 4LDTD 5C1ZA 2BKFA 2O2VB 4FBJB 2KX3A 3B1LX 1Z5SB 3SD5A 3KUDB 1S3SG 2N9XA 3UINB 4AUQC 1UD7A
chains in the Genus database with same CATH superfamily
3SR6A 2XK5B 2G45B 2JXTA 5CHVC 4CO7A 3ZYYX 1SGHA 1SEBD 3RZFA 3VUWA 2D3BA 2D3CA 3BYYB 2HTME 4OZAA 5KHOA 1N5XA 3H9DA 3N32A 4KIKB 3QJZA 1VD2A 1F0ZA 4ZYSA 4JX1C 3H8HA 2IDYA 4OVZA 3OJ4B 2LVQA 4EKUA 1C4CA 4P6VF 1WX9A 4TKNA 3A9JA 4M8MA 5LXHA 5AUKA 1V49A 2J42A 3ALBA 3W1SA 3OLMD 1L0YB 2R2QA 3FILB 4HCPB 2JUOA 1GOZA 4WQMA 2LUMA 1KRHA 1SIFA 4ICVA 1V1PA 1QKZA 2DAFA 1RM6C 4K7SA 3AE9B 3IHPC 5D2MB 4ZRJA 1AW7A 3CSTA 5EE0A 3RI7C 3QC8B 2WS3B 2V4LA 4W9JA 3A4RA 3AEAB 1IYFA 3N1YC 3AE7B 3URYA 2DAJA 1C77A 1C1YB 4L2YA 2G4DB 3HVDA 2MA9B 3AU5A 1KLUD 4A8XC 1YQ3B 4G0NB 3GE8C 2YVCA 4TV3A 2IY1B 1WI0A 1FCLA 3ZGZA 2WP9B 5AZGA 2M8SA 3SU8X 1CMXB 4JQWC 3SHQA 3MHZA 2BT6A 2D5GA 3VHTC 4IW0A 4WWPA 4EEWA 3Q69A 2IPKD 1NBFC 4RGNA 2M19A 3I9V1 4KGRA 3A9KB 5BYSA 4YL8A 4YT0B 1IP9A 3U52E 1JRPA 4AJYB 2IYDB 1RWSA 2LZ6A 2BS4B 2JYEA 1CQVA 1F77A 3NZ3A 4CQNA 3W1SC 4D2KA 2K8CA 3AU4A 3PVLA 2RSUA 2OHFA 3Q8AA 2KK8A 2KJ6A 2K6DB 1L2NA 4MM3B 2XN9C 1PYWD 5AZHA 4AJWA 1V81A 1JWSD 3SFDB 3RNCC 4EZJA 3QIJA 1D5XC 1N62A 3ZXRA 3BY4B 1QOFA 5HHDG 4KDLB 2B76B 2FCNA 4ZRKA 1E7PB 1FCCC 3EGRA 2LRUA 1SIJA 2MW5A 3U7ZA 4OW0A 4FLHA 3NVYA 4NZLB 2KOXA 3PLUA 2FIDA 3NVZA 4ANVA 1Y8RC 1HA5A 3AE4B 3AE1B 2ZPNA 2V3PA 5LLIA 4WWOA 4RH6A 4RFBA 1WGDA 1XF5L 3I57A 1N6ZA 3IBEA 3RD2A 4NAWB 4DXFA 1WR6E 1K52A 2HDEA 1MVKA 4K3BA 1FNVA 3A9KA 4O1NA 1ZUD2 3AEBB 3HM6X 2PE6B 2PVOD 4GLSC 2Y5CA 1KTKA 2K8BA 1NYRA 1AN8A 1KLVA 1XLOA 4E3CA 2DZIA 4XWWA 4GIVA 1WM2A 2BF8B 2H88B 1WE7A 2MJ3A 1LFDA 2WLBA 4J6IA 4XC2A 3PV1A 3R8BA 3QCAA 2GBJA 3CMMB 2KMCA 4II3B 2J52A 2LASA 4MGIE 4FN2A 2A5UA 2J0KA 1ET9A 3AH7A 2Y3AA 4L1BA 2GBNA 1OTRB 1BUIC 5AEKB 3WALA 1ZXIA 1HXYD 1TS4A 4HPMB 5JHAA 2C7MB 4TUUA 2RR9A 1WE6A 3U7DA 2CR5A 4LJPB 1LM8B 3NUHB 1STEA 3DBRB 3DQVA 1H4RA 2J0JA 4FJYA 2PVGC 1YMHE 1TS5A 4AOFA 2N7EA 1YQBA 3KWVA 2WX1A 4HDQA 2WDVB 1VJKA 5D6JB 1WR1A 4MSQB 1WX7A 3PS6A 2K3UA 3C8YA 3ZNGC 1L5PA 1FNUA 2KVZA 2KC2A 2LXCA 5BMIA 2GBMA 2LGDA 4AWJA 3PZ7A 2L76A 3BK2A 1V6EA 2WXGA 1GC7A 2ZCCA 3NHEB 4HPLB 2IZVB 1YN5A 1TYGB 2NBWB 1SJED 3MP9A 1TKGA 5E6JA 2GBKA 2K1FA 4LNFA 3X23A 4FJZA 2AWTA 1UWXA 1Q0WB 1I42A 1F1HA 2VH2A 2SAKA 5BYQA 3TL5A 1P7EA 1G6JA 4LJOB 1C4PA 1ENFA 4A20A 3BIID 3WCQA 2FE8A 3Q3NC 2R61A 2ICIA 4AP4C 2BW2A 2N1VA 3KH0A 2NPTA 2DZMA 1SE3A 1TKYA 2XEWA 1IGDA 2WHIA 4ZYNA 3ZIMA 1GJZA 2JWZA 3AV8A 5BYRA 2QMTA 1F9JA 2O6VD 1IPGA 3IT6B 3MJ5A 3Q8FA 4WJQA 4S0RA 4PT5A 3TBLD 2AEHA 4BOSC 2H89B 3A9JB 1I4HA 3U2SC 4IWPA 4ICUA 5MPOA 1R4MB 1M94A 1WGRA 3FILA 2VRRB 2AL3A 1YJ1A 2M4NA 3T9LA 2MBBB 3KQ4A 1FPYA 2L3ZA 2ZPYA 4IUMB 5HKHA 5C2TB 1XEEA 1NYQA 1EU3A 2W82A 5CX3A 2M0XA 4WH4A 1EWYC 5JZEB 2BTEA 3L10B 3A33B 4R3DA 4GB9A 2KZRA 1GUAB 2XNAC 3IVFA 2LMCA 3P1MA 1WXAA 1V9JA 3T8MA 5C3JB 4W9CA 1YJIA 3ZJTA 3ONSA 5H92C 1J8CA 2LGSA 4F1SA 2VZKD 1V2YA 4PS3A 1EUVB 3LB8C 4DK5A 4RNAA 1R7SA 1UNSA 3TEZA 2KNBA 2WXNA 2ON8A 3OJ3A 5FR3A 2UYZB 3APFA 4IWQA 2OEDA 1ZKHA 1WGYA 2Y5BB 4LDTD 5C1ZA 4HEA1 3SD5A 3VR8B 1S3SG 3DBHB 1UD7A 4X57B 4MJSA 4IKGA 5DPWA 5JHBA 2MRPA 2N0SB 3T3OA 4G3XB 1LXDA 1QQRA 1B9RA 3PHWB 3JYUA 4GU2A 1QT9A 5IKCM 4M00A 2W3RA 1TT5B 3IAS1 4EZLA 4GMVA 2UU7A 1WXQA 3B2GA 1FRDA 2OOBB 1Q5WB 5D7GA 1E0ZA 1R4NI 2KFKA 2NTTA 4BBNC 1AWDA 3PRPB 3VUXA 3VTVA 1E6EB 1D6EC 3VDZA 1HZ5A 1DOIA 4II2B 2PJHA 1NVID 2WXOA 1SE4A 3ZUNA 4ASWC 4RGTA 1Q1OA 1TTNA 1WIAA 2GOWA 2D3AA 4RM9A 4BKSA 2MJEA 1P7FA 2KO3A 2ZJDA 3WAPA 1FM0D 3MHSD 2Y5PA 2NCNA 2LHDA 2WU5B 1XQQA 4NJCA 1ZW7A 1SB3C 4YWGG 3P2BA 2JT4B 3AMZA 3LDZE 4F7ZA 3VVWB 1FIQA 1WGHA 3TCAA 2Z59B 1E8ZA 3AE5B 1XCTL 5J17A 3L4PA 2AX5A 2BGFA 1GB4A 3VTUA 3RNGC 3EA6A 4S17A 2AQ1B 3KYDD 2BQQA 4C56C 2JRIB 3L16A 4L23A 2PPHA 2J53A 1OQRA 4DWFA 1WX8A 3W1YA 4MGYE 4BKGA 5LNK1 3I63C 1JWBD 3TEXA 5IO9A 1WMHB 2QSDA 1V5TA 3UIOB 3TUOA 4A90A 4F8CB 2W3SA 4NNJB 1K8RB 1XXGA 1VRAB 3QARA 2CU1A 4RM8A 2MBOA 4GDLB 2ZNVB 2BBCA 3U30A 3ZRCA 1I4XA 3Q3JA 2Z8LA 2JU6X 1VLBA 5CHWA 5J18A 3TIXA 4IWOA 4HCNB 3AEFB 1L6VA 4KV2A 1WM3A 1V1PB 1LGRA 4HXDA 4A3OA 2NVUI 1WJ4A 1QOBA 3AI5A 3ZDTA 5DPSA 4G11A 1OQQA 3ZTDA 4ZRPA 3PGEA 5CHFA 4M01A 2FUG1 4XDDA 2ZZPB 2KVRA 3NG0A 2J4XA 3EHVA 2DHZA 4YSXB 4HWIB 4PS8A 2I38A 1T3QA 1V1OA 5G55A 3AEDB 2WDTB 1FMAD 1T6BX 1XO3A 1TKEA 1YN4A 3DBHI 2KWDA 1UBQA 1HQRD 3U4EG 1C3TA 1VZ8A 1V80A 3V60A 3RFZB 2LXAA 1PGXA 4KDIC 2VZKB 1DOYA 4ZOHC 2QEJC 1QZEA 2W9NA 5FKAC 3ECIA 1FXAA 4G50A 1FNWA 2I1KA 4RF0A 2ACZB 2O6VB 4P7IA 1R4NB 2M17A 4C00A 1JROA 4W9KA 4A6QA 4UDUC 4GDKB 2G9HD 4BAXA 2E6XA 2G1EA 4PS7A 4HLEA 4JWUC 2SEBD 4LNKA 1GC6A 1YOVB 4OHJA 1UELA 1FO4A 2TSSA 3ZNHB 2INCC 4HVBA 2WU2B 2NPTB 3B9JA 1AYFA 4OVVA 2DYMA 1HTOA 4TQ0A 2NBUA 3VXWA 3BVZA 3VFKA 3RULA 4YTMB 1N5WA 2MSED 1TIFA 3KUCB 1WJNA 1JWAD 5EDSA 2PTLA 1SE2A 3K9OB 1H8CA 4MH8A 4ANXA 3HUIA 1OEYJ 4GDLA 2R2OA 1E7VA 1EM7A 1RAXA 2LD9A 3L0WB 3MTNB 4HJKA 3CWIA 3VAWA 1YIWA 5L83A 3NJTA 2WXPA 1L4DB 3N9YC 1QOAA 3L08A 4J3OD 4KZ0A 3H1UA 1JRUA 2L00B 1WZ3A 4C4VB 1V97A 1A70A 3K9PB 4KGSA 2DZKA 2O6VA 2AQ3B 3IT4B 3JSVA 4NY0A 1D5ZC 1FRRA 2BKRB 3P4RB 1V86A 2RD0A 2O2VA 4GDKA 2WGSA 1RFKA 3CF6E 4NJ7A 4W9DA 3HK0A 1K50A 3WANA 2OJRA 3L13A 3ZO5B 3PLVA 5IAAC 1TZ1A 4HRSA 2LHEA 4H2AA 2C60A 5L95C 2LEKA 1XLNA 2FNJB 3RNAC 4HDOA 4KIKA 1L0XB 2EKEC 1RLFA 3APCA 3DWGC 4PYZA 2K9XA 2KDEB 5EE9A 4N6EB 4DHJB 5IA7A 1NENB 1ZGUB 4LDTB 4HKZE 4BBNF 1U4AA 3GZNI 4Q2JA 3N20C 1P9DU 2MBQA 2WWZA 3BYTB 4M02A 4MGZE 3DOWA 2UWQA 5IOIA 5JH5C 1E9MA 2BYFA 3Q6BA 2N9KA 2BYTA 2BS3B 1K51A 3D32A 5D3IB 4C4VA 2MX2A 3M63B 4GGQA 4K3CA 1E10A 3DWMA 1J7BA 1GAQB 2EMSA 3A1QB 1UGJA 3ML8A 1MG8A 3PZ8A 3IG3A 4LLGM 2EELA 3ABVB 1DYQA 3R2IA 4WQOB 1I7HA 4US9A 1TBEA 3W2DA 4E74A 2ASQA 2GB1A 2KC1A 1JCKB 2L83A 4NAMA 1R4MI 3PZDA 1FXTB 1UF0A 3HVZA 4MGKE 3AE3B 4BZAA 2PLPA 2KX3A 3BZDB 1L6UA 2N9XA 1SE9A 4OZBA 3NRZA 3C19A 2L52A 2C7NB 2FCQA 2MEKA 3B2FA 1BT0A 4IM0A 4DBGA 3WIMA 3W9CB 4MDKE 5BMHA 1WFYA 4I6NB 2BWES 3KW5B 2WNMA 4K7WA 4WURA 1SJHD 2HTHA 2WXMA 3EFUA 1XCQL 2KWCA 2V3SA 5EE1A 2MQJA 3TEWA 4KSLC 2X8XX 1EO6A 2G3QB 2AYOB 2V3NA 3HHMA 2YLMA 3ZJUA 2N9LA 2AQ2B 2DENB 1IGCA 4ARIA 2KYWA 4ZRIA 4XWTA 1D3ZA 3H7PB 1MFWA 2IBIB 3R3MA 4AQ7A 1WY8A 3B08A 1E8XA 1NEKB 3W5VB 1T0SC 1GNUA 1T5XD 3O13A 4C7ZA 2Z0DB 3I5JC 3GB1A 2YEPB 2IY0B 4FULA 3GZNB 2N9EB 2BB6A 4FHKA 3Q3FA 3ZDMC 2B3AA 1UZXB 1VCBA 3Q14C 4US8A 2HJ1A 4MH0E 4EE2A 2MLBA 1CJEA 1SBBB 3NY5A 2CKHB 2KKCA 3ZTCA 3FKYA 1MPEA 2IGGA 4ANUA 4YTPB 1LQBA 3VRBB 3BK1A 1OGWA 4KX6B 4EZKA 2MCNB 4A55A 5G5GA 4TQ1A 1ACCA 4CHKA 2KDIA 4W9GA 4MJSB 1JALA 5T8IA 2Z0EB 4WAAA 3NZSA 1XLQA 1PGAA 2DBYA 2GMIC 5CTRC 5GMVA 4C80A 2WXJA 3AE6B 1ROEA 4A3PA 4A9AA 2LRWA 2PW9A 3BVGA 3M3JA 1S1QB 2LGXA 1F2RI 2L32A 3NS1A 3MC8A 2RDHA 4URKA 3CIRB 2D11A 2JVCA 1FXIA 2REXA 4IC7B 2CHZA 4C7YA 3O65B 4NQKE 1MHHE 2L0FA 3IFWB 2KTFA 5IP4D 1PFDA 1C4AA 4WJOA 4IG7B 1OFFA 2J0MA 3SFEB 3ZXVA 4FJVB 1VZ7A 1EF5A 1TS2A 3L54A 1IBXA 2DX5B 2RGFA 2N7JA 5J2RA 5BMGA 2KTRB 1P0RA 1MI0A 4PYUA 2W54A 5E6OA 4MSMB 2KWVB 2PEAA 3H7PA 1E8WA 3PRMB 4LNNA 3R2TA 1KOTA 3W5UB 4KKIA 1TJEA 3BVMA 3X0WA 4XZ4A 4B6WA 5DPTA 2MP2B 4JLCA 3FC4A 1V8CA 2FCMA 3UQBA 1EWCA 2KLGA 2LVOA 4KKJA 2PKOA 3M62B 1M4VA 1Y56A 3DHIC 4BKTA 4MT5A 3AECB 5H8YE 2LFIA 1FEHA 1KJTA 4NQLB 3Q8CA 3A4SC 2N4FA 2XBBC 1I35A 4REZA 1QF6A 1ZP0B 2K8HA 3PPAA 3QQ8B 2VH1A 2KJRA 4HK2A 1ZXHA 3RZWC 2FCSA 3DBLI 5E6PA 1MJDA 2KDBA 5HFYA 3KLSX 2K39A 5G5HA 4TSSA 5D3DA 1C78A 2KDMA 3NS8A 4WWMA 1KF6B 1KH0A 2CHWA 2CHXA 1CZPA 2J7QB 3WAOA 2K5PA 2M0AA 3QAQA 1WGGA 1C9FA 3R66C 2WXHA 4WJPA 3ENEA 3ZKJC 2LUEA 3BINA 4BFRA 3C0RB 1WH3A 2WXQA 1GG3A 2KACA 3CSFA 5C23A 3DDCB 2K25A 2V0GA 1K53A 4ZRQA 1D5MC 2L8JA 2BYEA 2GLSA 2MP2A 4GSWA 4M8NA 4PK1A 1N60A 3ZRFA 3N1XC 3A1QA 3OG5A 4MACA 2G4SA 1LO5D 2QDFA 1D4BA 3RT3B 2X38A 3AULA 1HZ6A 2LGIA 2WDRB 1C79A 2I2YA 5G2NA 3DPDA 3ZNID 2BVCA 2INPE 4DHJD 2D2QA 4N9F4 3HRDD 3VTWA 1JWMD 1RFAA 1EF1A 4ACFA 3P63A 2JY6A 3DVGX 4W9IA 2QHOA 5HG2A 4HJGE 4IM3A 2DYBA 2MJDA 2L0TA 2M1MA 4K7UA 3UGBB 2W55A 4B9KA 3EFCA 2IO3B 1B1ZA 4TMAB 4DHZE 1WXMA 4W9FA 4HROA 2EMTA 5KHQA 2JPHA 4BKSD 3ETRA 3Q8EA 4HPPA 1PQSA 2EKIA 3Q3MC 3ZLZA 4IDIA 4MELA 3Q2AC 2FBWB 3KWLA 1ZDXA 2KWUB 1JW9D 1WRDB 4AS1A 1VR9A 2D3GA 2JSVX 1GPXA 4DDGD 3RUIB 1OEYA 1WWTA 1RYJA 4XGAB 4N59A 2KANA 4ZDVA 5TSSA 2DYOA 4JPSA 4XE0A 3Q8BA 2WXRA 4ZHOA 3DBLB 3UQAA 3WA0A 1WMHA 1FFVA 1TY0A 2KT7A 1J0GA 3KYCD 4ZHPA 4QAYA 3KVFB 2ONQA 3NOBA 3Q3OC 2WXKA 4FBJB 1N63A 4AUQC 3UINB 2BWFA 3ML9A 3NZUA 2N9PC 2KQ4X 2WX0A 3TMPB 1P1AA 1UUPA 5FK9C 1YX6B 3DVNU 2NMQA 4GOCA 1QLBB 5DPRA 5BO4B 1YQ4B 4DXAB 3N30A 1L0VB 3ZVVA 4YSZB 3SEBA 5JXVA 2V4IB 4USAA 2HD5B 4B95A 1DOXA 2JZ3B 4LNOA 3RYTA 4HKQA 3QHTA 4JWSC 2LJIA 2I1JA 3U8ZA 1NI3A 2JWUA 2C7HA 2MWSB 3J9CA 1EU4A 1C76A 3VR9B 2C5LC 3V3XA 4YTNB 1Z2MA 4B0EA 5HI1A 4NAWA 5DCNA 4KGTA 1KM7A 4EFOA 3LYYA 4KSKC 4M0WB 2PE9A 1UGMA 5LXIB 1YX5B 2WQYB 2FIFA 4CYEA 4DDID 3RNBC 3FAHA 2V9HA 4RCOA 3N3KB 3EC8A 3HIZA 4FHJA 3UI3A 2KFJA 1ISNA 5AZFA 2QILA 2MBHA 3AN1A 2LI5A 1YJJA 1F52A 4RGMA 2JRHA 4W9EA 4P1BC 2KMMA 4P1CC 3T3NA 1NI2A 1QILA 1I4GA 1YD8U 1ZDVA 1BMLC 1PDXA 1NDDA 4E71A 2K0PA 1HEZE 5E6NA 3V62A 2KTRA 1JWUD 4GXBA 3VQIA 2JZZA 4JGHB 3EECA 2KQ7A 2RMMA 3DCGA 3AE8B 2FAZA 1BXTA 3V05A 3RCZA 1KFYB 2JZPA 3N1ZC 1TS3A 2JX5A 3TJPA 4YXDB 2DZJA 2KXJA 2BYVE 2XK5A 4EOYA 4WWNA 2BB5A 3GE3C 2D10A 2V1YA 3IAM1 3DVNV 3S2AA 4W9HA 2CU3A 2RDBC 1WRIA 2NS5A 3GOEA 1WF9A 4KVGB 2JYTA 1F2RC 2IO1B 4LTUA 4JE3B 4KZCA 2ZEQA 4M0WA 2KHWB 1KLGD 3DHHC 4WJNA 1TY2A 4K1RB 1WGKA 1YN3A 2DLBA 4XX5A 3OWEB 3MC0B 2WXIA 4GN1A 2GI9A 3MFGA 2HJ8A 1JQ4A 1ZOYB 1XD3B 2WDQB 3PSEB 1I4RA 2QCZA 4FADA 1ZPSA 1T0QC 1VZ6A 2L1AA 3AE2B 4DQOC 1P3QU 3PHXB 4FXCA 1J7AA 1HE8A 3V6CB 2KD0A 3E56A 3WAMA 1ZE3D 4RGOS 4MEMA 3P4PB 5GXGB 5D94A 3BWUD 3P4QB 1A5RA 2IGHA 2Q5WD 3APDA 2L7RA 2RDGA 2JXXA 1FD6A 2KQSA 2ZCBA 3RMKC 4OZCA 1UH6A 3RN9C 5FR6A 2KJHB 1ET6A 2IO2B 1WXVA 4N58A 4MM3A 1VDVA 4DXGA 2MH7A 1UBIA 1PGBA 2K22A 2RPVA 1RRBA 1E5WA 1DGJA 2WXLA 1MG4A 5EE3A 1SSNA 2KDFB 3QX1A 2ZVNA 1OQYA 2KLCA 1XT9B 3AEGB 2IJ0A 3QA8A 3RPFC 1T0YA 2E3TA 4WAFA 2MBEA 4NJ6A 3V6EB 2RPQA 3TSSA 3LJ3A 2D07B 3VH3B 3V61A 1V5OA 4YSYB 3VH4B 2BS2B 1UWMA 2LGYA 2AL6A 1FFUA 4XDCA 2WYQA 3TEYA 3LXFA 2KN4A 3AXCA 3PTFC 2NR2A 1ESFA 2PMVA 1YNTE 2L05A 4RF1A 2HE7A 2QIEB 1SF0A 1E7UA 1QOGA 4B0MA 3ZNZB 3P42A 3PO0A 3R7QA 4XYCA 1WZ0A 3IXSA 3NVVA 3UF8A 1IUEA 3L17A 1CK1A 1TGZB 2ZW1A 1JMLA 3GP7A 2NBVB 1HTQA 4OVUA 5IN7A 1IBXB 1WYWB 3MC9A 3JW0X 1L4ZB 1L7YA 1Q10A 2ZW0A 4IOIE 3HM3A 4W9LA 3SDLC 4LCDE 2N7DA 2N1WA 2M56B 2KN5A 2LWPA 4LNIA 3DVGY 4JL9A 1WYGA 3ZJVA 2ZNVC 3JVZX 1E8YA 3QWZB 2A4ZA 2KAJA 2DNFA 2KFKB 5I4DA 1WJUA 4I6LB 1I4PA 3DBRI 4LK0M 3I3TB 2JQRB 2INNE 2IGDA 2DWQA 3GS2A 3OAWA 5AUIA 2WXFA 4IM2A 4ARCA 3RNFC 4EUTA 3R7RA 3H6NA 2INDC 2FUHB 3PREA 2JF5A 4P16A 4I6PA 4BOZB 2ZVOA 3VRAB 1J7CA 1I4QA 1WSPA 3MJWA 3H7SA 2KX0A 4DHZB 4WIPA 3PT2B 1E90A 2GRIA 4RMAA 1MHXA 4FA6A 3AEEB 3E9SA 3AB5A 2YEPF 1PUTA 2C9WB 2QJLA 5TR5A 2NTSA 4JIOU 4ANWA 2LVPA 1AARA 3M95A 3NVWA 2LJ5A 1WJ6A 2GBRA 2MHJA 3P4SB 2PIAA 3DBSA 2CJNA 1J19A 1GB1A 3UIPB 2BPSA 1SXTA 2CJOA 2OJWA 2K6QA 1X1MA 3PRZA 4BVUC 3ZW3A 3KUZA 2CS4A 1P98A 1XLPA 1T0RC 3B0AA 2QC8A 3ZQ4A 4NPNA 3EUB2 1WXSA 3DHGC 2IO0B 3QK0A 4K81A 3RNEC 3VUYA 3JSVB 2KMAA 3AM9A 2BKFA 2O2VB 4ITKA 3B1LX 1N61A 1Z5SB 3KUDB 1TZOA
chains in the Genus database with same CATH topology
1SE9A 4X57B 2BWFA 2XK5B 3ML9A 2G45B 4MJSA 5CHVC 3NZUA 5DPWA 2N9PC 4CO7A 5JHBA 2MRPA 2WX0A 3TMPB 1SGHA 3RZFA 2C7NB 2FCQA 1P1AA 3VUWA 4G3XB 1LXDA 1YX6B 3DVNU 1BT0A 3JYUA 3PHWB 4GU2A 4IM0A 4DBGA 4GOCA 5DPRA 3WIMA 5BO4B 4GMVA 4DXAB 5KHOA 3N30A 4EZLA 3H9DA 3N32A 3ZVVA 2OOBB 4KIKB 3QJZA 1VD2A 4MDKE 1Q5WB 1WFYA 2HD5B 4I6NB 5D7GA 2BWES 3KW5B 4B95A 1R4NI 2KFKA 4K7WA 2JZ3B 3RYTA 3OJ4B 2HTHA 4BBNC 2LVQA 3PRPB 4EKUA 3VUXA 3QHTA 1WX9A 4TKNA 3VTVA 3A9JA 3EFUA 4M8MA 5LXHA 1V49A 3ALBA 2KWCA 2V3SA 3W1SA 3OLMD 2I1JA 2MQJA 4KSLC 3U8ZA 2R2QA 1EO6A 2C7HA 2MWSB 3VDZA 2G3QB 4II2B 2AYOB 2PJHA 2C5LC 4HCPB 2JUOA 3ZUNA 4ASWC 1Z2MA 1Q1OA 1SIFA 1TTNA 1WIAA 2GOWA 4NAWA 4ICVA 4RM9A 3HHMA 4BKSA 5DCNA 2DAFA 4K7SA 2YLMA 3IHPC 5D2MB 1KM7A 2KO3A 2ZJDA 4ZRJA 3WAPA 4EFOA 4KSKC 2DENB 3CSTA 4M0WB 2PE9A 1UGMA 3MHSD 4ZRIA 3QC8B 5LXIB 3H7PB 1YX5B 2V4LA 2NCNA 4W9JA 3A4RA 2FIFA 4CYEA 4DDID 1IYFA 1XQQA 2IBIB 1ZW7A 2DAJA 3N3KB 3R3MA 1C1YB 3EC8A 3P2BA 1WY8A 3B08A 3HIZA 2JT4B 3LDZE 4FHJA 2G4DB 1E8XA 4F7ZA 2MA9B 3VVWB 2KFJA 1WGHA 1ISNA 3AU5A 1GNUA 5AZFA 2MBHA 3TCAA 4G0NB 4TV3A 2YVCA 2LI5A 2JRHA 4W9EA 2Z59B 2IY1B 1E8ZA 1WI0A 2Z0DB 5AZGA 2M8SA 5J17A 1NI2A 3SU8X 1CMXB 2IY0B 4FULA 4JQWC 1YD8U 2BGFA 3SHQA 3VTUA 2N9EB 4FHKA 3VHTC 4IW0A 4WWPA 4EEWA 1NDDA 3Q3FA 3ZDMC 4E71A 2B3AA 1UZXB 1VCBA 1NBFC 3KYDD 5E6NA 3V62A 2KTRA 2JRIB 3L16A 4GXBA 4MH0E 2PPHA 3A9KB 2JZZA 4JGHB 2MLBA 1WX8A 3EECA 4YL8A 3NY5A 4MGYE 2CKHB 2KKCA 3W1YA 2KQ7A 4BKGA 1IP9A 3DCGA 3ZTCA 2FAZA 1WMHB 4ANUA 4AJYB 1V5TA 3UIOB 1LQBA 2IYDB 4F8CB 2LZ6A 4NNJB 3W1SC 3RCZA 2K8CA 1K8RB 1OGWA 3AU4A 3QARA 3PVLA 2CU1A 4EZKA 2MCNB 2RSUA 4RM8A 2MBOA 4GDLB 2ZNVB 3TJPA 3U30A 4TQ1A 2DZJA 3ZRCA 2KXJA 2KK8A 2KJ6A 2K6DB 4CHKA 2KDIA 2BYVE 1L2NA 3Q3JA 4W9GA 2XK5A 4MJSB 5AZHA 4EOYA 4WWNA 5CHWA 2D10A 2Z0EB 4WAAA 2V1YA 4AJWA 1V81A 3NZSA 5J18A 3DVNV 3TIXA 4IWOA 3S2AA 4W9HA 4HCNB 2NS5A 3GOEA 4EZJA 3QIJA 4KV2A 1WF9A 1WM3A 2GMIC 4KVGB 5CTRC 3BY4B 4HXDA 5GMVA 4A3OA 2IO1B 2NVUI 4KZCA 1WJ4A 2LRWA 4A3PA 2ZEQA 3M3JA 3AI5A 4KDLB 1S1QB 2KHWB 2FCNA 2LGXA 5DPSA 3ZDTA 4G11A 4WJNA 4ZRKA 4K1RB 3ZTDA 4URKA 3PGEA 5CHFA 2LRUA 4XX5A 2MW5A 2D11A 4GN1A 2ZZPB 2HJ8A 4FLHA 2JVCA 2KOXA 2REXA 3PLUA 1XD3B 2CHZA 2FIDA 2KVRA 3O65B 4IC7B 4NQKE 2L0FA 3PSEB 3EHVA 4ANVA 3IFWB 4FADA 2DHZA 2KTFA 1Y8RC 4HWIB 2ZPNA 4PS8A 5G55A 5LLIA 1P3QU 4WWOA 1D3ZA 1WGDA 2WDTB 3PHXB 4WJOA 4IG7B 2J0MA 3DBHI 4FJVB 1HE8A 1UBQA 1EF5A 3IBEA 3L54A 3RD2A 4NAWB 3V6CB 1V80A 3V60A 1C3TA 2DX5B 2KD0A 1WR6E 2RGFA 2LXAA 3WAMA 4MEMA 4KDIC 5J2RA 2KTRB 1P0RA 5D94A 4PYUA 5E6OA 3A9KA 4MSMB 2KWVB 1QZEA 2PEAA 2W9NA 1E8WA 3ECIA 3H7PA 3HM6X 3PRMB 2PE6B 1A5RA 3APDA 1KOTA 2L7RA 4G50A 2K8BA 2I1KA 1KLVA 2JXXA 4E3CA 2DZIA 3X0WA 4GIVA 2KQSA 4XZ4A 2ZCBA 1WM2A 2O6VB 4P7IA 2BF8B 5DPTA 4B6WA 1WE7A 2MP2B 1LFDA 1UH6A 4J6IA 2M17A 4XC2A 3PV1A 4JLCA 3QCAA 4W9KA 5FR6A 2FCMA 2GBJA 2KJHB 3CMMB 3UQBA 2KMCA 4II3B 2KLGA 4GDKB 2IO2B 2LVOA 1WXVA 2LASA 4MGIE 4FN2A 2A5UA 4MM3A 2J0KA 3M62B 4PS7A 4HLEA 1UBIA 1GC6A 1UELA 4BKTA 2GBNA 1OTRB 3ZNHB 4HVBA 1RRBA 5AEKB 4NQLB 1E5WA 1KJTA 2NPTB 4OVVA 3A4SC 2DYMA 2N4FA 3WALA 2XBBC 1I35A 4TQ0A 2NBUA 4HPMB 3VXWA 5JHAA 2KDFB 2C7MB 2K8HA 4TUUA 3PPAA 2RR9A 1WE6A 3VFKA 3QQ8B 3U7DA 3RULA 2KJRA 3QX1A 4HK2A 2CR5A 2MSED 4LJPB 3RZWC 2FCSA 3DBLI 3KUCB 1WJNA 1OQYA 1LM8B 2ZVNA 5E6PA 2KLCA 5EDSA 1XT9B 3QA8A 3DQVA 1T0YA 1H4RA 2J0JA 2KDBA 3K9OB 2MBEA 1H8CA 4ANXA 1OEYJ 4GDLA 4FJYA 2K39A 2R2OA 4NJ6A 3V6EB 2RPQA 3LJ3A 2N7EA 1YQBA 4AOFA 2D07B 2WX1A 3VH3B 3NS8A 4HDQA 5D6JB 1WR1A 4MSQB 1E7VA 1V5OA 1WX7A 3V61A 2CHWA 3VH4B 2CHXA 2J7QB 3PS6A 1RAXA 2LD9A 2LGYA 3L0WB 3MTNB 4HJKA 3ZNGC 2AL6A 3VAWA 1YIWA 3WAOA 2KC2A 2WYQA 2LXCA 2GBMA 2LGDA 3QAQA 4AWJA 1WGGA 5L83A 2L76A 3R66C 1V6EA 3AXCA 3PTFC 2NR2A 4WJPA 3ENEA 3ZKJC 1GC7A 2LUEA 2ZCCA 3NHEB 4HPLB 3BINA 2IZVB 3L08A 4BFRA 2L05A 3C0RB 1JRUA 1WH3A 2NBWB 3H1UA 1GG3A 2L00B 1WZ3A 4KZ0A 2HE7A 2GBKA 2K1FA 1E7UA 3CSFA 3DDCB 5C23A 2K25A 3X23A 3K9PB 4FJZA 3ZNZB 2AWTA 3R7QA 2DZKA 2O6VA 2L8JA 2BYEA 3JSVA 1Q0WB 1WZ0A 4NY0A 2BKRB 2MP2A 4GSWA 1I42A 3UF8A 1V86A 2RD0A 3TL5A 2O2VA 3L17A 4M8NA 1G6JA 4LJOB 1TGZB 4GDKA 3CF6E 4NJ7A 4W9DA 3HK0A 3ZRFA 4A20A 2NBVB 4OVUA 3A1QA 3WANA 2G4SA 1WYWB 2OJRA 3L13A 4AP4C 3JW0X 1L7YA 2N1VA 3RT3B 3PLVA 3ZO5B 5IAAC 3KH0A 1TZ1A 3HM3A 2NPTA 2C60A 2DZMA 3AULA 4W9LA 5L95C 3SDLC 2XEWA 4LCDE 2N7DA 2N1WA 4ZYNA 2KN5A 2LWPA 3ZIMA 3DVGY 4JL9A 2FNJB 3DPDA 5G2NA 1GJZA 2ZNVC 2JWZA 3JVZX 4HDOA 4KIKA 3ZNID 2EKEC 1RLFA 3APCA 4DHJD 1F9JA 1E8YA 2O6VD 3QWZB 1IPGA 2A4ZA 2D2QA 4N9F4 2KFKB 4PYZA 3VTWA 2KDEB 4WJQA 3TBLD 1RFAA 1EF1A 1WJUA 4I6LB 4DHJB 5IA7A 3DBRI 1ZGUB 4LDTB 2AEHA 3I3TB 4BOSC 2JY6A 3A9JB 3DVGX 3OAWA 4W9IA 4BBNF 2QHOA 4IM2A 1U4AA 3GZNI 4IM3A 2DYBA 2L0TA 4EUTA 2M1MA 4IWPA 4K7UA 4ICUA 3UGBB 3R7RA 3H6NA 1M94A 1P9DU 1WGRA 4B9KA 2FUHB 2IO3B 4DHZE 2MBQA 2VRRB 1WXMA 2AL3A 2WWZA 3PREA 4W9FA 2JF5A 2EMTA 5KHQA 2JPHA 4BKSD 1YJ1A 4I6PA 4BOZB 2ZVOA 2M4NA 1PQSA 4MGZE 3T9LA 4DWFA 3DOWA 2MBBB 2UWQA 3MJWA 2ZPYA 2L3ZA 4IUMB 5HKHA 3H7SA 5JH5C 2KX0A 3ZLZA 4DHZB 3PT2B 1E90A 2BYFA 4RMAA 4MELA 4FA6A 3D32A 5CX3A 2M0XA 2MX2A 5JZEB 2KWUB 3L10B 3A33B 4GB9A 2C9WB 1GUAB 2KZRA 3M63B 5TR5A 4ANWA 4JIOU 3IVFA 2LVPA 3VQIA 1WRDB 1AARA 4GGQA 2D3GA 1WXAA 3M95A 4DDGD 2LJ5A 3RUIB 1WJ6A 1V9JA 3T8MA 2GBRA 4W9CA 2EMSA 3ONSA 1J8CA 1OEYA 3DBSA 4F1SA 3A1QB 1V2YA 3ML8A 1MG8A 1J19A 4PS3A 2KANA 3UIPB 1EUVB 3IG3A 4DK5A 4ZDVA 2BPSA 2DYOA 2KNBA 2K6QA 1X1MA 4WQOB 3UQAA 3PRZA 4BVUC 3WA0A 1WMHA 3ZW3A 3KUZA 1TBEA 2CS4A 3OJ3A 1P98A 4E74A 3B0AA 2ASQA 2UYZB 2KC1A 3APFA 4NPNA 1J0GA 4IWQA 1R4MI 1WXSA 3PZDA 2IO0B 3QK0A 1ZKHA 4K81A 3VUYA 3JSVB 1WGYA 1FXTB 3KYCD 4MGKE 2KMAA 3KVFB 2Y5BB 3NOBA 4LDTD 5C1ZA 2BKFA 2O2VB 4FBJB 2KX3A 3B1LX 1Z5SB 3SD5A 3KUDB 1S3SG 2N9XA 3UINB 4AUQC 1UD7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE9 A;  4X57 B;  2BWF A;  2XK5 B;  3ML9 A;  2G45 B;  4MJS A;  5CHV C;  3NZU A;  5DPW A;  2N9P C;  4CO7 A;  5JHB A;  2MRP A;  2WX0 A;  3TMP B;  1SGH A;  3RZF A;  2C7N B;  2FCQ A;  1P1A A;  3VUW A;  4G3X B;  1LXD A;  1YX6 B;  3DVN U;  1BT0 A;  3JYU A;  3PHW B;  4GU2 A;  4IM0 A;  4DBG A;  4GOC A;  5DPR A;  3WIM A;  5BO4 B;  4GMV A;  4DXA B;  5KHO A;  3N30 A;  4EZL A;  3H9D A;  3N32 A;  3ZVV A;  2OOB B;  4KIK B;  3QJZ A;  1VD2 A;  4MDK E;  1Q5W B;  1WFY A;  2HD5 B;  4I6N B;  5D7G A;  2BWE S;  3KW5 B;  4B95 A;  1R4N I;  2KFK A;  4K7W A;  2JZ3 B;  3RYT A;  3OJ4 B;  2HTH A;  4BBN C;  2LVQ A;  3PRP B;  4EKU A;  3VUX A;  3QHT A;  1WX9 A;  4TKN A;  3VTV A;  3A9J A;  3EFU A;  4M8M A;  5LXH A;  1V49 A;  3ALB A;  2KWC A;  2V3S A;  3W1S A;  3OLM D;  2I1J A;  2MQJ A;  4KSL C;  3U8Z A;  2R2Q A;  1EO6 A;  2C7H A;  2MWS B;  3VDZ A;  2G3Q B;  4II2 B;  2AYO B;  2PJH A;  2C5L C;  4HCP B;  2JUO A;  3ZUN A;  4ASW C;  1Z2M A;  1Q1O A;  1SIF A;  1TTN A;  1WIA A;  2GOW A;  4NAW A;  4ICV A;  4RM9 A;  3HHM A;  4BKS A;  5DCN A;  2DAF A;  4K7S A;  2YLM A;  3IHP C;  5D2M B;  1KM7 A;  2KO3 A;  2ZJD A;  4ZRJ A;  3WAP A;  4EFO A;  4KSK C;  2DEN B;  3CST A;  4M0W B;  2PE9 A;  1UGM A;  3MHS D;  4ZRI A;  3QC8 B;  5LXI B;  3H7P B;  1YX5 B;  2V4L A;  2NCN A;  4W9J A;  3A4R A;  2FIF A;  4CYE A;  4DDI D;  1IYF A;  1XQQ A;  2IBI B;  1ZW7 A;  2DAJ A;  3N3K B;  3R3M A;  1C1Y B;  3EC8 A;  3P2B A;  1WY8 A;  3B08 A;  3HIZ A;  2JT4 B;  3LDZ E;  4FHJ A;  2G4D B;  1E8X A;  4F7Z A;  2MA9 B;  3VVW B;  2KFJ A;  1WGH A;  1ISN A;  3AU5 A;  1GNU A;  5AZF A;  2MBH A;  3TCA A;  4G0N B;  4TV3 A;  2YVC A;  2LI5 A;  2JRH A;  4W9E A;  2Z59 B;  2IY1 B;  1E8Z A;  1WI0 A;  2Z0D B;  5AZG A;  2M8S A;  5J17 A;  1NI2 A;  3SU8 X;  1CMX B;  2IY0 B;  4FUL A;  4JQW C;  1YD8 U;  2BGF A;  3SHQ A;  3VTU A;  2N9E B;  4FHK A;  3VHT C;  4IW0 A;  4WWP A;  4EEW A;  1NDD A;  3Q3F A;  3ZDM C;  4E71 A;  2B3A A;  1UZX B;  1VCB A;  1NBF C;  3KYD D;  5E6N A;  3V62 A;  2KTR A;  2JRI B;  3L16 A;  4GXB A;  4MH0 E;  2PPH A;  3A9K B;  2JZZ A;  4JGH B;  2MLB A;  1WX8 A;  3EEC A;  4YL8 A;  3NY5 A;  4MGY E;  2CKH B;  2KKC A;  3W1Y A;  2KQ7 A;  4BKG A;  1IP9 A;  3DCG A;  3ZTC A;  2FAZ A;  1WMH B;  4ANU A;  4AJY B;  1V5T A;  3UIO B;  1LQB A;  2IYD B;  4F8C B;  2LZ6 A;  4NNJ B;  3W1S C;  3RCZ A;  2K8C A;  1K8R B;  1OGW A;  3AU4 A;  3QAR A;  3PVL A;  2CU1 A;  4EZK A;  2MCN B;  2RSU A;  4RM8 A;  2MBO A;  4GDL B;  2ZNV B;  3TJP A;  3U30 A;  4TQ1 A;  2DZJ A;  3ZRC A;  2KXJ A;  2KK8 A;  2KJ6 A;  2K6D B;  4CHK A;  2KDI A;  2BYV E;  1L2N A;  3Q3J A;  4W9G A;  2XK5 A;  4MJS B;  5AZH A;  4EOY A;  4WWN A;  5CHW A;  2D10 A;  2Z0E B;  4WAA A;  2V1Y A;  4AJW A;  1V81 A;  3NZS A;  5J18 A;  3DVN V;  3TIX A;  4IWO A;  3S2A A;  4W9H A;  4HCN B;  2NS5 A;  3GOE A;  4EZJ A;  3QIJ A;  4KV2 A;  1WF9 A;  1WM3 A;  2GMI C;  4KVG B;  5CTR C;  3BY4 B;  4HXD A;  5GMV A;  4A3O A;  2IO1 B;  2NVU I;  4KZC A;  1WJ4 A;  2LRW A;  4A3P A;  2ZEQ A;  3M3J A;  3AI5 A;  4KDL B;  1S1Q B;  2KHW B;  2FCN A;  2LGX A;  5DPS A;  3ZDT A;  4G11 A;  4WJN A;  4ZRK A;  4K1R B;  3ZTD A;  4URK A;  3PGE A;  5CHF A;  2LRU A;  4XX5 A;  2MW5 A;  2D11 A;  4GN1 A;  2ZZP B;  2HJ8 A;  4FLH A;  2JVC A;  2KOX A;  2REX A;  3PLU A;  1XD3 B;  2CHZ A;  2FID A;  2KVR A;  3O65 B;  4IC7 B;  4NQK E;  2L0F A;  3PSE B;  3EHV A;  4ANV A;  3IFW B;  4FAD A;  2DHZ A;  2KTF A;  1Y8R C;  4HWI B;  2ZPN A;  4PS8 A;  5G55 A;  5LLI A;  1P3Q U;  4WWO A;  1D3Z A;  1WGD A;  2WDT B;  3PHX B;  4WJO A;  4IG7 B;  2J0M A;  3DBH I;  4FJV B;  1HE8 A;  1UBQ A;  1EF5 A;  3IBE A;  3L54 A;  3RD2 A;  4NAW B;  3V6C B;  1V80 A;  3V60 A;  1C3T A;  2DX5 B;  2KD0 A;  1WR6 E;  2RGF A;  2LXA A;  3WAM A;  4MEM A;  4KDI C;  5J2R A;  2KTR B;  1P0R A;  5D94 A;  4PYU A;  5E6O A;  3A9K A;  4MSM B;  2KWV B;  1QZE A;  2PEA A;  2W9N A;  1E8W A;  3ECI A;  3H7P A;  3HM6 X;  3PRM B;  2PE6 B;  1A5R A;  3APD A;  1KOT A;  2L7R A;  4G50 A;  2K8B A;  2I1K A;  1KLV A;  2JXX A;  4E3C A;  2DZI A;  3X0W A;  4GIV A;  2KQS A;  4XZ4 A;  2ZCB A;  1WM2 A;  2O6V B;  4P7I A;  2BF8 B;  5DPT A;  4B6W A;  1WE7 A;  2MP2 B;  1LFD A;  1UH6 A;  4J6I A;  2M17 A;  4XC2 A;  3PV1 A;  4JLC A;  3QCA A;  4W9K A;  5FR6 A;  2FCM A;  2GBJ A;  2KJH B;  3CMM B;  3UQB A;  2KMC A;  4II3 B;  2KLG A;  4GDK B;  2IO2 B;  2LVO A;  1WXV A;  2LAS A;  4MGI E;  4FN2 A;  2A5U A;  4MM3 A;  2J0K A;  3M62 B;  4PS7 A;  4HLE A;  1UBI A;  1GC6 A;  1UEL A;  4BKT A;  2GBN A;  1OTR B;  3ZNH B;  4HVB A;  1RRB A;  5AEK B;  4NQL B;  1E5W A;  1KJT A;  2NPT B;  4OVV A;  3A4S C;  2DYM A;  2N4F A;  3WAL A;  2XBB C;  1I35 A;  4TQ0 A;  2NBU A;  4HPM B;  3VXW A;  5JHA A;  2KDF B;  2C7M B;  2K8H A;  4TUU A;  3PPA A;  2RR9 A;  1WE6 A;  3VFK A;  3QQ8 B;  3U7D A;  3RUL A;  2KJR A;  3QX1 A;  4HK2 A;  2CR5 A;  2MSE D;  4LJP B;  3RZW C;  2FCS A;  3DBL I;  3KUC B;  1WJN A;  1OQY A;  1LM8 B;  2ZVN A;  5E6P A;  2KLC A;  5EDS A;  1XT9 B;  3QA8 A;  3DQV A;  1T0Y A;  1H4R A;  2J0J A;  2KDB A;  3K9O B;  2MBE A;  1H8C A;  4ANX A;  1OEY J;  4GDL A;  4FJY A;  2K39 A;  2R2O A;  4NJ6 A;  3V6E B;  2RPQ A;  3LJ3 A;  2N7E A;  1YQB A;  4AOF A;  2D07 B;  2WX1 A;  3VH3 B;  3NS8 A;  4HDQ A;  5D6J B;  1WR1 A;  4MSQ B;  1E7V A;  1V5O A;  1WX7 A;  3V61 A;  2CHW A;  3VH4 B;  2CHX A;  2J7Q B;  3PS6 A;  1RAX A;  2LD9 A;  2LGY A;  3L0W B;  3MTN B;  4HJK A;  3ZNG C;  2AL6 A;  3VAW A;  1YIW A;  3WAO A;  2KC2 A;  2WYQ A;  2LXC A;  2GBM A;  2LGD A;  3QAQ A;  4AWJ A;  1WGG A;  5L83 A;  2L76 A;  3R66 C;  1V6E A;  3AXC A;  3PTF C;  2NR2 A;  4WJP A;  3ENE A;  3ZKJ C;  1GC7 A;  2LUE A;  2ZCC A;  3NHE B;  4HPL B;  3BIN A;  2IZV B;  3L08 A;  4BFR A;  2L05 A;  3C0R B;  1JRU A;  1WH3 A;  2NBW B;  3H1U A;  1GG3 A;  2L00 B;  1WZ3 A;  4KZ0 A;  2HE7 A;  2GBK A;  2K1F A;  1E7U A;  3CSF A;  3DDC B;  5C23 A;  2K25 A;  3X23 A;  3K9P B;  4FJZ A;  3ZNZ B;  2AWT A;  3R7Q A;  2DZK A;  2O6V A;  2L8J A;  2BYE A;  3JSV A;  1Q0W B;  1WZ0 A;  4NY0 A;  2BKR B;  2MP2 A;  4GSW A;  1I42 A;  3UF8 A;  1V86 A;  2RD0 A;  3TL5 A;  2O2V A;  3L17 A;  4M8N A;  1G6J A;  4LJO B;  1TGZ B;  4GDK A;  3CF6 E;  4NJ7 A;  4W9D A;  3HK0 A;  3ZRF A;  4A20 A;  2NBV B;  4OVU A;  3A1Q A;  3WAN A;  2G4S A;  1WYW B;  2OJR A;  3L13 A;  4AP4 C;  3JW0 X;  1L7Y A;  2N1V A;  3RT3 B;  3PLV A;  3ZO5 B;  5IAA C;  3KH0 A;  1TZ1 A;  3HM3 A;  2NPT A;  2C60 A;  2DZM A;  3AUL A;  4W9L A;  5L95 C;  3SDL C;  2XEW A;  4LCD E;  2N7D A;  2N1W A;  4ZYN A;  2KN5 A;  2LWP A;  3ZIM A;  3DVG Y;  4JL9 A;  2FNJ B;  3DPD A;  5G2N A;  1GJZ A;  2ZNV C;  2JWZ A;  3JVZ X;  4HDO A;  4KIK A;  3ZNI D;  2EKE C;  1RLF A;  3APC A;  4DHJ D;  1F9J A;  1E8Y A;  2O6V D;  3QWZ B;  1IPG A;  2A4Z A;  2D2Q A;  4N9F 4;  2KFK B;  4PYZ A;  3VTW A;  2KDE B;  4WJQ A;  3TBL D;  1RFA A;  1EF1 A;  1WJU A;  4I6L B;  4DHJ B;  5IA7 A;  3DBR I;  1ZGU B;  4LDT B;  2AEH A;  3I3T B;  4BOS C;  2JY6 A;  3A9J B;  3DVG X;  3OAW A;  4W9I A;  4BBN F;  2QHO A;  4IM2 A;  1U4A A;  3GZN I;  4IM3 A;  2DYB A;  2L0T A;  4EUT A;  2M1M A;  4IWP A;  4K7U A;  4ICU A;  3UGB B;  3R7R A;  3H6N A;  1M94 A;  1P9D U;  1WGR A;  4B9K A;  2FUH B;  2IO3 B;  4DHZ E;  2MBQ A;  2VRR B;  1WXM A;  2AL3 A;  2WWZ A;  3PRE A;  4W9F A;  2JF5 A;  2EMT A;  5KHQ A;  2JPH A;  4BKS D;  1YJ1 A;  4I6P A;  4BOZ B;  2ZVO A;  2M4N A;  1PQS A;  4MGZ E;  3T9L A;  4DWF A;  3DOW A;  2MBB B;  2UWQ A;  3MJW A;  2ZPY A;  2L3Z A;  4IUM B;  5HKH A;  3H7S A;  5JH5 C;  2KX0 A;  3ZLZ A;  4DHZ B;  3PT2 B;  1E90 A;  2BYF A;  4RMA A;  4MEL A;  4FA6 A;  3D32 A;  5CX3 A;  2M0X A;  2MX2 A;  5JZE B;  2KWU B;  3L10 B;  3A33 B;  4GB9 A;  2C9W B;  1GUA B;  2KZR A;  3M63 B;  5TR5 A;  4ANW A;  4JIO U;  3IVF A;  2LVP A;  3VQI A;  1WRD B;  1AAR A;  4GGQ A;  2D3G A;  1WXA A;  3M95 A;  4DDG D;  2LJ5 A;  3RUI B;  1WJ6 A;  1V9J A;  3T8M A;  2GBR A;  4W9C A;  2EMS A;  3ONS A;  1J8C A;  1OEY A;  3DBS A;  4F1S A;  3A1Q B;  1V2Y A;  3ML8 A;  1MG8 A;  1J19 A;  4PS3 A;  2KAN A;  3UIP B;  1EUV B;  3IG3 A;  4DK5 A;  4ZDV A;  2BPS A;  2DYO A;  2KNB A;  2K6Q A;  1X1M A;  4WQO B;  3UQA A;  3PRZ A;  4BVU C;  3WA0 A;  1WMH A;  3ZW3 A;  3KUZ A;  1TBE A;  2CS4 A;  3OJ3 A;  1P98 A;  4E74 A;  3B0A A;  2ASQ A;  2UYZ B;  2KC1 A;  3APF A;  4NPN A;  1J0G A;  4IWQ A;  1R4M I;  1WXS A;  3PZD A;  2IO0 B;  3QK0 A;  1ZKH A;  4K81 A;  3VUY A;  3JSV B;  1WGY A;  1FXT B;  3KYC D;  4MGK E;  2KMA A;  3KVF B;  2Y5B B;  3NOB A;  4LDT D;  5C1Z A;  2BKF A;  2O2V B;  4FBJ B;  2KX3 A;  3B1L X;  1Z5S B;  3SD5 A;  3KUD B;  1S3S G;  2N9X A;  3UIN B;  4AUQ C;  1UD7 A; 
#chains in the Genus database with same CATH topology
 3SR6 A;  2XK5 B;  2G45 B;  2JXT A;  5CHV C;  4CO7 A;  3ZYY X;  1SGH A;  1SEB D;  3RZF A;  3VUW A;  2D3B A;  2D3C A;  3BYY B;  2HTM E;  4OZA A;  5KHO A;  1N5X A;  3H9D A;  3N32 A;  4KIK B;  3QJZ A;  1VD2 A;  1F0Z A;  4ZYS A;  4JX1 C;  3H8H A;  2IDY A;  4OVZ A;  3OJ4 B;  2LVQ A;  4EKU A;  1C4C A;  4P6V F;  1WX9 A;  4TKN A;  3A9J A;  4M8M A;  5LXH A;  5AUK A;  1V49 A;  2J42 A;  3ALB A;  3W1S A;  3OLM D;  1L0Y B;  2R2Q A;  3FIL B;  4HCP B;  2JUO A;  1GOZ A;  4WQM A;  2LUM A;  1KRH A;  1SIF A;  4ICV A;  1V1P A;  1QKZ A;  2DAF A;  1RM6 C;  4K7S A;  3AE9 B;  3IHP C;  5D2M B;  4ZRJ A;  1AW7 A;  3CST A;  5EE0 A;  3RI7 C;  3QC8 B;  2WS3 B;  2V4L A;  4W9J A;  3A4R A;  3AEA B;  1IYF A;  3N1Y C;  3AE7 B;  3URY A;  2DAJ A;  1C77 A;  1C1Y B;  4L2Y A;  2G4D B;  3HVD A;  2MA9 B;  3AU5 A;  1KLU D;  4A8X C;  1YQ3 B;  4G0N B;  3GE8 C;  2YVC A;  4TV3 A;  2IY1 B;  1WI0 A;  1FCL A;  3ZGZ A;  2WP9 B;  5AZG A;  2M8S A;  3SU8 X;  1CMX B;  4JQW C;  3SHQ A;  3MHZ A;  2BT6 A;  2D5G A;  3VHT C;  4IW0 A;  4WWP A;  4EEW A;  3Q69 A;  2IPK D;  1NBF C;  4RGN A;  2M19 A;  3I9V 1;  4KGR A;  3A9K B;  5BYS A;  4YL8 A;  4YT0 B;  1IP9 A;  3U52 E;  1JRP A;  4AJY B;  2IYD B;  1RWS A;  2LZ6 A;  2BS4 B;  2JYE A;  1CQV A;  1F77 A;  3NZ3 A;  4CQN A;  3W1S C;  4D2K A;  2K8C A;  3AU4 A;  3PVL A;  2RSU A;  2OHF A;  3Q8A A;  2KK8 A;  2KJ6 A;  2K6D B;  1L2N A;  4MM3 B;  2XN9 C;  1PYW D;  5AZH A;  4AJW A;  1V81 A;  1JWS D;  3SFD B;  3RNC C;  4EZJ A;  3QIJ A;  1D5X C;  1N62 A;  3ZXR A;  3BY4 B;  1QOF A;  5HHD G;  4KDL B;  2B76 B;  2FCN A;  4ZRK A;  1E7P B;  1FCC C;  3EGR A;  2LRU A;  1SIJ A;  2MW5 A;  3U7Z A;  4OW0 A;  4FLH A;  3NVY A;  4NZL B;  2KOX A;  3PLU A;  2FID A;  3NVZ A;  4ANV A;  1Y8R C;  1HA5 A;  3AE4 B;  3AE1 B;  2ZPN A;  2V3P A;  5LLI A;  4WWO A;  4RH6 A;  4RFB A;  1WGD A;  1XF5 L;  3I57 A;  1N6Z A;  3IBE A;  3RD2 A;  4NAW B;  4DXF A;  1WR6 E;  1K52 A;  2HDE A;  1MVK A;  4K3B A;  1FNV A;  3A9K A;  4O1N A;  1ZUD 2;  3AEB B;  3HM6 X;  2PE6 B;  2PVO D;  4GLS C;  2Y5C A;  1KTK A;  2K8B A;  1NYR A;  1AN8 A;  1KLV A;  1XLO A;  4E3C A;  2DZI A;  4XWW A;  4GIV A;  1WM2 A;  2BF8 B;  2H88 B;  1WE7 A;  2MJ3 A;  1LFD A;  2WLB A;  4J6I A;  4XC2 A;  3PV1 A;  3R8B A;  3QCA A;  2GBJ A;  3CMM B;  2KMC A;  4II3 B;  2J52 A;  2LAS A;  4MGI E;  4FN2 A;  2A5U A;  2J0K A;  1ET9 A;  3AH7 A;  2Y3A A;  4L1B A;  2GBN A;  1OTR B;  1BUI C;  5AEK B;  3WAL A;  1ZXI A;  1HXY D;  1TS4 A;  4HPM B;  5JHA A;  2C7M B;  4TUU A;  2RR9 A;  1WE6 A;  3U7D A;  2CR5 A;  4LJP B;  1LM8 B;  3NUH B;  1STE A;  3DBR B;  3DQV A;  1H4R A;  2J0J A;  4FJY A;  2PVG C;  1YMH E;  1TS5 A;  4AOF A;  2N7E A;  1YQB A;  3KWV A;  2WX1 A;  4HDQ A;  2WDV B;  1VJK A;  5D6J B;  1WR1 A;  4MSQ B;  1WX7 A;  3PS6 A;  2K3U A;  3C8Y A;  3ZNG C;  1L5P A;  1FNU A;  2KVZ A;  2KC2 A;  2LXC A;  5BMI A;  2GBM A;  2LGD A;  4AWJ A;  3PZ7 A;  2L76 A;  3BK2 A;  1V6E A;  2WXG A;  1GC7 A;  2ZCC A;  3NHE B;  4HPL B;  2IZV B;  1YN5 A;  1TYG B;  2NBW B;  1SJE D;  3MP9 A;  1TKG A;  5E6J A;  2GBK A;  2K1F A;  4LNF A;  3X23 A;  4FJZ A;  2AWT A;  1UWX A;  1Q0W B;  1I42 A;  1F1H A;  2VH2 A;  2SAK A;  5BYQ A;  3TL5 A;  1P7E A;  1G6J A;  4LJO B;  1C4P A;  1ENF A;  4A20 A;  3BII D;  3WCQ A;  2FE8 A;  3Q3N C;  2R61 A;  2ICI A;  4AP4 C;  2BW2 A;  2N1V A;  3KH0 A;  2NPT A;  2DZM A;  1SE3 A;  1TKY A;  2XEW A;  1IGD A;  2WHI A;  4ZYN A;  3ZIM A;  1GJZ A;  2JWZ A;  3AV8 A;  5BYR A;  2QMT A;  1F9J A;  2O6V D;  1IPG A;  3IT6 B;  3MJ5 A;  3Q8F A;  4WJQ A;  4S0R A;  4PT5 A;  3TBL D;  2AEH A;  4BOS C;  2H89 B;  3A9J B;  1I4H A;  3U2S C;  4IWP A;  4ICU A;  5MPO A;  1R4M B;  1M94 A;  1WGR A;  3FIL A;  2VRR B;  2AL3 A;  1YJ1 A;  2M4N A;  3T9L A;  2MBB B;  3KQ4 A;  1FPY A;  2L3Z A;  2ZPY A;  4IUM B;  5HKH A;  5C2T B;  1XEE A;  1NYQ A;  1EU3 A;  2W82 A;  5CX3 A;  2M0X A;  4WH4 A;  1EWY C;  5JZE B;  2BTE A;  3L10 B;  3A33 B;  4R3D A;  4GB9 A;  2KZR A;  1GUA B;  2XNA C;  3IVF A;  2LMC A;  3P1M A;  1WXA A;  1V9J A;  3T8M A;  5C3J B;  4W9C A;  1YJI A;  3ZJT A;  3ONS A;  5H92 C;  1J8C A;  2LGS A;  4F1S A;  2VZK D;  1V2Y A;  4PS3 A;  1EUV B;  3LB8 C;  4DK5 A;  4RNA A;  1R7S A;  1UNS A;  3TEZ A;  2KNB A;  2WXN A;  2ON8 A;  3OJ3 A;  5FR3 A;  2UYZ B;  3APF A;  4IWQ A;  2OED A;  1ZKH A;  1WGY A;  2Y5B B;  4LDT D;  5C1Z A;  4HEA 1;  3SD5 A;  3VR8 B;  1S3S G;  3DBH B;  1UD7 A;  4X57 B;  4MJS A;  4IKG A;  5DPW A;  5JHB A;  2MRP A;  2N0S B;  3T3O A;  4G3X B;  1LXD A;  1QQR A;  1B9R A;  3PHW B;  3JYU A;  4GU2 A;  1QT9 A;  5IKC M;  4M00 A;  2W3R A;  1TT5 B;  3IAS 1;  4EZL A;  4GMV A;  2UU7 A;  1WXQ A;  3B2G A;  1FRD A;  2OOB B;  1Q5W B;  5D7G A;  1E0Z A;  1R4N I;  2KFK A;  2NTT A;  4BBN C;  1AWD A;  3PRP B;  3VUX A;  3VTV A;  1E6E B;  1D6E C;  3VDZ A;  1HZ5 A;  1DOI A;  4II2 B;  2PJH A;  1NVI D;  2WXO A;  1SE4 A;  3ZUN A;  4ASW C;  4RGT A;  1Q1O A;  1TTN A;  1WIA A;  2GOW A;  2D3A A;  4RM9 A;  4BKS A;  2MJE A;  1P7F A;  2KO3 A;  2ZJD A;  3WAP A;  1FM0 D;  3MHS D;  2Y5P A;  2NCN A;  2LHD A;  2WU5 B;  1XQQ A;  4NJC A;  1ZW7 A;  1SB3 C;  4YWG G;  3P2B A;  2JT4 B;  3AMZ A;  3LDZ E;  4F7Z A;  3VVW B;  1FIQ A;  1WGH A;  3TCA A;  2Z59 B;  1E8Z A;  3AE5 B;  1XCT L;  5J17 A;  3L4P A;  2AX5 A;  2BGF A;  1GB4 A;  3VTU A;  3RNG C;  3EA6 A;  4S17 A;  2AQ1 B;  3KYD D;  2BQQ A;  4C56 C;  2JRI B;  3L16 A;  4L23 A;  2PPH A;  2J53 A;  1OQR A;  4DWF A;  1WX8 A;  3W1Y A;  4MGY E;  4BKG A;  5LNK 1;  3I63 C;  1JWB D;  3TEX A;  5IO9 A;  1WMH B;  2QSD A;  1V5T A;  3UIO B;  3TUO A;  4A90 A;  4F8C B;  2W3S A;  4NNJ B;  1K8R B;  1XXG A;  1VRA B;  3QAR A;  2CU1 A;  4RM8 A;  2MBO A;  4GDL B;  2ZNV B;  2BBC A;  3U30 A;  3ZRC A;  1I4X A;  3Q3J A;  2Z8L A;  2JU6 X;  1VLB A;  5CHW A;  5J18 A;  3TIX A;  4IWO A;  4HCN B;  3AEF B;  1L6V A;  4KV2 A;  1WM3 A;  1V1P B;  1LGR A;  4HXD A;  4A3O A;  2NVU I;  1WJ4 A;  1QOB A;  3AI5 A;  3ZDT A;  5DPS A;  4G11 A;  1OQQ A;  3ZTD A;  4ZRP A;  3PGE A;  5CHF A;  4M01 A;  2FUG 1;  4XDD A;  2ZZP B;  2KVR A;  3NG0 A;  2J4X A;  3EHV A;  2DHZ A;  4YSX B;  4HWI B;  4PS8 A;  2I38 A;  1T3Q A;  1V1O A;  5G55 A;  3AED B;  2WDT B;  1FMA D;  1T6B X;  1XO3 A;  1TKE A;  1YN4 A;  3DBH I;  2KWD A;  1UBQ A;  1HQR D;  3U4E G;  1C3T A;  1VZ8 A;  1V80 A;  3V60 A;  3RFZ B;  2LXA A;  1PGX A;  4KDI C;  2VZK B;  1DOY A;  4ZOH C;  2QEJ C;  1QZE A;  2W9N A;  5FKA C;  3ECI A;  1FXA A;  4G50 A;  1FNW A;  2I1K A;  4RF0 A;  2ACZ B;  2O6V B;  4P7I A;  1R4N B;  2M17 A;  4C00 A;  1JRO A;  4W9K A;  4A6Q A;  4UDU C;  4GDK B;  2G9H D;  4BAX A;  2E6X A;  2G1E A;  4PS7 A;  4HLE A;  4JWU C;  2SEB D;  4LNK A;  1GC6 A;  1YOV B;  4OHJ A;  1UEL A;  1FO4 A;  2TSS A;  3ZNH B;  2INC C;  4HVB A;  2WU2 B;  2NPT B;  3B9J A;  1AYF A;  4OVV A;  2DYM A;  1HTO A;  4TQ0 A;  2NBU A;  3VXW A;  3BVZ A;  3VFK A;  3RUL A;  4YTM B;  1N5W A;  2MSE D;  1TIF A;  3KUC B;  1WJN A;  1JWA D;  5EDS A;  2PTL A;  1SE2 A;  3K9O B;  1H8C A;  4MH8 A;  4ANX A;  3HUI A;  1OEY J;  4GDL A;  2R2O A;  1E7V A;  1EM7 A;  1RAX A;  2LD9 A;  3L0W B;  3MTN B;  4HJK A;  3CWI A;  3VAW A;  1YIW A;  5L83 A;  3NJT A;  2WXP A;  1L4D B;  3N9Y C;  1QOA A;  3L08 A;  4J3O D;  4KZ0 A;  3H1U A;  1JRU A;  2L00 B;  1WZ3 A;  4C4V B;  1V97 A;  1A70 A;  3K9P B;  4KGS A;  2DZK A;  2O6V A;  2AQ3 B;  3IT4 B;  3JSV A;  4NY0 A;  1D5Z C;  1FRR A;  2BKR B;  3P4R B;  1V86 A;  2RD0 A;  2O2V A;  4GDK A;  2WGS A;  1RFK A;  3CF6 E;  4NJ7 A;  4W9D A;  3HK0 A;  1K50 A;  3WAN A;  2OJR A;  3L13 A;  3ZO5 B;  3PLV A;  5IAA C;  1TZ1 A;  4HRS A;  2LHE A;  4H2A A;  2C60 A;  5L95 C;  2LEK A;  1XLN A;  2FNJ B;  3RNA C;  4HDO A;  4KIK A;  1L0X B;  2EKE C;  1RLF A;  3APC A;  3DWG C;  4PYZ A;  2K9X A;  2KDE B;  5EE9 A;  4N6E B;  4DHJ B;  5IA7 A;  1NEN B;  1ZGU B;  4LDT B;  4HKZ E;  4BBN F;  1U4A A;  3GZN I;  4Q2J A;  3N20 C;  1P9D U;  2MBQ A;  2WWZ A;  3BYT B;  4M02 A;  4MGZ E;  3DOW A;  2UWQ A;  5IOI A;  5JH5 C;  1E9M A;  2BYF A;  3Q6B A;  2N9K A;  2BYT A;  2BS3 B;  1K51 A;  3D32 A;  5D3I B;  4C4V A;  2MX2 A;  3M63 B;  4GGQ A;  4K3C A;  1E10 A;  3DWM A;  1J7B A;  1GAQ B;  2EMS A;  3A1Q B;  1UGJ A;  3ML8 A;  1MG8 A;  3PZ8 A;  3IG3 A;  4LLG M;  2EEL A;  3ABV B;  1DYQ A;  3R2I A;  4WQO B;  1I7H A;  4US9 A;  1TBE A;  3W2D A;  4E74 A;  2ASQ A;  2GB1 A;  2KC1 A;  1JCK B;  2L83 A;  4NAM A;  1R4M I;  3PZD A;  1FXT B;  1UF0 A;  3HVZ A;  4MGK E;  3AE3 B;  4BZA A;  2PLP A;  2KX3 A;  3BZD B;  1L6U A;  2N9X A;  1SE9 A;  4OZB A;  3NRZ A;  3C19 A;  2L52 A;  2C7N B;  2FCQ A;  2MEK A;  3B2F A;  1BT0 A;  4IM0 A;  4DBG A;  3WIM A;  3W9C B;  4MDK E;  5BMH A;  1WFY A;  4I6N B;  2BWE S;  3KW5 B;  2WNM A;  4K7W A;  4WUR A;  1SJH D;  2HTH A;  2WXM A;  3EFU A;  1XCQ L;  2KWC A;  2V3S A;  5EE1 A;  2MQJ A;  3TEW A;  4KSL C;  2X8X X;  1EO6 A;  2G3Q B;  2AYO B;  2V3N A;  3HHM A;  2YLM A;  3ZJU A;  2N9L A;  2AQ2 B;  2DEN B;  1IGC A;  4ARI A;  2KYW A;  4ZRI A;  4XWT A;  1D3Z A;  3H7P B;  1MFW A;  2IBI B;  3R3M A;  4AQ7 A;  1WY8 A;  3B08 A;  1E8X A;  1NEK B;  3W5V B;  1T0S C;  1GNU A;  1T5X D;  3O13 A;  4C7Z A;  2Z0D B;  3I5J C;  3GB1 A;  2YEP B;  2IY0 B;  4FUL A;  3GZN B;  2N9E B;  2BB6 A;  4FHK A;  3Q3F A;  3ZDM C;  2B3A A;  1UZX B;  1VCB A;  3Q14 C;  4US8 A;  2HJ1 A;  4MH0 E;  4EE2 A;  2MLB A;  1CJE A;  1SBB B;  3NY5 A;  2CKH B;  2KKC A;  3ZTC A;  3FKY A;  1MPE A;  2IGG A;  4ANU A;  4YTP B;  1LQB A;  3VRB B;  3BK1 A;  1OGW A;  4KX6 B;  4EZK A;  2MCN B;  4A55 A;  5G5G A;  4TQ1 A;  1ACC A;  4CHK A;  2KDI A;  4W9G A;  4MJS B;  1JAL A;  5T8I A;  2Z0E B;  4WAA A;  3NZS A;  1XLQ A;  1PGA A;  2DBY A;  2GMI C;  5CTR C;  5GMV A;  4C80 A;  2WXJ A;  3AE6 B;  1ROE A;  4A3P A;  4A9A A;  2LRW A;  2PW9 A;  3BVG A;  3M3J A;  1S1Q B;  2LGX A;  1F2R I;  2L32 A;  3NS1 A;  3MC8 A;  2RDH A;  4URK A;  3CIR B;  2D11 A;  2JVC A;  1FXI A;  2REX A;  4IC7 B;  2CHZ A;  4C7Y A;  3O65 B;  4NQK E;  1MHH E;  2L0F A;  3IFW B;  2KTF A;  5IP4 D;  1PFD A;  1C4A A;  4WJO A;  4IG7 B;  1OFF A;  2J0M A;  3SFE B;  3ZXV A;  4FJV B;  1VZ7 A;  1EF5 A;  1TS2 A;  3L54 A;  1IBX A;  2DX5 B;  2RGF A;  2N7J A;  5J2R A;  5BMG A;  2KTR B;  1P0R A;  1MI0 A;  4PYU A;  2W54 A;  5E6O A;  4MSM B;  2KWV B;  2PEA A;  3H7P A;  1E8W A;  3PRM B;  4LNN A;  3R2T A;  1KOT A;  3W5U B;  4KKI A;  1TJE A;  3BVM A;  3X0W A;  4XZ4 A;  4B6W A;  5DPT A;  2MP2 B;  4JLC A;  3FC4 A;  1V8C A;  2FCM A;  3UQB A;  1EWC A;  2KLG A;  2LVO A;  4KKJ A;  2PKO A;  3M62 B;  1M4V A;  1Y56 A;  3DHI C;  4BKT A;  4MT5 A;  3AEC B;  5H8Y E;  2LFI A;  1FEH A;  1KJT A;  4NQL B;  3Q8C A;  3A4S C;  2N4F A;  2XBB C;  1I35 A;  4REZ A;  1QF6 A;  1ZP0 B;  2K8H A;  3PPA A;  3QQ8 B;  2VH1 A;  2KJR A;  4HK2 A;  1ZXH A;  3RZW C;  2FCS A;  3DBL I;  5E6P A;  1MJD A;  2KDB A;  5HFY A;  3KLS X;  2K39 A;  5G5H A;  4TSS A;  5D3D A;  1C78 A;  2KDM A;  3NS8 A;  4WWM A;  1KF6 B;  1KH0 A;  2CHW A;  2CHX A;  1CZP A;  2J7Q B;  3WAO A;  2K5P A;  2M0A A;  3QAQ A;  1WGG A;  1C9F A;  3R66 C;  2WXH A;  4WJP A;  3ENE A;  3ZKJ C;  2LUE A;  3BIN A;  4BFR A;  3C0R B;  1WH3 A;  2WXQ A;  1GG3 A;  2KAC A;  3CSF A;  5C23 A;  3DDC B;  2K25 A;  2V0G A;  1K53 A;  4ZRQ A;  1D5M C;  2L8J A;  2BYE A;  2GLS A;  2MP2 A;  4GSW A;  4M8N A;  4PK1 A;  1N60 A;  3ZRF A;  3N1X C;  3A1Q A;  3OG5 A;  4MAC A;  2G4S A;  1LO5 D;  2QDF A;  1D4B A;  3RT3 B;  2X38 A;  3AUL A;  1HZ6 A;  2LGI A;  2WDR B;  1C79 A;  2I2Y A;  5G2N A;  3DPD A;  3ZNI D;  2BVC A;  2INP E;  4DHJ D;  2D2Q A;  4N9F 4;  3HRD D;  3VTW A;  1JWM D;  1RFA A;  1EF1 A;  4ACF A;  3P63 A;  2JY6 A;  3DVG X;  4W9I A;  2QHO A;  5HG2 A;  4HJG E;  4IM3 A;  2DYB A;  2MJD A;  2L0T A;  2M1M A;  4K7U A;  3UGB B;  2W55 A;  4B9K A;  3EFC A;  2IO3 B;  1B1Z A;  4TMA B;  4DHZ E;  1WXM A;  4W9F A;  4HRO A;  2EMT A;  5KHQ A;  2JPH A;  4BKS D;  3ETR A;  3Q8E A;  4HPP A;  1PQS A;  2EKI A;  3Q3M C;  3ZLZ A;  4IDI A;  4MEL A;  3Q2A C;  2FBW B;  3KWL A;  1ZDX A;  2KWU B;  1JW9 D;  1WRD B;  4AS1 A;  1VR9 A;  2D3G A;  2JSV X;  1GPX A;  4DDG D;  3RUI B;  1OEY A;  1WWT A;  1RYJ A;  4XGA B;  4N59 A;  2KAN A;  4ZDV A;  5TSS A;  2DYO A;  4JPS A;  4XE0 A;  3Q8B A;  2WXR A;  4ZHO A;  3DBL B;  3UQA A;  3WA0 A;  1WMH A;  1FFV A;  1TY0 A;  2KT7 A;  1J0G A;  3KYC D;  4ZHP A;  4QAY A;  3KVF B;  2ONQ A;  3NOB A;  3Q3O C;  2WXK A;  4FBJ B;  1N63 A;  4AUQ C;  3UIN B;  2BWF A;  3ML9 A;  3NZU A;  2N9P C;  2KQ4 X;  2WX0 A;  3TMP B;  1P1A A;  1UUP A;  5FK9 C;  1YX6 B;  3DVN U;  2NMQ A;  4GOC A;  1QLB B;  5DPR A;  5BO4 B;  1YQ4 B;  4DXA B;  3N30 A;  1L0V B;  3ZVV A;  4YSZ B;  3SEB A;  5JXV A;  2V4I B;  4USA A;  2HD5 B;  4B95 A;  1DOX A;  2JZ3 B;  4LNO A;  3RYT A;  4HKQ A;  3QHT A;  4JWS C;  2LJI A;  2I1J A;  3U8Z A;  1NI3 A;  2JWU A;  2C7H A;  2MWS B;  3J9C A;  1EU4 A;  1C76 A;  3VR9 B;  2C5L C;  3V3X A;  4YTN B;  1Z2M A;  4B0E A;  5HI1 A;  4NAW A;  5DCN A;  4KGT A;  1KM7 A;  4EFO A;  3LYY A;  4KSK C;  4M0W B;  2PE9 A;  1UGM A;  5LXI B;  1YX5 B;  2WQY B;  2FIF A;  4CYE A;  4DDI D;  3RNB C;  3FAH A;  2V9H A;  4RCO A;  3N3K B;  3EC8 A;  3HIZ A;  4FHJ A;  3UI3 A;  2KFJ A;  1ISN A;  5AZF A;  2QIL A;  2MBH A;  3AN1 A;  2LI5 A;  1YJJ A;  1F52 A;  4RGM A;  2JRH A;  4W9E A;  4P1B C;  2KMM A;  4P1C C;  3T3N A;  1NI2 A;  1QIL A;  1I4G A;  1YD8 U;  1ZDV A;  1BML C;  1PDX A;  1NDD A;  4E71 A;  2K0P A;  1HEZ E;  5E6N A;  3V62 A;  2KTR A;  1JWU D;  4GXB A;  3VQI A;  2JZZ A;  4JGH B;  3EEC A;  2KQ7 A;  2RMM A;  3DCG A;  3AE8 B;  2FAZ A;  1BXT A;  3V05 A;  3RCZ A;  1KFY B;  2JZP A;  3N1Z C;  1TS3 A;  2JX5 A;  3TJP A;  4YXD B;  2DZJ A;  2KXJ A;  2BYV E;  2XK5 A;  4EOY A;  4WWN A;  2BB5 A;  3GE3 C;  2D10 A;  2V1Y A;  3IAM 1;  3DVN V;  3S2A A;  4W9H A;  2CU3 A;  2RDB C;  1WRI A;  2NS5 A;  3GOE A;  1WF9 A;  4KVG B;  2JYT A;  1F2R C;  2IO1 B;  4LTU A;  4JE3 B;  4KZC A;  2ZEQ A;  4M0W A;  2KHW B;  1KLG D;  3DHH C;  4WJN A;  1TY2 A;  4K1R B;  1WGK A;  1YN3 A;  2DLB A;  4XX5 A;  3OWE B;  3MC0 B;  2WXI A;  4GN1 A;  2GI9 A;  3MFG A;  2HJ8 A;  1JQ4 A;  1ZOY B;  1XD3 B;  2WDQ B;  3PSE B;  1I4R A;  2QCZ A;  4FAD A;  1ZPS A;  1T0Q C;  1VZ6 A;  2L1A A;  3AE2 B;  4DQO C;  1P3Q U;  3PHX B;  4FXC A;  1J7A A;  1HE8 A;  3V6C B;  2KD0 A;  3E56 A;  3WAM A;  1ZE3 D;  4RGO S;  4MEM A;  3P4P B;  5GXG B;  5D94 A;  3BWU D;  3P4Q B;  1A5R A;  2IGH A;  2Q5W D;  3APD A;  2L7R A;  2RDG A;  2JXX A;  1FD6 A;  2KQS A;  2ZCB A;  3RMK C;  4OZC A;  1UH6 A;  3RN9 C;  5FR6 A;  2KJH B;  1ET6 A;  2IO2 B;  1WXV A;  4N58 A;  4MM3 A;  1VDV A;  4DXG A;  2MH7 A;  1UBI A;  1PGB A;  2K22 A;  2RPV A;  1RRB A;  1E5W A;  1DGJ A;  2WXL A;  1MG4 A;  5EE3 A;  1SSN A;  2KDF B;  3QX1 A;  2ZVN A;  1OQY A;  2KLC A;  1XT9 B;  3AEG B;  2IJ0 A;  3QA8 A;  3RPF C;  1T0Y A;  2E3T A;  4WAF A;  2MBE A;  4NJ6 A;  3V6E B;  2RPQ A;  3TSS A;  3LJ3 A;  2D07 B;  3VH3 B;  3V61 A;  1V5O A;  4YSY B;  3VH4 B;  2BS2 B;  1UWM A;  2LGY A;  2AL6 A;  1FFU A;  4XDC A;  2WYQ A;  3TEY A;  3LXF A;  2KN4 A;  3AXC A;  3PTF C;  2NR2 A;  1ESF A;  2PMV A;  1YNT E;  2L05 A;  4RF1 A;  2HE7 A;  2QIE B;  1SF0 A;  1E7U A;  1QOG A;  4B0M A;  3ZNZ B;  3P42 A;  3PO0 A;  3R7Q A;  4XYC A;  1WZ0 A;  3IXS A;  3NVV A;  3UF8 A;  1IUE A;  3L17 A;  1CK1 A;  1TGZ B;  2ZW1 A;  1JML A;  3GP7 A;  2NBV B;  1HTQ A;  4OVU A;  5IN7 A;  1IBX B;  1WYW B;  3MC9 A;  3JW0 X;  1L4Z B;  1L7Y A;  1Q10 A;  2ZW0 A;  4IOI E;  3HM3 A;  4W9L A;  3SDL C;  4LCD E;  2N7D A;  2N1W A;  2M56 B;  2KN5 A;  2LWP A;  4LNI A;  3DVG Y;  4JL9 A;  1WYG A;  3ZJV A;  2ZNV C;  3JVZ X;  1E8Y A;  3QWZ B;  2A4Z A;  2KAJ A;  2DNF A;  2KFK B;  5I4D A;  1WJU A;  4I6L B;  1I4P A;  3DBR I;  4LK0 M;  3I3T B;  2JQR B;  2INN E;  2IGD A;  2DWQ A;  3GS2 A;  3OAW A;  5AUI A;  2WXF A;  4IM2 A;  4ARC A;  3RNF C;  4EUT A;  3R7R A;  3H6N A;  2IND C;  2FUH B;  3PRE A;  2JF5 A;  4P16 A;  4I6P A;  4BOZ B;  2ZVO A;  3VRA B;  1J7C A;  1I4Q A;  1WSP A;  3MJW A;  3H7S A;  2KX0 A;  4DHZ B;  4WIP A;  3PT2 B;  1E90 A;  2GRI A;  4RMA A;  1MHX A;  4FA6 A;  3AEE B;  3E9S A;  3AB5 A;  2YEP F;  1PUT A;  2C9W B;  2QJL A;  5TR5 A;  2NTS A;  4JIO U;  4ANW A;  2LVP A;  1AAR A;  3M95 A;  3NVW A;  2LJ5 A;  1WJ6 A;  2GBR A;  2MHJ A;  3P4S B;  2PIA A;  3DBS A;  2CJN A;  1J19 A;  1GB1 A;  3UIP B;  2BPS A;  1SXT A;  2CJO A;  2OJW A;  2K6Q A;  1X1M A;  3PRZ A;  4BVU C;  3ZW3 A;  3KUZ A;  2CS4 A;  1P98 A;  1XLP A;  1T0R C;  3B0A A;  2QC8 A;  3ZQ4 A;  4NPN A;  3EUB 2;  1WXS A;  3DHG C;  2IO0 B;  3QK0 A;  4K81 A;  3RNE C;  3VUY A;  3JSV B;  2KMA A;  3AM9 A;  2BKF A;  2O2V B;  4ITK A;  3B1L X;  1N61 A;  1Z5S B;  3KUD B;  1TZO A; 
#chains in the Genus database with same CATH homology
 1SE9 A;  4X57 B;  2BWF A;  2XK5 B;  3ML9 A;  2G45 B;  4MJS A;  5CHV C;  3NZU A;  5DPW A;  2N9P C;  4CO7 A;  5JHB A;  2MRP A;  2WX0 A;  3TMP B;  1SGH A;  3RZF A;  2C7N B;  2FCQ A;  1P1A A;  3VUW A;  4G3X B;  1LXD A;  1YX6 B;  3DVN U;  1BT0 A;  3JYU A;  3PHW B;  4GU2 A;  4IM0 A;  4DBG A;  4GOC A;  5DPR A;  3WIM A;  5BO4 B;  4GMV A;  4DXA B;  5KHO A;  3N30 A;  4EZL A;  3H9D A;  3N32 A;  3ZVV A;  2OOB B;  4KIK B;  3QJZ A;  1VD2 A;  4MDK E;  1Q5W B;  1WFY A;  2HD5 B;  4I6N B;  5D7G A;  2BWE S;  3KW5 B;  4B95 A;  1R4N I;  2KFK A;  4K7W A;  2JZ3 B;  3RYT A;  3OJ4 B;  2HTH A;  4BBN C;  2LVQ A;  3PRP B;  4EKU A;  3VUX A;  3QHT A;  1WX9 A;  4TKN A;  3VTV A;  3A9J A;  3EFU A;  4M8M A;  5LXH A;  1V49 A;  3ALB A;  2KWC A;  2V3S A;  3W1S A;  3OLM D;  2I1J A;  2MQJ A;  4KSL C;  3U8Z A;  2R2Q A;  1EO6 A;  2C7H A;  2MWS B;  3VDZ A;  2G3Q B;  4II2 B;  2AYO B;  2PJH A;  2C5L C;  4HCP B;  2JUO A;  3ZUN A;  4ASW C;  1Z2M A;  1Q1O A;  1SIF A;  1TTN A;  1WIA A;  2GOW A;  4NAW A;  4ICV A;  4RM9 A;  3HHM A;  4BKS A;  5DCN A;  2DAF A;  4K7S A;  2YLM A;  3IHP C;  5D2M B;  1KM7 A;  2KO3 A;  2ZJD A;  4ZRJ A;  3WAP A;  4EFO A;  4KSK C;  2DEN B;  3CST A;  4M0W B;  2PE9 A;  1UGM A;  3MHS D;  4ZRI A;  3QC8 B;  5LXI B;  3H7P B;  1YX5 B;  2V4L A;  2NCN A;  4W9J A;  3A4R A;  2FIF A;  4CYE A;  4DDI D;  1IYF A;  1XQQ A;  2IBI B;  1ZW7 A;  2DAJ A;  3N3K B;  3R3M A;  1C1Y B;  3EC8 A;  3P2B A;  1WY8 A;  3B08 A;  3HIZ A;  2JT4 B;  3LDZ E;  4FHJ A;  2G4D B;  1E8X A;  4F7Z A;  2MA9 B;  3VVW B;  2KFJ A;  1WGH A;  1ISN A;  3AU5 A;  1GNU A;  5AZF A;  2MBH A;  3TCA A;  4G0N B;  4TV3 A;  2YVC A;  2LI5 A;  2JRH A;  4W9E A;  2Z59 B;  2IY1 B;  1E8Z A;  1WI0 A;  2Z0D B;  5AZG A;  2M8S A;  5J17 A;  1NI2 A;  3SU8 X;  1CMX B;  2IY0 B;  4FUL A;  4JQW C;  1YD8 U;  2BGF A;  3SHQ A;  3VTU A;  2N9E B;  4FHK A;  3VHT C;  4IW0 A;  4WWP A;  4EEW A;  1NDD A;  3Q3F A;  3ZDM C;  4E71 A;  2B3A A;  1UZX B;  1VCB A;  1NBF C;  3KYD D;  5E6N A;  3V62 A;  2KTR A;  2JRI B;  3L16 A;  4GXB A;  4MH0 E;  2PPH A;  3A9K B;  2JZZ A;  4JGH B;  2MLB A;  1WX8 A;  3EEC A;  4YL8 A;  3NY5 A;  4MGY E;  2CKH B;  2KKC A;  3W1Y A;  2KQ7 A;  4BKG A;  1IP9 A;  3DCG A;  3ZTC A;  2FAZ A;  1WMH B;  4ANU A;  4AJY B;  1V5T A;  3UIO B;  1LQB A;  2IYD B;  4F8C B;  2LZ6 A;  4NNJ B;  3W1S C;  3RCZ A;  2K8C A;  1K8R B;  1OGW A;  3AU4 A;  3QAR A;  3PVL A;  2CU1 A;  4EZK A;  2MCN B;  2RSU A;  4RM8 A;  2MBO A;  4GDL B;  2ZNV B;  3TJP A;  3U30 A;  4TQ1 A;  2DZJ A;  3ZRC A;  2KXJ A;  2KK8 A;  2KJ6 A;  2K6D B;  4CHK A;  2KDI A;  2BYV E;  1L2N A;  3Q3J A;  4W9G A;  2XK5 A;  4MJS B;  5AZH A;  4EOY A;  4WWN A;  5CHW A;  2D10 A;  2Z0E B;  4WAA A;  2V1Y A;  4AJW A;  1V81 A;  3NZS A;  5J18 A;  3DVN V;  3TIX A;  4IWO A;  3S2A A;  4W9H A;  4HCN B;  2NS5 A;  3GOE A;  4EZJ A;  3QIJ A;  4KV2 A;  1WF9 A;  1WM3 A;  2GMI C;  4KVG B;  5CTR C;  3BY4 B;  4HXD A;  5GMV A;  4A3O A;  2IO1 B;  2NVU I;  4KZC A;  1WJ4 A;  2LRW A;  4A3P A;  2ZEQ A;  3M3J A;  3AI5 A;  4KDL B;  1S1Q B;  2KHW B;  2FCN A;  2LGX A;  5DPS A;  3ZDT A;  4G11 A;  4WJN A;  4ZRK A;  4K1R B;  3ZTD A;  4URK A;  3PGE A;  5CHF A;  2LRU A;  4XX5 A;  2MW5 A;  2D11 A;  4GN1 A;  2ZZP B;  2HJ8 A;  4FLH A;  2JVC A;  2KOX A;  2REX A;  3PLU A;  1XD3 B;  2CHZ A;  2FID A;  2KVR A;  3O65 B;  4IC7 B;  4NQK E;  2L0F A;  3PSE B;  3EHV A;  4ANV A;  3IFW B;  4FAD A;  2DHZ A;  2KTF A;  1Y8R C;  4HWI B;  2ZPN A;  4PS8 A;  5G55 A;  5LLI A;  1P3Q U;  4WWO A;  1D3Z A;  1WGD A;  2WDT B;  3PHX B;  4WJO A;  4IG7 B;  2J0M A;  3DBH I;  4FJV B;  1HE8 A;  1UBQ A;  1EF5 A;  3IBE A;  3L54 A;  3RD2 A;  4NAW B;  3V6C B;  1V80 A;  3V60 A;  1C3T A;  2DX5 B;  2KD0 A;  1WR6 E;  2RGF A;  2LXA A;  3WAM A;  4MEM A;  4KDI C;  5J2R A;  2KTR B;  1P0R A;  5D94 A;  4PYU A;  5E6O A;  3A9K A;  4MSM B;  2KWV B;  1QZE A;  2PEA A;  2W9N A;  1E8W A;  3ECI A;  3H7P A;  3HM6 X;  3PRM B;  2PE6 B;  1A5R A;  3APD A;  1KOT A;  2L7R A;  4G50 A;  2K8B A;  2I1K A;  1KLV A;  2JXX A;  4E3C A;  2DZI A;  3X0W A;  4GIV A;  2KQS A;  4XZ4 A;  2ZCB A;  1WM2 A;  2O6V B;  4P7I A;  2BF8 B;  5DPT A;  4B6W A;  1WE7 A;  2MP2 B;  1LFD A;  1UH6 A;  4J6I A;  2M17 A;  4XC2 A;  3PV1 A;  4JLC A;  3QCA A;  4W9K A;  5FR6 A;  2FCM A;  2GBJ A;  2KJH B;  3CMM B;  3UQB A;  2KMC A;  4II3 B;  2KLG A;  4GDK B;  2IO2 B;  2LVO A;  1WXV A;  2LAS A;  4MGI E;  4FN2 A;  2A5U A;  4MM3 A;  2J0K A;  3M62 B;  4PS7 A;  4HLE A;  1UBI A;  1GC6 A;  1UEL A;  4BKT A;  2GBN A;  1OTR B;  3ZNH B;  4HVB A;  1RRB A;  5AEK B;  4NQL B;  1E5W A;  1KJT A;  2NPT B;  4OVV A;  3A4S C;  2DYM A;  2N4F A;  3WAL A;  2XBB C;  1I35 A;  4TQ0 A;  2NBU A;  4HPM B;  3VXW A;  5JHA A;  2KDF B;  2C7M B;  2K8H A;  4TUU A;  3PPA A;  2RR9 A;  1WE6 A;  3VFK A;  3QQ8 B;  3U7D A;  3RUL A;  2KJR A;  3QX1 A;  4HK2 A;  2CR5 A;  2MSE D;  4LJP B;  3RZW C;  2FCS A;  3DBL I;  3KUC B;  1WJN A;  1OQY A;  1LM8 B;  2ZVN A;  5E6P A;  2KLC A;  5EDS A;  1XT9 B;  3QA8 A;  3DQV A;  1T0Y A;  1H4R A;  2J0J A;  2KDB A;  3K9O B;  2MBE A;  1H8C A;  4ANX A;  1OEY J;  4GDL A;  4FJY A;  2K39 A;  2R2O A;  4NJ6 A;  3V6E B;  2RPQ A;  3LJ3 A;  2N7E A;  1YQB A;  4AOF A;  2D07 B;  2WX1 A;  3VH3 B;  3NS8 A;  4HDQ A;  5D6J B;  1WR1 A;  4MSQ B;  1E7V A;  1V5O A;  1WX7 A;  3V61 A;  2CHW A;  3VH4 B;  2CHX A;  2J7Q B;  3PS6 A;  1RAX A;  2LD9 A;  2LGY A;  3L0W B;  3MTN B;  4HJK A;  3ZNG C;  2AL6 A;  3VAW A;  1YIW A;  3WAO A;  2KC2 A;  2WYQ A;  2LXC A;  2GBM A;  2LGD A;  3QAQ A;  4AWJ A;  1WGG A;  5L83 A;  2L76 A;  3R66 C;  1V6E A;  3AXC A;  3PTF C;  2NR2 A;  4WJP A;  3ENE A;  3ZKJ C;  1GC7 A;  2LUE A;  2ZCC A;  3NHE B;  4HPL B;  3BIN A;  2IZV B;  3L08 A;  4BFR A;  2L05 A;  3C0R B;  1JRU A;  1WH3 A;  2NBW B;  3H1U A;  1GG3 A;  2L00 B;  1WZ3 A;  4KZ0 A;  2HE7 A;  2GBK A;  2K1F A;  1E7U A;  3CSF A;  3DDC B;  5C23 A;  2K25 A;  3X23 A;  3K9P B;  4FJZ A;  3ZNZ B;  2AWT A;  3R7Q A;  2DZK A;  2O6V A;  2L8J A;  2BYE A;  3JSV A;  1Q0W B;  1WZ0 A;  4NY0 A;  2BKR B;  2MP2 A;  4GSW A;  1I42 A;  3UF8 A;  1V86 A;  2RD0 A;  3TL5 A;  2O2V A;  3L17 A;  4M8N A;  1G6J A;  4LJO B;  1TGZ B;  4GDK A;  3CF6 E;  4NJ7 A;  4W9D A;  3HK0 A;  3ZRF A;  4A20 A;  2NBV B;  4OVU A;  3A1Q A;  3WAN A;  2G4S A;  1WYW B;  2OJR A;  3L13 A;  4AP4 C;  3JW0 X;  1L7Y A;  2N1V A;  3RT3 B;  3PLV A;  3ZO5 B;  5IAA C;  3KH0 A;  1TZ1 A;  3HM3 A;  2NPT A;  2C60 A;  2DZM A;  3AUL A;  4W9L A;  5L95 C;  3SDL C;  2XEW A;  4LCD E;  2N7D A;  2N1W A;  4ZYN A;  2KN5 A;  2LWP A;  3ZIM A;  3DVG Y;  4JL9 A;  2FNJ B;  3DPD A;  5G2N A;  1GJZ A;  2ZNV C;  2JWZ A;  3JVZ X;  4HDO A;  4KIK A;  3ZNI D;  2EKE C;  1RLF A;  3APC A;  4DHJ D;  1F9J A;  1E8Y A;  2O6V D;  3QWZ B;  1IPG A;  2A4Z A;  2D2Q A;  4N9F 4;  2KFK B;  4PYZ A;  3VTW A;  2KDE B;  4WJQ A;  3TBL D;  1RFA A;  1EF1 A;  1WJU A;  4I6L B;  4DHJ B;  5IA7 A;  3DBR I;  1ZGU B;  4LDT B;  2AEH A;  3I3T B;  4BOS C;  2JY6 A;  3A9J B;  3DVG X;  3OAW A;  4W9I A;  4BBN F;  2QHO A;  4IM2 A;  1U4A A;  3GZN I;  4IM3 A;  2DYB A;  2L0T A;  4EUT A;  2M1M A;  4IWP A;  4K7U A;  4ICU A;  3UGB B;  3R7R A;  3H6N A;  1M94 A;  1P9D U;  1WGR A;  4B9K A;  2FUH B;  2IO3 B;  4DHZ E;  2MBQ A;  2VRR B;  1WXM A;  2AL3 A;  2WWZ A;  3PRE A;  4W9F A;  2JF5 A;  2EMT A;  5KHQ A;  2JPH A;  4BKS D;  1YJ1 A;  4I6P A;  4BOZ B;  2ZVO A;  2M4N A;  1PQS A;  4MGZ E;  3T9L A;  4DWF A;  3DOW A;  2MBB B;  2UWQ A;  3MJW A;  2ZPY A;  2L3Z A;  4IUM B;  5HKH A;  3H7S A;  5JH5 C;  2KX0 A;  3ZLZ A;  4DHZ B;  3PT2 B;  1E90 A;  2BYF A;  4RMA A;  4MEL A;  4FA6 A;  3D32 A;  5CX3 A;  2M0X A;  2MX2 A;  5JZE B;  2KWU B;  3L10 B;  3A33 B;  4GB9 A;  2C9W B;  1GUA B;  2KZR A;  3M63 B;  5TR5 A;  4ANW A;  4JIO U;  3IVF A;  2LVP A;  3VQI A;  1WRD B;  1AAR A;  4GGQ A;  2D3G A;  1WXA A;  3M95 A;  4DDG D;  2LJ5 A;  3RUI B;  1WJ6 A;  1V9J A;  3T8M A;  2GBR A;  4W9C A;  2EMS A;  3ONS A;  1J8C A;  1OEY A;  3DBS A;  4F1S A;  3A1Q B;  1V2Y A;  3ML8 A;  1MG8 A;  1J19 A;  4PS3 A;  2KAN A;  3UIP B;  1EUV B;  3IG3 A;  4DK5 A;  4ZDV A;  2BPS A;  2DYO A;  2KNB A;  2K6Q A;  1X1M A;  4WQO B;  3UQA A;  3PRZ A;  4BVU C;  3WA0 A;  1WMH A;  3ZW3 A;  3KUZ A;  1TBE A;  2CS4 A;  3OJ3 A;  1P98 A;  4E74 A;  3B0A A;  2ASQ A;  2UYZ B;  2KC1 A;  3APF A;  4NPN A;  1J0G A;  4IWQ A;  1R4M I;  1WXS A;  3PZD A;  2IO0 B;  3QK0 A;  1ZKH A;  4K81 A;  3VUY A;  3JSV B;  1WGY A;  1FXT B;  3KYC D;  4MGK E;  2KMA A;  3KVF B;  2Y5B B;  3NOB A;  4LDT D;  5C1Z A;  2BKF A;  2O2V B;  4FBJ B;  2KX3 A;  3B1L X;  1Z5S B;  3SD5 A;  3KUD B;  1S3S G;  2N9X A;  3UIN B;  4AUQ C;  1UD7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...