2KUMA

Solution structure of the human chemokine ccl27
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 27
publication title NMR analysis of the structure, dynamics, and unique oligomerization properties of the chemokine CCL27.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kumA01
1WTWA 1B2TA 5E4WC 1ILQA 1ICWA 4CJ1B 1IKLA 1X3PA 4ZKCB 2IL8A 2MGSA 3GV3A 3DEPA 1KNAA 1HUMA 2NZ1D 1AP0A 1EL0A 3DEOA 1TVXA 1GUWA 4HEDA 1O7ZA 2KVMA 3D6WA 4RAUC 2FJ2A 1BO0A 3UI2A 1ZXTA 1DOLA 2B2WC 3MTSA 4XT1B 1WTQA 2BDNA 1ML0D 3N52A 4OIKA 4CJ0B 4HAEA 4XT3B 4X3SA 1WTOA 2B2VC 2M2LA 3MWYW 4NW2A 1QE6A 1U4LA 4MHEA 4QUCA 2B2TA 2K05A 5EPJA 2L9HA 1HRJA 3I8ZA 1RTOA 1U4MA 2EE1A 2HCIA 1G2TA 1G6ZA 1EOTA 1HA6A 1EIHA 1XYIA 2B2VA 3HP3A 3Q6SA 4ZKBB 2N88A 1NAPA 1NR4A 4U68A 1DONA 1PFBA 1Q3LA 1BBXC 1CA6A 1WTRA 1F9PA 2MP1A 2K28A 1WTPA 2B2UA 2L11A 1DOMA 1MSHA 3TN2A 5EKIA 1CM9A 1J8IA 3IL8A 4HSVA 4MN3A 4R8IA 1B53A 1PDQA 2J7ZA 2D9UA 1WVLA 1HHVA 2DY8A 1U4PA 2EOTA 3FPUB 1O80A 4IURA 2B2TC 1RODA 2MPMA 4IUTA 1A15A 3SVMA 3F2UA 1WD1A 1ILPA 5CMDA 1ESRA 1RJTA 1HFGA 5D65A 1MI2A 2FFKB 4HCSA 3I91A 3H91A 1F2LA 4X3TA 5T1GA 1SSOA 5EPLA 5CBEE 1BF4A 1F9QA 1PFNA 2DY7A 1HFNA 2RVLA 4IUVA 5CORA 2HUGA 2B2UC 2K1BA 4LMQD 3DM1A 5JJZA 1BNZA 1MSGA 5EPKA 5COYA 4RWSC 4ZAIA 4ZLTF 1DZ1A 1JICA 2KUMA 4OIJA 1DOKA 1PFMA 1HUNA 2KEEA 2L12A 2X6GA 4QUFA 4X3UA 2K03A 5CBAE 1EQTA 2X69A 1JE4A 3LWEA 3P7JA 2KOLA 5D14A 2JYOA 1SAPA 3FDTA 4ZK9B 1G2SA 4UAIA 1EIGA 1B4OA 1KNEA 1VMPA 2FMMA 2N55A 2K04A 4O42A 2Q8TA 2FHTA 1J9OA 4XDXA 1AZPA 5DNFA 1RHPA 2HDLA 2RA4A 2RSNA 2HCCA 1C8CA 1G91A 2JP1A 1WTVA 2KECA 5E4XA 2NYZD 1CA5A 1RTNA 2VXWA 1WD0A 1IL8A 4CJ2C 1U4RA 1B3AA 1SDFA 2NWGA 1O7YA 2MJ8A 2Q8RE 2XIWA 3QO2A 4R9WA 2EPBA 1MGSA 2HDMA 4RA8A 4X3KA 2R3ZA 2RSOA 3ONAB 1XX8A 1F9SA 1VMCA 1B50A 2B2YC 1X3QA 1NCVA 5AFWA 4DN4M 5EJWA 1S4ZA 2H1EA 3G7LA 2FINB 3I3CA 1AZQA 2SDFA 1LV9A 2K01A 4IUQA 1M8AA 2B2YA 2KEDA 3TZDA 1F9RA 2CVRA 3KBXA 5T1IA 1E0BA 1QG7A 2X6LA 2B2WA 3IFDA 3GV6A 1NR2A 1X32A 2L4NA 3I90A 4IUUA 3R93A 1QNKA 1WTXA 3KUPA 4IUPA 1IKMA 1PLFA 2L1BA 5EQ0A
chains in the Genus database with same CATH superfamily
3HOVG 1OTCA 4MTNA 2UXBQ 2E5LQ 5C3WA 1HNWL 2NUCA 4CJ1B 1FYCA 4TKOB 3TP7A 2MQHA 1X3PA 1K9MC 1JQYD 4O2DA 3PIPA 5ELDA 1L0XB 2EJMA 4HIOA 3DEOA 4RAUC 1I50H 2FJ2A 3GTPH 2ZJRA 4FXDA 1V8QA 4AIMA 3G48A 5M5XB 5EBCA 4AYBB 2JA8B 3CC7A 3OWEB 3KJOA 2FXQA 1YVCA 2RQXA 5JEAG 3VA5A 5AJ3L 4FO2A 2IX1A 3ZYYX 4TVAB 1D5XC 1CZWA 2OQ0A 3PUYA 1MSHA 4P72A 5CV5A 1TY2A 1N33L 1A2TA 1BKBA 2E76C 4JI7L 3T13A 2F0NA 2MPMA 4GKJQ 4EVOA 4R4IA 4IFDJ 4J8QA 1PXUA 2NVYB 1F2LA 1RDPD 1HZBA 1SE8A 1QOHA 4DUYQ 4MNOA 3CQZH 1F2MA 4YY3Q 1S5CD 3M4QA 3M4OB 1JICA 4J1MA 1PFMA 1OXVA 4BY1H 3P7JA 1FVIA 5M3MH 4LFCL 1LTID 1JR0D 4JI8Q 2FHTA 1EU3A 4DR2Q 2CH4A 2N8NA 3LNNA 3X3NA 4RHSA 3O13A 3MZ5A 2JJQA 4QB4A 3PV0A 4HTHA 1FL0A 3SEBA 2JA6B 1A3UA 1EY9A 4UDUC 1F2ZA 3PGZA 1B50A 2EJGC 3WWVA 1YHAA 1ZYRD 5LL6X 2CHBD 4DUZL 4LF9Q 5CR3A 1XMQQ 4P71A 3HKZG 1A3TA 5IWAQ 1IHZA 2K32A 5K36G 1I4QA 2R7FA 1RKNA 2D0OA 1BCPD 2WAQB 3R2IA 3EJIA 3RLNA 5IYDH 3VR5A 5LHY1 3SK5A 2B8FA 3Q23A 1RCVD 4QIWE 1KDAA 2NB0A 1STGA 2BDOA 3CCJA 4ZKCB 3E9HA 1X3FA 4XIGS 3UDGA 3NK9A 1I5FA 1EL0A 2ZTDA 1SBBB 1HJPA 1SE4A 3BDOA 3HOZH 4XT1B 1ML0D 4QUCA 5JVG3 1EWCA 3ZJYC 4R4OA 5KIXA 4EQNA 3TP6A 3HOWH 1WTPA 1KLGD 4AQYQ 4H7BA 5JAVA 5EKIA 2IPKD 2BOSA 1S40A 4BS9A 3PIOA 1TS5A 1XXGA 4TSSA 2EOTA 4HJ8A 4FXGC 2NZOA 2NN6H 1MI2A 1SN8A 2FFKB 1VQDA 1VQPA 2A69C 3K8AA 4OWWB 4PQXA 4JW0A 4DV2Q 5FLMH 4A3MG 2VB2X 3K59A 1VQHA 3CF5A 4IZ8A 1BUVT 4A3MB 1KTKA 4EQPA 2N55A 4LNQA 5C5LA 2F3VA 4DAPA 3QG1A 1K8AC 1HNWQ 1B1ZA 5IP7H 2Y0SE 4CDCC 3S2HH 4IALA 3KLWA 1P8LA 1S72A 3F1ZA 4A3LH 3KYHC 1ASYA 1VF7A 4C3IG 2Q8RE 4A3JH 3L0OA 1JOQA 5LMUL 5C0XH 3BZCA 3K5MA 3QWNA 2NVQH 4NMZA 5D3IB 3IFTA 3DWAA 4Z9CB 4CDFC 2RBMA 5ELEA 2UUBL 3NBHB 1WOCA 5BN4A 3CCLA 2F0TA 4YCUA 5AJ3Q 5M3FH 4DR5Q 2WKDA 3T1HQ 4KLKA 2P5ZX 2WP8J 4X64L 1N33Q 3STBC 1NR2A 5I6WA 5BN3A 2JA7G 1EUJA 2EY6A 4JI7Q 1PV4A 3CW2C 3VA7A 3S15B 1WTWA 2PZUA 5KGUA 2R93G 4UHVA 4B08A 4Y7NH 2WB1G 2JA7B 3KJPA 1YJWA 1PH5A 1PTOC 3M4PA 1XTCD 3VR2A 2WB1B 1UWVA 3EROA 2LFNA 3D6WA 3MHBA 4H44C 1MBYA 2E2IH 3N52A 1QE6A 1C0AA 4MHEA 1STBA 4JYAL 4LFCQ 5GADC 1JC7A 4IO9A 3S1QH 2B2VA 1VQOA 1G51A 1BCPB 3NHHA 2ICIA 1NAPA 1LTSD 1Q3LA 2E74C 5I6YA 5C4JH 1I4XA 4ODGA 2EXDA 3E6ZX 3K7AH 2KHSA 1J8IA 2JA5G 4K8IA 4DR1L 1HFNA 3OTOL 5IT9L 5KYLA 1ESRA 4S3SA 2JA5B 1K8OA 1X55A 2CWPA 1X9NA 2YTYA 4KV6A 3NPPA 3M7GA 4LUOA 1LTGD 2OT2A 3FRPB 4KY6A 4YWKA 5J39A 1BNZA 5C44H 3K80C 1LTAD 1ICFB 3A5ZB 4RH6A 4OIJA 4A3CG 1JE4A 1VQKA 5D14A 1SAPA 2ZT9C 3WOFA 5JPNC 2A6ED 2Q8TA 3TEHB 3F2BA 2PPBC 5IYCG 3OWFA 1WYDA 5M5WH 4K0KL 2I0QA 2ZXRA 1KXLA 2EZVA 1CA5A 3H0GH 2F3IA 3TP8A 3M3YH 4KN4C 2A68C 4GN5A 1SDFA 1EYGA 1O7YA 2EVBA 2EPBA 3FKIB 1PH4A 4JPBW 2RSOA 3I7FA 3GTLB 1VMCA 1GVPA 4LF6Q 5M5YH 4HN7A 4FF3A 1DCZA 2EY5A 4KMUC 4LF4Q 2CQOA 4LJZC 3IRBA 4UY8C 2PZWA 1Q8KA 2AUKA 1C48A 3KBXA 3GDEA 3HKZE 1KAWA 2PW7A 2QKIC 1SR3A 4N8FA 3CPWA 1PRTF 1W2BA 4JV5Q 1LLRD 1YBYA 2G5DA 3MXNA 4KD4A 5C4XH 1FNUA 1STAA 5IOCA 1QZHA 1EY6A 3I73A 1ICWA 2IL8A 1GJXA 1VQNA 2WACA 1Q1EA 1TVXA 2ZXOA 5IP9G 2BH2A 1IW7D 3MTSA 2BDNA 2YV5A 3J80i 1RL2A 3G6JB 2PYKA 5EPJA 4YIJA 3I8ZA 4LAAA 3TSSA 3S16B 4ZCKA 1PTOH 1B44D 1HH2P 1AH9A 1H9MA 4JK1C 1DD2A 2F0UA 4PZ6A 1EWHA 3HOUG 2VQFL 1YIJA 4KY7A 1PH7A 3HOYG 1R9TH 3JAMc 3MEFA 4R8IA 1HHVA 3G71A 2J7ZA 5LMUQ 2DY8A 2RHQB 1CKNA 3NTHA 1N34Q 1Z6HA 4HCSA 1R4PB 3A74A 3KBGA 3KDFA 3CKIB 1STEA 4HR7B 2K33A 3H91A 3GTGH 3SXHA 3J7AV 2DY7A 3MXGA 1JWMD 1K83B 1UE7A 2EYOA 2QCPX 4ZAIA 4ZQ3A 2CW0D 4ZLTF 1ASZA 2WKCA 4X64Q 1WFQA 3DM3A 5EBDA 2KEEA 2L12A 4QUFA 1L0YB 2N49A 4H13C 3H3VC 3PO3G 2ICEC 5D3DA 1B4OA 4TQUS 4O42A 3TS2A 4K2LA 2YYZA 1KIXA 1CKMA 4LW1A 1XJVA 3PO3B 2IX0A 2F4IA 2SNSA 5IGFA 3NTKA 2R7ZG 1D5ZC 1EQQA 2F03A 3R2TA 1Q46A 3H6MA 1NJIC 5IGGA 2WFWA 4C3HH 1SE2A 5CV9A 2K75A 2R3ZA 4JYAQ 1CZGA 1IYVA 4WFN3 4YHHL 1QJOA 1GOZA 2PNRC 5M5XH 2JA8H 4IPCA 2B2YA 4DV4L 3EQLC 1BOSA 2KCMA 2LSSA 4KJNA 4M8AA 3KFUA 3I90A 4DR1Q 3I4NG 1CHPD 3BDLA 2KENA 5C3EB 3PO2H 3OTOQ 2PMZE 3W2DA 1YNND 2AWOA 1JORA 3TRZA 2I46A 1EOVA 2WB1E 4B3ML 4CKBA 1DJRD 4YWLA 3CP0A 2NVYH 3CD6A 3I4MG 4ZYSA 3MWYW 5IYBG 3BVMA 1U4LA 1VQIA 2CKZB 2TSSA 3QIAA 2JE6I 3M4OH 4A3FG 3I4MB 1IYJB 1HA6A 2K5DA 2LS01 2PQAA 4KKSA 1XYIA 4PMCA 4K0KQ 4A3FB 1WCMG 5BN5A 5FK9C 3CHBD 4QIWB 2K28A 5L37A 4F87A 2C9OA 1JJ2A 4GKKL 1WCMB 4HSVA 2PZTA 3DWQA 3CU7A 2F4VL 4MZ9A 1JOKA 3MXNB 4PNYA 2RKSA 5IGCA 2JA6H 3DLLA 2V4DA 1STHA 5CBEE 4G7HC 1M4VA 2KQ3A 1K0SA 1J5EL 1V43A 2G9DA 2NN6I 1VQ8A 5EPKA 5COYA 4NB3A 4A3IG 4GOPA 1CTMA 5IT9E 1Y8NB 4UP8A 1TWGH 5FLXc 1SNCA 3NXWA 2F1MA 1KDBA 2KOLA 1V1QA 3BVGA 3MFGA 3T56B 3X3MA 3NWTA 1SJHD 1V1OA 1S3OA 1YNJD 2RF4A 2C35B 1AFPA 2J0TD 1M1KC 1LT4D 3J80L 1J9OA 2MFIA 2RCFA 4DNTB 5A35A 1NE3A 5K36H 1ZYRC 2HCCA 3CCSA 4A3GG 2JA9A 1SFOB 2UUCL 2NYZD 2I5HA 3ND9A 1HTPA 1OXUA 4DAVA 3NELA 4K14A 1Q82C 1I94Q 3H3VH 1VF5C 2KCTA 1PH2A 2EYPA 3ER0A 4YCWA 4RA8A 1CKNB 1BCPC 1NNXA 1LT3D 3A8JE 3ONAB 4N8X1 4A3EG 4C3JG 1C4QA 3KDFB 2XWBB 2ZXPA 5C0XI 3QJYA 4C3JB 4NXNL 2R6GA 2R92B 3RN5A 2EDGA 5T1IA 3G6EA 3K5NA 3TZUA 2Y0SB 4HMJA 3NQIA 4NXML 1IBLQ 1IKMA 3GTQB 5EQ0A 1GO3E 5HURA 4HSPA 1J6QA 3CCMA 4A3BG 3CCQA 1ONLA 3GV3A 2XRQD 3JC66 4X66L 4L6TB 1HUMA 3S14B 4A3BB 3UE0A 2Z8LA 1BO0A 1WTQA 5KEEA 2IJ0A 2DN8A 4WRDA 5C6AA 1PH3A 2EYMA 3CPFA 4A3MH 5JJKA 3J81c 2MP1A 3CCRA 4BA1I 3KOJA 4OO1G 1GM5A 4FF4A 4DAYA 3HOVB 3C46A 1PH8A 1Q86C 3RMHA 2VUMG 2F0VA 5DEHA 2Z4HA 1M90C 3S2DB 1SRUA 4IUTA 2LKVA 1A15A 1PH6A 3F2UA 1BQQT 1WD1A 1HR0W 1ILPA 4ALPA 2VUMB 3RN2A 2XGTA 4YHHQ 1VQ5A 3UDFA 1I4RA 1Z47A 2HHHL 3C2PA 1UAPA 3J7AF 1HXYD 5I9PA 3ERSX 4DV4Q 4A93G 5C4ZA 1UEBA 4JI3Q 5CBAE 1A62A 4A93B 3BG3A 4ME5A 2F0MA 4R4QA 2PQAB 1RIPA 4A75A 1K0RA 4XQJA 4RGOS 2F0JA 3AFQA 1EY0A 5DNFA 2HDLA 2Z0SA 2IT1A 3GD7A 4B3MQ 3S15H 2HIXA 4XYOA 2JA7H 3NE5B 1KRSA 1EZ6A 4PG3A 4R9WA 1VQ9A 1L1OA 1EY7A 4XXEA 1OXSC 2F0KA 2E2JB 4ZUJA 3KF6A 5IE8A 3PUXA 4JBKA 5KYIA 4KHZA 3IAYA 3L7ZC 4DNIA 2MO0A 4POGA 3I3CA 2G9HD 3TZDA 1PZID 4GKKQ 1H9SA 1E0BA 4CBVA 4GLAC 1DXMA 3T53B 4IUUA 3BZKA 3KUPA 1PRTD 3N6RA 2F4VQ 4DGZA 3HOXG 3UE1A 4DR6L 1YEZA 3DMUA 1I3QB 3QB3A 2L5TA 5JOBA 3K0XA 3GTJB 2QA4A 1J5EQ 2BE5D 2B63G 2OCEA 2IX3A 1AEXA 3C3LA 2B2VC 4F8MA 4LF8L 2B63B 1VQCA 3A8IE 4IFDG 5CYUA 1RF2D 3HKZB 4DNRB 4B3RL 3Q8DA 1CA6A 1WTRA 2F3WA 4A3CH 2UUCQ 2B2UA 2ZM6L 5ELBA 4POFA 3U58A 2Q2UA 2AQ1B 4DV5L 4CDEC 2E2HB 4GS3A 3FKIH 2A6EC 1C9OA 4P73A 1X3EA 4IJLA 3T16A 4NDXA 4X62L 4R4TA 4K5VA 4KTAA 1YI2A 4QY7A 3D31A 1BBUA 4WJWA 3JAML 3OPOA 4BBRG 1R4QB 4X3UA 3TQYA 5GROA 1Y1VG 4AH6A 2JYOA 4NXMQ 1VQLA 1EIGA 1E3PA 3OSOA 5JJLA 1WTHA 4BBRB 4I65A 1Y1VB 2A6HD 4DK3C 2KCNA 3I56A 1LTTD 1Y69U 2AQ2B 4X66Q 1HNZL 5G3LF 1JJGA 4JI5L 1JT8A 3KLSX 2ZTEA 3QO2A 1GHJA 3J80E 3EA6A 2F0HA 2F52A 3U4VA 1LO5D 4DXGA 5EJWA 4IPHA 2FINB 4QL5A 1LV9A 2MNAA 1ZEQX 5M9OA 3S16H 2IW3A 4BBSG 2UXDL 4DK1A 1CFMA 2OXPA 1CUKA 1IW7C 1AE3A 1EWIA 4BBSB 3MVVA 1XPUA 5HGTA 4KHPL 5ELNA 1E2VA 1OXXK 1B2TA 4J6HA 1KQSA 1G8ZD 4C3IB 4K8JA 4DK0A 2HHHQ 2B29A 3BZDB 5J22A 4L5SA 3UI2A 1ZXTA 1DOLA 5ELOA 4APVA 5IGEA 1L1OB 4UP9A 1TWFB 4HJ9A 3BYYB 4QMGA 3KF6B 2K05A 1KAAA 1K83H 3I55A 2SOBA 3HP3A 5CV8A 4ZKBB 2N88A 4U68A 1E2WA 1QZGA 1DONA 3KLRA 2PMZB 4FNFA 3QR8A 5C5MA 1PRTB 3V2TA 1BDOA 2DJFC 2L11A 2K5NA 3P1HA 3PUVA 1QVCA 3PO3H 2R93B 2RCNA 1U9RA 1WVLA 1E7ZA 2CW0C 4QQBX 4DFAA 1AP0A 2XNAC 2F0PA 1A0IA 4XYQA 4LF5L 2Z1CA 1PHJA 2KBNA 4A4IA 3SHLA 3H15A 4DR7L 1YHBA 2K1BA 4B9XA 5FJ8H 3WOEA 4ABNA 4BY1G 3HRZC 2EQSA 5M3MG 2PO4A 1F2YA 1KNEA 4BY1B 4DR6Q 3GTKB 1AZPA 2OEOA 2RA4A 2RSNA 5C3EH 1BXTA 3PSIA 2ES2A 2JXMB 1IL8A 4DUZQ 1LACA 2XRSD 1EIFA 4WORA 3H09A 5FKAC 4DU9A 4EQ5A 5HGQA 3RNUA 1WJJA 5I2XA 1D7QA 4C1NK 1YHQA 3A54A 4HIMA 2KHJA 4LFBL 4V0BA 3RD4A 4RG1A 2B2YC 1JB7A 1NCVA 5JVH3 1HTLD 3H3VI 3PQIA 4IUNA 4B3RQ 3OHXC 1SYBA 3DXJC 1YNNC 4PV1C 2XSCA 3VDYA 4DV0L 2ZM6Q 1JCKB 1QUQA 5CC4A 2WIIB 3F2CA 2V1CC 5IYDG 4A3FH 5FOBB 2VQEL 2PQEA 4DV5Q 3CMEA 4KD3A 2PW5A 1VQMA 2Q2TA 1HR0L 3PIP3 3GTMB 1TS4A 3E9IA 4BXXG 4X62Q 2F0IA 3HOZG 4B3TL 1MJCA 4JI0L 2B2WC 1LM0A 1CT1D 2VZAA 4OX9L 1XTDA 1E24A 2KHIA 1EIHA 4LUZA 3BU2A 5C0XJ 2MO1A 1PYWD 1EQVA 1TR5A 4KHVA 5FO7B 1S5ED 3C1EA 1F9PA 2NZHA 4G57A 4JBJA 4JI5Q 1CM9A 3HKSA 1SNMA 3CXCA 1ENCA 2D9UA 5KRUA 3OYYA 2UU9L 1VDZA 2B2TC 1RODA 4HIKA 1PYBA 4IOAA 1NBWA 2NN6G 4N9TA 2VL6A 4KKTA 5D65A 4KN7C 4QJFA 4XTCS 1SROA 1NMFA 1YNJC 3K57A 2HUGA 1G6PA 3DM1A 5FLMG 4A3KG 2BA0A 4C3JH 1TWCB 5KNBA 2X69A 2AQ3B 3QOLA 4A3KB 4OGQC 3K5LA 2R92H 1CKOA 3HOUB 4KHPQ 2FMMA 1SYDA 3EFXD 5IP7G 3HOYB 4KK7A 3OOCA 3PUWA 4RCNA 3VYRA 4EGVA 1RHPA 3JAME 3GTQH 2B3GA 2UUBQ 4A3LG 5BR8L 2JSOA 1LYLA 1PYSB 2AHOB 3S2HB 1B3AA 5A2QL 3S1NB 1PMRA 4LUVA 1K73C 5DLQE 3FMCA 3AU7A 3A8KE 4A3BH 3CRLC 4KKUA 3RZOB 1OO9B 4C2MB 3S17B 1UE1A 3CCVA 4E6IA 4DR3L 1SYCA 1C7YA 1I6HB 2NBFA 2K5HA 2SDFA 5HY6A 4DV6L 1XPOA 1K28A 2IHFA 2M9VA 2QDLA 3FP9A 3GV6A 2QEJC 1YJNA 3VYTA 1GXDC 4HJ5A 4IUPA 4K6LA 3OW7A 3HOVH 2F0SA 2R7ZB 1JWUD 5LMNW 4JCVE 4LF5Q 1ILQA 3S2DH 1K8MA 2H4OA 2QGQA 4Y7NB 4P75A 1NY4A 3OMGA 4G4KA 4DR7Q 2Z6KA 2KVMA 2VY3A 3J7ZC 4DV7L 3T1YL 2EY1A 1QVFA 2UXBL 4A76A 1WTOA 2E5LL 2ZTCA 3RZDB 5ELCA 1SYEA 1I4HA 3I70A 2L9HA 3L3OC 4JOIA 5JEAH 1SEBD 1EOTA 4IN3A 4FDBA 3EVQA 3K7UC 1EYAA 2LY7A 3AB9A 3I4NB 4IJHA 2PNHA 4OONA 1QUQB 3AEVA 1PDQA 4L63B 3K7AB 1DYQA 1HNXL 4KY5A 4LFBQ 2UXCL 2RDGA 4B3SL 3AYHB 1B8AA 3BVZA 1LT5D 3OIQA 4X3TA 1SSOA 3SR1A 2E2JH 2RVLA 1V9PA 2XTIA 5JJZA 5C44G 2NTTA 3KLSA 1TU2B 1HUNA 3A7LA 2K5QA 2WV6D 5C44B 3NUCA 2H5XA 3FDTA 1ESFA 3S9WA 1STYA 4ILWA 4DUYL 2A68D 3BDCA 4YY3L 1SNOA 4UPAA 2IY5B 1HR0Q 5LL6S 1WTVA 5G3LD 5M5WB 1SMXA 1SNQA 2I07B 4B3TQ 4JI0Q 1S5FD 1S5DD 4HJAA 2MHVA 4HMIA 4JI8L 1Q81C 1I3QH 4PMBA 5NUCA 3GTJH 2PI2A 1XX8A 4F88A 4OX9Q 2L0CA 4JI6L 2DNCA 1PRTC 4A3IB 1HA5A 4DA2A 3K0YA 4DF7A 4L5TA 1FGBD 3NP8A 4QCLA 1D2BA 3I4OA 5IT9c 2O5JC 2CH4W 4F7XA 2BE5C 1X32A 1EY4A 3E0JA 2UU9Q 1FJGL 3D3RA 5E7NA 4HIDA 4A3GB 2IWHA 1N32L 5C4XG 1EQRA 5J3BA 2QDBA 1X54A 3NSWA 1UEAB 4ID6A 4JC0A 1VQ7A 1X6OA 4FXKC 4I7AA 4JBWA 1B9NA 4JVZA 2EXZA 4OWXB 2BA1A 2D0PA 4A3EB 2A73B 2E2HH 1QB5D 1KDCA 1LTRD 4RGNA 4HAEA 4JBMA 2VQFQ 3LGJA 4NW2A 3R3OA 4JI1L 3S1RB 3CRKC 4DKAC 4DV3L 1HRJA 4U673 1GUNA 1FR3A 3HG9A 5CV7A 3DHQA 4PZ7A 4OELB 1AW7A 3J7A5 1EY5A 2HD3A 1FNWA 1BBXC 4WJ3M 2F0FA 4PMWA 3D4WA 1DOMA 3JAMi 1LABA 5BR8Q 1Y1VH 2J4XA 1Q90A 2KCCA 4MN3A 2VB3X 2I5MX 1W3SA 5C4HA 1HQMC 1L0WA 3FPUB 3FHWA 3CCEA 1R9TB 2JEAI 1CQFA 1EYCA 5CMDA 1HZ9A 1YZ6A 3I91A 5JEAJ 2DNEA 3MAQA 1EFID 4DR3Q 4JI4L 4LFAL 3GTOB 2A6HC 1LUZA 4LMQD 1HQRD 1EFWA 1DZ1A 2N3SA 1NMGA 3I2ZA 4FP5D 1GUGA 2JQOA 2K03A 5GAHC 3AMUA 1A8VA 4GNXA 1VS0A 1VQBA 2O4XA 4MTKA 2NVTB 3W3AA 5EKLA 1QCBD 2MUYA 3GP7A 5FO8B 1OXTA 3NEMA 3TDQA 1MD2D 4GN4B 4DV7Q 4C3HG 4C3IH 1MGSA 1CHQD 3S1MB 1XNRL 1CI3M 4X65L 1HZAA 4C3HB 1N36L 4OL7A 2HIVA 4DN4M 2JA8G 1P16A 4AYBG 3E5SA 1CSPA 1A3VA 2CWAA 1KABA 1TWFH 5C3XA 5A2QE 1SXTA 3ITPA 3UDXA 3MXUA 5DM73 1B3QA 4DR4L 3OW2A 4OEMB 1A63A 1VQGA 1PA6A 2ZJQA 3FPPA 4FF2A 4R4CA 4DK6C 1STNA 3PO2G 1IYUA 1HNXQ 1T5EA 4CDDC 4FVMA 4DR5L 2UXCQ 3E3XA 1SNDA 4B3SQ 2R93H 1TWAB 4H02A 5E4WC 3T1HL 3PO2B 3NBIA 1IKLA 4JI2L 4BY7G 4C56C 1KNAA 4NKLA 2NZ1D 4JG2A 1HCZA 2E75C 3AQQA 4KJOA 1AN8A 4BY7B 2Q2IA 4OIKA 3Q22A 4XQQA 1II3A 3KF8A 4B9WA 4LF7L 2GN5A 3NBHA 2F0GA 4GOPB 3B6YA 1RTOA 1U4MA 1G2TA 1G6ZA 1PTOF 3Q24A 1PFSA 4ME3A 4EX5A 1PFBA 1TIID 2Q2HA 3V96A 3CAMA 1A2UA 1TWHB 3HOXB 1S5BD 3CCUA 3EN2A 3VR3A 3GTKH 4G7OC 2YTXA 2JA5H 5EKKA 4GLXA 2LXJA 4UP7A 4JI6Q 5KNCA 1Q12A 3GO5A 2JA6G 1HPCA 4WJ4A 1VQ6A 1BF4A 1PFNA 2DJGC 5GQOA 1O7LA 2VW9A 1K3RA 1CQVA 1DOKA 1VCIA 1CSQA 2OQKA 3LWEA 4HJ7A 1TXYA 1FJGQ 4KI0A 1TWGB 1Y1WG 4UAIA 2YU9B 2EYJA 1N32Q 1EU4A 2L15A 2WAQG 1XNQL 1EZ8A 1K8GA 5IYCH 4CHTB 1Y1WB 1SMYD 1QNUA 1QWYA 1Q7YC 1L2FA 1G91A 2JP1A 2NVXB 5E4XA 5LMNL 1FGUA 5CGKA 2VXWA 3BYTB 3T51B 1U4RA 2ATWA 4ZUIA 4NXNQ 2O2LD 2XIWA 3GTLH 3QOJA 5H1SE 3GTMH 1SNPA 1X3GA 4O0AA 1IL2A 4JI1Q 1KRTA 2EJFC 1F9SA 4DV3Q 3M85A 1X3QA 4BXXH 2F0OA 1SYFA 1Y8OB 2H1EA 2CQAA 4L8JA 4IUQA 1M8AA 1H9JA 2CVRA 3KK7A 4P2CB 4RHRA 2X6LA 3F8TA 4LF6L 2JN4A 1WTXA 1EIYB 4GNXB 4DAYB 4LF4L 1PLFA 3GQBA 5DM63 1H9KA 2GVAA 1SJED 3U9SA 2OWOA 4RMFA 1LTLA 2AWNA 5JPMC 4JI4Q 4LFAQ 1X56A 2LXKA 5F2DA 5IP9H 1LT6D 4RGMA 4JV5L 2JK8A 4OO1I 3D6CA 4OXPA 2M2LA 3PMFA 4A3DG 3J80c 5I2YA 4G7ZC 3U50C 5E3FA 2Q8IB 1Q1BA 5DAUA 2EE1A 2HCIA 2IHEA 2E8GA 3I72A 4A3DB 1ET6A 1TWCH 1D1IA 3ULLA 3J81i 1PVOA 4A3KH 2K5WA 4ULLA 3BS1A 3HOUH 1XMOL 5IIFA 3D8GA 1KC8C 3TN2A 3HOYH 2VNUD 3W1BA 1D1KA 4Y52H 2YTVA 4RFBA 1XNRQ 3K58A 4X65Q 1N36Q 2EYHA 3S1NH 4X6AH 1I50B 3G4SA 5ISRA 3GTPB 3VYSA 2K6AA 1I4GA 2A8VA 3SGIA 1F9QA 3RZOH 4L5QA 4YWMA 4C2MH 4K5XA 3S17H 4DR4Q 1JE5A 1MIUA 2ID0A 4CGYB 3L2PA 1N34L 2CCZA 1I6HH 3J81j 3KF8B 3TREA 1H9SB 1HZCA 1D6EC 4GN3B 1SYGA 4RKBA 4XDXA 1SE3A 4JI2Q 1CK1A 2KECA 3OIPA 1MHWC 2R7ZH 3EBEA 4FYDA 4EQOA 5IGBA 2A5HA 4CJ2C 3M7NA 2NWGA 2Z6BA 2MJ8A 3PF4A 1EEFD 3VYUA 4IPGA 4LF7Q 3CQZB 2D2CC 1JJCB 2KJXA 3CC4A 3A5UA 1FD7D 1S4ZA 3RZDH 1VQFA 4IQZA 1KHIA 1IXRA 4AYBE 5M3MB 4DV1L 2F0DA 1UE5A 2L4NA 3I4NH 1QNKA 3H94A 1MKHA 5FLXL 4IFDI 2OF1A 4DPGA 4LF8Q 2Z6KC 1I6VC 4K6DA 2R61A 2F0EA 2QEXA 2EY2A 1KL9A 2PCFB 4N9PA 1GUWA 4HEDA 1O7ZA 4JOIC 4XQNA 3TP5A 3I4MH 2PI2E 5IGDA 5IYBH 1DGSA 5GAEC 2EYFA 1XNQQ 2R7DA 1GUOA 1WCMH 3ULJA 1T9HA 5LMNQ 4R8NA 2XWJB 3F2DA 2HQEA 1JOOA 2E2DC 1JMCA 1U4PA 3FEWX 3V05A 2OTJA 4BA2I 5E1FA 4RGTA 3HOZB 5CV6A 3FKIG 5T1GA 1D8LA 2K4KA 5EPLA 1PH9A 2RHSB 1T5XD 1VQAA 2GVBA 4IUVA 3FVQA 1PH1A 4RWSC 4A3IH 3A7AB 3HOWG 1HNZQ 2X6GA 3A55A 1EQTA 1JWSD 2A69D 1G2SA 3DWPA 1VMPA 3HOWB 1NUCA 2UUAL 2OTLA 2N78A 3I4LA 1SFOH 3SE0A 1AE2A 2AMCB 4O1NA 3ULPA 1C8CA 2WAQE 2A1AA 5IODA 4A3GH 1RTNA 4GOPC 1DM0B 3C1FA 1RD9D 3J81L 2ENBA 1TY0A 1E1OA 2HDMA 4X3KA 1PZKD 2O5IC 2UXDQ 4A3EH 2TMPA 3A0JA 3U9OA 5AFWA 2CFMA 2D62A 1V1PA 3CMAA 3S1RH 1I94L 3RUZA 4NP5A 1XMOQ 1MJEA 1F9RA 1GHKA 3T4AC 2HQLA 3HFZB 1BR9A 1SLJA 3VR6A 1BCPF 3NWSA 2A19A 4IPDA 4OWTB 4DAMA 4A3JG 3ND8A 1TT2A 2GA4B 5C0XG 1IBML 2RDFA 3M4YA 2Z9HA 3S14H 4CKCA 4R1JA 1GKHA 2K5VA 2MGSA 4A3JB 1QVGA 2NVQB 3STBD 3W5OA 3UDIA 1IBLL 4RCOA 5M3FG 4QF4A 4CJ0B 4X3SA 3GTOH 3DUZA 5M3FB 2K14A 1XPRA 1PTOD 5JJIA 1W6KA 1X65A 1FNVA 2FMCA 3Q6SA 1H95A 4FF1A 1YJ9A 3SK8A 4V190 1Z9FA 1IBKL 5I9OA 3K81C 1E22A 4OO1H 3W1GA 2B39A 4L5RC 4I7ZC 2NVTH 4M1UB 5TSSA 3IL8A 1H9RA 1B53A 2VUMH 4IURA 1O80A 2D5DA 3NENA 1GUTA 2L55A 1HFGA 2RDHA 1B70B 1E1TA 2XVSA 3MC0B 3Q0AA 2E2IB 1G291 1N8RC 2K50A 3MA2B 3S1MH 4IOCA 5CORA 2WINB 5FJ8G 4DV1Q 1MSGA 3TMEA 4GNXC 2DUDA 4PZ8A 1KLUD 2KUMA 3U4ZA 3S1QB 2HT1A 4A93H 3VR4A 4ZK9B 3IKJA 5C4JB 2K04A 3PIO3 1ENFA 5CV4A 4ZRZA 2ALYB 5C3EG 1NSNS 4QGUA 5ELFA 4CKEA 4JI3L 2JEBI 4RKLA 1WD0A 1TWAH 3RR5A 1IZ6A 3HEJA 1A6XA 3A56A 5J1ZA 1N9WA 4DV0Q 4C1NI 3RLFA 4GKJL 3LWUA 4K5WA 4BY7H 1I4PA 2VQEQ 3PCOB 2F0WA 3G7LA 2SEBD 1AZQA 2LMCB 2KEDA 3OMCA 5I4DA 1GUSA 1O7IA 3SK4A 1B7YB 2B2WA 1U5KA 1L1OC 3H0GG 2M00A 4LWCA 4TRDA 2K52A 1TWHH 1Z7TA 2B8GA 2L1BA 4BWGB 5GAGC 3HOXH 1TS3A 1WI5A 3H0GB 3MFYA 1K3BC 1ENAA 1YNXA 1VQ4A 3M3YB 3D0FA 1TS2A 4DR2L 3AFPA 2SNMA 2BCOA 4K2KA 3L9AX 2DGYA 1EYDA 1Q8IA 3DEPA 4DXFA 1VQJA 3WDNA 1KD1C 2B63H 2KA7A 4GZYC 1B9MA 3TS0A 5M5YB 4XT3B 5FLXE 1BVSA 3MXPA 2AUJD 2B2TA 4IFDH 3S24A 2C5CA 2K7VA 3NTIA 2UUAQ 3TBIB 1NTGA 3SDZA 1V1PB 1W6JA 4LF9L 4MIUA 3ERQA 1XMQL 1NR4A 3HZXA 1U0LA 3D4DA 2I5LX 5IWAL 3NQTA 3K6OA 2YU9H 1VQEA 1TKWB 3HS0C 2AKWB 3E0EA 1Y8PB 5C4XB 2NTSA 1Y1WH 1EEID 1UUPA 1QILA 1BBWA 4YCVA 2NVXH 3SVMA 4GLVB 2A74C 3EIVA 1UNSA 1RJTA 5IY0A 5KNDA 3LX0A 1Y14B 2F0LA 3HGBA 3J7YW 4NPSA 3RLOA 1O78A 3P75A 2B2UC 1SMYC 5EAYA 2ASBA 3SK6A 1PTOB 1F77A 1ET9A 3M9BA 4BBRH 2R92G 3CC2A 3K5OA 3ICEA 2Y0SG 1ZKOA 2F0QA 1IBMQ 3R8BA 2BH8A 3P20A 2VS1A 1E2ZA 3D4RA 5EGTA 2XN9C 4AQYL 1JB3A 3URYA 4P74A 2QW7A 4DV6Q 1YITA 3GTGB 4OHJA 2Z4IA 1TQOA 2EIFA 1XWEA 4J15A 1GD7A 3MEHA 4LK1C 4H0LC 4HCEA 3PUZA 4Q0FA 3J81E 1PZJD 2K01A 1D5MC 1IBKQ 4DV2L 2EYLA 2QILA 4A3DH 1EY8A 3BJUA 5FO9B 4BBSH 1QG7A 3IFDA 1LTBD 2ZJPA 2QF7A 1UE6A 3R93A 3PF5A 5K5PA 4Q5VA 3T1YQ
chains in the Genus database with same CATH topology
5C3WA 2NUCA 4CJ1B 1FYCA 4TKOB 3TP7A 1X3PA 1JQYD 5ELDA 1L0XB 2EJMA 3DEOA 4RAUC 2FJ2A 4FXDA 1V8QA 5M5XB 2JA8B 5EBCA 4AYBB 3OWEB 2RQXA 5JEAG 3VA5A 4FO2A 2IX1A 3ZYYX 1D5XC 1CZWA 3PUYA 1MSHA 5CV5A 1TY2A 1A2TA 2E76C 3T13A 2F0NA 2MPMA 4EVOA 4IFDJ 4J8QA 1PXUA 2NVYB 1F2LA 1RDPD 1QOHA 1F2MA 1S5CD 3M4OB 1JICA 4J1MA 1PFMA 1OXVA 3P7JA 1LTID 1JR0D 2FHTA 1EU3A 3LNNA 3X3NA 4RHSA 3O13A 3MZ5A 4QB4A 3PV0A 4HTHA 3SEBA 2JA6B 1A3UA 1EY9A 4UDUC 1F2ZA 1B50A 2EJGC 1ZYRD 5LL6X 2CHBD 5CR3A 1A3TA 1IHZA 2K32A 5K36G 1I4QA 1RKNA 1BCPD 2WAQB 3R2IA 3EJIA 3VR5A 5LHY1 3SK5A 2B8FA 3Q23A 1RCVD 1KDAA 2NB0A 1STGA 2BDOA 4ZKCB 4XIGS 3NK9A 1EL0A 1SBBB 1SE4A 3BDOA 4XT1B 1ML0D 4QUCA 5JVG3 1EWCA 5KIXA 4EQNA 3TP6A 1WTPA 1KLGD 4H7BA 5JAVA 5EKIA 2IPKD 2BOSA 4BS9A 1TS5A 1XXGA 4TSSA 2EOTA 4FXGC 2NN6H 1MI2A 2FFKB 2A69C 4PQXA 2VB2X 3K59A 4IZ8A 1BUVT 4A3MB 1KTKA 4EQPA 2N55A 5C5LA 2F3VA 4DAPA 3QG1A 1B1ZA 4IALA 1VF7A 4C3IG 2Q8RE 1JOQA 5C0XH 3K5MA 3QWNA 4NMZA 5D3IB 3IFTA 3DWAA 4Z9CB 2RBMA 5ELEA 5BN4A 2F0TA 2WKDA 2WP8J 1NR2A 5I6WA 5BN3A 2EY6A 3VA7A 3S15B 1WTWA 2PZUA 5KGUA 4B08A 2JA7B 1PTOC 1XTCD 3VR2A 2WB1B 3EROA 2LFNA 3D6WA 3MHBA 4H44C 1MBYA 3N52A 1QE6A 4MHEA 1STBA 1JC7A 2B2VA 1BCPB 3NHHA 2ICIA 1NAPA 1LTSD 1Q3LA 2E74C 5I6YA 1I4XA 4ODGA 3E6ZX 2KHSA 1J8IA 4K8IA 1HFNA 5IT9L 5KYLA 1ESRA 4S3SA 2JA5B 1K8OA 4KV6A 3NPPA 3M7GA 1LTGD 2OT2A 3FRPB 4KY6A 5J39A 1BNZA 1LTAD 4RH6A 4OIJA 1JE4A 5D14A 1SAPA 2ZT9C 3WOFA 5JPNC 2A6ED 2Q8TA 2PPBC 3OWFA 2ZXRA 2EZVA 1CA5A 3TP8A 4KN4C 2A68C 1SDFA 1O7YA 2EVBA 2EPBA 3FKIB 2RSOA 3GTLB 1VMCA 4HN7A 4FF3A 1DCZA 2EY5A 4KMUC 4LJZC 2PZWA 2AUKA 1C48A 3KBXA 2PW7A 2QKIC 1PRTF 1LLRD 3MXNA 4KD4A 5IOCA 1FNUA 1STAA 1EY6A 3I73A 1ICWA 2IL8A 1GJXA 2WACA 1Q1EA 1TVXA 2ZXOA 1IW7D 3MTSA 2BDNA 3G6JB 2PYKA 5EPJA 4YIJA 3I8ZA 4LAAA 3TSSA 3S16B 1PTOH 1B44D 1H9MA 4JK1C 1DD2A 2F0UA 1EWHA 4KY7A 4R8IA 1HHVA 2J7ZA 2DY8A 3NTHA 1Z6HA 4HCSA 1R4PB 3KBGA 3CKIB 1STEA 4HR7B 2K33A 3H91A 3SXHA 3J7AV 2DY7A 3MXGA 1JWMD 1K83B 2EYOA 2QCPX 4ZAIA 4ZQ3A 2CW0D 4ZLTF 2WKCA 5EBDA 2KEEA 2L12A 4QUFA 1L0YB 4H13C 3H3VC 2ICEC 5D3DA 1B4OA 4TQUS 4O42A 4K2LA 2YYZA 3PO3B 2IX0A 2F4IA 2SNSA 5IGFA 3NTKA 1D5ZC 2F03A 3R2TA 3H6MA 5IGGA 1SE2A 5CV9A 2R3ZA 1CZGA 1IYVA 4WFN3 1QJOA 1GOZA 2PNRC 2B2YA 1BOSA 3EQLC 4KJNA 4M8AA 3I90A 1CHPD 3BDLA 5C3EB 3W2DA 1YNND 2AWOA 1JORA 2I46A 4CKBA 1DJRD 4ZYSA 3MWYW 3BVMA 1U4LA 2TSSA 3QIAA 2JE6I 3I4MB 1HA6A 2K5DA 2LS01 4KKSA 1XYIA 4PMCA 4A3FB 5BN5A 5FK9C 3CHBD 4QIWB 2K28A 4F87A 2C9OA 1WCMB 4HSVA 2PZTA 3DWQA 3CU7A 1JOKA 4PNYA 2RKSA 5IGCA 2V4DA 1STHA 5CBEE 4G7HC 1M4VA 2KQ3A 1V43A 2G9DA 2NN6I 5EPKA 5COYA 1CTMA 5IT9E 1Y8NB 1SNCA 3NXWA 2F1MA 1KDBA 2KOLA 3BVGA 3MFGA 3T56B 3X3MA 3NWTA 1SJHD 1V1OA 1YNJD 1AFPA 2J0TD 1LT4D 3J80L 1J9OA 4DNTB 5A35A 5K36H 1ZYRC 2HCCA 1SFOB 2NYZD 3ND9A 1HTPA 1OXUA 4DAVA 4K14A 1VF5C 2EYPA 4RA8A 1BCPC 1LT3D 3A8JE 3ONAB 4C3JG 1C4QA 2XWBB 2ZXPA 5C0XI 3QJYA 4C3JB 2R6GA 2R92B 2EDGA 5T1IA 3K5NA 3TZUA 2Y0SB 4HMJA 3NQIA 1IKMA 3GTQB 5EQ0A 5HURA 4HSPA 1ONLA 3GV3A 2XRQD 4L6TB 1HUMA 3S14B 4A3BB 2Z8LA 1BO0A 1WTQA 5KEEA 2IJ0A 2DN8A 4WRDA 5C6AA 2EYMA 2MP1A 4BA1I 4OO1G 3HOVB 4FF4A 4DAYA 3C46A 3RMHA 2F0VA 5DEHA 2Z4HA 3S2DB 4IUTA 1ILPA 2LKVA 1A15A 3F2UA 1BQQT 1WD1A 2VUMB 1I4RA 1Z47A 3C2PA 1UAPA 3J7AF 1HXYD 5I9PA 5C4ZA 5CBAE 4A93B 3BG3A 4ME5A 2F0MA 4XQJA 4RGOS 2F0JA 1EY0A 5DNFA 2HDLA 2IT1A 3GD7A 4XYOA 3NE5B 1EZ6A 4R9WA 1EY7A 4XXEA 1OXSC 2F0KA 2E2JB 4ZUJA 3PUXA 5KYIA 4KHZA 3IAYA 3L7ZC 3I3CA 2G9HD 3TZDA 1PZID 1H9SA 1E0BA 4CBVA 1DXMA 3T53B 4IUUA 3KUPA 1PRTD 3N6RA 4DGZA 3DMUA 1I3QB 3QB3A 2L5TA 5JOBA 3GTJB 2BE5D 2IX3A 1AEXA 3C3LA 2B2VC 4F8MA 2B63B 3A8IE 4IFDG 5CYUA 1RF2D 3HKZB 4DNRB 1CA6A 1WTRA 2F3WA 2B2UA 5ELBA 2AQ1B 2E2HB 2A6EC 3T16A 4NDXA 4K5VA 4KTAA 3D31A 4WJWA 3JAML 3OPOA 1R4QB 4X3UA 2JYOA 1EIGA 3OSOA 4BBRB 4I65A 1Y1VB 2A6HD 2KCNA 1LTTD 1Y69U 2AQ2B 5G3LF 3KLSX 3QO2A 1GHJA 3J80E 3EA6A 2F0HA 1LO5D 4DXGA 5EJWA 2FINB 1LV9A 1ZEQX 5M9OA 2IW3A 4DK1A 1CFMA 2OXPA 1IW7C 4BBSB 3MVVA 5HGTA 1E2VA 1OXXK 1B2TA 4J6HA 1G8ZD 4C3IB 4K8JA 4DK0A 3BZDB 5J22A 3UI2A 1ZXTA 1DOLA 5IGEA 1TWFB 3BYYB 4QMGA 2K05A 1KAAA 2SOBA 3HP3A 5CV8A 4ZKBB 2N88A 4U68A 1E2WA 1DONA 5C5MA 2PMZB 3KLRA 4FNFA 1PRTB 3V2TA 1BDOA 2L11A 3P1HA 3PUVA 2R93B 1U9RA 1WVLA 2CW0C 4DFAA 1AP0A 2XNAC 2F0PA 4XYQA 2Z1CA 3SHLA 2K1BA 4B9XA 3WOEA 4ABNA 3HRZC 2PO4A 1F2YA 1KNEA 4BY1B 3GTKB 1AZPA 2OEOA 2RA4A 2RSNA 1BXTA 2JXMB 1IL8A 1LACA 2XRSD 4WORA 5FKAC 3H09A 4DU9A 5I2XA 4C1NK 3A54A 4V0BA 3RD4A 2B2YC 1NCVA 5JVH3 1HTLD 4IUNA 3OHXC 1SYBA 3DXJC 1YNNC 4PV1C 2XSCA 5CC4A 1JCKB 2WIIB 5FOBB 2PQEA 4KD3A 2PW5A 3PIP3 3GTMB 1TS4A 2F0IA 2B2WC 1CT1D 1EIHA 5C0XJ 1PYWD 1EQVA 1TR5A 4KHVA 5FO7B 1S5ED 3C1EA 1F9PA 4G57A 1CM9A 1SNMA 1ENCA 2D9UA 5KRUA 1VDZA 2B2TC 1RODA 2NN6G 4N9TA 4KKTA 5D65A 4KN7C 4XTCS 1YNJC 3K57A 2HUGA 3DM1A 2BA0A 1TWCB 5KNBA 2X69A 2AQ3B 3QOLA 4A3KB 4OGQC 3K5LA 3HOUB 2FMMA 1SYDA 3EFXD 3HOYB 4KK7A 3OOCA 3PUWA 4RCNA 3VYRA 4EGVA 1RHPA 3JAME 2JSOA 3S2HB 1B3AA 5A2QL 3S1NB 1PMRA 3FMCA 3AU7A 3A8KE 3CRLC 4KKUA 3RZOB 1OO9B 4C2MB 3S17B 4E6IA 1SYCA 1I6HB 2NBFA 2SDFA 2M9VA 3GV6A 2QEJC 3VYTA 1GXDC 4IUPA 4K6LA 3OW7A 2F0SA 2R7ZB 1JWUD 1ILQA 1K8MA 2H4OA 4Y7NB 3OMGA 4G4KA 2KVMA 2EY1A 1WTOA 3RZDB 5ELCA 1SYEA 1I4HA 3I70A 2L9HA 3L3OC 5JEAH 1SEBD 1EOTA 4IN3A 3EVQA 1EYAA 2LY7A 3AB9A 3I4NB 1PDQA 4L63B 3K7AB 1DYQA 4KY5A 2RDGA 3BVZA 1LT5D 3OIQA 4X3TA 1SSOA 3SR1A 2RVLA 5JJZA 2NTTA 3KLSA 1TU2B 1HUNA 3A7LA 2K5QA 2WV6D 5C44B 3NUCA 3FDTA 1ESFA 3S9WA 1STYA 4ILWA 2A68D 3BDCA 1SNOA 5LL6S 1WTVA 5G3LD 5M5WB 1SNQA 2I07B 1S5FD 1S5DD 2MHVA 4HMIA 5NUCA 4PMBA 1XX8A 4F88A 2L0CA 2DNCA 1PRTC 4A3IB 1HA5A 4DA2A 3K0YA 4DF7A 1FGBD 3NP8A 4QCLA 1D2BA 2O5JC 4F7XA 2BE5C 1X32A 1EY4A 3E0JA 3D3RA 4A3GB 2IWHA 2QDBA 3NSWA 1UEAB 4ID6A 4FXKC 4JBWA 1B9NA 2EXZA 4A3EB 2BA1A 2A73B 1QB5D 1KDCA 1LTRD 4RGNA 4HAEA 4NW2A 3R3OA 3S1RB 3CRKC 1HRJA 4U673 1GUNA 1FR3A 3HG9A 5CV7A 3DHQA 1AW7A 1EY5A 1FNWA 1BBXC 2F0FA 4PMWA 3D4WA 1DOMA 1LABA 2J4XA 1Q90A 2KCCA 4MN3A 2VB3X 5C4HA 1HQMC 3FPUB 1R9TB 2JEAI 1CQFA 1EYCA 5CMDA 3I91A 5JEAJ 2DNEA 3MAQA 1EFID 3GTOB 2A6HC 4LMQD 1HQRD 1DZ1A 4FP5D 1GUGA 2K03A 3AMUA 2O4XA 2NVTB 3W3AA 5EKLA 1QCBD 2MUYA 3GP7A 5FO8B 1OXTA 3TDQA 1MD2D 4C3HG 1MGSA 1CHQD 3S1MB 1CI3M 4C3HB 4OL7A 4DN4M 3E5SA 1A3VA 1KABA 5C3XA 5A2QE 1SXTA 3ITPA 3MXUA 5DM73 3FPPA 4FF2A 1STNA 1IYUA 1T5EA 4FVMA 1SNDA 1TWAB 5E4WC 3PO2B 3NBIA 1IKLA 4C56C 1KNAA 4NKLA 2NZ1D 4KJOA 1HCZA 2E75C 1AN8A 4BY7B 4OIKA 3Q22A 4XQQA 1II3A 3KF8A 4B9WA 3NBHA 2F0GA 1RTOA 1U4MA 1G2TA 1G6ZA 1PTOF 3Q24A 1PFBA 1TIID 3V96A 1A2UA 1TWHB 3HOXB 1S5BD 3VR3A 4G7OC 5EKKA 5KNCA 1Q12A 3GO5A 1HPCA 1BF4A 1PFNA 1O7LA 1CQVA 1DOKA 1VCIA 3LWEA 4KI0A 1TWGB 2YU9B 4UAIA 2EYJA 1EU4A 1EZ8A 4CHTB 1Y1WB 1SMYD 1QNUA 1QWYA 1G91A 2JP1A 2NVXB 5E4XA 5CGKA 2VXWA 3BYTB 3T51B 1U4RA 4ZUIA 2O2LD 2XIWA 3QOJA 1SNPA 2EJFC 1F9SA 3M85A 1X3QA 2F0OA 1SYFA 1Y8OB 2H1EA 2CQAA 4L8JA 4IUQA 1M8AA 1H9JA 2CVRA 3KK7A 4P2CB 4RHRA 2X6LA 1WTXA 1PLFA 3GQBA 5DM63 1H9KA 1SJED 3U9SA 2AWNA 5JPMC 5F2DA 1LT6D 4RGMA 4OO1I 3D6CA 2M2LA 3PMFA 5I2YA 4G7ZC 5E3FA 2Q8IB 1Q1BA 5DAUA 2EE1A 2HCIA 3I72A 4A3DB 1ET6A 1D1IA 2K5WA 4ULLA 3BS1A 5IIFA 3D8GA 3TN2A 2VNUD 1D1KA 4RFBA 3K58A 2EYHA 1I50B 5ISRA 3GTPB 3VYSA 2K6AA 1I4GA 1F9QA 4K5XA 2ID0A 4CGYB 1H9SB 1D6EC 1SYGA 4RKBA 4XDXA 1SE3A 1CK1A 2KECA 3OIPA 4FYDA 4EQOA 5IGBA 2A5HA 4CJ2C 3M7NA 2NWGA 2MJ8A 1EEFD 3VYUA 3CQZB 2D2CC 2KJXA 1FD7D 1S4ZA 4IQZA 5M3MB 2F0DA 2L4NA 1QNKA 3H94A 5FLXL 4IFDI 2OF1A 1I6VC 4K6DA 2R61A 2F0EA 2EY2A 2PCFB 4N9PA 1GUWA 4HEDA 1O7ZA 4XQNA 3TP5A 5IGDA 2EYFA 1GUOA 4R8NA 2XWJB 2HQEA 1JOOA 2E2DC 1U4PA 3FEWX 3V05A 4BA2I 5E1FA 4RGTA 3HOZB 5CV6A 5T1GA 5EPLA 1T5XD 4IUVA 3FVQA 4RWSC 3A7AB 2X6GA 3A55A 1EQTA 1JWSD 2A69D 1G2SA 3DWPA 1VMPA 3HOWB 1NUCA 3I4LA 3SE0A 4O1NA 1C8CA 5IODA 1RTNA 1DM0B 3C1FA 1RD9D 3J81L 2ENBA 1TY0A 2HDMA 4X3KA 1PZKD 2O5IC 2TMPA 3U9OA 5AFWA 2D62A 1V1PA 3RUZA 4NP5A 1F9RA 1GHKA 3T4AC 1BR9A 3VR6A 1BCPF 3NWSA 3ND8A 1TT2A 2GA4B 5C0XG 2RDFA 3M4YA 4CKCA 4A3JB 2MGSA 2NVQB 4RCOA 4QF4A 4CJ0B 4X3SA 3DUZA 5M3FB 1PTOD 1W6KA 2FMCA 1FNVA 3Q6SA 4FF1A 3SK8A 4V190 5I9OA 4OO1H 2B39A 4I7ZC 4M1UB 5TSSA 3IL8A 1H9RA 1B53A 4IURA 1O80A 2D5DA 1GUTA 2L55A 1HFGA 2RDHA 2XVSA 3MC0B 3Q0AA 2E2IB 1G291 3MA2B 5CORA 2WINB 1MSGA 3TMEA 1KLUD 2KUMA 3S1QB 3VR4A 4ZK9B 3IKJA 5C4JB 2K04A 3PIO3 1ENFA 5CV4A 4ZRZA 1NSNS 5ELFA 4CKEA 2JEBI 4RKLA 1WD0A 3HEJA 1A6XA 3A56A 5J1ZA 4C1NI 3RLFA 3LWUA 4K5WA 1I4PA 2F0WA 3G7LA 2SEBD 1AZQA 2LMCB 2KEDA 3OMCA 5I4DA 1GUSA 3SK4A 2B2WA 2M00A 4TRDA 1Z7TA 2B8GA 2L1BA 4BWGB 1TS3A 3H0GB 3MFYA 1ENAA 3M3YB 1TS2A 2SNMA 2BCOA 4K2KA 3L9AX 4DXFA 1EYDA 1Q8IA 3DEPA 3WDNA 2KA7A 4GZYC 1B9MA 5M5YB 4XT3B 5FLXE 3MXPA 2AUJD 2B2TA 4IFDH 2C5CA 2K7VA 3NTIA 3TBIB 3SDZA 1V1PB 1W6JA 4MIUA 3ERQA 1NR4A 3HZXA 3D4DA 3NQTA 3K6OA 1TKWB 3HS0C 1Y8PB 5C4XB 2NTSA 1EEID 1UUPA 1QILA 3SVMA 2A74C 1UNSA 1RJTA 5KNDA 3LX0A 2F0LA 3HGBA 3J7YW 1O78A 3P75A 2B2UC 1SMYC 3SK6A 1PTOB 1F77A 1ET9A 3K5OA 1ZKOA 2F0QA 3R8BA 3P20A 1E2ZA 3D4RA 5EGTA 2XN9C 1JB3A 3URYA 3GTGB 4OHJA 2Z4IA 1TQOA 1XWEA 3MEHA 4LK1C 4H0LC 4HCEA 3PUZA 4Q0FA 3J81E 1PZJD 2K01A 1D5MC 2EYLA 2QILA 5FO9B 1EY8A 1QG7A 3IFDA 1LTBD 2QF7A 3R93A 5K5PA 4Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTW A;  1B2T A;  5E4W C;  1ILQ A;  1ICW A;  4CJ1 B;  1IKL A;  1X3P A;  4ZKC B;  2IL8 A;  2MGS A;  3GV3 A;  3DEP A;  1KNA A;  1HUM A;  2NZ1 D;  1AP0 A;  1EL0 A;  3DEO A;  1TVX A;  1GUW A;  4HED A;  1O7Z A;  2KVM A;  3D6W A;  4RAU C;  2FJ2 A;  1BO0 A;  3UI2 A;  1ZXT A;  1DOL A;  2B2W C;  3MTS A;  4XT1 B;  1WTQ A;  2BDN A;  1ML0 D;  3N52 A;  4OIK A;  4CJ0 B;  4HAE A;  4XT3 B;  4X3S A;  1WTO A;  2B2V C;  2M2L A;  3MWY W;  4NW2 A;  1QE6 A;  1U4L A;  4MHE A;  4QUC A;  2B2T A;  2K05 A;  5EPJ A;  2L9H A;  1HRJ A;  3I8Z A;  1RTO A;  1U4M A;  2EE1 A;  2HCI A;  1G2T A;  1G6Z A;  1EOT A;  1HA6 A;  1EIH A;  1XYI A;  2B2V A;  3HP3 A;  3Q6S A;  4ZKB B;  2N88 A;  1NAP A;  1NR4 A;  4U68 A;  1DON A;  1PFB A;  1Q3L A;  1BBX C;  1CA6 A;  1WTR A;  1F9P A;  2MP1 A;  2K28 A;  1WTP A;  2B2U A;  2L11 A;  1DOM A;  1MSH A;  3TN2 A;  5EKI A;  1CM9 A;  1J8I A;  3IL8 A;  4HSV A;  4MN3 A;  4R8I A;  1B53 A;  1PDQ A;  2J7Z A;  2D9U A;  1WVL A;  1HHV A;  2DY8 A;  1U4P A;  2EOT A;  3FPU B;  1O80 A;  4IUR A;  2B2T C;  1ROD A;  2MPM A;  4IUT A;  1A15 A;  3SVM A;  3F2U A;  1WD1 A;  1ILP A;  5CMD A;  1ESR A;  1RJT A;  1HFG A;  5D65 A;  1MI2 A;  2FFK B;  4HCS A;  3I91 A;  3H91 A;  1F2L A;  4X3T A;  5T1G A;  1SSO A;  5EPL A;  5CBE E;  1BF4 A;  1F9Q A;  1PFN A;  2DY7 A;  1HFN A;  2RVL A;  4IUV A;  5COR A;  2HUG A;  2B2U C;  2K1B A;  4LMQ D;  3DM1 A;  5JJZ A;  1BNZ A;  1MSG A;  5EPK A;  5COY A;  4RWS C;  4ZAI A;  4ZLT F;  1DZ1 A;  1JIC A;  2KUM A;  4OIJ A;  1DOK A;  1PFM A;  1HUN A;  2KEE A;  2L12 A;  2X6G A;  4QUF A;  4X3U A;  2K03 A;  5CBA E;  1EQT A;  2X69 A;  1JE4 A;  3LWE A;  3P7J A;  2KOL A;  5D14 A;  2JYO A;  1SAP A;  3FDT A;  4ZK9 B;  1G2S A;  4UAI A;  1EIG A;  1B4O A;  1KNE A;  1VMP A;  2FMM A;  2N55 A;  2K04 A;  4O42 A;  2Q8T A;  2FHT A;  1J9O A;  4XDX A;  1AZP A;  5DNF A;  1RHP A;  2HDL A;  2RA4 A;  2RSN A;  2HCC A;  1C8C A;  1G91 A;  2JP1 A;  1WTV A;  2KEC A;  5E4X A;  2NYZ D;  1CA5 A;  1RTN A;  2VXW A;  1WD0 A;  1IL8 A;  4CJ2 C;  1U4R A;  1B3A A;  1SDF A;  2NWG A;  1O7Y A;  2MJ8 A;  2Q8R E;  2XIW A;  3QO2 A;  4R9W A;  2EPB A;  1MGS A;  2HDM A;  4RA8 A;  4X3K A;  2R3Z A;  2RSO A;  3ONA B;  1XX8 A;  1F9S A;  1VMC A;  1B50 A;  2B2Y C;  1X3Q A;  1NCV A;  5AFW A;  4DN4 M;  5EJW A;  1S4Z A;  2H1E A;  3G7L A;  2FIN B;  3I3C A;  1AZQ A;  2SDF A;  1LV9 A;  2K01 A;  4IUQ A;  1M8A A;  2B2Y A;  2KED A;  3TZD A;  1F9R A;  2CVR A;  3KBX A;  5T1I A;  1E0B A;  1QG7 A;  2X6L A;  2B2W A;  3IFD A;  3GV6 A;  1NR2 A;  1X32 A;  2L4N A;  3I90 A;  4IUU A;  3R93 A;  1QNK A;  1WTX A;  3KUP A;  4IUP A;  1IKM A;  1PLF A;  2L1B A;  5EQ0 A; 
#chains in the Genus database with same CATH topology
 3HOV G;  1OTC A;  4MTN A;  2UXB Q;  2E5L Q;  5C3W A;  1HNW L;  2NUC A;  4CJ1 B;  1FYC A;  4TKO B;  3TP7 A;  2MQH A;  1X3P A;  1K9M C;  1JQY D;  4O2D A;  3PIP A;  5ELD A;  1L0X B;  2EJM A;  4HIO A;  3DEO A;  4RAU C;  1I50 H;  2FJ2 A;  3GTP H;  2ZJR A;  4FXD A;  1V8Q A;  4AIM A;  3G48 A;  5M5X B;  5EBC A;  4AYB B;  2JA8 B;  3CC7 A;  3OWE B;  3KJO A;  2FXQ A;  1YVC A;  2RQX A;  5JEA G;  3VA5 A;  5AJ3 L;  4FO2 A;  2IX1 A;  3ZYY X;  4TVA B;  1D5X C;  1CZW A;  2OQ0 A;  3PUY A;  1MSH A;  4P72 A;  5CV5 A;  1TY2 A;  1N33 L;  1A2T A;  1BKB A;  2E76 C;  4JI7 L;  3T13 A;  2F0N A;  2MPM A;  4GKJ Q;  4EVO A;  4R4I A;  4IFD J;  4J8Q A;  1PXU A;  2NVY B;  1F2L A;  1RDP D;  1HZB A;  1SE8 A;  1QOH A;  4DUY Q;  4MNO A;  3CQZ H;  1F2M A;  4YY3 Q;  1S5C D;  3M4Q A;  3M4O B;  1JIC A;  4J1M A;  1PFM A;  1OXV A;  4BY1 H;  3P7J A;  1FVI A;  5M3M H;  4LFC L;  1LTI D;  1JR0 D;  4JI8 Q;  2FHT A;  1EU3 A;  4DR2 Q;  2CH4 A;  2N8N A;  3LNN A;  3X3N A;  4RHS A;  3O13 A;  3MZ5 A;  2JJQ A;  4QB4 A;  3PV0 A;  4HTH A;  1FL0 A;  3SEB A;  2JA6 B;  1A3U A;  1EY9 A;  4UDU C;  1F2Z A;  3PGZ A;  1B50 A;  2EJG C;  3WWV A;  1YHA A;  1ZYR D;  5LL6 X;  2CHB D;  4DUZ L;  4LF9 Q;  5CR3 A;  1XMQ Q;  4P71 A;  3HKZ G;  1A3T A;  5IWA Q;  1IHZ A;  2K32 A;  5K36 G;  1I4Q A;  2R7F A;  1RKN A;  2D0O A;  1BCP D;  2WAQ B;  3R2I A;  3EJI A;  3RLN A;  5IYD H;  3VR5 A;  5LHY 1;  3SK5 A;  2B8F A;  3Q23 A;  1RCV D;  4QIW E;  1KDA A;  2NB0 A;  1STG A;  2BDO A;  3CCJ A;  4ZKC B;  3E9H A;  1X3F A;  4XIG S;  3UDG A;  3NK9 A;  1I5F A;  1EL0 A;  2ZTD A;  1SBB B;  1HJP A;  1SE4 A;  3BDO A;  3HOZ H;  4XT1 B;  1ML0 D;  4QUC A;  5JVG 3;  1EWC A;  3ZJY C;  4R4O A;  5KIX A;  4EQN A;  3TP6 A;  3HOW H;  1WTP A;  1KLG D;  4AQY Q;  4H7B A;  5JAV A;  5EKI A;  2IPK D;  2BOS A;  1S40 A;  4BS9 A;  3PIO A;  1TS5 A;  1XXG A;  4TSS A;  2EOT A;  4HJ8 A;  4FXG C;  2NZO A;  2NN6 H;  1MI2 A;  1SN8 A;  2FFK B;  1VQD A;  1VQP A;  2A69 C;  3K8A A;  4OWW B;  4PQX A;  4JW0 A;  4DV2 Q;  5FLM H;  4A3M G;  2VB2 X;  3K59 A;  1VQH A;  3CF5 A;  4IZ8 A;  1BUV T;  4A3M B;  1KTK A;  4EQP A;  2N55 A;  4LNQ A;  5C5L A;  2F3V A;  4DAP A;  3QG1 A;  1K8A C;  1HNW Q;  1B1Z A;  5IP7 H;  2Y0S E;  4CDC C;  3S2H H;  4IAL A;  3KLW A;  1P8L A;  1S72 A;  3F1Z A;  4A3L H;  3KYH C;  1ASY A;  1VF7 A;  4C3I G;  2Q8R E;  4A3J H;  3L0O A;  1JOQ A;  5LMU L;  5C0X H;  3BZC A;  3K5M A;  3QWN A;  2NVQ H;  4NMZ A;  5D3I B;  3IFT A;  3DWA A;  4Z9C B;  4CDF C;  2RBM A;  5ELE A;  2UUB L;  3NBH B;  1WOC A;  5BN4 A;  3CCL A;  2F0T A;  4YCU A;  5AJ3 Q;  5M3F H;  4DR5 Q;  2WKD A;  3T1H Q;  4KLK A;  2P5Z X;  2WP8 J;  4X64 L;  1N33 Q;  3STB C;  1NR2 A;  5I6W A;  5BN3 A;  2JA7 G;  1EUJ A;  2EY6 A;  4JI7 Q;  1PV4 A;  3CW2 C;  3VA7 A;  3S15 B;  1WTW A;  2PZU A;  5KGU A;  2R93 G;  4UHV A;  4B08 A;  4Y7N H;  2WB1 G;  2JA7 B;  3KJP A;  1YJW A;  1PH5 A;  1PTO C;  3M4P A;  1XTC D;  3VR2 A;  2WB1 B;  1UWV A;  3ERO A;  2LFN A;  3D6W A;  3MHB A;  4H44 C;  1MBY A;  2E2I H;  3N52 A;  1QE6 A;  1C0A A;  4MHE A;  1STB A;  4JYA L;  4LFC Q;  5GAD C;  1JC7 A;  4IO9 A;  3S1Q H;  2B2V A;  1VQO A;  1G51 A;  1BCP B;  3NHH A;  2ICI A;  1NAP A;  1LTS D;  1Q3L A;  2E74 C;  5I6Y A;  5C4J H;  1I4X A;  4ODG A;  2EXD A;  3E6Z X;  3K7A H;  2KHS A;  1J8I A;  2JA5 G;  4K8I A;  4DR1 L;  1HFN A;  3OTO L;  5IT9 L;  5KYL A;  1ESR A;  4S3S A;  2JA5 B;  1K8O A;  1X55 A;  2CWP A;  1X9N A;  2YTY A;  4KV6 A;  3NPP A;  3M7G A;  4LUO A;  1LTG D;  2OT2 A;  3FRP B;  4KY6 A;  4YWK A;  5J39 A;  1BNZ A;  5C44 H;  3K80 C;  1LTA D;  1ICF B;  3A5Z B;  4RH6 A;  4OIJ A;  4A3C G;  1JE4 A;  1VQK A;  5D14 A;  1SAP A;  2ZT9 C;  3WOF A;  5JPN C;  2A6E D;  2Q8T A;  3TEH B;  3F2B A;  2PPB C;  5IYC G;  3OWF A;  1WYD A;  5M5W H;  4K0K L;  2I0Q A;  2ZXR A;  1KXL A;  2EZV A;  1CA5 A;  3H0G H;  2F3I A;  3TP8 A;  3M3Y H;  4KN4 C;  2A68 C;  4GN5 A;  1SDF A;  1EYG A;  1O7Y A;  2EVB A;  2EPB A;  3FKI B;  1PH4 A;  4JPB W;  2RSO A;  3I7F A;  3GTL B;  1VMC A;  1GVP A;  4LF6 Q;  5M5Y H;  4HN7 A;  4FF3 A;  1DCZ A;  2EY5 A;  4KMU C;  4LF4 Q;  2CQO A;  4LJZ C;  3IRB A;  4UY8 C;  2PZW A;  1Q8K A;  2AUK A;  1C48 A;  3KBX A;  3GDE A;  3HKZ E;  1KAW A;  2PW7 A;  2QKI C;  1SR3 A;  4N8F A;  3CPW A;  1PRT F;  1W2B A;  4JV5 Q;  1LLR D;  1YBY A;  2G5D A;  3MXN A;  4KD4 A;  5C4X H;  1FNU A;  1STA A;  5IOC A;  1QZH A;  1EY6 A;  3I73 A;  1ICW A;  2IL8 A;  1GJX A;  1VQN A;  2WAC A;  1Q1E A;  1TVX A;  2ZXO A;  5IP9 G;  2BH2 A;  1IW7 D;  3MTS A;  2BDN A;  2YV5 A;  3J80 i;  1RL2 A;  3G6J B;  2PYK A;  5EPJ A;  4YIJ A;  3I8Z A;  4LAA A;  3TSS A;  3S16 B;  4ZCK A;  1PTO H;  1B44 D;  1HH2 P;  1AH9 A;  1H9M A;  4JK1 C;  1DD2 A;  2F0U A;  4PZ6 A;  1EWH A;  3HOU G;  2VQF L;  1YIJ A;  4KY7 A;  1PH7 A;  3HOY G;  1R9T H;  3JAM c;  3MEF A;  4R8I A;  1HHV A;  3G71 A;  2J7Z A;  5LMU Q;  2DY8 A;  2RHQ B;  1CKN A;  3NTH A;  1N34 Q;  1Z6H A;  4HCS A;  1R4P B;  3A74 A;  3KBG A;  3KDF A;  3CKI B;  1STE A;  4HR7 B;  2K33 A;  3H91 A;  3GTG H;  3SXH A;  3J7A V;  2DY7 A;  3MXG A;  1JWM D;  1K83 B;  1UE7 A;  2EYO A;  2QCP X;  4ZAI A;  4ZQ3 A;  2CW0 D;  4ZLT F;  1ASZ A;  2WKC A;  4X64 Q;  1WFQ A;  3DM3 A;  5EBD A;  2KEE A;  2L12 A;  4QUF A;  1L0Y B;  2N49 A;  4H13 C;  3H3V C;  3PO3 G;  2ICE C;  5D3D A;  1B4O A;  4TQU S;  4O42 A;  3TS2 A;  4K2L A;  2YYZ A;  1KIX A;  1CKM A;  4LW1 A;  1XJV A;  3PO3 B;  2IX0 A;  2F4I A;  2SNS A;  5IGF A;  3NTK A;  2R7Z G;  1D5Z C;  1EQQ A;  2F03 A;  3R2T A;  1Q46 A;  3H6M A;  1NJI C;  5IGG A;  2WFW A;  4C3H H;  1SE2 A;  5CV9 A;  2K75 A;  2R3Z A;  4JYA Q;  1CZG A;  1IYV A;  4WFN 3;  4YHH L;  1QJO A;  1GOZ A;  2PNR C;  5M5X H;  2JA8 H;  4IPC A;  2B2Y A;  4DV4 L;  3EQL C;  1BOS A;  2KCM A;  2LSS A;  4KJN A;  4M8A A;  3KFU A;  3I90 A;  4DR1 Q;  3I4N G;  1CHP D;  3BDL A;  2KEN A;  5C3E B;  3PO2 H;  3OTO Q;  2PMZ E;  3W2D A;  1YNN D;  2AWO A;  1JOR A;  3TRZ A;  2I46 A;  1EOV A;  2WB1 E;  4B3M L;  4CKB A;  1DJR D;  4YWL A;  3CP0 A;  2NVY H;  3CD6 A;  3I4M G;  4ZYS A;  3MWY W;  5IYB G;  3BVM A;  1U4L A;  1VQI A;  2CKZ B;  2TSS A;  3QIA A;  2JE6 I;  3M4O H;  4A3F G;  3I4M B;  1IYJ B;  1HA6 A;  2K5D A;  2LS0 1;  2PQA A;  4KKS A;  1XYI A;  4PMC A;  4K0K Q;  4A3F B;  1WCM G;  5BN5 A;  5FK9 C;  3CHB D;  4QIW B;  2K28 A;  5L37 A;  4F87 A;  2C9O A;  1JJ2 A;  4GKK L;  1WCM B;  4HSV A;  2PZT A;  3DWQ A;  3CU7 A;  2F4V L;  4MZ9 A;  1JOK A;  3MXN B;  4PNY A;  2RKS A;  5IGC A;  2JA6 H;  3DLL A;  2V4D A;  1STH A;  5CBE E;  4G7H C;  1M4V A;  2KQ3 A;  1K0S A;  1J5E L;  1V43 A;  2G9D A;  2NN6 I;  1VQ8 A;  5EPK A;  5COY A;  4NB3 A;  4A3I G;  4GOP A;  1CTM A;  5IT9 E;  1Y8N B;  4UP8 A;  1TWG H;  5FLX c;  1SNC A;  3NXW A;  2F1M A;  1KDB A;  2KOL A;  1V1Q A;  3BVG A;  3MFG A;  3T56 B;  3X3M A;  3NWT A;  1SJH D;  1V1O A;  1S3O A;  1YNJ D;  2RF4 A;  2C35 B;  1AFP A;  2J0T D;  1M1K C;  1LT4 D;  3J80 L;  1J9O A;  2MFI A;  2RCF A;  4DNT B;  5A35 A;  1NE3 A;  5K36 H;  1ZYR C;  2HCC A;  3CCS A;  4A3G G;  2JA9 A;  1SFO B;  2UUC L;  2NYZ D;  2I5H A;  3ND9 A;  1HTP A;  1OXU A;  4DAV A;  3NEL A;  4K14 A;  1Q82 C;  1I94 Q;  3H3V H;  1VF5 C;  2KCT A;  1PH2 A;  2EYP A;  3ER0 A;  4YCW A;  4RA8 A;  1CKN B;  1BCP C;  1NNX A;  1LT3 D;  3A8J E;  3ONA B;  4N8X 1;  4A3E G;  4C3J G;  1C4Q A;  3KDF B;  2XWB B;  2ZXP A;  5C0X I;  3QJY A;  4C3J B;  4NXN L;  2R6G A;  2R92 B;  3RN5 A;  2EDG A;  5T1I A;  3G6E A;  3K5N A;  3TZU A;  2Y0S B;  4HMJ A;  3NQI A;  4NXM L;  1IBL Q;  1IKM A;  3GTQ B;  5EQ0 A;  1GO3 E;  5HUR A;  4HSP A;  1J6Q A;  3CCM A;  4A3B G;  3CCQ A;  1ONL A;  3GV3 A;  2XRQ D;  3JC6 6;  4X66 L;  4L6T B;  1HUM A;  3S14 B;  4A3B B;  3UE0 A;  2Z8L A;  1BO0 A;  1WTQ A;  5KEE A;  2IJ0 A;  2DN8 A;  4WRD A;  5C6A A;  1PH3 A;  2EYM A;  3CPF A;  4A3M H;  5JJK A;  3J81 c;  2MP1 A;  3CCR A;  4BA1 I;  3KOJ A;  4OO1 G;  1GM5 A;  4FF4 A;  4DAY A;  3HOV B;  3C46 A;  1PH8 A;  1Q86 C;  3RMH A;  2VUM G;  2F0V A;  5DEH A;  2Z4H A;  1M90 C;  3S2D B;  1SRU A;  4IUT A;  2LKV A;  1A15 A;  1PH6 A;  3F2U A;  1BQQ T;  1WD1 A;  1HR0 W;  1ILP A;  4ALP A;  2VUM B;  3RN2 A;  2XGT A;  4YHH Q;  1VQ5 A;  3UDF A;  1I4R A;  1Z47 A;  2HHH L;  3C2P A;  1UAP A;  3J7A F;  1HXY D;  5I9P A;  3ERS X;  4DV4 Q;  4A93 G;  5C4Z A;  1UEB A;  4JI3 Q;  5CBA E;  1A62 A;  4A93 B;  3BG3 A;  4ME5 A;  2F0M A;  4R4Q A;  2PQA B;  1RIP A;  4A75 A;  1K0R A;  4XQJ A;  4RGO S;  2F0J A;  3AFQ A;  1EY0 A;  5DNF A;  2HDL A;  2Z0S A;  2IT1 A;  3GD7 A;  4B3M Q;  3S15 H;  2HIX A;  4XYO A;  2JA7 H;  3NE5 B;  1KRS A;  1EZ6 A;  4PG3 A;  4R9W A;  1VQ9 A;  1L1O A;  1EY7 A;  4XXE A;  1OXS C;  2F0K A;  2E2J B;  4ZUJ A;  3KF6 A;  5IE8 A;  3PUX A;  4JBK A;  5KYI A;  4KHZ A;  3IAY A;  3L7Z C;  4DNI A;  2MO0 A;  4POG A;  3I3C A;  2G9H D;  3TZD A;  1PZI D;  4GKK Q;  1H9S A;  1E0B A;  4CBV A;  4GLA C;  1DXM A;  3T53 B;  4IUU A;  3BZK A;  3KUP A;  1PRT D;  3N6R A;  2F4V Q;  4DGZ A;  3HOX G;  3UE1 A;  4DR6 L;  1YEZ A;  3DMU A;  1I3Q B;  3QB3 A;  2L5T A;  5JOB A;  3K0X A;  3GTJ B;  2QA4 A;  1J5E Q;  2BE5 D;  2B63 G;  2OCE A;  2IX3 A;  1AEX A;  3C3L A;  2B2V C;  4F8M A;  4LF8 L;  2B63 B;  1VQC A;  3A8I E;  4IFD G;  5CYU A;  1RF2 D;  3HKZ B;  4DNR B;  4B3R L;  3Q8D A;  1CA6 A;  1WTR A;  2F3W A;  4A3C H;  2UUC Q;  2B2U A;  2ZM6 L;  5ELB A;  4POF A;  3U58 A;  2Q2U A;  2AQ1 B;  4DV5 L;  4CDE C;  2E2H B;  4GS3 A;  3FKI H;  2A6E C;  1C9O A;  4P73 A;  1X3E A;  4IJL A;  3T16 A;  4NDX A;  4X62 L;  4R4T A;  4K5V A;  4KTA A;  1YI2 A;  4QY7 A;  3D31 A;  1BBU A;  4WJW A;  3JAM L;  3OPO A;  4BBR G;  1R4Q B;  4X3U A;  3TQY A;  5GRO A;  1Y1V G;  4AH6 A;  2JYO A;  4NXM Q;  1VQL A;  1EIG A;  1E3P A;  3OSO A;  5JJL A;  1WTH A;  4BBR B;  4I65 A;  1Y1V B;  2A6H D;  4DK3 C;  2KCN A;  3I56 A;  1LTT D;  1Y69 U;  2AQ2 B;  4X66 Q;  1HNZ L;  5G3L F;  1JJG A;  4JI5 L;  1JT8 A;  3KLS X;  2ZTE A;  3QO2 A;  1GHJ A;  3J80 E;  3EA6 A;  2F0H A;  2F52 A;  3U4V A;  1LO5 D;  4DXG A;  5EJW A;  4IPH A;  2FIN B;  4QL5 A;  1LV9 A;  2MNA A;  1ZEQ X;  5M9O A;  3S16 H;  2IW3 A;  4BBS G;  2UXD L;  4DK1 A;  1CFM A;  2OXP A;  1CUK A;  1IW7 C;  1AE3 A;  1EWI A;  4BBS B;  3MVV A;  1XPU A;  5HGT A;  4KHP L;  5ELN A;  1E2V A;  1OXX K;  1B2T A;  4J6H A;  1KQS A;  1G8Z D;  4C3I B;  4K8J A;  4DK0 A;  2HHH Q;  2B29 A;  3BZD B;  5J22 A;  4L5S A;  3UI2 A;  1ZXT A;  1DOL A;  5ELO A;  4APV A;  5IGE A;  1L1O B;  4UP9 A;  1TWF B;  4HJ9 A;  3BYY B;  4QMG A;  3KF6 B;  2K05 A;  1KAA A;  1K83 H;  3I55 A;  2SOB A;  3HP3 A;  5CV8 A;  4ZKB B;  2N88 A;  4U68 A;  1E2W A;  1QZG A;  1DON A;  3KLR A;  2PMZ B;  4FNF A;  3QR8 A;  5C5M A;  1PRT B;  3V2T A;  1BDO A;  2DJF C;  2L11 A;  2K5N A;  3P1H A;  3PUV A;  1QVC A;  3PO3 H;  2R93 B;  2RCN A;  1U9R A;  1WVL A;  1E7Z A;  2CW0 C;  4QQB X;  4DFA A;  1AP0 A;  2XNA C;  2F0P A;  1A0I A;  4XYQ A;  4LF5 L;  2Z1C A;  1PHJ A;  2KBN A;  4A4I A;  3SHL A;  3H15 A;  4DR7 L;  1YHB A;  2K1B A;  4B9X A;  5FJ8 H;  3WOE A;  4ABN A;  4BY1 G;  3HRZ C;  2EQS A;  5M3M G;  2PO4 A;  1F2Y A;  1KNE A;  4BY1 B;  4DR6 Q;  3GTK B;  1AZP A;  2OEO A;  2RA4 A;  2RSN A;  5C3E H;  1BXT A;  3PSI A;  2ES2 A;  2JXM B;  1IL8 A;  4DUZ Q;  1LAC A;  2XRS D;  1EIF A;  4WOR A;  3H09 A;  5FKA C;  4DU9 A;  4EQ5 A;  5HGQ A;  3RNU A;  1WJJ A;  5I2X A;  1D7Q A;  4C1N K;  1YHQ A;  3A54 A;  4HIM A;  2KHJ A;  4LFB L;  4V0B A;  3RD4 A;  4RG1 A;  2B2Y C;  1JB7 A;  1NCV A;  5JVH 3;  1HTL D;  3H3V I;  3PQI A;  4IUN A;  4B3R Q;  3OHX C;  1SYB A;  3DXJ C;  1YNN C;  4PV1 C;  2XSC A;  3VDY A;  4DV0 L;  2ZM6 Q;  1JCK B;  1QUQ A;  5CC4 A;  2WII B;  3F2C A;  2V1C C;  5IYD G;  4A3F H;  5FOB B;  2VQE L;  2PQE A;  4DV5 Q;  3CME A;  4KD3 A;  2PW5 A;  1VQM A;  2Q2T A;  1HR0 L;  3PIP 3;  3GTM B;  1TS4 A;  3E9I A;  4BXX G;  4X62 Q;  2F0I A;  3HOZ G;  4B3T L;  1MJC A;  4JI0 L;  2B2W C;  1LM0 A;  1CT1 D;  2VZA A;  4OX9 L;  1XTD A;  1E24 A;  2KHI A;  1EIH A;  4LUZ A;  3BU2 A;  5C0X J;  2MO1 A;  1PYW D;  1EQV A;  1TR5 A;  4KHV A;  5FO7 B;  1S5E D;  3C1E A;  1F9P A;  2NZH A;  4G57 A;  4JBJ A;  4JI5 Q;  1CM9 A;  3HKS A;  1SNM A;  3CXC A;  1ENC A;  2D9U A;  5KRU A;  3OYY A;  2UU9 L;  1VDZ A;  2B2T C;  1ROD A;  4HIK A;  1PYB A;  4IOA A;  1NBW A;  2NN6 G;  4N9T A;  2VL6 A;  4KKT A;  5D65 A;  4KN7 C;  4QJF A;  4XTC S;  1SRO A;  1NMF A;  1YNJ C;  3K57 A;  2HUG A;  1G6P A;  3DM1 A;  5FLM G;  4A3K G;  2BA0 A;  4C3J H;  1TWC B;  5KNB A;  2X69 A;  2AQ3 B;  3QOL A;  4A3K B;  4OGQ C;  3K5L A;  2R92 H;  1CKO A;  3HOU B;  4KHP Q;  2FMM A;  1SYD A;  3EFX D;  5IP7 G;  3HOY B;  4KK7 A;  3OOC A;  3PUW A;  4RCN A;  3VYR A;  4EGV A;  1RHP A;  3JAM E;  3GTQ H;  2B3G A;  2UUB Q;  4A3L G;  5BR8 L;  2JSO A;  1LYL A;  1PYS B;  2AHO B;  3S2H B;  1B3A A;  5A2Q L;  3S1N B;  1PMR A;  4LUV A;  1K73 C;  5DLQ E;  3FMC A;  3AU7 A;  3A8K E;  4A3B H;  3CRL C;  4KKU A;  3RZO B;  1OO9 B;  4C2M B;  3S17 B;  1UE1 A;  3CCV A;  4E6I A;  4DR3 L;  1SYC A;  1C7Y A;  1I6H B;  2NBF A;  2K5H A;  2SDF A;  5HY6 A;  4DV6 L;  1XPO A;  1K28 A;  2IHF A;  2M9V A;  2QDL A;  3FP9 A;  3GV6 A;  2QEJ C;  1YJN A;  3VYT A;  1GXD C;  4HJ5 A;  4IUP A;  4K6L A;  3OW7 A;  3HOV H;  2F0S A;  2R7Z B;  1JWU D;  5LMN W;  4JCV E;  4LF5 Q;  1ILQ A;  3S2D H;  1K8M A;  2H4O A;  2QGQ A;  4Y7N B;  4P75 A;  1NY4 A;  3OMG A;  4G4K A;  4DR7 Q;  2Z6K A;  2KVM A;  2VY3 A;  3J7Z C;  4DV7 L;  3T1Y L;  2EY1 A;  1QVF A;  2UXB L;  4A76 A;  1WTO A;  2E5L L;  2ZTC A;  3RZD B;  5ELC A;  1SYE A;  1I4H A;  3I70 A;  2L9H A;  3L3O C;  4JOI A;  5JEA H;  1SEB D;  1EOT A;  4IN3 A;  4FDB A;  3EVQ A;  3K7U C;  1EYA A;  2LY7 A;  3AB9 A;  3I4N B;  4IJH A;  2PNH A;  4OON A;  1QUQ B;  3AEV A;  1PDQ A;  4L63 B;  3K7A B;  1DYQ A;  1HNX L;  4KY5 A;  4LFB Q;  2UXC L;  2RDG A;  4B3S L;  3AYH B;  1B8A A;  3BVZ A;  1LT5 D;  3OIQ A;  4X3T A;  1SSO A;  3SR1 A;  2E2J H;  2RVL A;  1V9P A;  2XTI A;  5JJZ A;  5C44 G;  2NTT A;  3KLS A;  1TU2 B;  1HUN A;  3A7L A;  2K5Q A;  2WV6 D;  5C44 B;  3NUC A;  2H5X A;  3FDT A;  1ESF A;  3S9W A;  1STY A;  4ILW A;  4DUY L;  2A68 D;  3BDC A;  4YY3 L;  1SNO A;  4UPA A;  2IY5 B;  1HR0 Q;  5LL6 S;  1WTV A;  5G3L D;  5M5W B;  1SMX A;  1SNQ A;  2I07 B;  4B3T Q;  4JI0 Q;  1S5F D;  1S5D D;  4HJA A;  2MHV A;  4HMI A;  4JI8 L;  1Q81 C;  1I3Q H;  4PMB A;  5NUC A;  3GTJ H;  2PI2 A;  1XX8 A;  4F88 A;  4OX9 Q;  2L0C A;  4JI6 L;  2DNC A;  1PRT C;  4A3I B;  1HA5 A;  4DA2 A;  3K0Y A;  4DF7 A;  4L5T A;  1FGB D;  3NP8 A;  4QCL A;  1D2B A;  3I4O A;  5IT9 c;  2O5J C;  2CH4 W;  4F7X A;  2BE5 C;  1X32 A;  1EY4 A;  3E0J A;  2UU9 Q;  1FJG L;  3D3R A;  5E7N A;  4HID A;  4A3G B;  2IWH A;  1N32 L;  5C4X G;  1EQR A;  5J3B A;  2QDB A;  1X54 A;  3NSW A;  1UEA B;  4ID6 A;  4JC0 A;  1VQ7 A;  1X6O A;  4FXK C;  4I7A A;  4JBW A;  1B9N A;  4JVZ A;  2EXZ A;  4OWX B;  2BA1 A;  2D0P A;  4A3E B;  2A73 B;  2E2H H;  1QB5 D;  1KDC A;  1LTR D;  4RGN A;  4HAE A;  4JBM A;  2VQF Q;  3LGJ A;  4NW2 A;  3R3O A;  4JI1 L;  3S1R B;  3CRK C;  4DKA C;  4DV3 L;  1HRJ A;  4U67 3;  1GUN A;  1FR3 A;  3HG9 A;  5CV7 A;  3DHQ A;  4PZ7 A;  4OEL B;  1AW7 A;  3J7A 5;  1EY5 A;  2HD3 A;  1FNW A;  1BBX C;  4WJ3 M;  2F0F A;  4PMW A;  3D4W A;  1DOM A;  3JAM i;  1LAB A;  5BR8 Q;  1Y1V H;  2J4X A;  1Q90 A;  2KCC A;  4MN3 A;  2VB3 X;  2I5M X;  1W3S A;  5C4H A;  1HQM C;  1L0W A;  3FPU B;  3FHW A;  3CCE A;  1R9T B;  2JEA I;  1CQF A;  1EYC A;  5CMD A;  1HZ9 A;  1YZ6 A;  3I91 A;  5JEA J;  2DNE A;  3MAQ A;  1EFI D;  4DR3 Q;  4JI4 L;  4LFA L;  3GTO B;  2A6H C;  1LUZ A;  4LMQ D;  1HQR D;  1EFW A;  1DZ1 A;  2N3S A;  1NMG A;  3I2Z A;  4FP5 D;  1GUG A;  2JQO A;  2K03 A;  5GAH C;  3AMU A;  1A8V A;  4GNX A;  1VS0 A;  1VQB A;  2O4X A;  4MTK A;  2NVT B;  3W3A A;  5EKL A;  1QCB D;  2MUY A;  3GP7 A;  5FO8 B;  1OXT A;  3NEM A;  3TDQ A;  1MD2 D;  4GN4 B;  4DV7 Q;  4C3H G;  4C3I H;  1MGS A;  1CHQ D;  3S1M B;  1XNR L;  1CI3 M;  4X65 L;  1HZA A;  4C3H B;  1N36 L;  4OL7 A;  2HIV A;  4DN4 M;  2JA8 G;  1P16 A;  4AYB G;  3E5S A;  1CSP A;  1A3V A;  2CWA A;  1KAB A;  1TWF H;  5C3X A;  5A2Q E;  1SXT A;  3ITP A;  3UDX A;  3MXU A;  5DM7 3;  1B3Q A;  4DR4 L;  3OW2 A;  4OEM B;  1A63 A;  1VQG A;  1PA6 A;  2ZJQ A;  3FPP A;  4FF2 A;  4R4C A;  4DK6 C;  1STN A;  3PO2 G;  1IYU A;  1HNX Q;  1T5E A;  4CDD C;  4FVM A;  4DR5 L;  2UXC Q;  3E3X A;  1SND A;  4B3S Q;  2R93 H;  1TWA B;  4H02 A;  5E4W C;  3T1H L;  3PO2 B;  3NBI A;  1IKL A;  4JI2 L;  4BY7 G;  4C56 C;  1KNA A;  4NKL A;  2NZ1 D;  4JG2 A;  1HCZ A;  2E75 C;  3AQQ A;  4KJO A;  1AN8 A;  4BY7 B;  2Q2I A;  4OIK A;  3Q22 A;  4XQQ A;  1II3 A;  3KF8 A;  4B9W A;  4LF7 L;  2GN5 A;  3NBH A;  2F0G A;  4GOP B;  3B6Y A;  1RTO A;  1U4M A;  1G2T A;  1G6Z A;  1PTO F;  3Q24 A;  1PFS A;  4ME3 A;  4EX5 A;  1PFB A;  1TII D;  2Q2H A;  3V96 A;  3CAM A;  1A2U A;  1TWH B;  3HOX B;  1S5B D;  3CCU A;  3EN2 A;  3VR3 A;  3GTK H;  4G7O C;  2YTX A;  2JA5 H;  5EKK A;  4GLX A;  2LXJ A;  4UP7 A;  4JI6 Q;  5KNC A;  1Q12 A;  3GO5 A;  2JA6 G;  1HPC A;  4WJ4 A;  1VQ6 A;  1BF4 A;  1PFN A;  2DJG C;  5GQO A;  1O7L A;  2VW9 A;  1K3R A;  1CQV A;  1DOK A;  1VCI A;  1CSQ A;  2OQK A;  3LWE A;  4HJ7 A;  1TXY A;  1FJG Q;  4KI0 A;  1TWG B;  1Y1W G;  4UAI A;  2YU9 B;  2EYJ A;  1N32 Q;  1EU4 A;  2L15 A;  2WAQ G;  1XNQ L;  1EZ8 A;  1K8G A;  5IYC H;  4CHT B;  1Y1W B;  1SMY D;  1QNU A;  1QWY A;  1Q7Y C;  1L2F A;  1G91 A;  2JP1 A;  2NVX B;  5E4X A;  5LMN L;  1FGU A;  5CGK A;  2VXW A;  3BYT B;  3T51 B;  1U4R A;  2ATW A;  4ZUI A;  4NXN Q;  2O2L D;  2XIW A;  3GTL H;  3QOJ A;  5H1S E;  3GTM H;  1SNP A;  1X3G A;  4O0A A;  1IL2 A;  4JI1 Q;  1KRT A;  2EJF C;  1F9S A;  4DV3 Q;  3M85 A;  1X3Q A;  4BXX H;  2F0O A;  1SYF A;  1Y8O B;  2H1E A;  2CQA A;  4L8J A;  4IUQ A;  1M8A A;  1H9J A;  2CVR A;  3KK7 A;  4P2C B;  4RHR A;  2X6L A;  3F8T A;  4LF6 L;  2JN4 A;  1WTX A;  1EIY B;  4GNX B;  4DAY B;  4LF4 L;  1PLF A;  3GQB A;  5DM6 3;  1H9K A;  2GVA A;  1SJE D;  3U9S A;  2OWO A;  4RMF A;  1LTL A;  2AWN A;  5JPM C;  4JI4 Q;  4LFA Q;  1X56 A;  2LXK A;  5F2D A;  5IP9 H;  1LT6 D;  4RGM A;  4JV5 L;  2JK8 A;  4OO1 I;  3D6C A;  4OXP A;  2M2L A;  3PMF A;  4A3D G;  3J80 c;  5I2Y A;  4G7Z C;  3U50 C;  5E3F A;  2Q8I B;  1Q1B A;  5DAU A;  2EE1 A;  2HCI A;  2IHE A;  2E8G A;  3I72 A;  4A3D B;  1ET6 A;  1TWC H;  1D1I A;  3ULL A;  3J81 i;  1PVO A;  4A3K H;  2K5W A;  4ULL A;  3BS1 A;  3HOU H;  1XMO L;  5IIF A;  3D8G A;  1KC8 C;  3TN2 A;  3HOY H;  2VNU D;  3W1B A;  1D1K A;  4Y52 H;  2YTV A;  4RFB A;  1XNR Q;  3K58 A;  4X65 Q;  1N36 Q;  2EYH A;  3S1N H;  4X6A H;  1I50 B;  3G4S A;  5ISR A;  3GTP B;  3VYS A;  2K6A A;  1I4G A;  2A8V A;  3SGI A;  1F9Q A;  3RZO H;  4L5Q A;  4YWM A;  4C2M H;  4K5X A;  3S17 H;  4DR4 Q;  1JE5 A;  1MIU A;  2ID0 A;  4CGY B;  3L2P A;  1N34 L;  2CCZ A;  1I6H H;  3J81 j;  3KF8 B;  3TRE A;  1H9S B;  1HZC A;  1D6E C;  4GN3 B;  1SYG A;  4RKB A;  4XDX A;  1SE3 A;  4JI2 Q;  1CK1 A;  2KEC A;  3OIP A;  1MHW C;  2R7Z H;  3EBE A;  4FYD A;  4EQO A;  5IGB A;  2A5H A;  4CJ2 C;  3M7N A;  2NWG A;  2Z6B A;  2MJ8 A;  3PF4 A;  1EEF D;  3VYU A;  4IPG A;  4LF7 Q;  3CQZ B;  2D2C C;  1JJC B;  2KJX A;  3CC4 A;  3A5U A;  1FD7 D;  1S4Z A;  3RZD H;  1VQF A;  4IQZ A;  1KHI A;  1IXR A;  4AYB E;  5M3M B;  4DV1 L;  2F0D A;  1UE5 A;  2L4N A;  3I4N H;  1QNK A;  3H94 A;  1MKH A;  5FLX L;  4IFD I;  2OF1 A;  4DPG A;  4LF8 Q;  2Z6K C;  1I6V C;  4K6D A;  2R61 A;  2F0E A;  2QEX A;  2EY2 A;  1KL9 A;  2PCF B;  4N9P A;  1GUW A;  4HED A;  1O7Z A;  4JOI C;  4XQN A;  3TP5 A;  3I4M H;  2PI2 E;  5IGD A;  5IYB H;  1DGS A;  5GAE C;  2EYF A;  1XNQ Q;  2R7D A;  1GUO A;  1WCM H;  3ULJ A;  1T9H A;  5LMN Q;  4R8N A;  2XWJ B;  3F2D A;  2HQE A;  1JOO A;  2E2D C;  1JMC A;  1U4P A;  3FEW X;  3V05 A;  2OTJ A;  4BA2 I;  5E1F A;  4RGT A;  3HOZ B;  5CV6 A;  3FKI G;  5T1G A;  1D8L A;  2K4K A;  5EPL A;  1PH9 A;  2RHS B;  1T5X D;  1VQA A;  2GVB A;  4IUV A;  3FVQ A;  1PH1 A;  4RWS C;  4A3I H;  3A7A B;  3HOW G;  1HNZ Q;  2X6G A;  3A55 A;  1EQT A;  1JWS D;  2A69 D;  1G2S A;  3DWP A;  1VMP A;  3HOW B;  1NUC A;  2UUA L;  2OTL A;  2N78 A;  3I4L A;  1SFO H;  3SE0 A;  1AE2 A;  2AMC B;  4O1N A;  3ULP A;  1C8C A;  2WAQ E;  2A1A A;  5IOD A;  4A3G H;  1RTN A;  4GOP C;  1DM0 B;  3C1F A;  1RD9 D;  3J81 L;  2ENB A;  1TY0 A;  1E1O A;  2HDM A;  4X3K A;  1PZK D;  2O5I C;  2UXD Q;  4A3E H;  2TMP A;  3A0J A;  3U9O A;  5AFW A;  2CFM A;  2D62 A;  1V1P A;  3CMA A;  3S1R H;  1I94 L;  3RUZ A;  4NP5 A;  1XMO Q;  1MJE A;  1F9R A;  1GHK A;  3T4A C;  2HQL A;  3HFZ B;  1BR9 A;  1SLJ A;  3VR6 A;  1BCP F;  3NWS A;  2A19 A;  4IPD A;  4OWT B;  4DAM A;  4A3J G;  3ND8 A;  1TT2 A;  2GA4 B;  5C0X G;  1IBM L;  2RDF A;  3M4Y A;  2Z9H A;  3S14 H;  4CKC A;  4R1J A;  1GKH A;  2K5V A;  2MGS A;  4A3J B;  1QVG A;  2NVQ B;  3STB D;  3W5O A;  3UDI A;  1IBL L;  4RCO A;  5M3F G;  4QF4 A;  4CJ0 B;  4X3S A;  3GTO H;  3DUZ A;  5M3F B;  2K14 A;  1XPR A;  1PTO D;  5JJI A;  1W6K A;  1X65 A;  1FNV A;  2FMC A;  3Q6S A;  1H95 A;  4FF1 A;  1YJ9 A;  3SK8 A;  4V19 0;  1Z9F A;  1IBK L;  5I9O A;  3K81 C;  1E22 A;  4OO1 H;  3W1G A;  2B39 A;  4L5R C;  4I7Z C;  2NVT H;  4M1U B;  5TSS A;  3IL8 A;  1H9R A;  1B53 A;  2VUM H;  4IUR A;  1O80 A;  2D5D A;  3NEN A;  1GUT A;  2L55 A;  1HFG A;  2RDH A;  1B70 B;  1E1T A;  2XVS A;  3MC0 B;  3Q0A A;  2E2I B;  1G29 1;  1N8R C;  2K50 A;  3MA2 B;  3S1M H;  4IOC A;  5COR A;  2WIN B;  5FJ8 G;  4DV1 Q;  1MSG A;  3TME A;  4GNX C;  2DUD A;  4PZ8 A;  1KLU D;  2KUM A;  3U4Z A;  3S1Q B;  2HT1 A;  4A93 H;  3VR4 A;  4ZK9 B;  3IKJ A;  5C4J B;  2K04 A;  3PIO 3;  1ENF A;  5CV4 A;  4ZRZ A;  2ALY B;  5C3E G;  1NSN S;  4QGU A;  5ELF A;  4CKE A;  4JI3 L;  2JEB I;  4RKL A;  1WD0 A;  1TWA H;  3RR5 A;  1IZ6 A;  3HEJ A;  1A6X A;  3A56 A;  5J1Z A;  1N9W A;  4DV0 Q;  4C1N I;  3RLF A;  4GKJ L;  3LWU A;  4K5W A;  4BY7 H;  1I4P A;  2VQE Q;  3PCO B;  2F0W A;  3G7L A;  2SEB D;  1AZQ A;  2LMC B;  2KED A;  3OMC A;  5I4D A;  1GUS A;  1O7I A;  3SK4 A;  1B7Y B;  2B2W A;  1U5K A;  1L1O C;  3H0G G;  2M00 A;  4LWC A;  4TRD A;  2K52 A;  1TWH H;  1Z7T A;  2B8G A;  2L1B A;  4BWG B;  5GAG C;  3HOX H;  1TS3 A;  1WI5 A;  3H0G B;  3MFY A;  1K3B C;  1ENA A;  1YNX A;  1VQ4 A;  3M3Y B;  3D0F A;  1TS2 A;  4DR2 L;  3AFP A;  2SNM A;  2BCO A;  4K2K A;  3L9A X;  2DGY A;  1EYD A;  1Q8I A;  3DEP A;  4DXF A;  1VQJ A;  3WDN A;  1KD1 C;  2B63 H;  2KA7 A;  4GZY C;  1B9M A;  3TS0 A;  5M5Y B;  4XT3 B;  5FLX E;  1BVS A;  3MXP A;  2AUJ D;  2B2T A;  4IFD H;  3S24 A;  2C5C A;  2K7V A;  3NTI A;  2UUA Q;  3TBI B;  1NTG A;  3SDZ A;  1V1P B;  1W6J A;  4LF9 L;  4MIU A;  3ERQ A;  1XMQ L;  1NR4 A;  3HZX A;  1U0L A;  3D4D A;  2I5L X;  5IWA L;  3NQT A;  3K6O A;  2YU9 H;  1VQE A;  1TKW B;  3HS0 C;  2AKW B;  3E0E A;  1Y8P B;  5C4X B;  2NTS A;  1Y1W H;  1EEI D;  1UUP A;  1QIL A;  1BBW A;  4YCV A;  2NVX H;  3SVM A;  4GLV B;  2A74 C;  3EIV A;  1UNS A;  1RJT A;  5IY0 A;  5KND A;  3LX0 A;  1Y14 B;  2F0L A;  3HGB A;  3J7Y W;  4NPS A;  3RLO A;  1O78 A;  3P75 A;  2B2U C;  1SMY C;  5EAY A;  2ASB A;  3SK6 A;  1PTO B;  1F77 A;  1ET9 A;  3M9B A;  4BBR H;  2R92 G;  3CC2 A;  3K5O A;  3ICE A;  2Y0S G;  1ZKO A;  2F0Q A;  1IBM Q;  3R8B A;  2BH8 A;  3P20 A;  2VS1 A;  1E2Z A;  3D4R A;  5EGT A;  2XN9 C;  4AQY L;  1JB3 A;  3URY A;  4P74 A;  2QW7 A;  4DV6 Q;  1YIT A;  3GTG B;  4OHJ A;  2Z4I A;  1TQO A;  2EIF A;  1XWE A;  4J15 A;  1GD7 A;  3MEH A;  4LK1 C;  4H0L C;  4HCE A;  3PUZ A;  4Q0F A;  3J81 E;  1PZJ D;  2K01 A;  1D5M C;  1IBK Q;  4DV2 L;  2EYL A;  2QIL A;  4A3D H;  1EY8 A;  3BJU A;  5FO9 B;  4BBS H;  1QG7 A;  3IFD A;  1LTB D;  2ZJP A;  2QF7 A;  1UE6 A;  3R93 A;  3PF5 A;  5K5P A;  4Q5V A;  3T1Y Q; 
#chains in the Genus database with same CATH homology
 5C3W A;  2NUC A;  4CJ1 B;  1FYC A;  4TKO B;  3TP7 A;  1X3P A;  1JQY D;  5ELD A;  1L0X B;  2EJM A;  3DEO A;  4RAU C;  2FJ2 A;  4FXD A;  1V8Q A;  5M5X B;  2JA8 B;  5EBC A;  4AYB B;  3OWE B;  2RQX A;  5JEA G;  3VA5 A;  4FO2 A;  2IX1 A;  3ZYY X;  1D5X C;  1CZW A;  3PUY A;  1MSH A;  5CV5 A;  1TY2 A;  1A2T A;  2E76 C;  3T13 A;  2F0N A;  2MPM A;  4EVO A;  4IFD J;  4J8Q A;  1PXU A;  2NVY B;  1F2L A;  1RDP D;  1QOH A;  1F2M A;  1S5C D;  3M4O B;  1JIC A;  4J1M A;  1PFM A;  1OXV A;  3P7J A;  1LTI D;  1JR0 D;  2FHT A;  1EU3 A;  3LNN A;  3X3N A;  4RHS A;  3O13 A;  3MZ5 A;  4QB4 A;  3PV0 A;  4HTH A;  3SEB A;  2JA6 B;  1A3U A;  1EY9 A;  4UDU C;  1F2Z A;  1B50 A;  2EJG C;  1ZYR D;  5LL6 X;  2CHB D;  5CR3 A;  1A3T A;  1IHZ A;  2K32 A;  5K36 G;  1I4Q A;  1RKN A;  1BCP D;  2WAQ B;  3R2I A;  3EJI A;  3VR5 A;  5LHY 1;  3SK5 A;  2B8F A;  3Q23 A;  1RCV D;  1KDA A;  2NB0 A;  1STG A;  2BDO A;  4ZKC B;  4XIG S;  3NK9 A;  1EL0 A;  1SBB B;  1SE4 A;  3BDO A;  4XT1 B;  1ML0 D;  4QUC A;  5JVG 3;  1EWC A;  5KIX A;  4EQN A;  3TP6 A;  1WTP A;  1KLG D;  4H7B A;  5JAV A;  5EKI A;  2IPK D;  2BOS A;  4BS9 A;  1TS5 A;  1XXG A;  4TSS A;  2EOT A;  4FXG C;  2NN6 H;  1MI2 A;  2FFK B;  2A69 C;  4PQX A;  2VB2 X;  3K59 A;  4IZ8 A;  1BUV T;  4A3M B;  1KTK A;  4EQP A;  2N55 A;  5C5L A;  2F3V A;  4DAP A;  3QG1 A;  1B1Z A;  4IAL A;  1VF7 A;  4C3I G;  2Q8R E;  1JOQ A;  5C0X H;  3K5M A;  3QWN A;  4NMZ A;  5D3I B;  3IFT A;  3DWA A;  4Z9C B;  2RBM A;  5ELE A;  5BN4 A;  2F0T A;  2WKD A;  2WP8 J;  1NR2 A;  5I6W A;  5BN3 A;  2EY6 A;  3VA7 A;  3S15 B;  1WTW A;  2PZU A;  5KGU A;  4B08 A;  2JA7 B;  1PTO C;  1XTC D;  3VR2 A;  2WB1 B;  3ERO A;  2LFN A;  3D6W A;  3MHB A;  4H44 C;  1MBY A;  3N52 A;  1QE6 A;  4MHE A;  1STB A;  1JC7 A;  2B2V A;  1BCP B;  3NHH A;  2ICI A;  1NAP A;  1LTS D;  1Q3L A;  2E74 C;  5I6Y A;  1I4X A;  4ODG A;  3E6Z X;  2KHS A;  1J8I A;  4K8I A;  1HFN A;  5IT9 L;  5KYL A;  1ESR A;  4S3S A;  2JA5 B;  1K8O A;  4KV6 A;  3NPP A;  3M7G A;  1LTG D;  2OT2 A;  3FRP B;  4KY6 A;  5J39 A;  1BNZ A;  1LTA D;  4RH6 A;  4OIJ A;  1JE4 A;  5D14 A;  1SAP A;  2ZT9 C;  3WOF A;  5JPN C;  2A6E D;  2Q8T A;  2PPB C;  3OWF A;  2ZXR A;  2EZV A;  1CA5 A;  3TP8 A;  4KN4 C;  2A68 C;  1SDF A;  1O7Y A;  2EVB A;  2EPB A;  3FKI B;  2RSO A;  3GTL B;  1VMC A;  4HN7 A;  4FF3 A;  1DCZ A;  2EY5 A;  4KMU C;  4LJZ C;  2PZW A;  2AUK A;  1C48 A;  3KBX A;  2PW7 A;  2QKI C;  1PRT F;  1LLR D;  3MXN A;  4KD4 A;  5IOC A;  1FNU A;  1STA A;  1EY6 A;  3I73 A;  1ICW A;  2IL8 A;  1GJX A;  2WAC A;  1Q1E A;  1TVX A;  2ZXO A;  1IW7 D;  3MTS A;  2BDN A;  3G6J B;  2PYK A;  5EPJ A;  4YIJ A;  3I8Z A;  4LAA A;  3TSS A;  3S16 B;  1PTO H;  1B44 D;  1H9M A;  4JK1 C;  1DD2 A;  2F0U A;  1EWH A;  4KY7 A;  4R8I A;  1HHV A;  2J7Z A;  2DY8 A;  3NTH A;  1Z6H A;  4HCS A;  1R4P B;  3KBG A;  3CKI B;  1STE A;  4HR7 B;  2K33 A;  3H91 A;  3SXH A;  3J7A V;  2DY7 A;  3MXG A;  1JWM D;  1K83 B;  2EYO A;  2QCP X;  4ZAI A;  4ZQ3 A;  2CW0 D;  4ZLT F;  2WKC A;  5EBD A;  2KEE A;  2L12 A;  4QUF A;  1L0Y B;  4H13 C;  3H3V C;  2ICE C;  5D3D A;  1B4O A;  4TQU S;  4O42 A;  4K2L A;  2YYZ A;  3PO3 B;  2IX0 A;  2F4I A;  2SNS A;  5IGF A;  3NTK A;  1D5Z C;  2F03 A;  3R2T A;  3H6M A;  5IGG A;  1SE2 A;  5CV9 A;  2R3Z A;  1CZG A;  1IYV A;  4WFN 3;  1QJO A;  1GOZ A;  2PNR C;  2B2Y A;  1BOS A;  3EQL C;  4KJN A;  4M8A A;  3I90 A;  1CHP D;  3BDL A;  5C3E B;  3W2D A;  1YNN D;  2AWO A;  1JOR A;  2I46 A;  4CKB A;  1DJR D;  4ZYS A;  3MWY W;  3BVM A;  1U4L A;  2TSS A;  3QIA A;  2JE6 I;  3I4M B;  1HA6 A;  2K5D A;  2LS0 1;  4KKS A;  1XYI A;  4PMC A;  4A3F B;  5BN5 A;  5FK9 C;  3CHB D;  4QIW B;  2K28 A;  4F87 A;  2C9O A;  1WCM B;  4HSV A;  2PZT A;  3DWQ A;  3CU7 A;  1JOK A;  4PNY A;  2RKS A;  5IGC A;  2V4D A;  1STH A;  5CBE E;  4G7H C;  1M4V A;  2KQ3 A;  1V43 A;  2G9D A;  2NN6 I;  5EPK A;  5COY A;  1CTM A;  5IT9 E;  1Y8N B;  1SNC A;  3NXW A;  2F1M A;  1KDB A;  2KOL A;  3BVG A;  3MFG A;  3T56 B;  3X3M A;  3NWT A;  1SJH D;  1V1O A;  1YNJ D;  1AFP A;  2J0T D;  1LT4 D;  3J80 L;  1J9O A;  4DNT B;  5A35 A;  5K36 H;  1ZYR C;  2HCC A;  1SFO B;  2NYZ D;  3ND9 A;  1HTP A;  1OXU A;  4DAV A;  4K14 A;  1VF5 C;  2EYP A;  4RA8 A;  1BCP C;  1LT3 D;  3A8J E;  3ONA B;  4C3J G;  1C4Q A;  2XWB B;  2ZXP A;  5C0X I;  3QJY A;  4C3J B;  2R6G A;  2R92 B;  2EDG A;  5T1I A;  3K5N A;  3TZU A;  2Y0S B;  4HMJ A;  3NQI A;  1IKM A;  3GTQ B;  5EQ0 A;  5HUR A;  4HSP A;  1ONL A;  3GV3 A;  2XRQ D;  4L6T B;  1HUM A;  3S14 B;  4A3B B;  2Z8L A;  1BO0 A;  1WTQ A;  5KEE A;  2IJ0 A;  2DN8 A;  4WRD A;  5C6A A;  2EYM A;  2MP1 A;  4BA1 I;  4OO1 G;  3HOV B;  4FF4 A;  4DAY A;  3C46 A;  3RMH A;  2F0V A;  5DEH A;  2Z4H A;  3S2D B;  4IUT A;  1ILP A;  2LKV A;  1A15 A;  3F2U A;  1BQQ T;  1WD1 A;  2VUM B;  1I4R A;  1Z47 A;  3C2P A;  1UAP A;  3J7A F;  1HXY D;  5I9P A;  5C4Z A;  5CBA E;  4A93 B;  3BG3 A;  4ME5 A;  2F0M A;  4XQJ A;  4RGO S;  2F0J A;  1EY0 A;  5DNF A;  2HDL A;  2IT1 A;  3GD7 A;  4XYO A;  3NE5 B;  1EZ6 A;  4R9W A;  1EY7 A;  4XXE A;  1OXS C;  2F0K A;  2E2J B;  4ZUJ A;  3PUX A;  5KYI A;  4KHZ A;  3IAY A;  3L7Z C;  3I3C A;  2G9H D;  3TZD A;  1PZI D;  1H9S A;  1E0B A;  4CBV A;  1DXM A;  3T53 B;  4IUU A;  3KUP A;  1PRT D;  3N6R A;  4DGZ A;  3DMU A;  1I3Q B;  3QB3 A;  2L5T A;  5JOB A;  3GTJ B;  2BE5 D;  2IX3 A;  1AEX A;  3C3L A;  2B2V C;  4F8M A;  2B63 B;  3A8I E;  4IFD G;  5CYU A;  1RF2 D;  3HKZ B;  4DNR B;  1CA6 A;  1WTR A;  2F3W A;  2B2U A;  5ELB A;  2AQ1 B;  2E2H B;  2A6E C;  3T16 A;  4NDX A;  4K5V A;  4KTA A;  3D31 A;  4WJW A;  3JAM L;  3OPO A;  1R4Q B;  4X3U A;  2JYO A;  1EIG A;  3OSO A;  4BBR B;  4I65 A;  1Y1V B;  2A6H D;  2KCN A;  1LTT D;  1Y69 U;  2AQ2 B;  5G3L F;  3KLS X;  3QO2 A;  1GHJ A;  3J80 E;  3EA6 A;  2F0H A;  1LO5 D;  4DXG A;  5EJW A;  2FIN B;  1LV9 A;  1ZEQ X;  5M9O A;  2IW3 A;  4DK1 A;  1CFM A;  2OXP A;  1IW7 C;  4BBS B;  3MVV A;  5HGT A;  1E2V A;  1OXX K;  1B2T A;  4J6H A;  1G8Z D;  4C3I B;  4K8J A;  4DK0 A;  3BZD B;  5J22 A;  3UI2 A;  1ZXT A;  1DOL A;  5IGE A;  1TWF B;  3BYY B;  4QMG A;  2K05 A;  1KAA A;  2SOB A;  3HP3 A;  5CV8 A;  4ZKB B;  2N88 A;  4U68 A;  1E2W A;  1DON A;  5C5M A;  2PMZ B;  3KLR A;  4FNF A;  1PRT B;  3V2T A;  1BDO A;  2L11 A;  3P1H A;  3PUV A;  2R93 B;  1U9R A;  1WVL A;  2CW0 C;  4DFA A;  1AP0 A;  2XNA C;  2F0P A;  4XYQ A;  2Z1C A;  3SHL A;  2K1B A;  4B9X A;  3WOE A;  4ABN A;  3HRZ C;  2PO4 A;  1F2Y A;  1KNE A;  4BY1 B;  3GTK B;  1AZP A;  2OEO A;  2RA4 A;  2RSN A;  1BXT A;  2JXM B;  1IL8 A;  1LAC A;  2XRS D;  4WOR A;  5FKA C;  3H09 A;  4DU9 A;  5I2X A;  4C1N K;  3A54 A;  4V0B A;  3RD4 A;  2B2Y C;  1NCV A;  5JVH 3;  1HTL D;  4IUN A;  3OHX C;  1SYB A;  3DXJ C;  1YNN C;  4PV1 C;  2XSC A;  5CC4 A;  1JCK B;  2WII B;  5FOB B;  2PQE A;  4KD3 A;  2PW5 A;  3PIP 3;  3GTM B;  1TS4 A;  2F0I A;  2B2W C;  1CT1 D;  1EIH A;  5C0X J;  1PYW D;  1EQV A;  1TR5 A;  4KHV A;  5FO7 B;  1S5E D;  3C1E A;  1F9P A;  4G57 A;  1CM9 A;  1SNM A;  1ENC A;  2D9U A;  5KRU A;  1VDZ A;  2B2T C;  1ROD A;  2NN6 G;  4N9T A;  4KKT A;  5D65 A;  4KN7 C;  4XTC S;  1YNJ C;  3K57 A;  2HUG A;  3DM1 A;  2BA0 A;  1TWC B;  5KNB A;  2X69 A;  2AQ3 B;  3QOL A;  4A3K B;  4OGQ C;  3K5L A;  3HOU B;  2FMM A;  1SYD A;  3EFX D;  3HOY B;  4KK7 A;  3OOC A;  3PUW A;  4RCN A;  3VYR A;  4EGV A;  1RHP A;  3JAM E;  2JSO A;  3S2H B;  1B3A A;  5A2Q L;  3S1N B;  1PMR A;  3FMC A;  3AU7 A;  3A8K E;  3CRL C;  4KKU A;  3RZO B;  1OO9 B;  4C2M B;  3S17 B;  4E6I A;  1SYC A;  1I6H B;  2NBF A;  2SDF A;  2M9V A;  3GV6 A;  2QEJ C;  3VYT A;  1GXD C;  4IUP A;  4K6L A;  3OW7 A;  2F0S A;  2R7Z B;  1JWU D;  1ILQ A;  1K8M A;  2H4O A;  4Y7N B;  3OMG A;  4G4K A;  2KVM A;  2EY1 A;  1WTO A;  3RZD B;  5ELC A;  1SYE A;  1I4H A;  3I70 A;  2L9H A;  3L3O C;  5JEA H;  1SEB D;  1EOT A;  4IN3 A;  3EVQ A;  1EYA A;  2LY7 A;  3AB9 A;  3I4N B;  1PDQ A;  4L63 B;  3K7A B;  1DYQ A;  4KY5 A;  2RDG A;  3BVZ A;  1LT5 D;  3OIQ A;  4X3T A;  1SSO A;  3SR1 A;  2RVL A;  5JJZ A;  2NTT A;  3KLS A;  1TU2 B;  1HUN A;  3A7L A;  2K5Q A;  2WV6 D;  5C44 B;  3NUC A;  3FDT A;  1ESF A;  3S9W A;  1STY A;  4ILW A;  2A68 D;  3BDC A;  1SNO A;  5LL6 S;  1WTV A;  5G3L D;  5M5W B;  1SNQ A;  2I07 B;  1S5F D;  1S5D D;  2MHV A;  4HMI A;  5NUC A;  4PMB A;  1XX8 A;  4F88 A;  2L0C A;  2DNC A;  1PRT C;  4A3I B;  1HA5 A;  4DA2 A;  3K0Y A;  4DF7 A;  1FGB D;  3NP8 A;  4QCL A;  1D2B A;  2O5J C;  4F7X A;  2BE5 C;  1X32 A;  1EY4 A;  3E0J A;  3D3R A;  4A3G B;  2IWH A;  2QDB A;  3NSW A;  1UEA B;  4ID6 A;  4FXK C;  4JBW A;  1B9N A;  2EXZ A;  4A3E B;  2BA1 A;  2A73 B;  1QB5 D;  1KDC A;  1LTR D;  4RGN A;  4HAE A;  4NW2 A;  3R3O A;  3S1R B;  3CRK C;  1HRJ A;  4U67 3;  1GUN A;  1FR3 A;  3HG9 A;  5CV7 A;  3DHQ A;  1AW7 A;  1EY5 A;  1FNW A;  1BBX C;  2F0F A;  4PMW A;  3D4W A;  1DOM A;  1LAB A;  2J4X A;  1Q90 A;  2KCC A;  4MN3 A;  2VB3 X;  5C4H A;  1HQM C;  3FPU B;  1R9T B;  2JEA I;  1CQF A;  1EYC A;  5CMD A;  3I91 A;  5JEA J;  2DNE A;  3MAQ A;  1EFI D;  3GTO B;  2A6H C;  4LMQ D;  1HQR D;  1DZ1 A;  4FP5 D;  1GUG A;  2K03 A;  3AMU A;  2O4X A;  2NVT B;  3W3A A;  5EKL A;  1QCB D;  2MUY A;  3GP7 A;  5FO8 B;  1OXT A;  3TDQ A;  1MD2 D;  4C3H G;  1MGS A;  1CHQ D;  3S1M B;  1CI3 M;  4C3H B;  4OL7 A;  4DN4 M;  3E5S A;  1A3V A;  1KAB A;  5C3X A;  5A2Q E;  1SXT A;  3ITP A;  3MXU A;  5DM7 3;  3FPP A;  4FF2 A;  1STN A;  1IYU A;  1T5E A;  4FVM A;  1SND A;  1TWA B;  5E4W C;  3PO2 B;  3NBI A;  1IKL A;  4C56 C;  1KNA A;  4NKL A;  2NZ1 D;  4KJO A;  1HCZ A;  2E75 C;  1AN8 A;  4BY7 B;  4OIK A;  3Q22 A;  4XQQ A;  1II3 A;  3KF8 A;  4B9W A;  3NBH A;  2F0G A;  1RTO A;  1U4M A;  1G2T A;  1G6Z A;  1PTO F;  3Q24 A;  1PFB A;  1TII D;  3V96 A;  1A2U A;  1TWH B;  3HOX B;  1S5B D;  3VR3 A;  4G7O C;  5EKK A;  5KNC A;  1Q12 A;  3GO5 A;  1HPC A;  1BF4 A;  1PFN A;  1O7L A;  1CQV A;  1DOK A;  1VCI A;  3LWE A;  4KI0 A;  1TWG B;  2YU9 B;  4UAI A;  2EYJ A;  1EU4 A;  1EZ8 A;  4CHT B;  1Y1W B;  1SMY D;  1QNU A;  1QWY A;  1G91 A;  2JP1 A;  2NVX B;  5E4X A;  5CGK A;  2VXW A;  3BYT B;  3T51 B;  1U4R A;  4ZUI A;  2O2L D;  2XIW A;  3QOJ A;  1SNP A;  2EJF C;  1F9S A;  3M85 A;  1X3Q A;  2F0O A;  1SYF A;  1Y8O B;  2H1E A;  2CQA A;  4L8J A;  4IUQ A;  1M8A A;  1H9J A;  2CVR A;  3KK7 A;  4P2C B;  4RHR A;  2X6L A;  1WTX A;  1PLF A;  3GQB A;  5DM6 3;  1H9K A;  1SJE D;  3U9S A;  2AWN A;  5JPM C;  5F2D A;  1LT6 D;  4RGM A;  4OO1 I;  3D6C A;  2M2L A;  3PMF A;  5I2Y A;  4G7Z C;  5E3F A;  2Q8I B;  1Q1B A;  5DAU A;  2EE1 A;  2HCI A;  3I72 A;  4A3D B;  1ET6 A;  1D1I A;  2K5W A;  4ULL A;  3BS1 A;  5IIF A;  3D8G A;  3TN2 A;  2VNU D;  1D1K A;  4RFB A;  3K58 A;  2EYH A;  1I50 B;  5ISR A;  3GTP B;  3VYS A;  2K6A A;  1I4G A;  1F9Q A;  4K5X A;  2ID0 A;  4CGY B;  1H9S B;  1D6E C;  1SYG A;  4RKB A;  4XDX A;  1SE3 A;  1CK1 A;  2KEC A;  3OIP A;  4FYD A;  4EQO A;  5IGB A;  2A5H A;  4CJ2 C;  3M7N A;  2NWG A;  2MJ8 A;  1EEF D;  3VYU A;  3CQZ B;  2D2C C;  2KJX A;  1FD7 D;  1S4Z A;  4IQZ A;  5M3M B;  2F0D A;  2L4N A;  1QNK A;  3H94 A;  5FLX L;  4IFD I;  2OF1 A;  1I6V C;  4K6D A;  2R61 A;  2F0E A;  2EY2 A;  2PCF B;  4N9P A;  1GUW A;  4HED A;  1O7Z A;  4XQN A;  3TP5 A;  5IGD A;  2EYF A;  1GUO A;  4R8N A;  2XWJ B;  2HQE A;  1JOO A;  2E2D C;  1U4P A;  3FEW X;  3V05 A;  4BA2 I;  5E1F A;  4RGT A;  3HOZ B;  5CV6 A;  5T1G A;  5EPL A;  1T5X D;  4IUV A;  3FVQ A;  4RWS C;  3A7A B;  2X6G A;  3A55 A;  1EQT A;  1JWS D;  2A69 D;  1G2S A;  3DWP A;  1VMP A;  3HOW B;  1NUC A;  3I4L A;  3SE0 A;  4O1N A;  1C8C A;  5IOD A;  1RTN A;  1DM0 B;  3C1F A;  1RD9 D;  3J81 L;  2ENB A;  1TY0 A;  2HDM A;  4X3K A;  1PZK D;  2O5I C;  2TMP A;  3U9O A;  5AFW A;  2D62 A;  1V1P A;  3RUZ A;  4NP5 A;  1F9R A;  1GHK A;  3T4A C;  1BR9 A;  3VR6 A;  1BCP F;  3NWS A;  3ND8 A;  1TT2 A;  2GA4 B;  5C0X G;  2RDF A;  3M4Y A;  4CKC A;  4A3J B;  2MGS A;  2NVQ B;  4RCO A;  4QF4 A;  4CJ0 B;  4X3S A;  3DUZ A;  5M3F B;  1PTO D;  1W6K A;  2FMC A;  1FNV A;  3Q6S A;  4FF1 A;  3SK8 A;  4V19 0;  5I9O A;  4OO1 H;  2B39 A;  4I7Z C;  4M1U B;  5TSS A;  3IL8 A;  1H9R A;  1B53 A;  4IUR A;  1O80 A;  2D5D A;  1GUT A;  2L55 A;  1HFG A;  2RDH A;  2XVS A;  3MC0 B;  3Q0A A;  2E2I B;  1G29 1;  3MA2 B;  5COR A;  2WIN B;  1MSG A;  3TME A;  1KLU D;  2KUM A;  3S1Q B;  3VR4 A;  4ZK9 B;  3IKJ A;  5C4J B;  2K04 A;  3PIO 3;  1ENF A;  5CV4 A;  4ZRZ A;  1NSN S;  5ELF A;  4CKE A;  2JEB I;  4RKL A;  1WD0 A;  3HEJ A;  1A6X A;  3A56 A;  5J1Z A;  4C1N I;  3RLF A;  3LWU A;  4K5W A;  1I4P A;  2F0W A;  3G7L A;  2SEB D;  1AZQ A;  2LMC B;  2KED A;  3OMC A;  5I4D A;  1GUS A;  3SK4 A;  2B2W A;  2M00 A;  4TRD A;  1Z7T A;  2B8G A;  2L1B A;  4BWG B;  1TS3 A;  3H0G B;  3MFY A;  1ENA A;  3M3Y B;  1TS2 A;  2SNM A;  2BCO A;  4K2K A;  3L9A X;  4DXF A;  1EYD A;  1Q8I A;  3DEP A;  3WDN A;  2KA7 A;  4GZY C;  1B9M A;  5M5Y B;  4XT3 B;  5FLX E;  3MXP A;  2AUJ D;  2B2T A;  4IFD H;  2C5C A;  2K7V A;  3NTI A;  3TBI B;  3SDZ A;  1V1P B;  1W6J A;  4MIU A;  3ERQ A;  1NR4 A;  3HZX A;  3D4D A;  3NQT A;  3K6O A;  1TKW B;  3HS0 C;  1Y8P B;  5C4X B;  2NTS A;  1EEI D;  1UUP A;  1QIL A;  3SVM A;  2A74 C;  1UNS A;  1RJT A;  5KND A;  3LX0 A;  2F0L A;  3HGB A;  3J7Y W;  1O78 A;  3P75 A;  2B2U C;  1SMY C;  3SK6 A;  1PTO B;  1F77 A;  1ET9 A;  3K5O A;  1ZKO A;  2F0Q A;  3R8B A;  3P20 A;  1E2Z A;  3D4R A;  5EGT A;  2XN9 C;  1JB3 A;  3URY A;  3GTG B;  4OHJ A;  2Z4I A;  1TQO A;  1XWE A;  3MEH A;  4LK1 C;  4H0L C;  4HCE A;  3PUZ A;  4Q0F A;  3J81 E;  1PZJ D;  2K01 A;  1D5M C;  2EYL A;  2QIL A;  5FO9 B;  1EY8 A;  1QG7 A;  3IFD A;  1LTB D;  2QF7 A;  3R93 A;  5K5P A;  4Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...