2KUCA

Solution structure of a putative disulphide-isomerase from bacteroides thetaiotaomicron
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
121
structure length
121
Chain Sequence
b'AQADGIAFRELSFPEALKRAEVEDKLLFVDCFTTWCGPCKRLSKVVFKDSLVADYFNRHFVNLKMDMEKGEGVELRKKYGVHAYPTLLFINSSGEVVYRLVGAEDAPELLKKVKLGVESEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative disulphide-isomerase
publication title Solution Structure of a putative disulphide-isomerase from Bacteroides thetaiotaomicron
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase
total genus 34
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2kucA00
5EL8A 3W6GA 3ERGA 3LYKA 2V6KA 2IMDA 5HQPA 3PINA 2LUSA 1VF3A 5JWOB 4LA1A 3UAPA 4K6XA 5A5KA 4P3YB 4TXOB 5IIZA 1IYIA 2YWMA 2FY6A 4KSMA 2VCVA 3KZQA 4KNDA 5CRDA 2H72A 1YY7A 2R3XA 4J2FA 3CXGA 5DCGA 4KA0A 3CRUA 3CSIA 2B7JA 3GHAA 3TDGA 3VI5A 3UEMA 3HDCA 4GSSA 1K0NA 2LSTA 2YZHA 4E8EA 1M7TA 4EDZA 1SL2B 2YOIA 2RUFA 1SL0B 4O5RA 1YEXA 4MZCA 1A23A 1PX6A 1S3DA 1LJRA 4G9HA 4NWYA 4RUVA 1G7OA 1GWCA 5HR1A 3CTGA 3LSZA 2IFQB 4Q5NA 19GSA 1GLQA 3TRXA 2H0IA 5D9XA 1TRSA 3KXOA 3ED3A 3LXZA 1PN9A 4TRXA 4GWRA 2GS3A 2DIYA 4EUYA 3VK9A 5ABRA 1O8XA 1N8JA 2OE0A 1V98A 2JZSA 1GSSA 2GVPA 2YP6A 2O87A 2XPEA 1TRVA 1X9SB 3GX0A 5D9TA 1WP0A 3CSHA 2B5YA 1LBKA 4ZL7A 3UBLA 2YWOA 1O7UA 4TR4A 3RHCA 2BMXA 1MD4A 1OYJA 2GSTA 2N5BA 4K0NA 1VF1A 4TR3A 4QL7A 4XTSA 2VM2A 5DDLA 1Q4JA 2F9SA 4LMVA 4F0BA 4F9ZA 2H30A 2ON7A 1M0UA 3L9UA 1GSFA 4ZBDA 5IMVA 1XCCA 4LMWA 2C3QA 1DUGA 2L4QA 5IMDA 1N2AA 3HA9A 6GSTA 1LU4A 3UL3A 5IO2A 3VFIA 1I5GA 1YEPA 4FYUA 3TB2A 2X99A 1TI3A 5ECLB 3GTUB 4Q5FA 4PQIA 2XBQA 3EYTA 5KN1A 3UJ1A 3C7MA 4HU9A 5FT3A 3ZFLA 2QC7A 2GSSA 2GQLA 5EY6A 4KUNA 1WJKA 4K2DA 1V57A 1OKDA 4TOPA 1BJXA 2C3TA 4DSRA 2H8LA 1MEKA 5DAKB 5D96A 4IKHA 1XW9A 5DALB 2M80A 3GFKA 1Z6MA 4KE3A 4EDYA 5CRHA 4MF7A 2VL9A 2PWJA 4GQCA 2CVKA 1HQOA 5FWGA 9GSSA 2FHEA 11GSA 3ZIVA 2LRCA 4IVFA 4OMVA 2WCIA 3CRTA 2IN3A 2DJ1A 3IE3A 3PGTA 2PUKC 3LEFA 1FB6A 4L0UA 3UIWA 4MPGA 1K0BA 1RQMA 1GSQA 2H1BA 3TRQA 3HXSA 1QUWA 2N5FA 2C80A 5ELGA 2VLUA 3TUEA 4ID0A 3VWWA 3IR4A 3QFAC 5HR3A 1ML6A 1TDIA 4ML6A 3ZITA 1K0DA 1YKCA 1V40A 3F4TA 4IS0A 2GSRA 3ERWA 4N10A 3KTLA 2B7KA 2C0DA 3O6TA 3WT1A 5GAND 2YWNA 2MYGA 2P31A 1AQXA 4HOJA 2GZZA 3HVXA 5KN0A 5AIVA 4GSTA 3W8JA 2F3MA 1TTZA 3LYPA 3H4KA 3ZVJD 3FEUA 4TXOA 1J08A 2MBTA 4MA9A 3QR6A 5G2ZA 4MPFA 1CQHA 2ON5A 1QXHA 5ECKB 3TJBA 3RDWA 3IAM2 1THXA 1R5AA 3I6AA 5GSTA 2XHFA 1FW1A 1WRYA 2CT6A 4FIWA 4JU5A 3IOSA 4KW6A 3Q6OA 4HEA2 1BAYA 3KTBA 3P7XA 4IJIA 3S9FA 3H1NA 2PPTA 5G5FA 4N0ZA 3EMXA 2IWTA 2GTUA 1Y25A 2GQMA 5ECMB 5JCWA 2QGVA 1SKSB 1GNEA 3UARA 1ERUA 2H01A 3ME7A 2PVOC 2WB9A 4EC0A 2VD0A 4AF2A 1SENA 1Z5YE 5HFIA 3C73A 5D8IA 4POBA 2YANA 3Q18A 4G19A 2OE1A 1JHBA 1ZYEA 5DQSA 4Q5QA 2AB6A 4OO4A 5IMAA 2YNXA 4MP4A 4E8HA 4HJ2A 5D93A 4CDOA 4O7HA 2R6KA 2AV4A 1HNBA 3A2XA 4JR4A 1TRWA 3DD3A 5G1KA 2GDRA 3L0HA 3KH9A 2ZUPA 4I6XA 1NSWA 3TOUA 3DWVA 4EKZA 3I69A 1ZGNA 2X8CA 1BG5A 1K3OA 3QD9A 2WS2A 4WBJA 1OC9A 3N9JA 2FCHA 1AUCA 5J3RA 4EVMA 3KH7A 2GT6A 5F0GA 5IO0A 4KDUA 3A5WA 1UVZA 5CRGA 3KMOA 2L5OA 3MWHA 2N5AA 4KDYA 3GKKA 4MLYA 1VRSD 5H5SA 5DVBA 2JSYA 4OCFA 4KAEA 3IRAA 2H6XA 1ZCPA 3WYWA 3APQA 22GSA 1TW9A 3D4TA 2R37A 4ZIJA 20GSA 1TOFA 2H1AA 3GV1A 4WBRD 3GX8A 3DEXA 1ZMAA 4RQXA 3WGXA 4HS1A 1VF4A 4DEJA 4AJ6A 1MD3A 1AXDA 5IOWA 2WDUA 3EMPA 3HY2A 3EU4A 3SWLA 1WOUA 1IYHA 5C04A 4HUAA 2HZEB 1MDJA 3FHKA 3HZ4A 1R26A 2EIQA 3GN3A 3UVTA 1AIUA 3F0IA 3HVSA 1QGVA 5G1LA 4XRDA 3WGDA 2VOCA 2H0HA 3BBYA 2C0GA 3HD5A 1WE0A 4XS1A 3KJYA 3F6FA 3GRXA 4ISDA 4PX1A 4JEDA 1JZRA 1JZDA 1TK0B 3D5JA 3ME8A 4FH8A 4XRAA 4HU7A 2KP2A 4TVEA 2JZTA 3H79A 1TU8A 2OADA 3ZREA 5CNWA 2GQKA 4ULXA 1YQ1A 4MJCA 3EINA 1U3IA 1XVQA 5HR2A 2LRNA 1GUKA 4TW5A 4ECCA 4KDXA 5ENUA 3HJOA 2L4CA 2OKAA 4YH2A 4G10A 3VPTA 2AUVA 4MH3A 3FZ5A 4N0VA 5IPGA 5DJLA 3LGCA 3GURA 1M99A 2HI7A 5A4VA 3U5RE 3ISOA 1AW9A 1XBSA 3LQ7A 1OVNA 4BPYA 4QL9A 3ZFBA 3IK7A 2HE3A 2PERA 4IGJA 4NHWA 5A4UA 3L78A 1JLVA 2DJ3A 3UOMA 2OE3A 5DCHA 1SL1B 1PMTA 3IV4A 4IBPA 4PQHA 5JCGA 3US3A 1A8LA 4V2MA 5H5QA 4ML1A 3F4RA 2VO4A 4WR4A 3PR8A 4L5OA 2DJKA 1XXUA 3KP9A 2HXKA 1GTBA 4OFTA 1U87A 2A4VA 2XBIA 3E3EA 3WD6A 1DE1A 1OKTA 4XS4A 3D21A 4TR1B 5IOXA 3CSJA 2H0GA 2H19A 2HRNA 1YDKA 2IL3A 3I43A 3ZLPA 1A8YA 1PRXA 2HZFA 2GSQA 2R5GA 4Q5RA 1GH2A 3GA4A 2B3SA 4NHZA 3G7YA 1TI1A 2L59A 2YWIA 4G2EA 1XZOA 1PQNA 4NXIA 1TKDB 1GULA 1WIKA 4L8EA 4NAXA 4JBBA 2VCWA 2RM6A 3N5OA 1FHEA 2MBSA 2EIOA 3M1GA 1T8EB 5B6NA 1JLWA 2XPDA 3QAVA 4DSSA 1WWJA 1B9XC 4NV2A 2YJ7A 1EZKA 2I1UA 3GH9A 1GSUA 4BL7A 5G30A 3LFLA 1GSYA 3GKNA 3LG6A 1DBYA 1SK0A 1X5EA 3TJGA 5IMZA 3BJ5A 3IPZA 2G0FA 4F2IA 1ERTA 2C0EA 4IJ3A 3HZ8A 3GH6A 1V2AA 1GRXA 4EL1A 3MSZA 4ZB8A 2LJKA 2C8UA 3D22A 3ZRDA 2ZCTA 4H86A 2O85A 4TXVA 4PXOA 5IMCA 2NBSA 5AN1A 3P90A 3I9V2 2HT9A 1I9DA 7GSSA 4TN8A 2JZRA 4GSNA 2O8VB 4OFNA 1B4PA 1OC3A 3KCMA 3HJMA 4V1Ag 1YF1A 3ZMKA 1Z7RA 2VIMA 2YN1A 1VF2A 1MTCA 4MCUA 4YQVA 2AHEA 1TXXA 2RLIA 4L5LA 5E59A 4GQFA 3APOA 2KUCA 3UBKA 1U6TA 1F3AA 4HDEA 5IMFA 2DLXA 3EVIA 4RI7A 1S3AA 5ID2A 1JZWA 5G31A 5J4UA 3ZYWA 2M46A 3HKRA 1PKZA 4KH7A 2VL2A 1T4YA 3W8SA 5ECHB 1X0RA 1U3AA 2DMLA 1G6YA 2I9HA 4OO5A 3BOAA 1CQGA 4X1UA 4O92A 1Q98A 2VLTA 5CO3A 5G5EA 2LKUA 3WGEA 1EEMA 3UMAA 3E9JB 5GAPD 2M72A 1GSEA 2DJJA 1OE8A 4ACSA 1W89A 2J9HA 4KSOA 1ST9A 2A2SA 2H74A 3L4NA 1ILOA 5ECSA 3TKPA 1SD9A 4NMUA 1O85A 4GRFA 2DJ2A 5AGYA 5HFGA 4I97A 2AAWA 3LJRA 2PVQA 4POLA 4XS6A 2O7KA 3M8NA 3HCZA 3DXBA 1MDKA 1UA5A 4MABA 1UC7A 4WXTA 3VPQA 1B9YC 1JFUA 4LL1B 1Z3EA 1WMJA 4L0WA 1UN2A 1R7HA 4MF6A 1Z7PA 4I2UA 3F8UA 4DSQA 1EWXA 3MNGA 5GZZB 1YKAA 2WJUA 3QMXA 4YAVA 2CX3A 2MZCA 4MMMA 1M2BA 1GUMA 2LQOA 4QQ7A 2XC2A 3BCIA 1VGLA 4JZQA 4PNFA 2B6MA 2REMA 2IFQA 3DYRA 3D0ZA 1X9MB 3G7JA 2J23A 4IN0A 5COHA 2B5EA 3GKXA 3P2AA 4F0CA 1GP1A 5F06A 5J9BA 1TK5B 2JADA 2YPMA 1M9AA 5D9VA 2V6OA 3QAGA 1KBNA 2LNTA 3KD0A 4LLRA 4KB3A 4D73B 2VCZA 1X9WB 1XIYA 1PGTA 3C1RA 3C8EA 3RBTA 4POMA 3F4SA 2PBJA 2I81A 3GUSA 5ECPB 5DBQA 1TRUA 2MMZA 2VUPA 4X0XA 2EC4A 5CP1A 4CW9A 2IIYA 5B6MA 1M2AA 1PL2A 1Y6EA 6GSXA 5EVOA 4POKA 2VL3A 3MAKA 2VM1A 2LNSA 3IBHA 3A2VA 2WFCA 2LV3A 2DIZA 2VCTA 2ZNMA 5ECOB 1K0OA 4GTUA 3L9SA 2GZPA 4OFMA 5AIXA 2CAQA 1O81A 3C1SA 1URMA 3H93A 4MJBA 3GTUA 2IMIA 3AY8A 4YQUA 2FLSA 4NPBA 5F05A 3KIJA 4ECIA 5KN2A 4ZB9A 3VWXA 2V1MA 2B1LA 3Q19A 2HFDA 3VWVA 5J41A 3RHBA 3GSSA 4XHMA 3TRPA 3NOFA 1AQVA 3DIEA 4ZBAA 4K7OA 1XWBA 1T3BA 2H1DA 3C71A 4X43A 3NIVA 3H8QA 4Z7XA 1PA3A 4WF5A 4AGSA 5DAKA 3M3MA 1ERWA 2NTOA 5DALA 4IW9A 1B4QA 2MMAA 1ABAA 2HYXA 3M0FA 4J57E 3KP8A 1R5PA 1T7PB 4PGTA 1FAAA 2YCDA 2LS5A 4OWYA 4IQ1A 3CBUA 2IMFA 13GSA 4GCIA 3D4MA 4JR6A 2X8HA 2E7PA 2DBCA 2QSIA 2E0QA 4HI7A 2RUEA 4K9ZA 4HZ4A 5B8AA 4J56E 2CZ3A 2H6YA 2OACA 4OD7A 2GGTA 1TJDA 6GSVA 5GSSA 1WPIA 3KGKA 2CZ2A 4PUFC 3F3QA 3EURA 3A3TA 5KEJA 4EE0A 2WULA 2JL4A 2L6CA 2CVDA 4F82A 4IP6A 4PQ1A 4IHUA 17GSA 1OAZA 4EXJA 5B7CA 2P5RA 3TGZA 2LEGA 4K0GA 5CYYA 3FR3A 2JSZA 1XOAA 4JRRA 2FWGA 2R2JA 4ECJA 3IC4A 1T00A 2CA8A 2OBKA 1K0AA 1XW5A 4IELA 4V1Ap 1BEDA 4N30A 3QAWA 1EV9A 2VLVA 8GSSA 2VD1A 1KTEA 3DGQA 2FUG2 1U88A 1FVKA 1Z6NA 1DSBA 1HYUA 4WKWA 4BA7A 3VWUA 1SK2A 2DSAA 18GSA 3FW2A 4BWSA 1SU9A 4PNGA 1USBA 14GSA 2YV9A 4NV5A 5C00A 4PUAA 2F8FA 2CV4A 4MJEA 5H5RA 3IK9A 1F37A 2HSHA 2E2MA 1XFLA 4WF4A 3F63A 2GZYA 1MDIA 5JCUA 2L5LA 5HR0A 2VL2C 5D9WA 3LWAA 1GSDA 4KCEA 1EOGA 1QK8A 4K7IA 4ZL9A 1BX9A 4D73A 5AISA 4FYBA 1THOA 1SKRB 3SBCA 1V9WA 4JE1A 5INYA 1SJ6A 1C72A 5A4WA 5J5NA 1YZXA 1HNCA 4XIHA 2FNOA 3HJPA 2CVBA 4MDCA 3WT2A 3ZZXA 1TK8B 5ECIB 4K7NA 2CAIA 1PX7A 3M9KA 1E6BA 2FA4A 2O89A 1NHYA 3TKSE 1XWCA 1QFNA 1TP9A 1ZYQB 5DQYA 3IA1A 1SJZA 2HLSA 1A0FA 4ZXGA 3F6DA 2X64A 1AQWA 1FG4A 5CAXA 3MDKA 2X8GA 2AJQB 3ERFA 2TRXA 1EP7A 2K8VA 1S3CA 5CREA 4IP1A 4N11A 2GT5A 1K0MA 4K1FA 2FA8A 4KGIA 3L9VA 2JACA 2YJHA 4MZWA 1FVJA 4ZBBA 1ON4A 1KEBA 5HFKA 4MK3A 5LNKe 3P8WA 1Z9HA 1OC9B 1AC1A 4MF5A 2RM5A 5ECQB 3TKQA 3EE2A 3TKSA 3O3TA 5IPHA 2GLRA 2K8SA 1NM3A 5LD0A 1EGRA 3IXRA 4ILFA 1GTIA 2D2ZA 4K8MA 2B1KA 2HNLA 2CX4A 3CTFA 3D6IA 2IPAA 3QCPA 2HZEA 1HD2A 3FZ9A 6GSYA 2IMEA 4RQRA 3ZTLA 1SYRA 3EC3A 1YJ6A 4LL4B 5F8BA 3DVWA 1XVWA 3M9JA 2OBIA 16GSA 4I8BA 4V2LA 5LCZA 2VCXA 3EU3A 3QPMA 1J0FA 1GTUA 2KLXA 4WEYA 1A24A 1XWGA 3KM6A 5F07A 1EP8A 4O32A 3FKFA 2YV7A 2HRFA 4KCAA 4ZL8A 2BTOT 1K0CA 1SK1A 2PGTA 3ZL5A 3HYPA 1RK4A 1FOVA 1GTAA 4WETA 2NDOA 2C3NA 3HVVA 5KN3A 3FR6A 4GLTA 2OJLA 3TOTA 1XWKA 1G0TA 3DRNA 5FHIA 2LJRA 1XW6A 1B8XA 2WRTA 4XCSA 2L6DA 3ZIJA 3FZAA 1KNGA 3TKRA 4MJAA 1K3LA 6GSWA 1SKWB 4KX4A 3ZMLA 3LORA 3JCML 4EF0A 2KHPA 1GL8A 5E4WA 3TJJA 3FYGA 4OCEA 2H6ZA 1FO5A 1G7EA 1NW2A 1TU7A 2ES7A 3FR9A 3A2WA 2YZUA 2MMNA 3F3RA 3UVHA 2H73A 5ECRB 2H66A 4CHSA 2TIRA 2G2QA 2LQQA 3HHVA 4ZILA 2V41A 3QDNA 2LTKA 2FWEA 6GSSA 1F9MA 3CYNA 3E0UA 1QQ2A 2FWFA 2NVLA 1ZOFA 1F3BA 1GNWA 1V58A 1F6MC 4ECBA 4I5QA 4GF0A 3BCKA 1XWAA 1YF0A 3ZVJA 4HQSA 3O76A 5L71A 1SJIA 1M9BA 1EOHA 5B8BA 5IQYA 2P5QA 4TR1A 3FY7A 2K6VA 1K3YA 2LRTA 2C0FA 3QFBC 1E2YA 2H1GA 3CMIA 1OC8A 4HJMA 2I3YA 1SYXA 1F2EA 1O8WA 3IDVA 3U6VA 2NPBA 2B5XA 1DE2A 4YAPA 2JU5A 2V32A 2Z9SA 2DJ0A 1H4OA 1H75A 4AJ8A 2H76A 4BVYA 3GKMA 2VAFA 4F03A 3J7Yk 1M2DA 1AAZA 3EWLA 3K8NA 1ZZYA 2H71A 3GYKA 4XS4B 1ACVA 3DMLA 4BVXA 4MH2A 3GNJA 1J9BA 2PU9C 4HZ2A 1A2JA 5JWQB 1ERVA 1EGOA 4PURA 6GSUA 2KP1A 1G6WA 3FRCA 5D73A 1NHOA 4GXZA 5ELAA 2P0GA 1GLPA 1X5DA 3LXTA 1XPVA 2CQ9A 2QKEA 4AJ7A 2TRCP 12GSA 5DJMA 1PL1A 3KMNA 1EV4A 3TJFA 3IAS2 2KOKA 4IQAA 2C4JA 1QMVA 4DSSB 4MZBA 1OE7A 3RAZA 2MMOA 3RPNA 4WR5A 1PD21 1HNAA 2H75A 1X5CA 3FZ4A 3PH9A 4FO5A 2DMMA 5ECNB 5IM9A 3OR5A 4V2NA 1B48A 1FB0A 5JWRB 2R4VA 2HSYA 2WGRA 3TJKA 1PKWA 3QOUA 1BQ7A 3GL5A 2BJXA 2C1YA 1A2LA 2FGXA 4ZB6A 2K18A 1PSQA 2RIIA 2V2GA 2EIRA 1A0RP 1O73A 2ALBA 2FD3A 2PMTA 3DVXA 3APSA 3IHQA 4EO3A 1EEJA 1ZL9A 2PN8A 3VI7A 2FWHA 4I2TA 2L57A 1SD8A 1XOBA 5J9CA 3G9BA 3J7Yb 2IJYA 2AYTA 4TKYA 3R2QA 2K9FA 4YQMA 4TR0A 5ID2B 3GMFA 10GSA 2IMKA 1BYEA 2A2RA 3NZNA 3FK8A 3Q74A 3GL3A 2I4AA 2VCQA 3V1WA 4FYCA 2F51A 3VLNA 2LJAA 3GSTA 1W4VA 1T4ZA 2F8AA 4DVCA 4HQZA 1JZOA 4BWQA 3G7IA 3RPPA 1GUHA 1RW1A 3TCOA 3BD2A 2OA7A 5CRWA 2WZ9A 3TKSC 3GIXA 2E2GA 2H70A 3F9UA 1O6JA 1R4WA 5EPFA 3KEBA 1T1VA 1A2MA 3DKSA 4RI6A 3VURA 2DC5A
chains in the Genus database with same CATH superfamily
5EL8A 3W6GA 3ERGA 3LYKA 2V6KA 2IMDA 5HQPA 3PINA 2QA1A 2LUSA 1VF3A 5JWOB 4LA1A 3UAPA 4K6XA 5A5KA 4P3YB 4TXOB 5IIZA 1IYIA 2YWMA 2FY6A 4KSMA 2VCVA 3KZQA 4KNDA 5CRDA 2H72A 1YY7A 2R3XA 1PFOA 4J2FA 4EIPA 3CXGA 3FMWA 5DCGA 4KA0A 3CRUA 3CSIA 2B7JA 3GHAA 3TDGA 3VI5A 3UEMA 3HDCA 4GSSA 1K0NA 2LSTA 2YZHA 4E8EA 1M7TA 4EDZA 1SL2B 2YOIA 2RUFA 1SL0B 4O5RA 1YEXA 4MZCA 1A23A 1PX6A 1S3DA 1LJRA 4G9HA 4NWYA 4RUVA 1G7OA 1GWCA 4HSCX 5HR1A 3CTGA 3LSZA 2IFQB 4Q5NA 19GSA 1GLQA 3TRXA 2H0IA 5D9XA 1TRSA 3KXOA 3ED3A 3LXZA 1PN9A 4TRXA 4GWRA 5KOWA 2GS3A 2DIYA 4EUYA 3VK9A 5ABRA 1O8XA 1N8JA 2OE0A 1V98A 2JZSA 1GSSA 5KOXA 2GVPA 2YP6A 2O87A 2XPEA 2X4AA 1TRVA 1X9SB 3GX0A 5D9TA 1WP0A 3CSHA 2B5YA 1LBKA 3CQFA 4ZL7A 3UBLA 2YWOA 1O7UA 4TR4A 3RHCA 2BMXA 1MD4A 1OYJA 4A5PA 2GSTA 2N5BA 4K0NA 1VF1A 4TR3A 4QL7A 4XTSA 2VM2A 5DDLA 1Q4JA 2F9SA 4LMVA 4F0BA 4F9ZA 2H30A 2ON7A 1M0UA 3L9UA 1GSFA 4ZBDA 5IMVA 1XCCA 4LMWA 2C3QA 1DUGA 2L4QA 5IMDA 1N2AA 3HA9A 6GSTA 1LU4A 3UL3A 5IO2A 3VFIA 1I5GA 1YEPA 4FYUA 3TB2A 2X99A 1TI3A 5ECLB 4EIQA 3GTUB 4Q5FA 4PQIA 2XBQA 3EYTA 5KN1A 3UJ1A 3C7MA 4HU9A 5FT3A 3ZFLA 2QC7A 2GSSA 2GQLA 5EY6A 2A2PA 4KUNA 1WJKA 4K2DA 1V57A 1M3JA 1OKDA 4TOPA 1BJXA 2C3TA 4Z2TA 4DSRA 2H8LA 1MEKA 5DAKB 5D96A 4IKHA 1XW9A 5DALB 2M80A 3GFKA 1Z6MA 4KE3A 4EDYA 5CRHA 4MF7A 2VL9A 2PWJA 4GQCA 2CVKA 1HQOA 5FWGA 9GSSA 2FHEA 11GSA 3ZIVA 3MIXA 2LRCA 4IVFA 4OMVA 2WCIA 3CRTA 2IN3A 2DJ1A 3IE3A 3PGTA 2PUKC 3LEFA 1FB6A 4L0UA 3UIWA 3IHGA 4MPGA 1K0BA 1RQMA 1GSQA 2H1BA 3TRQA 3HXSA 1QUWA 2N5FA 2C80A 5ELGA 2VLUA 3TUEA 4ID0A 3VWWA 3IR4A 3QFAC 5HR3A 1ML6A 1TDIA 4ML6A 3ZITA 1K0DA 1YKCA 1V40A 3F4TA 4IS0A 2GSRA 3ERWA 4N10A 3KTLA 2B7KA 2C0DA 3O6TA 3WT1A 5GAND 2YWNA 2MYGA 2P31A 1AQXA 4HOJA 2GZZA 3HVXA 5KN0A 1XG8A 5AIVA 4GSTA 3W8JA 2F3MA 1TTZA 3LYPA 3H4KA 3ZVJD 4CY6A 3FEUA 4TXOA 1J08A 2MBTA 4MA9A 3QR6A 5G2ZA 4MPFA 1CQHA 2ON5A 1QXHA 5ECKB 3TJBA 3RDWA 3IAM2 1THXA 1R5AA 3I6AA 5GSTA 2XHFA 1FW1A 1WRYA 2CT6A 4FIWA 4JU5A 3IOSA 2DKIA 4KW6A 4YKGA 3Q6OA 4HEA2 1BAYA 3KTBA 3P7XA 4IJIA 3S9FA 3H1NA 2PPTA 1S3RA 4CY8A 5G5FA 4N0ZA 3EMXA 2IWTA 2GTUA 1Y25A 2GQMA 5ECMB 5JCWA 2QGVA 1SKSB 1GNEA 3UARA 1ERUA 2H01A 3ME7A 2PVOC 2WB9A 4EC0A 2VD0A 4AF2A 1SENA 1Z5YE 5HFIA 3C73A 5D8IA 4POBA 2YANA 3Q18A 4G19A 2OE1A 1JHBA 1ZYEA 5DQSA 4Q5QA 2AB6A 4OO4A 5IMAA 2YNXA 4MP4A 4E8HA 4HJ2A 5D93A 4CDOA 4O7HA 2R6KA 2HRAA 2AV4A 1HNBA 3A2XA 4JR4A 1TRWA 3MYDA 3DD3A 5G1KA 2GDRA 3L0HA 3KH9A 2ZUPA 4I6XA 1NSWA 3TOUA 3A5IA 3DWVA 4EKZA 3I69A 1ZGNA 2X8CA 1BG5A 1K3OA 3QD9A 2WS2A 4WBJA 1OC9A 3IC8A 3N9JA 2FCHA 1AUCA 5J3RA 4EVMA 3KH7A 2GT6A 5F0GA 5IO0A 4KDUA 3A5WA 1UVZA 5CRGA 3KMOA 2L5OA 3MWHA 2N5AA 4KDYA 3GKKA 4MLYA 1VRSD 5H5SA 5DVBA 2JSYA 4MNNA 4OCFA 4KAEA 3IRAA 2H6XA 1ZCPA 3WYWA 3APQA 22GSA 1TW9A 3D4TA 2R37A 4ZIJA 20GSA 1TOFA 2H1AA 3GV1A 4WBRD 3GX8A 3DEXA 1ZMAA 4RQXA 3WGXA 4HS1A 1VF4A 4DEJA 4AJ6A 1MD3A 1AXDA 5IOWA 2WDUA 3EMPA 3HY2A 3EU4A 3SWLA 1WOUA 1IYHA 5C04A 4HUAA 2HZEB 1MDJA 3FHKA 3HZ4A 1R26A 3HVNA 2EIQA 3GN3A 3UVTA 1AIUA 3F0IA 3HVSA 1QGVA 5G1LA 4XRDA 3WGDA 2VOCA 2H0HA 3BBYA 2C0GA 3HD5A 1WE0A 4XS1A 3KJYA 3F6FA 3GRXA 4ISDA 4PX1A 4JEDA 1JZRA 1JZDA 1TK0B 3D5JA 3ME8A 4FH8A 4XRAA 4HU7A 2KP2A 4TVEA 2JZTA 3H79A 1TU8A 2OADA 3ZREA 5CNWA 2GQKA 4ULXA 1YQ1A 4MJCA 5BMUA 3EINA 1U3IA 1XVQA 5HR2A 2LRNA 1GUKA 4TW5A 4ECCA 4KDXA 5ENUA 3HJOA 2L4CA 1M3IA 2OKAA 4YH2A 4G10A 3VPTA 2AUVA 4MH3A 3FZ5A 4N0VA 5IPGA 3LGCA 5DJLA 3GURA 1M99A 2HI7A 5A4VA 3U5RE 3ISOA 2DKHA 2R0CA 1AW9A 1XBSA 3LQ7A 1OVNA 4BPYA 4QL9A 3ZFBA 3IK7A 2HE3A 2PERA 4IGJA 4NHWA 5A4UA 3L78A 1JLVA 2DJ3A 3UOMA 2OE3A 5DCHA 1SL1B 1PMTA 3IV4A 4IBPA 4PQHA 5JCGA 3US3A 1A8LA 4V2MA 5H5QA 4ML1A 3F4RA 2VO4A 4WR4A 3PR8A 4L5OA 2DJKA 1XXUA 3KP9A 2HXKA 1GTBA 4OFTA 1U87A 2A4VA 2XBIA 3E3EA 3WD6A 1DE1A 1OKTA 4XS4A 3D21A 4TR1B 5IOXA 3CSJA 2H0GA 2H19A 2HRNA 1YDKA 2IL3A 3I43A 3ZLPA 4O5UA 1A8YA 1PRXA 2HZFA 1ZYNA 2GSQA 2R5GA 4Q5RA 1GH2A 4PTSA 3GA4A 2B3SA 4NHZA 3G7YA 1TI1A 2L59A 2YWIA 4BVYB 4G2EA 1XZOA 1PQNA 4NXIA 1TKDB 1GULA 3EPTA 1WIKA 4L8EA 4NAXA 4JBBA 2VCWA 2RM6A 3N5OA 1FHEA 2MBSA 2EIOA 3M1GA 1T8EB 5B6NA 1JLWA 2XPDA 3QAVA 4BVXB 4DSSA 1WWJA 1B9XC 4NV2A 2YJ7A 1EZKA 2I1UA 3GH9A 1GSUA 4BL7A 5G30A 3LFLA 1GSYA 3GKNA 3LG6A 4Z2RA 1DBYA 1SK0A 1X5EA 3TJGA 5IMZA 3BJ5A 3IPZA 2G0FA 4F2IA 2HRKA 1ERTA 2C0EA 4IJ3A 3HZ8A 3GH6A 1V2AA 1GRXA 4EL1A 3MSZA 4ZB8A 2LJKA 2C8UA 3D22A 3ZRDA 2ZCTA 4H86A 2O85A 4TXVA 4PXOA 5IMCA 2NBSA 5AN1A 3P90A 3I9V2 2HT9A 1I9DA 7GSSA 4TN8A 2JZRA 4GSNA 2O8VB 2HSMA 4OFNA 1B4PA 1OC3A 3KCMA 3HJMA 4V1Ag 1YF1A 3ZMKA 1Z7RA 2VIMA 2YN1A 1VF2A 1MTCA 4MCUA 4YQVA 2AHEA 1TXXA 2RLIA 4L5LA 5E59A 4GQFA 3APOA 2KUCA 3UBKA 1U6TA 1F3AA 4HDEA 5IMFA 2DLXA 3EVIA 4RI7A 1S3AA 5ID2A 4USSA 3LW9A 1JZWA 5G31A 5J4UA 3ZYWA 2M46A 3HKRA 1PKZA 4KH7A 2VL2A 1T4YA 3W8SA 5ECHB 1X0RA 1U3AA 2DMLA 1G6YA 2I9HA 4OO5A 3BOAA 1CQGA 4X1UA 4O92A 1Q98A 2VLTA 5CO3A 5G5EA 2LKUA 3WGEA 1EEMA 3UMAA 3E9JB 5GAPD 2M72A 1GSEA 2DJJA 1OE8A 4ACSA 1W89A 2J9HA 4KSOA 1ST9A 2A2SA 2H74A 3L4NA 1ILOA 5ECSA 3TKPA 1SD9A 4NMUA 1O85A 4GRFA 2DJ2A 5AGYA 5HFGA 4I97A 2AAWA 3LJRA 2PVQA 4POLA 4XS6A 2O7KA 3M8NA 2R0PA 3HCZA 3DXBA 1MDKA 1UA5A 4MABA 1UC7A 4WXTA 3VPQA 1B9YC 1JFUA 4LL1B 1Z3EA 1WMJA 4L0WA 1UN2A 2QA2A 1R7HA 4MF6A 1Z7PA 4I2UA 3F8UA 4DSQA 1EWXA 3MNGA 5GZZB 1YKAA 2WJUA 3QMXA 4YAVA 2CX3A 2MZCA 4MMMA 1M2BA 1GUMA 2LQOA 4QQ7A 2XC2A 3BCIA 1VGLA 4JZQA 4PNFA 2B6MA 2REMA 4X4JA 2IFQA 3DYRA 3D0ZA 1X9MB 3G7JA 2J23A 4IN0A 5COHA 2B5EA 3GKXA 3P2AA 4F0CA 1GP1A 5F06A 5J9BA 1TK5B 2JADA 2YPMA 1M9AA 5D9VA 2V6OA 3QAGA 1KBNA 2LNTA 3KD0A 4LLRA 4KB3A 4K5SA 4D73B 2VCZA 1X9WB 1XIYA 1PGTA 3C1RA 3C8EA 3RBTA 4POMA 3F4SA 2PBJA 2I81A 3GUSA 5ECPB 5DBQA 1TRUA 2MMZA 2VUPA 4X0XA 2EC4A 5CP1A 4CW9A 2IIYA 5B6MA 1M2AA 1PL2A 1Y6EA 6GSXA 4BIKA 5EVOA 4POKA 2VL3A 3MAKA 2VM1A 2LNSA 3IBHA 3A2VA 2WFCA 2LV3A 2DIZA 2VCTA 2ZNMA 5ECOB 1K0OA 4GTUA 3L9SA 2GZPA 4OFMA 5AIXA 2CAQA 1O81A 3C1SA 1URMA 3H93A 4MJBA 3GTUA 2IMIA 3AY8A 4YQUA 2FLSA 4NPBA 5F05A 3KIJA 4ECIA 5KN2A 4ZB9A 3VWXA 2V1MA 2B1LA 3Q19A 2HFDA 3VWVA 5J41A 3RHBA 3GSSA 4XHMA 3TRPA 3NOFA 1AQVA 3DIEA 4ZBAA 4K7OA 1XWBA 1T3BA 2H1DA 3C71A 4X43A 3NIVA 3H8QA 4Z7XA 1PA3A 4WF5A 4AGSA 5DAKA 3M3MA 1ERWA 2NTOA 5DALA 4IW9A 1B4QA 2MMAA 1ABAA 2HYXA 3M0FA 4J57E 3KP8A 1R5PA 1T7PB 4PGTA 1FAAA 2YCDA 2LS5A 4OWYA 4IQ1A 3CBUA 2IMFA 13GSA 4GCIA 3D4MA 4JR6A 2X8HA 2E7PA 2DBCA 2QSIA 2E0QA 4HI7A 2RUEA 4K9ZA 4HZ4A 5B8AA 4J56E 2CZ3A 2H6YA 2OACA 4OD7A 2GGTA 1TJDA 6GSVA 5GSSA 1WPIA 3KGKA 2CZ2A 4PUFC 3F3QA 3EURA 3A3TA 5KEJA 4EE0A 2WULA 2JL4A 2L6CA 2CVDA 4F82A 4IP6A 4PQ1A 4ICYA 4IHUA 17GSA 1OAZA 4EXJA 5B7CA 2P5RA 3TGZA 2LEGA 4FQUA 4K0GA 5CYYA 3FR3A 2JSZA 1XOAA 4JRRA 2FWGA 2R2JA 4ECJA 3IC4A 1T00A 2CA8A 2OBKA 1K0AA 1XW5A 4IELA 4G0IA 4V1Ap 1BEDA 4N30A 3QAWA 1EV9A 2VLVA 8GSSA 2VD1A 1KTEA 3DGQA 2FUG2 1U88A 1FVKA 1Z6NA 1DSBA 3PPUA 1HYUA 4WKWA 4BA7A 3VWUA 1SK2A 2DSAA 18GSA 3FW2A 4BWSA 1SU9A 4PNGA 2X49A 1USBA 14GSA 2YV9A 4NV5A 4YKFA 5C00A 4PUAA 2F8FA 2CV4A 4MJEA 5H5RA 3IK9A 1F37A 2HSHA 2E2MA 1XFLA 4WF4A 3F63A 2GZYA 1MDIA 5JCUA 2L5LA 5HR0A 2VL2C 5D9WA 3LWAA 1GSDA 4KCEA 1EOGA 1QK8A 4K7IA 4ZL9A 1BX9A 4D73A 5AISA 4FYBA 1THOA 1SKRB 3SBCA 1V9WA 4JE1A 5INYA 1SJ6A 1C72A 5A4WA 5J5NA 1YZXA 1HNCA 4XIHA 2FNOA 3HJPA 2CVBA 4MDCA 3WT2A 3ZZXA 1TK8B 5ECIB 4K7NA 2CAIA 1PX7A 3M9KA 1E6BA 2FA4A 2O89A 1NHYA 3TKSE 4G0KA 1XWCA 5BRTA 1QFNA 1TP9A 2UZ8A 1ZYQB 5DQYA 3IA1A 1SJZA 2HLSA 1A0FA 4ZXGA 3F6DA 2X64A 1AQWA 1FG4A 5CAXA 3MDKA 2X8GA 2AJQB 3ERFA 2TRXA 1EP7A 2K8VA 1S3CA 5CREA 4IP1A 4N11A 2GT5A 1K0MA 4K1FA 2FA8A 4KGIA 3L9VA 2JACA 2YJHA 4MZWA 1FVJA 4ZBBA 1ON4A 1KEBA 5HFKA 4MK3A 5LNKe 3P8WA 4K5RA 1Z9HA 1OC9B 1AC1A 4MF5A 2RM5A 5ECQB 3TKQA 3EE2A 3TKSA 3O3TA 5IPHA 2GLRA 2K8SA 1NM3A 5LD0A 1EGRA 3IXRA 4ILFA 1GTIA 2D2ZA 4K8MA 2B1KA 2HNLA 2CX4A 3CTFA 3D6IA 2IPAA 3QCPA 2HZEA 1PN0A 1HD2A 3FZ9A 6GSYA 2IMEA 4RQRA 3ZTLA 1SYRA 4O5QA 3EC3A 1YJ6A 4LL4B 5F8BA 3DVWA 2A4HA 1XVWA 3M9JA 2OBIA 16GSA 4I8BA 4V2LA 5LCZA 2VCXA 3EU3A 3QPMA 1J0FA 1GTUA 2KLXA 4WEYA 1A24A 1XWGA 3KM6A 5F07A 1EP8A 4O32A 3FKFA 2YV7A 2HRFA 4KCAA 4ZL8A 2BTOT 1K0CA 1SK1A 2PGTA 3ZL5A 3HYPA 1RK4A 1FOVA 1GTAA 4WETA 2NDOA 2C3NA 3HVVA 5KN3A 3FR6A 4GLTA 2OJLA 3TOTA 1XWKA 1G0TA 3DRNA 5FHIA 2LJRA 1XW6A 1B8XA 2WRTA 4XCSA 2L6DA 3ZIJA 3FZAA 1KNGA 3R3EA 3TKRA 4MJAA 1K3LA 6GSWA 1SKWB 4KX4A 3ZMLA 3LORA 3JCML 4EF0A 2KHPA 1GL8A 5E4WA 3TJJA 3FYGA 4OCEA 2H6ZA 1FO5A 1G7EA 1NW2A 1TU7A 2ES7A 3FR9A 3A2WA 2YZUA 2MMNA 3F3RA 3UVHA 2H73A 5ECRB 2H66A 4CHSA 1FOHA 2TIRA 2G2QA 2LQQA 3HHVA 4ZILA 2V41A 3QDNA 2LTKA 2FWEA 6GSSA 1F9MA 3CYNA 3E0UA 1QQ2A 2FWFA 2NVLA 1ZOFA 1F3BA 1GNWA 1V58A 1F6MC 4ECBA 4I5QA 4GF0A 3BCKA 1XWAA 1YF0A 3ZVJA 4HQSA 3O76A 5L71A 1SJIA 1M9BA 1EOHA 5B8BA 5IQYA 2P5QA 4TR1A 3FY7A 2K6VA 1K3YA 2LRTA 2C0FA 3QFBC 1E2YA 2H1GA 3CMIA 1OC8A 4Z2UA 4HJMA 2I3YA 1SYXA 1F2EA 1O8WA 3IDVA 3U6VA 2NPBA 2B5XA 1DE2A 4YAPA 2JU5A 2V32A 2Z9SA 2DJ0A 1H4OA 1H75A 4AJ8A 2H76A 4BVYA 3GKMA 2VAFA 4F03A 3J7Yk 1M2DA 4G0LA 1AAZA 3EWLA 3K8NA 1ZZYA 2H71A 3GYKA 4XS4B 1ACVA 3DMLA 4BVXA 4MH2A 3GNJA 1J9BA 1ZYPA 2PU9C 4HZ2A 1A2JA 5JWQB 1ERVA 1EGOA 4PURA 6GSUA 2KP1A 1G6WA 3FRCA 5D73A 1NHOA 4GXZA 4KF9A 5ELAA 2P0GA 1GLPA 1X5DA 3LXTA 1XPVA 2CQ9A 2QKEA 4AJ7A 2TRCP 12GSA 5DJMA 1PL1A 3KMNA 1EV4A 3TJFA 3IAS2 2KOKA 4IQAA 2C4JA 1QMVA 4DSSB 4MZBA 1OE7A 3RAZA 2MMOA 3RPNA 4WR5A 1PD21 1HNAA 2H75A 4BL7B 1X5CA 3FZ4A 3PH9A 4FO5A 2DMMA 5ECNB 5IM9A 3OR5A 4V2NA 1B48A 1FB0A 5JWRB 2R4VA 2HSYA 2WGRA 3TJKA 1PKWA 3QOUA 1BQ7A 3GL5A 2BJXA 2C1YA 1A2LA 2FGXA 4ZB6A 2R0GA 2K18A 1PSQA 2RIIA 2V2GA 2EIRA 1A0RP 1O73A 2ALBA 2FD3A 2PMTA 3DVXA 3APSA 3IHQA 4EO3A 1EEJA 1ZL9A 2PN8A 3VI7A 2FWHA 4I2TA 2L57A 1SD8A 1XOBA 5J9CA 3G9BA 3J7Yb 2IJYA 2AYTA 4TKYA 3R2QA 2K9FA 4K2XA 4YQMA 4TR0A 5ID2B 3GMFA 10GSA 2IMKA 1BYEA 2A2RA 3NZNA 3FK8A 3Q74A 3GL3A 2I4AA 2VCQA 3V1WA 4FYCA 2F51A 3VLNA 2LJAA 3GSTA 1W4VA 1T4ZA 2F8AA 4DVCA 4HQZA 1JZOA 4BWQA 3G7IA 3RPPA 1GUHA 1RW1A 3TCOA 3BD2A 2OA7A 5CRWA 2WZ9A 3TKSC 3GIXA 2E2GA 2H70A 3F9UA 1O6JA 1R4WA 5EPFA 3KEBA 1T1VA 1A2MA 3DKSA 4RI6A 3VURA 2DC5A
chains in the Genus database with same CATH topology
5EL8A 3W6GA 3ERGA 3LYKA 2V6KA 2IMDA 5HQPA 3PINA 2QA1A 2LUSA 1VF3A 5JWOB 4LA1A 3UAPA 4K6XA 5A5KA 4P3YB 4TXOB 5IIZA 1IYIA 2YWMA 2FY6A 4KSMA 2VCVA 3KZQA 4KNDA 5CRDA 2H72A 1YY7A 2R3XA 4J2FA 4EIPA 3CXGA 3FMWA 5DCGA 4KA0A 3CRUA 3CSIA 2B7JA 3GHAA 3TDGA 3VI5A 3UEMA 3HDCA 4GSSA 1K0NA 2LSTA 2YZHA 4E8EA 1M7TA 4EDZA 1SL2B 2YOIA 2RUFA 1SL0B 4O5RA 1YEXA 4MZCA 1A23A 1PX6A 1S3DA 1LJRA 4G9HA 4NWYA 4RUVA 1G7OA 1GWCA 5HR1A 3CTGA 3LSZA 2IFQB 4Q5NA 19GSA 1GLQA 3TRXA 2H0IA 5D9XA 1TRSA 3KXOA 3ED3A 3LXZA 1PN9A 4TRXA 4GWRA 5KOWA 2GS3A 2DIYA 4EUYA 3VK9A 5ABRA 1O8XA 1N8JA 2OE0A 1V98A 2JZSA 1GSSA 5KOXA 2GVPA 2YP6A 2O87A 2XPEA 2X4AA 1TRVA 1X9SB 3GX0A 5D9TA 1WP0A 3CSHA 2B5YA 1LBKA 4ZL7A 3UBLA 2YWOA 1O7UA 4TR4A 3RHCA 2BMXA 1MD4A 1OYJA 4A5PA 2GSTA 2N5BA 4K0NA 1VF1A 4TR3A 4QL7A 4XTSA 2VM2A 5DDLA 1Q4JA 2F9SA 4LMVA 4F0BA 4F9ZA 2H30A 2ON7A 1M0UA 3L9UA 1GSFA 4ZBDA 5IMVA 1XCCA 4LMWA 2C3QA 1DUGA 2L4QA 5IMDA 1N2AA 3HA9A 6GSTA 1LU4A 3UL3A 5IO2A 3VFIA 1I5GA 1YEPA 4FYUA 3TB2A 2X99A 1TI3A 5ECLB 4EIQA 3GTUB 4Q5FA 4PQIA 2XBQA 3EYTA 5KN1A 3UJ1A 3C7MA 4HU9A 5FT3A 3ZFLA 2QC7A 2GSSA 2GQLA 5EY6A 2A2PA 4KUNA 1WJKA 4K2DA 1V57A 1OKDA 4TOPA 1BJXA 2C3TA 4Z2TA 4DSRA 2H8LA 1MEKA 5DAKB 5D96A 4IKHA 1XW9A 5DALB 2M80A 3GFKA 1Z6MA 4KE3A 4EDYA 5CRHA 4MF7A 2VL9A 2PWJA 4GQCA 2CVKA 1HQOA 5FWGA 9GSSA 2FHEA 11GSA 3ZIVA 3MIXA 2LRCA 4IVFA 4OMVA 2WCIA 3CRTA 2IN3A 2DJ1A 3IE3A 3PGTA 2PUKC 3LEFA 1FB6A 4L0UA 3UIWA 3IHGA 4MPGA 1K0BA 1RQMA 1GSQA 2H1BA 3TRQA 3HXSA 1QUWA 2N5FA 2C80A 5ELGA 2VLUA 3TUEA 4ID0A 3VWWA 3IR4A 3QFAC 5HR3A 1ML6A 1TDIA 4ML6A 3ZITA 1K0DA 1YKCA 1V40A 3F4TA 4IS0A 2GSRA 3ERWA 4N10A 3KTLA 2B7KA 2C0DA 3O6TA 3WT1A 5GAND 2YWNA 2MYGA 2P31A 1AQXA 4HOJA 2GZZA 3HVXA 5KN0A 5AIVA 4GSTA 3W8JA 2F3MA 1TTZA 3LYPA 3H4KA 3ZVJD 4CY6A 3FEUA 4TXOA 1J08A 2MBTA 4MA9A 3QR6A 5G2ZA 4MPFA 1CQHA 2ON5A 1QXHA 5ECKB 3TJBA 3RDWA 3IAM2 1THXA 1R5AA 3I6AA 5GSTA 2XHFA 1FW1A 1WRYA 2CT6A 4FIWA 4JU5A 3IOSA 2DKIA 4KW6A 4YKGA 3Q6OA 4HEA2 1BAYA 3KTBA 3P7XA 4IJIA 3S9FA 3H1NA 2PPTA 4CY8A 5G5FA 4N0ZA 3EMXA 2IWTA 2GTUA 1Y25A 2GQMA 5ECMB 5JCWA 2QGVA 1SKSB 1GNEA 3UARA 1ERUA 2H01A 3ME7A 2PVOC 2WB9A 4EC0A 2VD0A 4AF2A 1SENA 1Z5YE 5HFIA 3C73A 5D8IA 4POBA 2YANA 3Q18A 4G19A 2OE1A 1JHBA 1ZYEA 5DQSA 4Q5QA 2AB6A 4OO4A 5IMAA 2YNXA 4MP4A 4E8HA 4HJ2A 5D93A 4CDOA 4O7HA 2R6KA 2HRAA 2AV4A 1HNBA 3A2XA 4JR4A 1TRWA 3MYDA 3DD3A 5G1KA 2GDRA 3L0HA 3KH9A 2ZUPA 4I6XA 1NSWA 3TOUA 3A5IA 3DWVA 4EKZA 3I69A 1ZGNA 2X8CA 1BG5A 1K3OA 3QD9A 2WS2A 4WBJA 1OC9A 3IC8A 3N9JA 2FCHA 1AUCA 5J3RA 4EVMA 3KH7A 2GT6A 5F0GA 5IO0A 4KDUA 3A5WA 1UVZA 5CRGA 3KMOA 2L5OA 3MWHA 2N5AA 4KDYA 3GKKA 4MLYA 1VRSD 5H5SA 5DVBA 2JSYA 4MNNA 4OCFA 4KAEA 3IRAA 2H6XA 1ZCPA 3WYWA 3APQA 22GSA 1TW9A 3D4TA 2R37A 4ZIJA 20GSA 1TOFA 2H1AA 3GV1A 4WBRD 3GX8A 3DEXA 1ZMAA 4RQXA 3WGXA 4HS1A 1VF4A 4DEJA 4AJ6A 1MD3A 1AXDA 5IOWA 2WDUA 3EMPA 3HY2A 3EU4A 3SWLA 1WOUA 1IYHA 5C04A 4HUAA 2HZEB 1MDJA 3FHKA 3HZ4A 1R26A 2EIQA 3GN3A 3UVTA 1AIUA 3F0IA 3HVSA 1QGVA 5G1LA 4XRDA 3WGDA 2VOCA 2H0HA 3BBYA 2C0GA 3HD5A 1WE0A 4XS1A 3KJYA 3F6FA 3GRXA 4ISDA 4PX1A 4JEDA 1JZRA 1JZDA 1TK0B 3D5JA 3ME8A 4FH8A 4XRAA 4HU7A 2KP2A 4TVEA 2JZTA 3H79A 1TU8A 2OADA 3ZREA 5CNWA 2GQKA 4ULXA 1YQ1A 4MJCA 5BMUA 3EINA 1U3IA 1XVQA 5HR2A 2LRNA 1GUKA 4TW5A 4ECCA 4KDXA 5ENUA 3HJOA 2L4CA 2OKAA 4YH2A 4G10A 3VPTA 2AUVA 4MH3A 3FZ5A 4N0VA 5IPGA 3LGCA 5DJLA 3GURA 1M99A 2HI7A 5A4VA 3U5RE 3ISOA 2DKHA 2R0CA 1AW9A 1XBSA 3LQ7A 1OVNA 4BPYA 4QL9A 3ZFBA 3IK7A 2HE3A 2PERA 4IGJA 4NHWA 5A4UA 3L78A 1JLVA 2DJ3A 3UOMA 2OE3A 5DCHA 1SL1B 1PMTA 3IV4A 4IBPA 4PQHA 5JCGA 3US3A 1A8LA 4V2MA 5H5QA 4ML1A 3F4RA 2VO4A 4WR4A 3PR8A 4L5OA 2DJKA 1XXUA 3KP9A 2HXKA 1GTBA 4OFTA 1U87A 2A4VA 2XBIA 3E3EA 3WD6A 1DE1A 1OKTA 4XS4A 3D21A 4TR1B 5IOXA 3CSJA 2H0GA 2H19A 2HRNA 1YDKA 2IL3A 3I43A 3ZLPA 4O5UA 1A8YA 1PRXA 2HZFA 1ZYNA 2GSQA 2R5GA 4Q5RA 1GH2A 4PTSA 3GA4A 2B3SA 4NHZA 3G7YA 1TI1A 2L59A 2YWIA 4BVYB 4G2EA 1XZOA 1PQNA 4NXIA 1TKDB 1GULA 3EPTA 1WIKA 4L8EA 4NAXA 4JBBA 2VCWA 2RM6A 3N5OA 1FHEA 2MBSA 2EIOA 3M1GA 1T8EB 5B6NA 1JLWA 2XPDA 3QAVA 4BVXB 4DSSA 1WWJA 1B9XC 4NV2A 2YJ7A 1EZKA 2I1UA 3GH9A 1GSUA 4BL7A 5G30A 3LFLA 1GSYA 3GKNA 3LG6A 4Z2RA 1DBYA 1SK0A 1X5EA 3TJGA 5IMZA 3BJ5A 3IPZA 2G0FA 4F2IA 2HRKA 1ERTA 2C0EA 4IJ3A 3HZ8A 3GH6A 1V2AA 1GRXA 4EL1A 3MSZA 4ZB8A 2LJKA 2C8UA 3D22A 3ZRDA 2ZCTA 4H86A 2O85A 4TXVA 4PXOA 5IMCA 2NBSA 5AN1A 3P90A 3I9V2 2HT9A 1I9DA 7GSSA 4TN8A 2JZRA 4GSNA 2O8VB 2HSMA 4OFNA 1B4PA 1OC3A 3KCMA 3HJMA 4V1Ag 1YF1A 3ZMKA 1Z7RA 2VIMA 2YN1A 1VF2A 1MTCA 4MCUA 4YQVA 2AHEA 1TXXA 2RLIA 4L5LA 5E59A 4GQFA 3APOA 2KUCA 3UBKA 1U6TA 1F3AA 4HDEA 5IMFA 2DLXA 3EVIA 4RI7A 1S3AA 5ID2A 4USSA 3LW9A 1JZWA 5G31A 5J4UA 3ZYWA 2M46A 3HKRA 1PKZA 4KH7A 2VL2A 1T4YA 3W8SA 5ECHB 1X0RA 1U3AA 2DMLA 1G6YA 2I9HA 4OO5A 3BOAA 1CQGA 4X1UA 4O92A 1Q98A 2VLTA 5CO3A 5G5EA 2LKUA 3WGEA 1EEMA 3UMAA 3E9JB 5GAPD 2M72A 1GSEA 2DJJA 1OE8A 4ACSA 1W89A 2J9HA 4KSOA 1ST9A 2A2SA 2H74A 3L4NA 1ILOA 5ECSA 3TKPA 1SD9A 4NMUA 1O85A 4GRFA 2DJ2A 5AGYA 5HFGA 4I97A 2AAWA 3LJRA 2PVQA 4POLA 4XS6A 2O7KA 3M8NA 2R0PA 3HCZA 3DXBA 1MDKA 1UA5A 4MABA 1UC7A 4WXTA 3VPQA 1B9YC 1JFUA 4LL1B 1Z3EA 1WMJA 4L0WA 1UN2A 2QA2A 1R7HA 4MF6A 1Z7PA 4I2UA 3F8UA 4DSQA 1EWXA 3MNGA 5GZZB 1YKAA 2WJUA 3QMXA 4YAVA 2CX3A 2MZCA 4MMMA 1M2BA 1GUMA 2LQOA 4QQ7A 2XC2A 3BCIA 1VGLA 4JZQA 4PNFA 2B6MA 2REMA 4X4JA 2IFQA 3DYRA 3D0ZA 1X9MB 3G7JA 2J23A 4IN0A 5COHA 2B5EA 3GKXA 3P2AA 4F0CA 1GP1A 5F06A 5J9BA 1TK5B 2JADA 2YPMA 1M9AA 5D9VA 2V6OA 3QAGA 1KBNA 2LNTA 3KD0A 4LLRA 4KB3A 4K5SA 4D73B 2VCZA 1X9WB 1XIYA 1PGTA 3C1RA 3C8EA 3RBTA 4POMA 3F4SA 2PBJA 2I81A 3GUSA 5ECPB 5DBQA 1TRUA 2MMZA 2VUPA 4X0XA 2EC4A 5CP1A 4CW9A 2IIYA 5B6MA 1M2AA 1PL2A 1Y6EA 6GSXA 5EVOA 4POKA 2VL3A 3MAKA 2VM1A 2LNSA 3IBHA 3A2VA 2WFCA 2LV3A 2DIZA 2VCTA 2ZNMA 5ECOB 1K0OA 4GTUA 3L9SA 2GZPA 4OFMA 5AIXA 2CAQA 1O81A 3C1SA 1URMA 3H93A 4MJBA 3GTUA 2IMIA 3AY8A 4YQUA 2FLSA 4NPBA 5F05A 3KIJA 4ECIA 5KN2A 4ZB9A 3VWXA 2V1MA 2B1LA 3Q19A 2HFDA 3VWVA 5J41A 3RHBA 3GSSA 4XHMA 3TRPA 3NOFA 1AQVA 3DIEA 4ZBAA 4K7OA 1XWBA 1T3BA 2H1DA 3C71A 4X43A 3NIVA 3H8QA 4Z7XA 1PA3A 4WF5A 4AGSA 5DAKA 3M3MA 1ERWA 2NTOA 5DALA 4IW9A 1B4QA 2MMAA 1ABAA 2HYXA 3M0FA 4J57E 3KP8A 1R5PA 1T7PB 4PGTA 1FAAA 2YCDA 2LS5A 4OWYA 4IQ1A 3CBUA 2IMFA 13GSA 4GCIA 3D4MA 4JR6A 2X8HA 2E7PA 2DBCA 2QSIA 2E0QA 4HI7A 2RUEA 4K9ZA 4HZ4A 5B8AA 4J56E 2CZ3A 2H6YA 2OACA 4OD7A 2GGTA 1TJDA 6GSVA 5GSSA 1WPIA 3KGKA 2CZ2A 4PUFC 3F3QA 3EURA 3A3TA 5KEJA 4EE0A 2WULA 2JL4A 2L6CA 2CVDA 4F82A 4IP6A 4PQ1A 4ICYA 4IHUA 17GSA 1OAZA 4EXJA 5B7CA 2P5RA 3TGZA 2LEGA 4FQUA 4K0GA 5CYYA 3FR3A 2JSZA 1XOAA 4JRRA 2FWGA 2R2JA 4ECJA 3IC4A 1T00A 2CA8A 2OBKA 1K0AA 1XW5A 4IELA 4G0IA 4V1Ap 1BEDA 4N30A 3QAWA 1EV9A 2VLVA 8GSSA 2VD1A 1KTEA 3DGQA 2FUG2 1U88A 1FVKA 1Z6NA 1DSBA 3PPUA 1HYUA 4WKWA 4BA7A 3VWUA 1SK2A 2DSAA 18GSA 3FW2A 4BWSA 1SU9A 4PNGA 2X49A 1USBA 14GSA 2YV9A 4NV5A 4YKFA 5C00A 4PUAA 2F8FA 2CV4A 4MJEA 5H5RA 3IK9A 1F37A 2HSHA 2E2MA 1XFLA 4WF4A 3F63A 2GZYA 1MDIA 5JCUA 2L5LA 5HR0A 2VL2C 5D9WA 3LWAA 1GSDA 4KCEA 1EOGA 1QK8A 4K7IA 4ZL9A 1BX9A 4D73A 5AISA 4FYBA 1THOA 1SKRB 3SBCA 1V9WA 4JE1A 5INYA 1SJ6A 1C72A 5A4WA 5J5NA 1YZXA 1HNCA 4XIHA 2FNOA 3HJPA 2CVBA 4MDCA 3WT2A 3ZZXA 1TK8B 5ECIB 4K7NA 2CAIA 1PX7A 3M9KA 1E6BA 2FA4A 2O89A 1NHYA 3TKSE 4G0KA 1XWCA 5BRTA 1QFNA 1TP9A 2UZ8A 1ZYQB 5DQYA 3IA1A 1SJZA 2HLSA 1A0FA 4ZXGA 3F6DA 2X64A 1AQWA 1FG4A 5CAXA 3MDKA 2X8GA 2AJQB 3ERFA 2TRXA 1EP7A 2K8VA 1S3CA 5CREA 4IP1A 4N11A 2GT5A 1K0MA 4K1FA 2FA8A 4KGIA 3L9VA 2JACA 2YJHA 4MZWA 1FVJA 4ZBBA 1ON4A 1KEBA 5HFKA 4MK3A 5LNKe 3P8WA 4K5RA 1Z9HA 1OC9B 1AC1A 4MF5A 2RM5A 5ECQB 3TKQA 3EE2A 3TKSA 3O3TA 5IPHA 2GLRA 2K8SA 1NM3A 5LD0A 1EGRA 3IXRA 4ILFA 1GTIA 2D2ZA 4K8MA 2B1KA 2HNLA 2CX4A 3CTFA 3D6IA 2IPAA 3QCPA 2HZEA 1PN0A 1HD2A 3FZ9A 6GSYA 2IMEA 4RQRA 3ZTLA 1SYRA 4O5QA 3EC3A 1YJ6A 4LL4B 5F8BA 3DVWA 2A4HA 1XVWA 3M9JA 2OBIA 16GSA 4I8BA 4V2LA 5LCZA 2VCXA 3EU3A 3QPMA 1J0FA 1GTUA 2KLXA 4WEYA 1A24A 1XWGA 3KM6A 5F07A 1EP8A 4O32A 3FKFA 2YV7A 2HRFA 4KCAA 4ZL8A 2BTOT 1K0CA 1SK1A 2PGTA 3ZL5A 3HYPA 1RK4A 1FOVA 1GTAA 4WETA 2NDOA 2C3NA 3HVVA 5KN3A 3FR6A 4GLTA 2OJLA 3TOTA 1XWKA 1G0TA 3DRNA 5FHIA 2LJRA 1XW6A 1B8XA 2WRTA 4XCSA 2L6DA 3ZIJA 3FZAA 1KNGA 3R3EA 3TKRA 4MJAA 1K3LA 6GSWA 1SKWB 4KX4A 3ZMLA 3LORA 3JCML 4EF0A 2KHPA 1GL8A 5E4WA 3TJJA 3FYGA 4OCEA 2H6ZA 1FO5A 1G7EA 1NW2A 1TU7A 2ES7A 3FR9A 3A2WA 2YZUA 2MMNA 3F3RA 3UVHA 2H73A 5ECRB 2H66A 4CHSA 1FOHA 2TIRA 2G2QA 2LQQA 3HHVA 4ZILA 2V41A 3QDNA 2LTKA 2FWEA 6GSSA 1F9MA 3CYNA 3E0UA 1QQ2A 2FWFA 2NVLA 1ZOFA 1F3BA 1GNWA 1V58A 1F6MC 4ECBA 4I5QA 4GF0A 3BCKA 1XWAA 1YF0A 3ZVJA 4HQSA 3O76A 5L71A 1SJIA 1M9BA 1EOHA 5B8BA 5IQYA 2P5QA 4TR1A 3FY7A 2K6VA 1K3YA 2LRTA 2C0FA 3QFBC 1E2YA 2H1GA 3CMIA 1OC8A 4Z2UA 4HJMA 2I3YA 1SYXA 1F2EA 1O8WA 3IDVA 3U6VA 2NPBA 2B5XA 1DE2A 4YAPA 2JU5A 2V32A 2Z9SA 2DJ0A 1H4OA 1H75A 4AJ8A 2H76A 4BVYA 3GKMA 2VAFA 4F03A 3J7Yk 1M2DA 4G0LA 1AAZA 3EWLA 3K8NA 1ZZYA 2H71A 3GYKA 4XS4B 1ACVA 3DMLA 4BVXA 4MH2A 3GNJA 1J9BA 1ZYPA 2PU9C 4HZ2A 1A2JA 5JWQB 1ERVA 1EGOA 4PURA 6GSUA 2KP1A 1G6WA 3FRCA 5D73A 1NHOA 4GXZA 4KF9A 5ELAA 2P0GA 1GLPA 1X5DA 3LXTA 1XPVA 2CQ9A 2QKEA 4AJ7A 2TRCP 12GSA 5DJMA 1PL1A 3KMNA 1EV4A 3TJFA 3IAS2 2KOKA 4IQAA 2C4JA 1QMVA 4DSSB 4MZBA 1OE7A 3RAZA 2MMOA 3RPNA 4WR5A 1PD21 1HNAA 2H75A 4BL7B 1X5CA 3FZ4A 3PH9A 4FO5A 2DMMA 5ECNB 5IM9A 3OR5A 4V2NA 1B48A 1FB0A 5JWRB 2R4VA 2HSYA 2WGRA 3TJKA 1PKWA 3QOUA 1BQ7A 3GL5A 2BJXA 2C1YA 1A2LA 2FGXA 4ZB6A 2R0GA 2K18A 1PSQA 2RIIA 2V2GA 2EIRA 1A0RP 1O73A 2ALBA 2FD3A 2PMTA 3DVXA 3APSA 3IHQA 4EO3A 1EEJA 1ZL9A 2PN8A 3VI7A 2FWHA 4I2TA 2L57A 1SD8A 1XOBA 5J9CA 3G9BA 3J7Yb 2IJYA 2AYTA 4TKYA 3R2QA 2K9FA 4K2XA 4YQMA 4TR0A 5ID2B 3GMFA 10GSA 2IMKA 1BYEA 2A2RA 3NZNA 3FK8A 3Q74A 3GL3A 2I4AA 2VCQA 3V1WA 4FYCA 2F51A 3VLNA 2LJAA 3GSTA 1W4VA 1T4ZA 2F8AA 4DVCA 4HQZA 1JZOA 4BWQA 3G7IA 3RPPA 1GUHA 1RW1A 3TCOA 3BD2A 2OA7A 5CRWA 2WZ9A 3TKSC 3GIXA 2E2GA 2H70A 3F9UA 1O6JA 1R4WA 5EPFA 3KEBA 1T1VA 1A2MA 3DKSA 4RI6A 3VURA 2DC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EL8 A;  3W6G A;  3ERG A;  3LYK A;  2V6K A;  2IMD A;  5HQP A;  3PIN A;  2LUS A;  1VF3 A;  5JWO B;  4LA1 A;  3UAP A;  4K6X A;  5A5K A;  4P3Y B;  4TXO B;  5IIZ A;  1IYI A;  2YWM A;  2FY6 A;  4KSM A;  2VCV A;  3KZQ A;  4KND A;  5CRD A;  2H72 A;  1YY7 A;  2R3X A;  4J2F A;  3CXG A;  5DCG A;  4KA0 A;  3CRU A;  3CSI A;  2B7J A;  3GHA A;  3TDG A;  3VI5 A;  3UEM A;  3HDC A;  4GSS A;  1K0N A;  2LST A;  2YZH A;  4E8E A;  1M7T A;  4EDZ A;  1SL2 B;  2YOI A;  2RUF A;  1SL0 B;  4O5R A;  1YEX A;  4MZC A;  1A23 A;  1PX6 A;  1S3D A;  1LJR A;  4G9H A;  4NWY A;  4RUV A;  1G7O A;  1GWC A;  5HR1 A;  3CTG A;  3LSZ A;  2IFQ B;  4Q5N A;  19GS A;  1GLQ A;  3TRX A;  2H0I A;  5D9X A;  1TRS A;  3KXO A;  3ED3 A;  3LXZ A;  1PN9 A;  4TRX A;  4GWR A;  2GS3 A;  2DIY A;  4EUY A;  3VK9 A;  5ABR A;  1O8X A;  1N8J A;  2OE0 A;  1V98 A;  2JZS A;  1GSS A;  2GVP A;  2YP6 A;  2O87 A;  2XPE A;  1TRV A;  1X9S B;  3GX0 A;  5D9T A;  1WP0 A;  3CSH A;  2B5Y A;  1LBK A;  4ZL7 A;  3UBL A;  2YWO A;  1O7U A;  4TR4 A;  3RHC A;  2BMX A;  1MD4 A;  1OYJ A;  2GST A;  2N5B A;  4K0N A;  1VF1 A;  4TR3 A;  4QL7 A;  4XTS A;  2VM2 A;  5DDL A;  1Q4J A;  2F9S A;  4LMV A;  4F0B A;  4F9Z A;  2H30 A;  2ON7 A;  1M0U A;  3L9U A;  1GSF A;  4ZBD A;  5IMV A;  1XCC A;  4LMW A;  2C3Q A;  1DUG A;  2L4Q A;  5IMD A;  1N2A A;  3HA9 A;  6GST A;  1LU4 A;  3UL3 A;  5IO2 A;  3VFI A;  1I5G A;  1YEP A;  4FYU A;  3TB2 A;  2X99 A;  1TI3 A;  5ECL B;  3GTU B;  4Q5F A;  4PQI A;  2XBQ A;  3EYT A;  5KN1 A;  3UJ1 A;  3C7M A;  4HU9 A;  5FT3 A;  3ZFL A;  2QC7 A;  2GSS A;  2GQL A;  5EY6 A;  4KUN A;  1WJK A;  4K2D A;  1V57 A;  1OKD A;  4TOP A;  1BJX A;  2C3T A;  4DSR A;  2H8L A;  1MEK A;  5DAK B;  5D96 A;  4IKH A;  1XW9 A;  5DAL B;  2M80 A;  3GFK A;  1Z6M A;  4KE3 A;  4EDY A;  5CRH A;  4MF7 A;  2VL9 A;  2PWJ A;  4GQC A;  2CVK A;  1HQO A;  5FWG A;  9GSS A;  2FHE A;  11GS A;  3ZIV A;  2LRC A;  4IVF A;  4OMV A;  2WCI A;  3CRT A;  2IN3 A;  2DJ1 A;  3IE3 A;  3PGT A;  2PUK C;  3LEF A;  1FB6 A;  4L0U A;  3UIW A;  4MPG A;  1K0B A;  1RQM A;  1GSQ A;  2H1B A;  3TRQ A;  3HXS A;  1QUW A;  2N5F A;  2C80 A;  5ELG A;  2VLU A;  3TUE A;  4ID0 A;  3VWW A;  3IR4 A;  3QFA C;  5HR3 A;  1ML6 A;  1TDI A;  4ML6 A;  3ZIT A;  1K0D A;  1YKC A;  1V40 A;  3F4T A;  4IS0 A;  2GSR A;  3ERW A;  4N10 A;  3KTL A;  2B7K A;  2C0D A;  3O6T A;  3WT1 A;  5GAN D;  2YWN A;  2MYG A;  2P31 A;  1AQX A;  4HOJ A;  2GZZ A;  3HVX A;  5KN0 A;  5AIV A;  4GST A;  3W8J A;  2F3M A;  1TTZ A;  3LYP A;  3H4K A;  3ZVJ D;  3FEU A;  4TXO A;  1J08 A;  2MBT A;  4MA9 A;  3QR6 A;  5G2Z A;  4MPF A;  1CQH A;  2ON5 A;  1QXH A;  5ECK B;  3TJB A;  3RDW A;  3IAM 2;  1THX A;  1R5A A;  3I6A A;  5GST A;  2XHF A;  1FW1 A;  1WRY A;  2CT6 A;  4FIW A;  4JU5 A;  3IOS A;  4KW6 A;  3Q6O A;  4HEA 2;  1BAY A;  3KTB A;  3P7X A;  4IJI A;  3S9F A;  3H1N A;  2PPT A;  5G5F A;  4N0Z A;  3EMX A;  2IWT A;  2GTU A;  1Y25 A;  2GQM A;  5ECM B;  5JCW A;  2QGV A;  1SKS B;  1GNE A;  3UAR A;  1ERU A;  2H01 A;  3ME7 A;  2PVO C;  2WB9 A;  4EC0 A;  2VD0 A;  4AF2 A;  1SEN A;  1Z5Y E;  5HFI A;  3C73 A;  5D8I A;  4POB A;  2YAN A;  3Q18 A;  4G19 A;  2OE1 A;  1JHB A;  1ZYE A;  5DQS A;  4Q5Q A;  2AB6 A;  4OO4 A;  5IMA A;  2YNX A;  4MP4 A;  4E8H A;  4HJ2 A;  5D93 A;  4CDO A;  4O7H A;  2R6K A;  2AV4 A;  1HNB A;  3A2X A;  4JR4 A;  1TRW A;  3DD3 A;  5G1K A;  2GDR A;  3L0H A;  3KH9 A;  2ZUP A;  4I6X A;  1NSW A;  3TOU A;  3DWV A;  4EKZ A;  3I69 A;  1ZGN A;  2X8C A;  1BG5 A;  1K3O A;  3QD9 A;  2WS2 A;  4WBJ A;  1OC9 A;  3N9J A;  2FCH A;  1AUC A;  5J3R A;  4EVM A;  3KH7 A;  2GT6 A;  5F0G A;  5IO0 A;  4KDU A;  3A5W A;  1UVZ A;  5CRG A;  3KMO A;  2L5O A;  3MWH A;  2N5A A;  4KDY A;  3GKK A;  4MLY A;  1VRS D;  5H5S A;  5DVB A;  2JSY A;  4OCF A;  4KAE A;  3IRA A;  2H6X A;  1ZCP A;  3WYW A;  3APQ A;  22GS A;  1TW9 A;  3D4T A;  2R37 A;  4ZIJ A;  20GS A;  1TOF A;  2H1A A;  3GV1 A;  4WBR D;  3GX8 A;  3DEX A;  1ZMA A;  4RQX A;  3WGX A;  4HS1 A;  1VF4 A;  4DEJ A;  4AJ6 A;  1MD3 A;  1AXD A;  5IOW A;  2WDU A;  3EMP A;  3HY2 A;  3EU4 A;  3SWL A;  1WOU A;  1IYH A;  5C04 A;  4HUA A;  2HZE B;  1MDJ A;  3FHK A;  3HZ4 A;  1R26 A;  2EIQ A;  3GN3 A;  3UVT A;  1AIU A;  3F0I A;  3HVS A;  1QGV A;  5G1L A;  4XRD A;  3WGD A;  2VOC A;  2H0H A;  3BBY A;  2C0G A;  3HD5 A;  1WE0 A;  4XS1 A;  3KJY A;  3F6F A;  3GRX A;  4ISD A;  4PX1 A;  4JED A;  1JZR A;  1JZD A;  1TK0 B;  3D5J A;  3ME8 A;  4FH8 A;  4XRA A;  4HU7 A;  2KP2 A;  4TVE A;  2JZT A;  3H79 A;  1TU8 A;  2OAD A;  3ZRE A;  5CNW A;  2GQK A;  4ULX A;  1YQ1 A;  4MJC A;  3EIN A;  1U3I A;  1XVQ A;  5HR2 A;  2LRN A;  1GUK A;  4TW5 A;  4ECC A;  4KDX A;  5ENU A;  3HJO A;  2L4C A;  2OKA A;  4YH2 A;  4G10 A;  3VPT A;  2AUV A;  4MH3 A;  3FZ5 A;  4N0V A;  5IPG A;  5DJL A;  3LGC A;  3GUR A;  1M99 A;  2HI7 A;  5A4V A;  3U5R E;  3ISO A;  1AW9 A;  1XBS A;  3LQ7 A;  1OVN A;  4BPY A;  4QL9 A;  3ZFB A;  3IK7 A;  2HE3 A;  2PER A;  4IGJ A;  4NHW A;  5A4U A;  3L78 A;  1JLV A;  2DJ3 A;  3UOM A;  2OE3 A;  5DCH A;  1SL1 B;  1PMT A;  3IV4 A;  4IBP A;  4PQH A;  5JCG A;  3US3 A;  1A8L A;  4V2M A;  5H5Q A;  4ML1 A;  3F4R A;  2VO4 A;  4WR4 A;  3PR8 A;  4L5O A;  2DJK A;  1XXU A;  3KP9 A;  2HXK A;  1GTB A;  4OFT A;  1U87 A;  2A4V A;  2XBI A;  3E3E A;  3WD6 A;  1DE1 A;  1OKT A;  4XS4 A;  3D21 A;  4TR1 B;  5IOX A;  3CSJ A;  2H0G A;  2H19 A;  2HRN A;  1YDK A;  2IL3 A;  3I43 A;  3ZLP A;  1A8Y A;  1PRX A;  2HZF A;  2GSQ A;  2R5G A;  4Q5R A;  1GH2 A;  3GA4 A;  2B3S A;  4NHZ A;  3G7Y A;  1TI1 A;  2L59 A;  2YWI A;  4G2E A;  1XZO A;  1PQN A;  4NXI A;  1TKD B;  1GUL A;  1WIK A;  4L8E A;  4NAX A;  4JBB A;  2VCW A;  2RM6 A;  3N5O A;  1FHE A;  2MBS A;  2EIO A;  3M1G A;  1T8E B;  5B6N A;  1JLW A;  2XPD A;  3QAV A;  4DSS A;  1WWJ A;  1B9X C;  4NV2 A;  2YJ7 A;  1EZK A;  2I1U A;  3GH9 A;  1GSU A;  4BL7 A;  5G30 A;  3LFL A;  1GSY A;  3GKN A;  3LG6 A;  1DBY A;  1SK0 A;  1X5E A;  3TJG A;  5IMZ A;  3BJ5 A;  3IPZ A;  2G0F A;  4F2I A;  1ERT A;  2C0E A;  4IJ3 A;  3HZ8 A;  3GH6 A;  1V2A A;  1GRX A;  4EL1 A;  3MSZ A;  4ZB8 A;  2LJK A;  2C8U A;  3D22 A;  3ZRD A;  2ZCT A;  4H86 A;  2O85 A;  4TXV A;  4PXO A;  5IMC A;  2NBS A;  5AN1 A;  3P90 A;  3I9V 2;  2HT9 A;  1I9D A;  7GSS A;  4TN8 A;  2JZR A;  4GSN A;  2O8V B;  4OFN A;  1B4P A;  1OC3 A;  3KCM A;  3HJM A;  4V1A g;  1YF1 A;  3ZMK A;  1Z7R A;  2VIM A;  2YN1 A;  1VF2 A;  1MTC A;  4MCU A;  4YQV A;  2AHE A;  1TXX A;  2RLI A;  4L5L A;  5E59 A;  4GQF A;  3APO A;  2KUC A;  3UBK A;  1U6T A;  1F3A A;  4HDE A;  5IMF A;  2DLX A;  3EVI A;  4RI7 A;  1S3A A;  5ID2 A;  1JZW A;  5G31 A;  5J4U A;  3ZYW A;  2M46 A;  3HKR A;  1PKZ A;  4KH7 A;  2VL2 A;  1T4Y A;  3W8S A;  5ECH B;  1X0R A;  1U3A A;  2DML A;  1G6Y A;  2I9H A;  4OO5 A;  3BOA A;  1CQG A;  4X1U A;  4O92 A;  1Q98 A;  2VLT A;  5CO3 A;  5G5E A;  2LKU A;  3WGE A;  1EEM A;  3UMA A;  3E9J B;  5GAP D;  2M72 A;  1GSE A;  2DJJ A;  1OE8 A;  4ACS A;  1W89 A;  2J9H A;  4KSO A;  1ST9 A;  2A2S A;  2H74 A;  3L4N A;  1ILO A;  5ECS A;  3TKP A;  1SD9 A;  4NMU A;  1O85 A;  4GRF A;  2DJ2 A;  5AGY A;  5HFG A;  4I97 A;  2AAW A;  3LJR A;  2PVQ A;  4POL A;  4XS6 A;  2O7K A;  3M8N A;  3HCZ A;  3DXB A;  1MDK A;  1UA5 A;  4MAB A;  1UC7 A;  4WXT A;  3VPQ A;  1B9Y C;  1JFU A;  4LL1 B;  1Z3E A;  1WMJ A;  4L0W A;  1UN2 A;  1R7H A;  4MF6 A;  1Z7P A;  4I2U A;  3F8U A;  4DSQ A;  1EWX A;  3MNG A;  5GZZ B;  1YKA A;  2WJU A;  3QMX A;  4YAV A;  2CX3 A;  2MZC A;  4MMM A;  1M2B A;  1GUM A;  2LQO A;  4QQ7 A;  2XC2 A;  3BCI A;  1VGL A;  4JZQ A;  4PNF A;  2B6M A;  2REM A;  2IFQ A;  3DYR A;  3D0Z A;  1X9M B;  3G7J A;  2J23 A;  4IN0 A;  5COH A;  2B5E A;  3GKX A;  3P2A A;  4F0C A;  1GP1 A;  5F06 A;  5J9B A;  1TK5 B;  2JAD A;  2YPM A;  1M9A A;  5D9V A;  2V6O A;  3QAG A;  1KBN A;  2LNT A;  3KD0 A;  4LLR A;  4KB3 A;  4D73 B;  2VCZ A;  1X9W B;  1XIY A;  1PGT A;  3C1R A;  3C8E A;  3RBT A;  4POM A;  3F4S A;  2PBJ A;  2I81 A;  3GUS A;  5ECP B;  5DBQ A;  1TRU A;  2MMZ A;  2VUP A;  4X0X A;  2EC4 A;  5CP1 A;  4CW9 A;  2IIY A;  5B6M A;  1M2A A;  1PL2 A;  1Y6E A;  6GSX A;  5EVO A;  4POK A;  2VL3 A;  3MAK A;  2VM1 A;  2LNS A;  3IBH A;  3A2V A;  2WFC A;  2LV3 A;  2DIZ A;  2VCT A;  2ZNM A;  5ECO B;  1K0O A;  4GTU A;  3L9S A;  2GZP A;  4OFM A;  5AIX A;  2CAQ A;  1O81 A;  3C1S A;  1URM A;  3H93 A;  4MJB A;  3GTU A;  2IMI A;  3AY8 A;  4YQU A;  2FLS A;  4NPB A;  5F05 A;  3KIJ A;  4ECI A;  5KN2 A;  4ZB9 A;  3VWX A;  2V1M A;  2B1L A;  3Q19 A;  2HFD A;  3VWV A;  5J41 A;  3RHB A;  3GSS A;  4XHM A;  3TRP A;  3NOF A;  1AQV A;  3DIE A;  4ZBA A;  4K7O A;  1XWB A;  1T3B A;  2H1D A;  3C71 A;  4X43 A;  3NIV A;  3H8Q A;  4Z7X A;  1PA3 A;  4WF5 A;  4AGS A;  5DAK A;  3M3M A;  1ERW A;  2NTO A;  5DAL A;  4IW9 A;  1B4Q A;  2MMA A;  1ABA A;  2HYX A;  3M0F A;  4J57 E;  3KP8 A;  1R5P A;  1T7P B;  4PGT A;  1FAA A;  2YCD A;  2LS5 A;  4OWY A;  4IQ1 A;  3CBU A;  2IMF A;  13GS A;  4GCI A;  3D4M A;  4JR6 A;  2X8H A;  2E7P A;  2DBC A;  2QSI A;  2E0Q A;  4HI7 A;  2RUE A;  4K9Z A;  4HZ4 A;  5B8A A;  4J56 E;  2CZ3 A;  2H6Y A;  2OAC A;  4OD7 A;  2GGT A;  1TJD A;  6GSV A;  5GSS A;  1WPI A;  3KGK A;  2CZ2 A;  4PUF C;  3F3Q A;  3EUR A;  3A3T A;  5KEJ A;  4EE0 A;  2WUL A;  2JL4 A;  2L6C A;  2CVD A;  4F82 A;  4IP6 A;  4PQ1 A;  4IHU A;  17GS A;  1OAZ A;  4EXJ A;  5B7C A;  2P5R A;  3TGZ A;  2LEG A;  4K0G A;  5CYY A;  3FR3 A;  2JSZ A;  1XOA A;  4JRR A;  2FWG A;  2R2J A;  4ECJ A;  3IC4 A;  1T00 A;  2CA8 A;  2OBK A;  1K0A A;  1XW5 A;  4IEL A;  4V1A p;  1BED A;  4N30 A;  3QAW A;  1EV9 A;  2VLV A;  8GSS A;  2VD1 A;  1KTE A;  3DGQ A;  2FUG 2;  1U88 A;  1FVK A;  1Z6N A;  1DSB A;  1HYU A;  4WKW A;  4BA7 A;  3VWU A;  1SK2 A;  2DSA A;  18GS A;  3FW2 A;  4BWS A;  1SU9 A;  4PNG A;  1USB A;  14GS A;  2YV9 A;  4NV5 A;  5C00 A;  4PUA A;  2F8F A;  2CV4 A;  4MJE A;  5H5R A;  3IK9 A;  1F37 A;  2HSH A;  2E2M A;  1XFL A;  4WF4 A;  3F63 A;  2GZY A;  1MDI A;  5JCU A;  2L5L A;  5HR0 A;  2VL2 C;  5D9W A;  3LWA A;  1GSD A;  4KCE A;  1EOG A;  1QK8 A;  4K7I A;  4ZL9 A;  1BX9 A;  4D73 A;  5AIS A;  4FYB A;  1THO A;  1SKR B;  3SBC A;  1V9W A;  4JE1 A;  5INY A;  1SJ6 A;  1C72 A;  5A4W A;  5J5N A;  1YZX A;  1HNC A;  4XIH A;  2FNO A;  3HJP A;  2CVB A;  4MDC A;  3WT2 A;  3ZZX A;  1TK8 B;  5ECI B;  4K7N A;  2CAI A;  1PX7 A;  3M9K A;  1E6B A;  2FA4 A;  2O89 A;  1NHY A;  3TKS E;  1XWC A;  1QFN A;  1TP9 A;  1ZYQ B;  5DQY A;  3IA1 A;  1SJZ A;  2HLS A;  1A0F A;  4ZXG A;  3F6D A;  2X64 A;  1AQW A;  1FG4 A;  5CAX A;  3MDK A;  2X8G A;  2AJQ B;  3ERF A;  2TRX A;  1EP7 A;  2K8V A;  1S3C A;  5CRE A;  4IP1 A;  4N11 A;  2GT5 A;  1K0M A;  4K1F A;  2FA8 A;  4KGI A;  3L9V A;  2JAC A;  2YJH A;  4MZW A;  1FVJ A;  4ZBB A;  1ON4 A;  1KEB A;  5HFK A;  4MK3 A;  5LNK e;  3P8W A;  1Z9H A;  1OC9 B;  1AC1 A;  4MF5 A;  2RM5 A;  5ECQ B;  3TKQ A;  3EE2 A;  3TKS A;  3O3T A;  5IPH A;  2GLR A;  2K8S A;  1NM3 A;  5LD0 A;  1EGR A;  3IXR A;  4ILF A;  1GTI A;  2D2Z A;  4K8M A;  2B1K A;  2HNL A;  2CX4 A;  3CTF A;  3D6I A;  2IPA A;  3QCP A;  2HZE A;  1HD2 A;  3FZ9 A;  6GSY A;  2IME A;  4RQR A;  3ZTL A;  1SYR A;  3EC3 A;  1YJ6 A;  4LL4 B;  5F8B A;  3DVW A;  1XVW A;  3M9J A;  2OBI A;  16GS A;  4I8B A;  4V2L A;  5LCZ A;  2VCX A;  3EU3 A;  3QPM A;  1J0F A;  1GTU A;  2KLX A;  4WEY A;  1A24 A;  1XWG A;  3KM6 A;  5F07 A;  1EP8 A;  4O32 A;  3FKF A;  2YV7 A;  2HRF A;  4KCA A;  4ZL8 A;  2BTO T;  1K0C A;  1SK1 A;  2PGT A;  3ZL5 A;  3HYP A;  1RK4 A;  1FOV A;  1GTA A;  4WET A;  2NDO A;  2C3N A;  3HVV A;  5KN3 A;  3FR6 A;  4GLT A;  2OJL A;  3TOT A;  1XWK A;  1G0T A;  3DRN A;  5FHI A;  2LJR A;  1XW6 A;  1B8X A;  2WRT A;  4XCS A;  2L6D A;  3ZIJ A;  3FZA A;  1KNG A;  3TKR A;  4MJA A;  1K3L A;  6GSW A;  1SKW B;  4KX4 A;  3ZML A;  3LOR A;  3JCM L;  4EF0 A;  2KHP A;  1GL8 A;  5E4W A;  3TJJ A;  3FYG A;  4OCE A;  2H6Z A;  1FO5 A;  1G7E A;  1NW2 A;  1TU7 A;  2ES7 A;  3FR9 A;  3A2W A;  2YZU A;  2MMN A;  3F3R A;  3UVH A;  2H73 A;  5ECR B;  2H66 A;  4CHS A;  2TIR A;  2G2Q A;  2LQQ A;  3HHV A;  4ZIL A;  2V41 A;  3QDN A;  2LTK A;  2FWE A;  6GSS A;  1F9M A;  3CYN A;  3E0U A;  1QQ2 A;  2FWF A;  2NVL A;  1ZOF A;  1F3B A;  1GNW A;  1V58 A;  1F6M C;  4ECB A;  4I5Q A;  4GF0 A;  3BCK A;  1XWA A;  1YF0 A;  3ZVJ A;  4HQS A;  3O76 A;  5L71 A;  1SJI A;  1M9B A;  1EOH A;  5B8B A;  5IQY A;  2P5Q A;  4TR1 A;  3FY7 A;  2K6V A;  1K3Y A;  2LRT A;  2C0F A;  3QFB C;  1E2Y A;  2H1G A;  3CMI A;  1OC8 A;  4HJM A;  2I3Y A;  1SYX A;  1F2E A;  1O8W A;  3IDV A;  3U6V A;  2NPB A;  2B5X A;  1DE2 A;  4YAP A;  2JU5 A;  2V32 A;  2Z9S A;  2DJ0 A;  1H4O A;  1H75 A;  4AJ8 A;  2H76 A;  4BVY A;  3GKM A;  2VAF A;  4F03 A;  3J7Y k;  1M2D A;  1AAZ A;  3EWL A;  3K8N A;  1ZZY A;  2H71 A;  3GYK A;  4XS4 B;  1ACV A;  3DML A;  4BVX A;  4MH2 A;  3GNJ A;  1J9B A;  2PU9 C;  4HZ2 A;  1A2J A;  5JWQ B;  1ERV A;  1EGO A;  4PUR A;  6GSU A;  2KP1 A;  1G6W A;  3FRC A;  5D73 A;  1NHO A;  4GXZ A;  5ELA A;  2P0G A;  1GLP A;  1X5D A;  3LXT A;  1XPV A;  2CQ9 A;  2QKE A;  4AJ7 A;  2TRC P;  12GS A;  5DJM A;  1PL1 A;  3KMN A;  1EV4 A;  3TJF A;  3IAS 2;  2KOK A;  4IQA A;  2C4J A;  1QMV A;  4DSS B;  4MZB A;  1OE7 A;  3RAZ A;  2MMO A;  3RPN A;  4WR5 A;  1PD2 1;  1HNA A;  2H75 A;  1X5C A;  3FZ4 A;  3PH9 A;  4FO5 A;  2DMM A;  5ECN B;  5IM9 A;  3OR5 A;  4V2N A;  1B48 A;  1FB0 A;  5JWR B;  2R4V A;  2HSY A;  2WGR A;  3TJK A;  1PKW A;  3QOU A;  1BQ7 A;  3GL5 A;  2BJX A;  2C1Y A;  1A2L A;  2FGX A;  4ZB6 A;  2K18 A;  1PSQ A;  2RII A;  2V2G A;  2EIR A;  1A0R P;  1O73 A;  2ALB A;  2FD3 A;  2PMT A;  3DVX A;  3APS A;  3IHQ A;  4EO3 A;  1EEJ A;  1ZL9 A;  2PN8 A;  3VI7 A;  2FWH A;  4I2T A;  2L57 A;  1SD8 A;  1XOB A;  5J9C A;  3G9B A;  3J7Y b;  2IJY A;  2AYT A;  4TKY A;  3R2Q A;  2K9F A;  4YQM A;  4TR0 A;  5ID2 B;  3GMF A;  10GS A;  2IMK A;  1BYE A;  2A2R A;  3NZN A;  3FK8 A;  3Q74 A;  3GL3 A;  2I4A A;  2VCQ A;  3V1W A;  4FYC A;  2F51 A;  3VLN A;  2LJA A;  3GST A;  1W4V A;  1T4Z A;  2F8A A;  4DVC A;  4HQZ A;  1JZO A;  4BWQ A;  3G7I A;  3RPP A;  1GUH A;  1RW1 A;  3TCO A;  3BD2 A;  2OA7 A;  5CRW A;  2WZ9 A;  3TKS C;  3GIX A;  2E2G A;  2H70 A;  3F9U A;  1O6J A;  1R4W A;  5EPF A;  3KEB A;  1T1V A;  1A2M A;  3DKS A;  4RI6 A;  3VUR A;  2DC5 A; 
#chains in the Genus database with same CATH topology
 5EL8 A;  3W6G A;  3ERG A;  3LYK A;  2V6K A;  2IMD A;  5HQP A;  3PIN A;  2QA1 A;  2LUS A;  1VF3 A;  5JWO B;  4LA1 A;  3UAP A;  4K6X A;  5A5K A;  4P3Y B;  4TXO B;  5IIZ A;  1IYI A;  2YWM A;  2FY6 A;  4KSM A;  2VCV A;  3KZQ A;  4KND A;  5CRD A;  2H72 A;  1YY7 A;  2R3X A;  1PFO A;  4J2F A;  4EIP A;  3CXG A;  3FMW A;  5DCG A;  4KA0 A;  3CRU A;  3CSI A;  2B7J A;  3GHA A;  3TDG A;  3VI5 A;  3UEM A;  3HDC A;  4GSS A;  1K0N A;  2LST A;  2YZH A;  4E8E A;  1M7T A;  4EDZ A;  1SL2 B;  2YOI A;  2RUF A;  1SL0 B;  4O5R A;  1YEX A;  4MZC A;  1A23 A;  1PX6 A;  1S3D A;  1LJR A;  4G9H A;  4NWY A;  4RUV A;  1G7O A;  1GWC A;  4HSC X;  5HR1 A;  3CTG A;  3LSZ A;  2IFQ B;  4Q5N A;  19GS A;  1GLQ A;  3TRX A;  2H0I A;  5D9X A;  1TRS A;  3KXO A;  3ED3 A;  3LXZ A;  1PN9 A;  4TRX A;  4GWR A;  5KOW A;  2GS3 A;  2DIY A;  4EUY A;  3VK9 A;  5ABR A;  1O8X A;  1N8J A;  2OE0 A;  1V98 A;  2JZS A;  1GSS A;  5KOX A;  2GVP A;  2YP6 A;  2O87 A;  2XPE A;  2X4A A;  1TRV A;  1X9S B;  3GX0 A;  5D9T A;  1WP0 A;  3CSH A;  2B5Y A;  1LBK A;  3CQF A;  4ZL7 A;  3UBL A;  2YWO A;  1O7U A;  4TR4 A;  3RHC A;  2BMX A;  1MD4 A;  1OYJ A;  4A5P A;  2GST A;  2N5B A;  4K0N A;  1VF1 A;  4TR3 A;  4QL7 A;  4XTS A;  2VM2 A;  5DDL A;  1Q4J A;  2F9S A;  4LMV A;  4F0B A;  4F9Z A;  2H30 A;  2ON7 A;  1M0U A;  3L9U A;  1GSF A;  4ZBD A;  5IMV A;  1XCC A;  4LMW A;  2C3Q A;  1DUG A;  2L4Q A;  5IMD A;  1N2A A;  3HA9 A;  6GST A;  1LU4 A;  3UL3 A;  5IO2 A;  3VFI A;  1I5G A;  1YEP A;  4FYU A;  3TB2 A;  2X99 A;  1TI3 A;  5ECL B;  4EIQ A;  3GTU B;  4Q5F A;  4PQI A;  2XBQ A;  3EYT A;  5KN1 A;  3UJ1 A;  3C7M A;  4HU9 A;  5FT3 A;  3ZFL A;  2QC7 A;  2GSS A;  2GQL A;  5EY6 A;  2A2P A;  4KUN A;  1WJK A;  4K2D A;  1V57 A;  1M3J A;  1OKD A;  4TOP A;  1BJX A;  2C3T A;  4Z2T A;  4DSR A;  2H8L A;  1MEK A;  5DAK B;  5D96 A;  4IKH A;  1XW9 A;  5DAL B;  2M80 A;  3GFK A;  1Z6M A;  4KE3 A;  4EDY A;  5CRH A;  4MF7 A;  2VL9 A;  2PWJ A;  4GQC A;  2CVK A;  1HQO A;  5FWG A;  9GSS A;  2FHE A;  11GS A;  3ZIV A;  3MIX A;  2LRC A;  4IVF A;  4OMV A;  2WCI A;  3CRT A;  2IN3 A;  2DJ1 A;  3IE3 A;  3PGT A;  2PUK C;  3LEF A;  1FB6 A;  4L0U A;  3UIW A;  3IHG A;  4MPG A;  1K0B A;  1RQM A;  1GSQ A;  2H1B A;  3TRQ A;  3HXS A;  1QUW A;  2N5F A;  2C80 A;  5ELG A;  2VLU A;  3TUE A;  4ID0 A;  3VWW A;  3IR4 A;  3QFA C;  5HR3 A;  1ML6 A;  1TDI A;  4ML6 A;  3ZIT A;  1K0D A;  1YKC A;  1V40 A;  3F4T A;  4IS0 A;  2GSR A;  3ERW A;  4N10 A;  3KTL A;  2B7K A;  2C0D A;  3O6T A;  3WT1 A;  5GAN D;  2YWN A;  2MYG A;  2P31 A;  1AQX A;  4HOJ A;  2GZZ A;  3HVX A;  5KN0 A;  1XG8 A;  5AIV A;  4GST A;  3W8J A;  2F3M A;  1TTZ A;  3LYP A;  3H4K A;  3ZVJ D;  4CY6 A;  3FEU A;  4TXO A;  1J08 A;  2MBT A;  4MA9 A;  3QR6 A;  5G2Z A;  4MPF A;  1CQH A;  2ON5 A;  1QXH A;  5ECK B;  3TJB A;  3RDW A;  3IAM 2;  1THX A;  1R5A A;  3I6A A;  5GST A;  2XHF A;  1FW1 A;  1WRY A;  2CT6 A;  4FIW A;  4JU5 A;  3IOS A;  2DKI A;  4KW6 A;  4YKG A;  3Q6O A;  4HEA 2;  1BAY A;  3KTB A;  3P7X A;  4IJI A;  3S9F A;  3H1N A;  2PPT A;  1S3R A;  4CY8 A;  5G5F A;  4N0Z A;  3EMX A;  2IWT A;  2GTU A;  1Y25 A;  2GQM A;  5ECM B;  5JCW A;  2QGV A;  1SKS B;  1GNE A;  3UAR A;  1ERU A;  2H01 A;  3ME7 A;  2PVO C;  2WB9 A;  4EC0 A;  2VD0 A;  4AF2 A;  1SEN A;  1Z5Y E;  5HFI A;  3C73 A;  5D8I A;  4POB A;  2YAN A;  3Q18 A;  4G19 A;  2OE1 A;  1JHB A;  1ZYE A;  5DQS A;  4Q5Q A;  2AB6 A;  4OO4 A;  5IMA A;  2YNX A;  4MP4 A;  4E8H A;  4HJ2 A;  5D93 A;  4CDO A;  4O7H A;  2R6K A;  2HRA A;  2AV4 A;  1HNB A;  3A2X A;  4JR4 A;  1TRW A;  3MYD A;  3DD3 A;  5G1K A;  2GDR A;  3L0H A;  3KH9 A;  2ZUP A;  4I6X A;  1NSW A;  3TOU A;  3A5I A;  3DWV A;  4EKZ A;  3I69 A;  1ZGN A;  2X8C A;  1BG5 A;  1K3O A;  3QD9 A;  2WS2 A;  4WBJ A;  1OC9 A;  3IC8 A;  3N9J A;  2FCH A;  1AUC A;  5J3R A;  4EVM A;  3KH7 A;  2GT6 A;  5F0G A;  5IO0 A;  4KDU A;  3A5W A;  1UVZ A;  5CRG A;  3KMO A;  2L5O A;  3MWH A;  2N5A A;  4KDY A;  3GKK A;  4MLY A;  1VRS D;  5H5S A;  5DVB A;  2JSY A;  4MNN A;  4OCF A;  4KAE A;  3IRA A;  2H6X A;  1ZCP A;  3WYW A;  3APQ A;  22GS A;  1TW9 A;  3D4T A;  2R37 A;  4ZIJ A;  20GS A;  1TOF A;  2H1A A;  3GV1 A;  4WBR D;  3GX8 A;  3DEX A;  1ZMA A;  4RQX A;  3WGX A;  4HS1 A;  1VF4 A;  4DEJ A;  4AJ6 A;  1MD3 A;  1AXD A;  5IOW A;  2WDU A;  3EMP A;  3HY2 A;  3EU4 A;  3SWL A;  1WOU A;  1IYH A;  5C04 A;  4HUA A;  2HZE B;  1MDJ A;  3FHK A;  3HZ4 A;  1R26 A;  3HVN A;  2EIQ A;  3GN3 A;  3UVT A;  1AIU A;  3F0I A;  3HVS A;  1QGV A;  5G1L A;  4XRD A;  3WGD A;  2VOC A;  2H0H A;  3BBY A;  2C0G A;  3HD5 A;  1WE0 A;  4XS1 A;  3KJY A;  3F6F A;  3GRX A;  4ISD A;  4PX1 A;  4JED A;  1JZR A;  1JZD A;  1TK0 B;  3D5J A;  3ME8 A;  4FH8 A;  4XRA A;  4HU7 A;  2KP2 A;  4TVE A;  2JZT A;  3H79 A;  1TU8 A;  2OAD A;  3ZRE A;  5CNW A;  2GQK A;  4ULX A;  1YQ1 A;  4MJC A;  5BMU A;  3EIN A;  1U3I A;  1XVQ A;  5HR2 A;  2LRN A;  1GUK A;  4TW5 A;  4ECC A;  4KDX A;  5ENU A;  3HJO A;  2L4C A;  1M3I A;  2OKA A;  4YH2 A;  4G10 A;  3VPT A;  2AUV A;  4MH3 A;  3FZ5 A;  4N0V A;  5IPG A;  3LGC A;  5DJL A;  3GUR A;  1M99 A;  2HI7 A;  5A4V A;  3U5R E;  3ISO A;  2DKH A;  2R0C A;  1AW9 A;  1XBS A;  3LQ7 A;  1OVN A;  4BPY A;  4QL9 A;  3ZFB A;  3IK7 A;  2HE3 A;  2PER A;  4IGJ A;  4NHW A;  5A4U A;  3L78 A;  1JLV A;  2DJ3 A;  3UOM A;  2OE3 A;  5DCH A;  1SL1 B;  1PMT A;  3IV4 A;  4IBP A;  4PQH A;  5JCG A;  3US3 A;  1A8L A;  4V2M A;  5H5Q A;  4ML1 A;  3F4R A;  2VO4 A;  4WR4 A;  3PR8 A;  4L5O A;  2DJK A;  1XXU A;  3KP9 A;  2HXK A;  1GTB A;  4OFT A;  1U87 A;  2A4V A;  2XBI A;  3E3E A;  3WD6 A;  1DE1 A;  1OKT A;  4XS4 A;  3D21 A;  4TR1 B;  5IOX A;  3CSJ A;  2H0G A;  2H19 A;  2HRN A;  1YDK A;  2IL3 A;  3I43 A;  3ZLP A;  4O5U A;  1A8Y A;  1PRX A;  2HZF A;  1ZYN A;  2GSQ A;  2R5G A;  4Q5R A;  1GH2 A;  4PTS A;  3GA4 A;  2B3S A;  4NHZ A;  3G7Y A;  1TI1 A;  2L59 A;  2YWI A;  4BVY B;  4G2E A;  1XZO A;  1PQN A;  4NXI A;  1TKD B;  1GUL A;  3EPT A;  1WIK A;  4L8E A;  4NAX A;  4JBB A;  2VCW A;  2RM6 A;  3N5O A;  1FHE A;  2MBS A;  2EIO A;  3M1G A;  1T8E B;  5B6N A;  1JLW A;  2XPD A;  3QAV A;  4BVX B;  4DSS A;  1WWJ A;  1B9X C;  4NV2 A;  2YJ7 A;  1EZK A;  2I1U A;  3GH9 A;  1GSU A;  4BL7 A;  5G30 A;  3LFL A;  1GSY A;  3GKN A;  3LG6 A;  4Z2R A;  1DBY A;  1SK0 A;  1X5E A;  3TJG A;  5IMZ A;  3BJ5 A;  3IPZ A;  2G0F A;  4F2I A;  2HRK A;  1ERT A;  2C0E A;  4IJ3 A;  3HZ8 A;  3GH6 A;  1V2A A;  1GRX A;  4EL1 A;  3MSZ A;  4ZB8 A;  2LJK A;  2C8U A;  3D22 A;  3ZRD A;  2ZCT A;  4H86 A;  2O85 A;  4TXV A;  4PXO A;  5IMC A;  2NBS A;  5AN1 A;  3P90 A;  3I9V 2;  2HT9 A;  1I9D A;  7GSS A;  4TN8 A;  2JZR A;  4GSN A;  2O8V B;  2HSM A;  4OFN A;  1B4P A;  1OC3 A;  3KCM A;  3HJM A;  4V1A g;  1YF1 A;  3ZMK A;  1Z7R A;  2VIM A;  2YN1 A;  1VF2 A;  1MTC A;  4MCU A;  4YQV A;  2AHE A;  1TXX A;  2RLI A;  4L5L A;  5E59 A;  4GQF A;  3APO A;  2KUC A;  3UBK A;  1U6T A;  1F3A A;  4HDE A;  5IMF A;  2DLX A;  3EVI A;  4RI7 A;  1S3A A;  5ID2 A;  4USS A;  3LW9 A;  1JZW A;  5G31 A;  5J4U A;  3ZYW A;  2M46 A;  3HKR A;  1PKZ A;  4KH7 A;  2VL2 A;  1T4Y A;  3W8S A;  5ECH B;  1X0R A;  1U3A A;  2DML A;  1G6Y A;  2I9H A;  4OO5 A;  3BOA A;  1CQG A;  4X1U A;  4O92 A;  1Q98 A;  2VLT A;  5CO3 A;  5G5E A;  2LKU A;  3WGE A;  1EEM A;  3UMA A;  3E9J B;  5GAP D;  2M72 A;  1GSE A;  2DJJ A;  1OE8 A;  4ACS A;  1W89 A;  2J9H A;  4KSO A;  1ST9 A;  2A2S A;  2H74 A;  3L4N A;  1ILO A;  5ECS A;  3TKP A;  1SD9 A;  4NMU A;  1O85 A;  4GRF A;  2DJ2 A;  5AGY A;  5HFG A;  4I97 A;  2AAW A;  3LJR A;  2PVQ A;  4POL A;  4XS6 A;  2O7K A;  3M8N A;  2R0P A;  3HCZ A;  3DXB A;  1MDK A;  1UA5 A;  4MAB A;  1UC7 A;  4WXT A;  3VPQ A;  1B9Y C;  1JFU A;  4LL1 B;  1Z3E A;  1WMJ A;  4L0W A;  1UN2 A;  2QA2 A;  1R7H A;  4MF6 A;  1Z7P A;  4I2U A;  3F8U A;  4DSQ A;  1EWX A;  3MNG A;  5GZZ B;  1YKA A;  2WJU A;  3QMX A;  4YAV A;  2CX3 A;  2MZC A;  4MMM A;  1M2B A;  1GUM A;  2LQO A;  4QQ7 A;  2XC2 A;  3BCI A;  1VGL A;  4JZQ A;  4PNF A;  2B6M A;  2REM A;  4X4J A;  2IFQ A;  3DYR A;  3D0Z A;  1X9M B;  3G7J A;  2J23 A;  4IN0 A;  5COH A;  2B5E A;  3GKX A;  3P2A A;  4F0C A;  1GP1 A;  5F06 A;  5J9B A;  1TK5 B;  2JAD A;  2YPM A;  1M9A A;  5D9V A;  2V6O A;  3QAG A;  1KBN A;  2LNT A;  3KD0 A;  4LLR A;  4KB3 A;  4K5S A;  4D73 B;  2VCZ A;  1X9W B;  1XIY A;  1PGT A;  3C1R A;  3C8E A;  3RBT A;  4POM A;  3F4S A;  2PBJ A;  2I81 A;  3GUS A;  5ECP B;  5DBQ A;  1TRU A;  2MMZ A;  2VUP A;  4X0X A;  2EC4 A;  5CP1 A;  4CW9 A;  2IIY A;  5B6M A;  1M2A A;  1PL2 A;  1Y6E A;  6GSX A;  4BIK A;  5EVO A;  4POK A;  2VL3 A;  3MAK A;  2VM1 A;  2LNS A;  3IBH A;  3A2V A;  2WFC A;  2LV3 A;  2DIZ A;  2VCT A;  2ZNM A;  5ECO B;  1K0O A;  4GTU A;  3L9S A;  2GZP A;  4OFM A;  5AIX A;  2CAQ A;  1O81 A;  3C1S A;  1URM A;  3H93 A;  4MJB A;  3GTU A;  2IMI A;  3AY8 A;  4YQU A;  2FLS A;  4NPB A;  5F05 A;  3KIJ A;  4ECI A;  5KN2 A;  4ZB9 A;  3VWX A;  2V1M A;  2B1L A;  3Q19 A;  2HFD A;  3VWV A;  5J41 A;  3RHB A;  3GSS A;  4XHM A;  3TRP A;  3NOF A;  1AQV A;  3DIE A;  4ZBA A;  4K7O A;  1XWB A;  1T3B A;  2H1D A;  3C71 A;  4X43 A;  3NIV A;  3H8Q A;  4Z7X A;  1PA3 A;  4WF5 A;  4AGS A;  5DAK A;  3M3M A;  1ERW A;  2NTO A;  5DAL A;  4IW9 A;  1B4Q A;  2MMA A;  1ABA A;  2HYX A;  3M0F A;  4J57 E;  3KP8 A;  1R5P A;  1T7P B;  4PGT A;  1FAA A;  2YCD A;  2LS5 A;  4OWY A;  4IQ1 A;  3CBU A;  2IMF A;  13GS A;  4GCI A;  3D4M A;  4JR6 A;  2X8H A;  2E7P A;  2DBC A;  2QSI A;  2E0Q A;  4HI7 A;  2RUE A;  4K9Z A;  4HZ4 A;  5B8A A;  4J56 E;  2CZ3 A;  2H6Y A;  2OAC A;  4OD7 A;  2GGT A;  1TJD A;  6GSV A;  5GSS A;  1WPI A;  3KGK A;  2CZ2 A;  4PUF C;  3F3Q A;  3EUR A;  3A3T A;  5KEJ A;  4EE0 A;  2WUL A;  2JL4 A;  2L6C A;  2CVD A;  4F82 A;  4IP6 A;  4PQ1 A;  4ICY A;  4IHU A;  17GS A;  1OAZ A;  4EXJ A;  5B7C A;  2P5R A;  3TGZ A;  2LEG A;  4FQU A;  4K0G A;  5CYY A;  3FR3 A;  2JSZ A;  1XOA A;  4JRR A;  2FWG A;  2R2J A;  4ECJ A;  3IC4 A;  1T00 A;  2CA8 A;  2OBK A;  1K0A A;  1XW5 A;  4IEL A;  4G0I A;  4V1A p;  1BED A;  4N30 A;  3QAW A;  1EV9 A;  2VLV A;  8GSS A;  2VD1 A;  1KTE A;  3DGQ A;  2FUG 2;  1U88 A;  1FVK A;  1Z6N A;  1DSB A;  3PPU A;  1HYU A;  4WKW A;  4BA7 A;  3VWU A;  1SK2 A;  2DSA A;  18GS A;  3FW2 A;  4BWS A;  1SU9 A;  4PNG A;  2X49 A;  1USB A;  14GS A;  2YV9 A;  4NV5 A;  4YKF A;  5C00 A;  4PUA A;  2F8F A;  2CV4 A;  4MJE A;  5H5R A;  3IK9 A;  1F37 A;  2HSH A;  2E2M A;  1XFL A;  4WF4 A;  3F63 A;  2GZY A;  1MDI A;  5JCU A;  2L5L A;  5HR0 A;  2VL2 C;  5D9W A;  3LWA A;  1GSD A;  4KCE A;  1EOG A;  1QK8 A;  4K7I A;  4ZL9 A;  1BX9 A;  4D73 A;  5AIS A;  4FYB A;  1THO A;  1SKR B;  3SBC A;  1V9W A;  4JE1 A;  5INY A;  1SJ6 A;  1C72 A;  5A4W A;  5J5N A;  1YZX A;  1HNC A;  4XIH A;  2FNO A;  3HJP A;  2CVB A;  4MDC A;  3WT2 A;  3ZZX A;  1TK8 B;  5ECI B;  4K7N A;  2CAI A;  1PX7 A;  3M9K A;  1E6B A;  2FA4 A;  2O89 A;  1NHY A;  3TKS E;  4G0K A;  1XWC A;  5BRT A;  1QFN A;  1TP9 A;  2UZ8 A;  1ZYQ B;  5DQY A;  3IA1 A;  1SJZ A;  2HLS A;  1A0F A;  4ZXG A;  3F6D A;  2X64 A;  1AQW A;  1FG4 A;  5CAX A;  3MDK A;  2X8G A;  2AJQ B;  3ERF A;  2TRX A;  1EP7 A;  2K8V A;  1S3C A;  5CRE A;  4IP1 A;  4N11 A;  2GT5 A;  1K0M A;  4K1F A;  2FA8 A;  4KGI A;  3L9V A;  2JAC A;  2YJH A;  4MZW A;  1FVJ A;  4ZBB A;  1ON4 A;  1KEB A;  5HFK A;  4MK3 A;  5LNK e;  3P8W A;  4K5R A;  1Z9H A;  1OC9 B;  1AC1 A;  4MF5 A;  2RM5 A;  5ECQ B;  3TKQ A;  3EE2 A;  3TKS A;  3O3T A;  5IPH A;  2GLR A;  2K8S A;  1NM3 A;  5LD0 A;  1EGR A;  3IXR A;  4ILF A;  1GTI A;  2D2Z A;  4K8M A;  2B1K A;  2HNL A;  2CX4 A;  3CTF A;  3D6I A;  2IPA A;  3QCP A;  2HZE A;  1PN0 A;  1HD2 A;  3FZ9 A;  6GSY A;  2IME A;  4RQR A;  3ZTL A;  1SYR A;  4O5Q A;  3EC3 A;  1YJ6 A;  4LL4 B;  5F8B A;  3DVW A;  2A4H A;  1XVW A;  3M9J A;  2OBI A;  16GS A;  4I8B A;  4V2L A;  5LCZ A;  2VCX A;  3EU3 A;  3QPM A;  1J0F A;  1GTU A;  2KLX A;  4WEY A;  1A24 A;  1XWG A;  3KM6 A;  5F07 A;  1EP8 A;  4O32 A;  3FKF A;  2YV7 A;  2HRF A;  4KCA A;  4ZL8 A;  2BTO T;  1K0C A;  1SK1 A;  2PGT A;  3ZL5 A;  3HYP A;  1RK4 A;  1FOV A;  1GTA A;  4WET A;  2NDO A;  2C3N A;  3HVV A;  5KN3 A;  3FR6 A;  4GLT A;  2OJL A;  3TOT A;  1XWK A;  1G0T A;  3DRN A;  5FHI A;  2LJR A;  1XW6 A;  1B8X A;  2WRT A;  4XCS A;  2L6D A;  3ZIJ A;  3FZA A;  1KNG A;  3R3E A;  3TKR A;  4MJA A;  1K3L A;  6GSW A;  1SKW B;  4KX4 A;  3ZML A;  3LOR A;  3JCM L;  4EF0 A;  2KHP A;  1GL8 A;  5E4W A;  3TJJ A;  3FYG A;  4OCE A;  2H6Z A;  1FO5 A;  1G7E A;  1NW2 A;  1TU7 A;  2ES7 A;  3FR9 A;  3A2W A;  2YZU A;  2MMN A;  3F3R A;  3UVH A;  2H73 A;  5ECR B;  2H66 A;  4CHS A;  1FOH A;  2TIR A;  2G2Q A;  2LQQ A;  3HHV A;  4ZIL A;  2V41 A;  3QDN A;  2LTK A;  2FWE A;  6GSS A;  1F9M A;  3CYN A;  3E0U A;  1QQ2 A;  2FWF A;  2NVL A;  1ZOF A;  1F3B A;  1GNW A;  1V58 A;  1F6M C;  4ECB A;  4I5Q A;  4GF0 A;  3BCK A;  1XWA A;  1YF0 A;  3ZVJ A;  4HQS A;  3O76 A;  5L71 A;  1SJI A;  1M9B A;  1EOH A;  5B8B A;  5IQY A;  2P5Q A;  4TR1 A;  3FY7 A;  2K6V A;  1K3Y A;  2LRT A;  2C0F A;  3QFB C;  1E2Y A;  2H1G A;  3CMI A;  1OC8 A;  4Z2U A;  4HJM A;  2I3Y A;  1SYX A;  1F2E A;  1O8W A;  3IDV A;  3U6V A;  2NPB A;  2B5X A;  1DE2 A;  4YAP A;  2JU5 A;  2V32 A;  2Z9S A;  2DJ0 A;  1H4O A;  1H75 A;  4AJ8 A;  2H76 A;  4BVY A;  3GKM A;  2VAF A;  4F03 A;  3J7Y k;  1M2D A;  4G0L A;  1AAZ A;  3EWL A;  3K8N A;  1ZZY A;  2H71 A;  3GYK A;  4XS4 B;  1ACV A;  3DML A;  4BVX A;  4MH2 A;  3GNJ A;  1J9B A;  1ZYP A;  2PU9 C;  4HZ2 A;  1A2J A;  5JWQ B;  1ERV A;  1EGO A;  4PUR A;  6GSU A;  2KP1 A;  1G6W A;  3FRC A;  5D73 A;  1NHO A;  4GXZ A;  4KF9 A;  5ELA A;  2P0G A;  1GLP A;  1X5D A;  3LXT A;  1XPV A;  2CQ9 A;  2QKE A;  4AJ7 A;  2TRC P;  12GS A;  5DJM A;  1PL1 A;  3KMN A;  1EV4 A;  3TJF A;  3IAS 2;  2KOK A;  4IQA A;  2C4J A;  1QMV A;  4DSS B;  4MZB A;  1OE7 A;  3RAZ A;  2MMO A;  3RPN A;  4WR5 A;  1PD2 1;  1HNA A;  2H75 A;  4BL7 B;  1X5C A;  3FZ4 A;  3PH9 A;  4FO5 A;  2DMM A;  5ECN B;  5IM9 A;  3OR5 A;  4V2N A;  1B48 A;  1FB0 A;  5JWR B;  2R4V A;  2HSY A;  2WGR A;  3TJK A;  1PKW A;  3QOU A;  1BQ7 A;  3GL5 A;  2BJX A;  2C1Y A;  1A2L A;  2FGX A;  4ZB6 A;  2R0G A;  2K18 A;  1PSQ A;  2RII A;  2V2G A;  2EIR A;  1A0R P;  1O73 A;  2ALB A;  2FD3 A;  2PMT A;  3DVX A;  3APS A;  3IHQ A;  4EO3 A;  1EEJ A;  1ZL9 A;  2PN8 A;  3VI7 A;  2FWH A;  4I2T A;  2L57 A;  1SD8 A;  1XOB A;  5J9C A;  3G9B A;  3J7Y b;  2IJY A;  2AYT A;  4TKY A;  3R2Q A;  2K9F A;  4K2X A;  4YQM A;  4TR0 A;  5ID2 B;  3GMF A;  10GS A;  2IMK A;  1BYE A;  2A2R A;  3NZN A;  3FK8 A;  3Q74 A;  3GL3 A;  2I4A A;  2VCQ A;  3V1W A;  4FYC A;  2F51 A;  3VLN A;  2LJA A;  3GST A;  1W4V A;  1T4Z A;  2F8A A;  4DVC A;  4HQZ A;  1JZO A;  4BWQ A;  3G7I A;  3RPP A;  1GUH A;  1RW1 A;  3TCO A;  3BD2 A;  2OA7 A;  5CRW A;  2WZ9 A;  3TKS C;  3GIX A;  2E2G A;  2H70 A;  3F9U A;  1O6J A;  1R4W A;  5EPF A;  3KEB A;  1T1V A;  1A2M A;  3DKS A;  4RI6 A;  3VUR A;  2DC5 A; 
#chains in the Genus database with same CATH homology
 5EL8 A;  3W6G A;  3ERG A;  3LYK A;  2V6K A;  2IMD A;  5HQP A;  3PIN A;  2QA1 A;  2LUS A;  1VF3 A;  5JWO B;  4LA1 A;  3UAP A;  4K6X A;  5A5K A;  4P3Y B;  4TXO B;  5IIZ A;  1IYI A;  2YWM A;  2FY6 A;  4KSM A;  2VCV A;  3KZQ A;  4KND A;  5CRD A;  2H72 A;  1YY7 A;  2R3X A;  4J2F A;  4EIP A;  3CXG A;  3FMW A;  5DCG A;  4KA0 A;  3CRU A;  3CSI A;  2B7J A;  3GHA A;  3TDG A;  3VI5 A;  3UEM A;  3HDC A;  4GSS A;  1K0N A;  2LST A;  2YZH A;  4E8E A;  1M7T A;  4EDZ A;  1SL2 B;  2YOI A;  2RUF A;  1SL0 B;  4O5R A;  1YEX A;  4MZC A;  1A23 A;  1PX6 A;  1S3D A;  1LJR A;  4G9H A;  4NWY A;  4RUV A;  1G7O A;  1GWC A;  5HR1 A;  3CTG A;  3LSZ A;  2IFQ B;  4Q5N A;  19GS A;  1GLQ A;  3TRX A;  2H0I A;  5D9X A;  1TRS A;  3KXO A;  3ED3 A;  3LXZ A;  1PN9 A;  4TRX A;  4GWR A;  5KOW A;  2GS3 A;  2DIY A;  4EUY A;  3VK9 A;  5ABR A;  1O8X A;  1N8J A;  2OE0 A;  1V98 A;  2JZS A;  1GSS A;  5KOX A;  2GVP A;  2YP6 A;  2O87 A;  2XPE A;  2X4A A;  1TRV A;  1X9S B;  3GX0 A;  5D9T A;  1WP0 A;  3CSH A;  2B5Y A;  1LBK A;  4ZL7 A;  3UBL A;  2YWO A;  1O7U A;  4TR4 A;  3RHC A;  2BMX A;  1MD4 A;  1OYJ A;  4A5P A;  2GST A;  2N5B A;  4K0N A;  1VF1 A;  4TR3 A;  4QL7 A;  4XTS A;  2VM2 A;  5DDL A;  1Q4J A;  2F9S A;  4LMV A;  4F0B A;  4F9Z A;  2H30 A;  2ON7 A;  1M0U A;  3L9U A;  1GSF A;  4ZBD A;  5IMV A;  1XCC A;  4LMW A;  2C3Q A;  1DUG A;  2L4Q A;  5IMD A;  1N2A A;  3HA9 A;  6GST A;  1LU4 A;  3UL3 A;  5IO2 A;  3VFI A;  1I5G A;  1YEP A;  4FYU A;  3TB2 A;  2X99 A;  1TI3 A;  5ECL B;  4EIQ A;  3GTU B;  4Q5F A;  4PQI A;  2XBQ A;  3EYT A;  5KN1 A;  3UJ1 A;  3C7M A;  4HU9 A;  5FT3 A;  3ZFL A;  2QC7 A;  2GSS A;  2GQL A;  5EY6 A;  2A2P A;  4KUN A;  1WJK A;  4K2D A;  1V57 A;  1OKD A;  4TOP A;  1BJX A;  2C3T A;  4Z2T A;  4DSR A;  2H8L A;  1MEK A;  5DAK B;  5D96 A;  4IKH A;  1XW9 A;  5DAL B;  2M80 A;  3GFK A;  1Z6M A;  4KE3 A;  4EDY A;  5CRH A;  4MF7 A;  2VL9 A;  2PWJ A;  4GQC A;  2CVK A;  1HQO A;  5FWG A;  9GSS A;  2FHE A;  11GS A;  3ZIV A;  3MIX A;  2LRC A;  4IVF A;  4OMV A;  2WCI A;  3CRT A;  2IN3 A;  2DJ1 A;  3IE3 A;  3PGT A;  2PUK C;  3LEF A;  1FB6 A;  4L0U A;  3UIW A;  3IHG A;  4MPG A;  1K0B A;  1RQM A;  1GSQ A;  2H1B A;  3TRQ A;  3HXS A;  1QUW A;  2N5F A;  2C80 A;  5ELG A;  2VLU A;  3TUE A;  4ID0 A;  3VWW A;  3IR4 A;  3QFA C;  5HR3 A;  1ML6 A;  1TDI A;  4ML6 A;  3ZIT A;  1K0D A;  1YKC A;  1V40 A;  3F4T A;  4IS0 A;  2GSR A;  3ERW A;  4N10 A;  3KTL A;  2B7K A;  2C0D A;  3O6T A;  3WT1 A;  5GAN D;  2YWN A;  2MYG A;  2P31 A;  1AQX A;  4HOJ A;  2GZZ A;  3HVX A;  5KN0 A;  5AIV A;  4GST A;  3W8J A;  2F3M A;  1TTZ A;  3LYP A;  3H4K A;  3ZVJ D;  4CY6 A;  3FEU A;  4TXO A;  1J08 A;  2MBT A;  4MA9 A;  3QR6 A;  5G2Z A;  4MPF A;  1CQH A;  2ON5 A;  1QXH A;  5ECK B;  3TJB A;  3RDW A;  3IAM 2;  1THX A;  1R5A A;  3I6A A;  5GST A;  2XHF A;  1FW1 A;  1WRY A;  2CT6 A;  4FIW A;  4JU5 A;  3IOS A;  2DKI A;  4KW6 A;  4YKG A;  3Q6O A;  4HEA 2;  1BAY A;  3KTB A;  3P7X A;  4IJI A;  3S9F A;  3H1N A;  2PPT A;  4CY8 A;  5G5F A;  4N0Z A;  3EMX A;  2IWT A;  2GTU A;  1Y25 A;  2GQM A;  5ECM B;  5JCW A;  2QGV A;  1SKS B;  1GNE A;  3UAR A;  1ERU A;  2H01 A;  3ME7 A;  2PVO C;  2WB9 A;  4EC0 A;  2VD0 A;  4AF2 A;  1SEN A;  1Z5Y E;  5HFI A;  3C73 A;  5D8I A;  4POB A;  2YAN A;  3Q18 A;  4G19 A;  2OE1 A;  1JHB A;  1ZYE A;  5DQS A;  4Q5Q A;  2AB6 A;  4OO4 A;  5IMA A;  2YNX A;  4MP4 A;  4E8H A;  4HJ2 A;  5D93 A;  4CDO A;  4O7H A;  2R6K A;  2HRA A;  2AV4 A;  1HNB A;  3A2X A;  4JR4 A;  1TRW A;  3MYD A;  3DD3 A;  5G1K A;  2GDR A;  3L0H A;  3KH9 A;  2ZUP A;  4I6X A;  1NSW A;  3TOU A;  3A5I A;  3DWV A;  4EKZ A;  3I69 A;  1ZGN A;  2X8C A;  1BG5 A;  1K3O A;  3QD9 A;  2WS2 A;  4WBJ A;  1OC9 A;  3IC8 A;  3N9J A;  2FCH A;  1AUC A;  5J3R A;  4EVM A;  3KH7 A;  2GT6 A;  5F0G A;  5IO0 A;  4KDU A;  3A5W A;  1UVZ A;  5CRG A;  3KMO A;  2L5O A;  3MWH A;  2N5A A;  4KDY A;  3GKK A;  4MLY A;  1VRS D;  5H5S A;  5DVB A;  2JSY A;  4MNN A;  4OCF A;  4KAE A;  3IRA A;  2H6X A;  1ZCP A;  3WYW A;  3APQ A;  22GS A;  1TW9 A;  3D4T A;  2R37 A;  4ZIJ A;  20GS A;  1TOF A;  2H1A A;  3GV1 A;  4WBR D;  3GX8 A;  3DEX A;  1ZMA A;  4RQX A;  3WGX A;  4HS1 A;  1VF4 A;  4DEJ A;  4AJ6 A;  1MD3 A;  1AXD A;  5IOW A;  2WDU A;  3EMP A;  3HY2 A;  3EU4 A;  3SWL A;  1WOU A;  1IYH A;  5C04 A;  4HUA A;  2HZE B;  1MDJ A;  3FHK A;  3HZ4 A;  1R26 A;  2EIQ A;  3GN3 A;  3UVT A;  1AIU A;  3F0I A;  3HVS A;  1QGV A;  5G1L A;  4XRD A;  3WGD A;  2VOC A;  2H0H A;  3BBY A;  2C0G A;  3HD5 A;  1WE0 A;  4XS1 A;  3KJY A;  3F6F A;  3GRX A;  4ISD A;  4PX1 A;  4JED A;  1JZR A;  1JZD A;  1TK0 B;  3D5J A;  3ME8 A;  4FH8 A;  4XRA A;  4HU7 A;  2KP2 A;  4TVE A;  2JZT A;  3H79 A;  1TU8 A;  2OAD A;  3ZRE A;  5CNW A;  2GQK A;  4ULX A;  1YQ1 A;  4MJC A;  5BMU A;  3EIN A;  1U3I A;  1XVQ A;  5HR2 A;  2LRN A;  1GUK A;  4TW5 A;  4ECC A;  4KDX A;  5ENU A;  3HJO A;  2L4C A;  2OKA A;  4YH2 A;  4G10 A;  3VPT A;  2AUV A;  4MH3 A;  3FZ5 A;  4N0V A;  5IPG A;  3LGC A;  5DJL A;  3GUR A;  1M99 A;  2HI7 A;  5A4V A;  3U5R E;  3ISO A;  2DKH A;  2R0C A;  1AW9 A;  1XBS A;  3LQ7 A;  1OVN A;  4BPY A;  4QL9 A;  3ZFB A;  3IK7 A;  2HE3 A;  2PER A;  4IGJ A;  4NHW A;  5A4U A;  3L78 A;  1JLV A;  2DJ3 A;  3UOM A;  2OE3 A;  5DCH A;  1SL1 B;  1PMT A;  3IV4 A;  4IBP A;  4PQH A;  5JCG A;  3US3 A;  1A8L A;  4V2M A;  5H5Q A;  4ML1 A;  3F4R A;  2VO4 A;  4WR4 A;  3PR8 A;  4L5O A;  2DJK A;  1XXU A;  3KP9 A;  2HXK A;  1GTB A;  4OFT A;  1U87 A;  2A4V A;  2XBI A;  3E3E A;  3WD6 A;  1DE1 A;  1OKT A;  4XS4 A;  3D21 A;  4TR1 B;  5IOX A;  3CSJ A;  2H0G A;  2H19 A;  2HRN A;  1YDK A;  2IL3 A;  3I43 A;  3ZLP A;  4O5U A;  1A8Y A;  1PRX A;  2HZF A;  1ZYN A;  2GSQ A;  2R5G A;  4Q5R A;  1GH2 A;  4PTS A;  3GA4 A;  2B3S A;  4NHZ A;  3G7Y A;  1TI1 A;  2L59 A;  2YWI A;  4BVY B;  4G2E A;  1XZO A;  1PQN A;  4NXI A;  1TKD B;  1GUL A;  3EPT A;  1WIK A;  4L8E A;  4NAX A;  4JBB A;  2VCW A;  2RM6 A;  3N5O A;  1FHE A;  2MBS A;  2EIO A;  3M1G A;  1T8E B;  5B6N A;  1JLW A;  2XPD A;  3QAV A;  4BVX B;  4DSS A;  1WWJ A;  1B9X C;  4NV2 A;  2YJ7 A;  1EZK A;  2I1U A;  3GH9 A;  1GSU A;  4BL7 A;  5G30 A;  3LFL A;  1GSY A;  3GKN A;  3LG6 A;  4Z2R A;  1DBY A;  1SK0 A;  1X5E A;  3TJG A;  5IMZ A;  3BJ5 A;  3IPZ A;  2G0F A;  4F2I A;  2HRK A;  1ERT A;  2C0E A;  4IJ3 A;  3HZ8 A;  3GH6 A;  1V2A A;  1GRX A;  4EL1 A;  3MSZ A;  4ZB8 A;  2LJK A;  2C8U A;  3D22 A;  3ZRD A;  2ZCT A;  4H86 A;  2O85 A;  4TXV A;  4PXO A;  5IMC A;  2NBS A;  5AN1 A;  3P90 A;  3I9V 2;  2HT9 A;  1I9D A;  7GSS A;  4TN8 A;  2JZR A;  4GSN A;  2O8V B;  2HSM A;  4OFN A;  1B4P A;  1OC3 A;  3KCM A;  3HJM A;  4V1A g;  1YF1 A;  3ZMK A;  1Z7R A;  2VIM A;  2YN1 A;  1VF2 A;  1MTC A;  4MCU A;  4YQV A;  2AHE A;  1TXX A;  2RLI A;  4L5L A;  5E59 A;  4GQF A;  3APO A;  2KUC A;  3UBK A;  1U6T A;  1F3A A;  4HDE A;  5IMF A;  2DLX A;  3EVI A;  4RI7 A;  1S3A A;  5ID2 A;  4USS A;  3LW9 A;  1JZW A;  5G31 A;  5J4U A;  3ZYW A;  2M46 A;  3HKR A;  1PKZ A;  4KH7 A;  2VL2 A;  1T4Y A;  3W8S A;  5ECH B;  1X0R A;  1U3A A;  2DML A;  1G6Y A;  2I9H A;  4OO5 A;  3BOA A;  1CQG A;  4X1U A;  4O92 A;  1Q98 A;  2VLT A;  5CO3 A;  5G5E A;  2LKU A;  3WGE A;  1EEM A;  3UMA A;  3E9J B;  5GAP D;  2M72 A;  1GSE A;  2DJJ A;  1OE8 A;  4ACS A;  1W89 A;  2J9H A;  4KSO A;  1ST9 A;  2A2S A;  2H74 A;  3L4N A;  1ILO A;  5ECS A;  3TKP A;  1SD9 A;  4NMU A;  1O85 A;  4GRF A;  2DJ2 A;  5AGY A;  5HFG A;  4I97 A;  2AAW A;  3LJR A;  2PVQ A;  4POL A;  4XS6 A;  2O7K A;  3M8N A;  2R0P A;  3HCZ A;  3DXB A;  1MDK A;  1UA5 A;  4MAB A;  1UC7 A;  4WXT A;  3VPQ A;  1B9Y C;  1JFU A;  4LL1 B;  1Z3E A;  1WMJ A;  4L0W A;  1UN2 A;  2QA2 A;  1R7H A;  4MF6 A;  1Z7P A;  4I2U A;  3F8U A;  4DSQ A;  1EWX A;  3MNG A;  5GZZ B;  1YKA A;  2WJU A;  3QMX A;  4YAV A;  2CX3 A;  2MZC A;  4MMM A;  1M2B A;  1GUM A;  2LQO A;  4QQ7 A;  2XC2 A;  3BCI A;  1VGL A;  4JZQ A;  4PNF A;  2B6M A;  2REM A;  4X4J A;  2IFQ A;  3DYR A;  3D0Z A;  1X9M B;  3G7J A;  2J23 A;  4IN0 A;  5COH A;  2B5E A;  3GKX A;  3P2A A;  4F0C A;  1GP1 A;  5F06 A;  5J9B A;  1TK5 B;  2JAD A;  2YPM A;  1M9A A;  5D9V A;  2V6O A;  3QAG A;  1KBN A;  2LNT A;  3KD0 A;  4LLR A;  4KB3 A;  4K5S A;  4D73 B;  2VCZ A;  1X9W B;  1XIY A;  1PGT A;  3C1R A;  3C8E A;  3RBT A;  4POM A;  3F4S A;  2PBJ A;  2I81 A;  3GUS A;  5ECP B;  5DBQ A;  1TRU A;  2MMZ A;  2VUP A;  4X0X A;  2EC4 A;  5CP1 A;  4CW9 A;  2IIY A;  5B6M A;  1M2A A;  1PL2 A;  1Y6E A;  6GSX A;  5EVO A;  4POK A;  2VL3 A;  3MAK A;  2VM1 A;  2LNS A;  3IBH A;  3A2V A;  2WFC A;  2LV3 A;  2DIZ A;  2VCT A;  2ZNM A;  5ECO B;  1K0O A;  4GTU A;  3L9S A;  2GZP A;  4OFM A;  5AIX A;  2CAQ A;  1O81 A;  3C1S A;  1URM A;  3H93 A;  4MJB A;  3GTU A;  2IMI A;  3AY8 A;  4YQU A;  2FLS A;  4NPB A;  5F05 A;  3KIJ A;  4ECI A;  5KN2 A;  4ZB9 A;  3VWX A;  2V1M A;  2B1L A;  3Q19 A;  2HFD A;  3VWV A;  5J41 A;  3RHB A;  3GSS A;  4XHM A;  3TRP A;  3NOF A;  1AQV A;  3DIE A;  4ZBA A;  4K7O A;  1XWB A;  1T3B A;  2H1D A;  3C71 A;  4X43 A;  3NIV A;  3H8Q A;  4Z7X A;  1PA3 A;  4WF5 A;  4AGS A;  5DAK A;  3M3M A;  1ERW A;  2NTO A;  5DAL A;  4IW9 A;  1B4Q A;  2MMA A;  1ABA A;  2HYX A;  3M0F A;  4J57 E;  3KP8 A;  1R5P A;  1T7P B;  4PGT A;  1FAA A;  2YCD A;  2LS5 A;  4OWY A;  4IQ1 A;  3CBU A;  2IMF A;  13GS A;  4GCI A;  3D4M A;  4JR6 A;  2X8H A;  2E7P A;  2DBC A;  2QSI A;  2E0Q A;  4HI7 A;  2RUE A;  4K9Z A;  4HZ4 A;  5B8A A;  4J56 E;  2CZ3 A;  2H6Y A;  2OAC A;  4OD7 A;  2GGT A;  1TJD A;  6GSV A;  5GSS A;  1WPI A;  3KGK A;  2CZ2 A;  4PUF C;  3F3Q A;  3EUR A;  3A3T A;  5KEJ A;  4EE0 A;  2WUL A;  2JL4 A;  2L6C A;  2CVD A;  4F82 A;  4IP6 A;  4PQ1 A;  4ICY A;  4IHU A;  17GS A;  1OAZ A;  4EXJ A;  5B7C A;  2P5R A;  3TGZ A;  2LEG A;  4FQU A;  4K0G A;  5CYY A;  3FR3 A;  2JSZ A;  1XOA A;  4JRR A;  2FWG A;  2R2J A;  4ECJ A;  3IC4 A;  1T00 A;  2CA8 A;  2OBK A;  1K0A A;  1XW5 A;  4IEL A;  4G0I A;  4V1A p;  1BED A;  4N30 A;  3QAW A;  1EV9 A;  2VLV A;  8GSS A;  2VD1 A;  1KTE A;  3DGQ A;  2FUG 2;  1U88 A;  1FVK A;  1Z6N A;  1DSB A;  3PPU A;  1HYU A;  4WKW A;  4BA7 A;  3VWU A;  1SK2 A;  2DSA A;  18GS A;  3FW2 A;  4BWS A;  1SU9 A;  4PNG A;  2X49 A;  1USB A;  14GS A;  2YV9 A;  4NV5 A;  4YKF A;  5C00 A;  4PUA A;  2F8F A;  2CV4 A;  4MJE A;  5H5R A;  3IK9 A;  1F37 A;  2HSH A;  2E2M A;  1XFL A;  4WF4 A;  3F63 A;  2GZY A;  1MDI A;  5JCU A;  2L5L A;  5HR0 A;  2VL2 C;  5D9W A;  3LWA A;  1GSD A;  4KCE A;  1EOG A;  1QK8 A;  4K7I A;  4ZL9 A;  1BX9 A;  4D73 A;  5AIS A;  4FYB A;  1THO A;  1SKR B;  3SBC A;  1V9W A;  4JE1 A;  5INY A;  1SJ6 A;  1C72 A;  5A4W A;  5J5N A;  1YZX A;  1HNC A;  4XIH A;  2FNO A;  3HJP A;  2CVB A;  4MDC A;  3WT2 A;  3ZZX A;  1TK8 B;  5ECI B;  4K7N A;  2CAI A;  1PX7 A;  3M9K A;  1E6B A;  2FA4 A;  2O89 A;  1NHY A;  3TKS E;  4G0K A;  1XWC A;  5BRT A;  1QFN A;  1TP9 A;  2UZ8 A;  1ZYQ B;  5DQY A;  3IA1 A;  1SJZ A;  2HLS A;  1A0F A;  4ZXG A;  3F6D A;  2X64 A;  1AQW A;  1FG4 A;  5CAX A;  3MDK A;  2X8G A;  2AJQ B;  3ERF A;  2TRX A;  1EP7 A;  2K8V A;  1S3C A;  5CRE A;  4IP1 A;  4N11 A;  2GT5 A;  1K0M A;  4K1F A;  2FA8 A;  4KGI A;  3L9V A;  2JAC A;  2YJH A;  4MZW A;  1FVJ A;  4ZBB A;  1ON4 A;  1KEB A;  5HFK A;  4MK3 A;  5LNK e;  3P8W A;  4K5R A;  1Z9H A;  1OC9 B;  1AC1 A;  4MF5 A;  2RM5 A;  5ECQ B;  3TKQ A;  3EE2 A;  3TKS A;  3O3T A;  5IPH A;  2GLR A;  2K8S A;  1NM3 A;  5LD0 A;  1EGR A;  3IXR A;  4ILF A;  1GTI A;  2D2Z A;  4K8M A;  2B1K A;  2HNL A;  2CX4 A;  3CTF A;  3D6I A;  2IPA A;  3QCP A;  2HZE A;  1PN0 A;  1HD2 A;  3FZ9 A;  6GSY A;  2IME A;  4RQR A;  3ZTL A;  1SYR A;  4O5Q A;  3EC3 A;  1YJ6 A;  4LL4 B;  5F8B A;  3DVW A;  2A4H A;  1XVW A;  3M9J A;  2OBI A;  16GS A;  4I8B A;  4V2L A;  5LCZ A;  2VCX A;  3EU3 A;  3QPM A;  1J0F A;  1GTU A;  2KLX A;  4WEY A;  1A24 A;  1XWG A;  3KM6 A;  5F07 A;  1EP8 A;  4O32 A;  3FKF A;  2YV7 A;  2HRF A;  4KCA A;  4ZL8 A;  2BTO T;  1K0C A;  1SK1 A;  2PGT A;  3ZL5 A;  3HYP A;  1RK4 A;  1FOV A;  1GTA A;  4WET A;  2NDO A;  2C3N A;  3HVV A;  5KN3 A;  3FR6 A;  4GLT A;  2OJL A;  3TOT A;  1XWK A;  1G0T A;  3DRN A;  5FHI A;  2LJR A;  1XW6 A;  1B8X A;  2WRT A;  4XCS A;  2L6D A;  3ZIJ A;  3FZA A;  1KNG A;  3R3E A;  3TKR A;  4MJA A;  1K3L A;  6GSW A;  1SKW B;  4KX4 A;  3ZML A;  3LOR A;  3JCM L;  4EF0 A;  2KHP A;  1GL8 A;  5E4W A;  3TJJ A;  3FYG A;  4OCE A;  2H6Z A;  1FO5 A;  1G7E A;  1NW2 A;  1TU7 A;  2ES7 A;  3FR9 A;  3A2W A;  2YZU A;  2MMN A;  3F3R A;  3UVH A;  2H73 A;  5ECR B;  2H66 A;  4CHS A;  1FOH A;  2TIR A;  2G2Q A;  2LQQ A;  3HHV A;  4ZIL A;  2V41 A;  3QDN A;  2LTK A;  2FWE A;  6GSS A;  1F9M A;  3CYN A;  3E0U A;  1QQ2 A;  2FWF A;  2NVL A;  1ZOF A;  1F3B A;  1GNW A;  1V58 A;  1F6M C;  4ECB A;  4I5Q A;  4GF0 A;  3BCK A;  1XWA A;  1YF0 A;  3ZVJ A;  4HQS A;  3O76 A;  5L71 A;  1SJI A;  1M9B A;  1EOH A;  5B8B A;  5IQY A;  2P5Q A;  4TR1 A;  3FY7 A;  2K6V A;  1K3Y A;  2LRT A;  2C0F A;  3QFB C;  1E2Y A;  2H1G A;  3CMI A;  1OC8 A;  4Z2U A;  4HJM A;  2I3Y A;  1SYX A;  1F2E A;  1O8W A;  3IDV A;  3U6V A;  2NPB A;  2B5X A;  1DE2 A;  4YAP A;  2JU5 A;  2V32 A;  2Z9S A;  2DJ0 A;  1H4O A;  1H75 A;  4AJ8 A;  2H76 A;  4BVY A;  3GKM A;  2VAF A;  4F03 A;  3J7Y k;  1M2D A;  4G0L A;  1AAZ A;  3EWL A;  3K8N A;  1ZZY A;  2H71 A;  3GYK A;  4XS4 B;  1ACV A;  3DML A;  4BVX A;  4MH2 A;  3GNJ A;  1J9B A;  1ZYP A;  2PU9 C;  4HZ2 A;  1A2J A;  5JWQ B;  1ERV A;  1EGO A;  4PUR A;  6GSU A;  2KP1 A;  1G6W A;  3FRC A;  5D73 A;  1NHO A;  4GXZ A;  4KF9 A;  5ELA A;  2P0G A;  1GLP A;  1X5D A;  3LXT A;  1XPV A;  2CQ9 A;  2QKE A;  4AJ7 A;  2TRC P;  12GS A;  5DJM A;  1PL1 A;  3KMN A;  1EV4 A;  3TJF A;  3IAS 2;  2KOK A;  4IQA A;  2C4J A;  1QMV A;  4DSS B;  4MZB A;  1OE7 A;  3RAZ A;  2MMO A;  3RPN A;  4WR5 A;  1PD2 1;  1HNA A;  2H75 A;  4BL7 B;  1X5C A;  3FZ4 A;  3PH9 A;  4FO5 A;  2DMM A;  5ECN B;  5IM9 A;  3OR5 A;  4V2N A;  1B48 A;  1FB0 A;  5JWR B;  2R4V A;  2HSY A;  2WGR A;  3TJK A;  1PKW A;  3QOU A;  1BQ7 A;  3GL5 A;  2BJX A;  2C1Y A;  1A2L A;  2FGX A;  4ZB6 A;  2R0G A;  2K18 A;  1PSQ A;  2RII A;  2V2G A;  2EIR A;  1A0R P;  1O73 A;  2ALB A;  2FD3 A;  2PMT A;  3DVX A;  3APS A;  3IHQ A;  4EO3 A;  1EEJ A;  1ZL9 A;  2PN8 A;  3VI7 A;  2FWH A;  4I2T A;  2L57 A;  1SD8 A;  1XOB A;  5J9C A;  3G9B A;  3J7Y b;  2IJY A;  2AYT A;  4TKY A;  3R2Q A;  2K9F A;  4K2X A;  4YQM A;  4TR0 A;  5ID2 B;  3GMF A;  10GS A;  2IMK A;  1BYE A;  2A2R A;  3NZN A;  3FK8 A;  3Q74 A;  3GL3 A;  2I4A A;  2VCQ A;  3V1W A;  4FYC A;  2F51 A;  3VLN A;  2LJA A;  3GST A;  1W4V A;  1T4Z A;  2F8A A;  4DVC A;  4HQZ A;  1JZO A;  4BWQ A;  3G7I A;  3RPP A;  1GUH A;  1RW1 A;  3TCO A;  3BD2 A;  2OA7 A;  5CRW A;  2WZ9 A;  3TKS C;  3GIX A;  2E2G A;  2H70 A;  3F9U A;  1O6J A;  1R4W A;  5EPF A;  3KEB A;  1T1V A;  1A2M A;  3DKS A;  4RI6 A;  3VUR A;  2DC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...