2KUMA

Solution structure of the human chemokine ccl27
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR analysis of the structure, dynamics, and unique oligomerization properties of the chemokine CCL27.
pubmed doi rcsb
molecule keywords C-C motif chemokine 27
molecule tags Signaling protein
source organism Homo sapiens
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kumA01
2FFKB 1EQTA 4NW2A 1WVLA 4O42A 1ESRA 2HDMA 1XYIA 2H1EA 4IURA 1MSHA 4XT3B 2K04A 1A15A 2B2VA 2BDNA 2L1BA 5COYA 5JJZA 1SDFA 1F2LA 1F9PA 2B2UC 2KVMA 2D9UA 5EKIA 5E4WC 3H91A 1PDQA 1DOKA 1X32A 1CA5A 1B50A 1J8IA 1HUNA 1U4RA 2NYZD 2Q8TA 2EE1A 1CM9A 2RA4A 3FDTA 5CBAE 4X3UA 1BF4A 1VMPA 2HDLA 3I90A 4HEDA 2DY7A 1IKMA 1U4MA 1QNKA 2K1BA 1ML0D 3F2UA 4LMQD 3ONAB 2B2YA 2M2LA 4ZLTF 1G2SA 1F9QA 3MWYW 1KNAA 2X6LA 1PLFA 2B2TC 2RSNA 3IL8A 1WTWA 5EPKA 1LV9A 4QUCA 4HAEA 4HSVA 4IUUA 5EJWA 2XIWA 2HUGA 2R3ZA 1EL0A 2K28A 1KNEA 2DY8A 4R8IA 2MP1A 2JYOA 3SVMA 1HA6A 5EPLA 2B2UA 1X3QA 1BO0A 2L12A 4R9WA 1RODA 4X3KA 1U4PA 3DM1A 4HCSA 1E0BA 2NZ1D 2KECA 3TN2A 5D14A 1WTRA 2K05A 2MPMA 2MJ8A 1U4LA 2X6GA 4IUTA 3Q6SA 1WD0A 2RSOA 4ZAIA 1SAPA 1RJTA 3FPUB 4QUFA 1ICWA 3QO2A 1C8CA 3DEPA 5EQ0A 4U68A 1WD1A 1GUWA 2FHTA 4DN4M 1EIHA 1S4ZA 4RAUC 4XT1B 1BBXC 1B53A 2K03A 1IKLA 5T1GA 1ILPA 1B3AA 4ZKCB 2B2TA 2KEDA 1JE4A 2MGSA 3R93A 1G6ZA 1HHVA 1IL8A 1B4OA 3KBXA 3G7LA 1WTXA 1CA6A 1G2TA 2B2WC 4CJ0B 1WTPA 5CMDA 3GV3A 1RTNA 2NWGA 2Q8RE 2VXWA 4IUVA 1NAPA 1XX8A 1MGSA 5DNFA 2L4NA 2L9HA 4OIKA 4ZK9B 1VMCA 2FINB 4XDXA 1O7YA 1DOMA 5CORA 2CVRA 3N52A 1EIGA 1NR4A 4ZKBB 3P7JA 1M8AA 4UAIA 3GV6A 4RA8A 3LWEA 1NR2A 4IUQA 1BNZA 4MN3A 3I3CA 1B2TA 1TVXA 1HFNA 1DOLA 2JP1A 1QE6A 2K01A 1PFMA 1Q3LA 2L11A 1AZPA 3I91A 1MSGA 4OIJA 5AFWA 2B2VC 2IL8A 3I8ZA 3D6WA 1WTOA 5T1IA 2N55A 2KUMA 1JICA 2SDFA 2FJ2A 3UI2A 1AZQA 1DZ1A 5EPJA 5E4XA 1X3PA 2FMMA 1HRJA 1NCVA 3IFDA 1ZXTA 4MHEA 2B2WA 1PFNA 2KEEA 1F9SA 1SSOA 4X3TA 2X69A 1ILQA 1MI2A 2HCCA 1DONA 1QG7A 3TZDA 1O7ZA 1F9RA 4IUPA 4RWSC 1O80A 3KUPA 1WTVA 1HFGA 1RHPA 1RTOA 2N88A 2RVLA 2EOTA 3DEOA 2EPBA 3HP3A 5D65A 1WTQA 2B2YC 1G91A 1J9OA 1EOTA 1PFBA 2KOLA 1HUMA 5CBEE 2HCIA 3MTSA 4CJ2C 4CJ1B 2J7ZA 4X3SA 1AP0A
chains in the Genus database with same CATH superfamily
1D5ZC 4GKKL 1GUNA 2F0PA 4YIJA 1LTSD 3K6OA 1HNXQ 4X6AH 4PNYA 3FKIB 3AQQA 4DR1Q 1PZJD 5IGGA 2J0TD 4ZUIA 4KKUA 1UWVA 2F0OA 3VYSA 4NXNQ 4PZ8A 2OT2A 2JEAI 1I3QB 3O13A 4BBRB 5JVH3 2OQKA 4QB4A 5EJWA 3OTOQ 2DY8A 3T1HL 2NVXB 5L37A 1E22A 3TN2A 4A3EB 1SE3A 5DEHA 1S5FD 3GO5A 3S14B 4PZ7A 3FPUB 4QUFA 5IYDH 1U0LA 5IT9E 1I4GA 4AIMA 4GNXA 2B39A 3HOXB 1JC7A 1LT4D 1PZKD 3QJYA 4RAUC 3KJOA 1B53A 5C4JB 1Y8OB 3HKZB 5IWAL 5M5XB 3CAMA 5TSSA 2KEDA 1K73C 2WINB 2JA7B 2K4KA 4OXPA 4X62Q 1WTXA 1VQDA 3N6RA 2JN4A 5EKLA 2NVYH 3BS1A 3S15H 2KBNA 4XDXA 1XMQQ 4YHHL 3GTJH 2R7ZG 2EIFA 1QWYA 4FF2A 1FR3A 3Q22A 3J7AV 1D6EC 2F0UA 3K80C 3CC2A 3Q24A 1B3QA 5AFWA 4C3IH 3GD7A 5FJ8H 5CR3A 1SFOB 1X56A 4G57A 5LMNQ 4XYQA 1IW7D 2XGTA 2EYFA 5E1FA 3STBC 1SSOA 1QOHA 5AJ3Q 3H0GB 4H02A 3I4OA 2HCCA 4A3KH 3M7NA 3AEVA 4DA2A 4JBWA 1QJOA 1KLUD 2RDHA 1XNRL 1I4QA 2AQ3B 2B2YC 1EOTA 1VF5C 1PFBA 4DV1L 5CBEE 4G4KA 4GLVB 1SJED 4CJ2C 3MEHA 1GUWA 1AP0A 1EY8A 4A93H 1WCMG 5ELCA 3AB9A 1AFPA 3BJUA 1LTRD 4J1MA 4BS9A 4GOPB 1XNQL 3S2DB 4GLXA 1RCVD 3CKIB 2PQAA 2UUCL 1XNRQ 4HR7B 1EWIA 2JQOA 4ILWA 2NVQB 3KJPA 1X32A 4DUZQ 3GP7A 3KDFA 1ENFA 2JA9A 4DV3L 1YNJC 3OMGA 3I90A 1ICFB 4P73A 4RKBA 1QNKA 1JCKB 3K5LA 4TRDA 1XJVA 4A3IB 1ASYA 1LO5D 3ND8A 2K52A 5EPKA 2XWBB 4YCWA 4DR5L 5CC4A 1SNOA 3GTPH 1Z7TA 4DK0A 5KYIA 1I5FA 3RMHA 2YU9H 5JPNC 4DXFA 1O78A 2WAQB 2A74C 3D31A 1TR5A 1BVSA 1BCPB 5IP9G 2X6GA 4JI6L 3GTLH 1SYFA 1E24A 4JI3Q 1VQOA 2E8GA 3UE0A 1PFSA 1PRTC 1PVOA 2CW0C 2HHHQ 1F2ZA 1TXYA 2Y0SE 2VZAA 3RLOA 1RIPA 3QOLA 1ILPA 4B3SL 2B63B 1CHPD 1D1KA 1TWFB 5M3FG 2ICIA 1M90C 4IPDA 1HR0Q 2Q8RE 1Z47A 4BBSB 4JVZA 2FMCA 2N3SA 1D1IA 1JQYD 5IYBG 2PI2A 4I65A 4B3ML 2FINB 2WACA 4OHJA 5ELDA 4UAIA 2A68D 3M4OH 4DR6L 3CHBD 1AE2A 4LJZC 5A35A 3IFTA 2V1CC 3I4NB 3I91A 1MSGA 2C9OA 1KRSA 1EY4A 1EY5A 1WTOA 2WB1E 2O5JC 2L5TA 4MZ9A 1KD1C 2F0WA 1IYJB 5EAYA 4ZCKA 1O7IA 1IBLQ 2UXDL 2KQ3A 2SOBA 4DAVA 1STBA 3TREA 4DNRB 4LNQA 4XYOA 1B7YB 3L9AX 4Y52H 3L0OA 2NZHA 2KOLA 5CV6A 4DV5L 3H15A 4JYAL 1EQVA 1MSHA 4LFCL 3I70A 2CH4A 1B8AA 3R3OA 1EQQA 2B2UC 3I7FA 1YEZA 1PDQA 5IP7H 4KMUC 3M3YH 1EOVA 2NN6I 4J6HA 4DV5Q 1C0AA 4DXGA 2CWAA 3NWTA 1EWCA 2N49A 4KI0A 1G2SA 2VS1A 2X6LA 2DGYA 3CCEA 2RKSA 2XSCA 4DUYQ 3OMCA 2UXBL 2PNRC 4UP9A 1KIXA 1JWSD 4C2MB 3U4VA 4R9WA 3NTHA 2DN8A 3A8IE 2JEBI 4K2KA 3DM1A 2EYOA 2GN5A 4HCSA 4FF1A 2KECA 2A8VA 4GOPA 4KD3A 1CKNB 3K0YA 2F0EA 3CP0A 1I4RA 1I50B 2PMZE 4L8JA 5JJLA 1PRTD 1GOZA 3QO2A 2E75C 1FNVA 4DNTB 4B3RL 4LFBQ 1LTGD 4A3GB 1JOQA 1K8OA 2J4XA 4DR4Q 1X55A 3Q0AA 2Z1CA 3TP5A 2CCZA 3I4MB 1NMFA 1W2BA 3KBXA 1B70B 5GAEC 5K36H 1E1OA 4EGVA 4F7XA 1TS2A 1H9JA 4WORA 1QZHA 1BBWA 4HJ7A 2TSSA 3N52A 4GS3A 2H5XA 3CCMA 1TIID 2NVTH 2NTTA 1VQEA 1K0SA 2HD3A 3SDZA 4RFBA 1LT6D 3E0JA 1C9OA 1I4PA 3UDFA 3ULLA 2IL8A 1EEFD 3D6WA 1CZWA 5DAUA 3S1MH 2ZJPA 1M4VA 1EU3A 2O4XA 3I2ZA 5M5YH 5C6AA 4JI7Q 4NPSA 2CH4W 4L63B 1F9SA 1Q8IA 4TKOB 5IYCG 1W6JA 1HFGA 3KF8A 3FMCA 5GROA 3DEOA 3HP3A 3K7AH 3RR5A 3TS0A 3AFQA 1H95A 1S5BD 4N8FA 1Q12A 2JA5H 2YTVA 3F1ZA 4POFA 3GTQH 3MAQA 3PO3H 1CT1D 5EKIA 1AN8A 4Q0FA 1HUNA 1FL0A 4AYBG 1L1OA 3OW2A 1KDCA 2BH8A 1IBKL 1VF7A 4CKBA 1KABA 1S5DD 2DNCA 4OEMB 4S3SA 5E3FA 5LL6X 1IKMA 3PO2G 2A5HA 4P75A 3K7UC 1PH1A 3URYA 4JI0L 5M5WB 2IT1A 1UE5A 2CHBD 4KHVA 4RGTA 1A62A 1C48A 2XIWA 1XPUA 1FD7D 4LUVA 4EQNA 4MNOA 5EPLA 2K14A 3BDOA 5FLXc 2QEXA 1PRTB 3OHXC 4QQBX 4LFAL 1P8LA 1EUJA 1KLGD 2MJ8A 5EKKA 1PYBA 1RJTA 3E0EA 3HOUH 4DV0Q 4R4TA 3CQZB 2K75A 1RD9D 4EQ5A 5FO7B 2ATWA 4NMZA 1V1OA 2RQXA 3DXJC 5C0XH 2B29A 3CRLC 4LFAQ 1DD2A 3FKIH 2I07B 1HHVA 1TWGB 3RLFA 4C1NI 4CKEA 3HOYG 3GV3A 2NWGA 2VXWA 3DM3A 3GDEA 4OIKA 4V190 5E7NA 3U4ZA 1Y14B 4EVOA 1J6QA 2CVRA 4JI4L 1I3QH 5IGEA 1M8AA 4BBRH 5C3XA 4ABNA 4OONA 4YCVA 2F0LA 2EXZA 2K01A 2G5DA 1LT3D 5A2QL 4KKTA 1X6OA 1N36L 1CKNA 2EVBA 2VL6A 3MZ5A 1K8GA 2NVXH 4YWKA 1J5EL 3HKZE 1L0YB 3MEFA 3SK8A 4A3EH 2D2CC 1WI5A 3S1NB 3S14H 4H13C 4FNFA 2JA8G 4A3CH 4XQNA 2ZTCA 5C4HA 4JI1Q 5CV8A 1PZID 1TS5A 4WRDA 1JORA 3HOXH 2K7VA 5C4JH 5M5XH 3HOWG 3DWPA 4YY3Q 2R92B 5CMDA 2JA7H 1YJ9A 1ESRA 3UE1A 1UEAB 1F9PA 2KVMA 1PTOD 4H7BA 1FVIA 3K0XA 3PUXA 3J81c 5JVG3 2PW5A 3LWUA 2R7ZB 1C7YA 4J8QA 4RKLA 3NTKA 1OO9B 1YBYA 3VR5A 5C44G 2ENBA 1ZYRC 1PHJA 3A54A 2ES2A 1XMOQ 1N32L 1XWEA 4JK1C 1TWHB 5D3DA 3CMAA 2B2YA 1QVCA 5LL6S 2V4DA 1SFOH 4JI8Q 5J3BA 1A6XA 2F0MA 4L5RC 2HUGA 4OWWB 3H0GH 4R8IA 3A8JE 3CD6A 4JBJA 4DV6L 3RNUA 5IT9L 4OO1H 1STEA 2Z6KA 4M1UB 1DXMA 4XQJA 1HZAA 1S72A 3E9HA 3NWSA 2NB0A 5ISRA 2D0OA 1WCMB 2K03A 1F2MA 2Q2IA 3S2DH 4JBKA 1B3AA 3L3OC 1VQGA 4DV2L 3P1HA 2Z8LA 3R2IA 2NVQH 3TMEA 1IL8A 5C3EG 2QA4A 1QNUA 2OTJA 4DF7A 1NTGA 1SYDA 1NSNS 1U5KA 2B2WC 5FK9C 3RUZA 2YYZA 1SYGA 4BY1G 3J80c 3K58A 1S5CD 1GVPA 3MXNB 3JAMc 2EJMA 3L2PA 1JOKA 5KNCA 2WKDA 4DV2Q 3B6YA 2JXMB 4A3IH 4A3KG 4FXKC 4A3JG 2WAQE 3R2TA 3OSOA 2ZT9C 2ZM6L 2L11A 1FNUA 4A3LG 2NUCA 1LTID 1SNQA 2EY6A 2F4VL 4DV7L 3MA2B 1X3PA 4UPAA 2NBFA 3PF4A 1LACA 3M7GA 3K59A 4K0KQ 3PUZA 2ZJQA 1XTCD 4HIKA 3H6MA 1GHKA 1KAAA 1PYWD 3PUWA 2QDLA 4B08A 2ALYB 4LF7L 4LUZA 2EYJA 4MTNA 1N9WA 5KYLA 2JA6B 1WTPA 2B63H 1TWFH 4IFDJ 4CBVA 4IPHA 2QILA 1UE6A 3A74A 1PTOB 5KRUA 5M3FB 1JJ2A 1D5MC 1SJHD 4GKJQ 1STHA 3P75A 4BBSH 4LF7Q 2D9UA 1LUZA 1J8IA 3H91A 2ZTDA 1IW7C 2NTSA 4Y7NB 4GN5A 4PMBA 2MO1A 3MHBA 1SMXA 3NHHA 1MJCA 1LYLA 3IRBA 1XPOA 2CFMA 1SMYD 1HNXL 3GTKB 4IOCA 1TU2B 5JEAH 1B44D 1H9SA 4DR1L 3RN5A 1L2FA 1PH9A 3CPWA 3FEWX 4X65Q 4A3DG 2B2TC 2RSNA 1LV9A 1HPCA 3TBIB 1SE8A 1R4PB 4NXNL 4BY7G 1VQLA 1CHQD 3HEJA 1D5XC 3FVQA 2B2UA 4N9TA 1GKHA 5D14A 2RDFA 3BDLA 4LF6L 1QILA 3OTOL 2A6HD 2QEJC 1BBXC 5FLMG 1V9PA 3D4RA 5IGCA 5C3WA 2BCOA 1HNWQ 4ZKCB 1MIUA 4LF6Q 1K0RA 1HCZA 1I4HA 2F52A 2OCEA 4A76A 1L0XB 1YITA 1LTTD 4JW0A 3ULJA 1MHWC 1A2UA 2BE5D 2K32A 3MXUA 2KJXA 1PTOF 1AW7A 4X62L 1OXXK 1Y8NB 1Q3LA 1AZPA 2RBMA 1XMQL 4C2MH 4ULLA 3LGJA 4NDXA 5CV9A 2JJQA 3IFDA 3HOVG 4QCLA 3T1YQ 2GVBA 3NENA 1MI2A 1I50H 5KIXA 4MTKA 2N88A 4UP8A 1II3A 5LMNL 1N33Q 1IBMQ 2MQHA 3QOJA 4A3GH 1L0WA 2A68C 5AJ3L 1CSPA 4CJ1B 3MXNA 3I4MH 1WFQA 1K3RA 2ZXRA 3D0FA 5JJZA 2RHQB 5LMNW 4K8JA 1YZ6A 1G291 1DOKA 4FP5D 4GN4B 1VQ4A 4C3JB 1IZ6A 3BZDB 4A3MB 3CW2C 2F3VA 3HZXA 1BF4A 1EY0A 2HDLA 4WJ3M 4BXXH 2E5LQ 3PF5A 2F0NA 2B8GA 1X54A 2CQOA 3BVMA 1ENAA 3ERQA 4DUZL 4N9PA 2KCMA 1E3PA 1KHIA 4ZRZA 2JK8A 3VR2A 2NN6H 3ITPA 4FVMA 3ULPA 4KN7C 4QIWB 3CCLA 3TS2A 4ME3A 3G6EA 5I6WA 5GADC 1EFID 3IAYA 3E3XA 4UP7A 1YHBA 1X3FA 1EIHA 1E7ZA 5BN4A 5ELOA 3H3VI 1RF2D 2R93G 3NK9A 5K5PA 1G6ZA 3TP7A 4JI3L 4IJHA 1M1KC 3BYYB 1GO3E 4RHRA 2HHHL 3NP8A 1HZCA 2F0TA 3K5OA 1EIYB 3PO2B 3U50C 2YTXA 1STNA 5IIFA 5M5WH 1NR2A 1HR0L 4UY8C 4DAMA 3OW7A 1BDOA 3I8ZA 1OXTA 1Y69U 1TKWB 4KK7A 1FJGQ 1IYVA 2PZUA 1BUVT 1R4QB 1UE1A 2C35B 1ZXTA 5C4XG 2E2JB 3OYYA 1HR0W 1O7ZA 2AQ2B 1TWCB 3I55A 4DV4Q 3CQZH 3CPFA 2VQFQ 5F2DA 3U9OA 4RGOS 4KTAA 4C3HB 1DJRD 1S3OA 4MIUA 2F0VA 1IBLL 4NB3A 1XYIA 1TWGH 2IX1A 5BR8Q 2L1BA 1SDFA 1VDZA 3HOYB 1LTLA 1TQOA 3HG9A 3J7YW 1B50A 1VQKA 2F0HA 1R9TB 4E6IA 3QWNA 3WDNA 1CM9A 2RA4A 4JI2Q 3W1GA 2WV6D 3SK5A 3J7AF 3EIVA 4L5TA 3F2CA 3M4QA 5M3MG 2KCTA 3VA5A 4DNIA 5HY6A 2QF7A 4CDCC 1EQRA 1NBWA 3OPOA 4CDFC 4HSVA 1HZ9A 2KHJA 1VQBA 1H9MA 3FHWA 2MP1A 3FKIG 3S1NH 4K6LA 4RG1A 4KY7A 2EYLA 3A7LA 2JA8B 3ZYYX 2E2HB 1PH4A 5FLXE 4DUYL 3KLWA 1K3BC 2RSOA 3A56A 3VR6A 5BN3A 4A3BG 1C8CA 1SE4A 2R92H 3D4WA 5C5MA 3NELA 3HOWB 4DAYB 4KY5A 3CCVA 2PO4A 2XRQD 1T5EA 3EROA 1EIFA 3T51B 3PIO3 2HT1A 4KJNA 1CA6A 3VYUA 4HIMA 4IPCA 2EYPA 1BOSA 4IFDG 4LFBL 4TSSA 4IUVA 2PPBC 4LF4Q 5CYUA 2R7ZH 1YNXA 2L9HA 3NEMA 5GAHC 4A3FG 1VMCA 4DR4L 1OXUA 1MD2D 2C5CA 5C44B 1TWHH 4ZKBB 1XTDA 2MNAA 3G6JB 4CDEC 4KHZA 1B2TA 2Q2HA 1PFMA 2LY7A 1Z9FA 1B9NA 2B2VC 3KBGA 4HMIA 1TWAB 3QB3A 2KUMA 2JA7G 3W3AA 2FMMA 3HFZB 2B2WA 4X64Q 1LT5D 3PIOA 2OEOA 3HKSA 1QG7A 3S1QB 1RTOA 4GNXC 1HNZQ 1WCMH 1C4QA 4JI7L 4OELB 4GLAC 3UDGA 3S9WA 1EQTA 1SEBD 1TY0A 3G71A 4LUOA 4AQYQ 1VQPA 1PH5A 5C3EB 2BDNA 2EY2A 3NQIA 4POGA 3X3NA 1SYBA 3S24A 4BY1B 2HQEA 2KHSA 2ICEC 4ZUJA 4FXGC 3J81E 2A6ED 1VQ6A 5KEEA 3W5OA 4B3TQ 2G9DA 4A3JB 5JJIA 3DUZA 4NXML 2K5WA 1KDBA 1X3GA 2M2LA 1SNDA 1UNSA 2F1MA 2RCFA 4JCVE 3W1BA 4HAEA 3HOZG 4L6TB 3VYRA 1KNEA 4NXMQ 2EJGC 5IP9H 4PMCA 4DFAA 4G7OC 1PTOC 3RZDB 4PV1C 3KLSA 2E2IB 4CHTB 1SAPA 1TS4A 2JA6H 4WFN3 3VA7A 4DR2Q 1PTOH 1QCBD 4KV6A 5M3FH 3K81C 1GHJA 3K8AA 2D0PA 2B2TA 3PUVA 1VQ8A 1Y8PB 5HGTA 4K5WA 1GUSA 2Z4IA 5IYBH 4K5VA 3H09A 1YHAA 4Y7NH 4DV0L 1G2TA 1KC8C 1BR9A 2IJ0A 3S16H 1MGSA 4DK3C 4DGZA 3TRZA 3I4LA 2Z6BA 3J80E 1JT8A 1E2WA 3GTKH 5CORA 3JAME 3S17B 3L7ZC 1BNZA 1PA6A 3TSSA 2A19A 2Q8IB 2E74C 3E5SA 4A3DB 3NUCA 1Y1WG 4LK1C 2ID0A 2VUMG 4G7ZC 2SEBD 2F4IA 2KA7A 5T1IA 4LF8Q 2LSSA 4BY7B 1X9NA 1Y1VG 1AZQA 3CC4A 3RD4A 2AMCB 1CTMA 4OX9Q 3EVQA 3K5NA 3S1RB 1ET6A 1YVCA 1VQHA 5CV5A 1DM0B 1TY2A 1CQFA 1UEBA 5C5LA 2AKWB 1BXTA 1WTQA 1G91A 1J9OA 3TEHB 2EYMA 2PQEA 2A1AA 4HJ5A 1DYQA 3I4NG 2VNUD 4R8NA 2PCFB 1B9MA 2AHOB 2K04A 4JI1L 1HQRD 1X3EA 2H4OA 2F0JA 3R8BA 1NNXA 4LWCA 3NBHB 1HXYD 1RKNA 4YY3L 3IKJA 5C4ZA 5KGUA 2EE1A 2BH2A 4YWMA 1N34Q 4LF5Q 1U4MA 2P5ZX 4K8IA 2K1BA 3DLLA 3VDYA 2FXQA 1LM0A 3ONAB 2F0IA 3DHQA 2Q2UA 1SBBB 4DKAC 4IUNA 2IHEA 5D3IB 5I2YA 3BDCA 2XWJB 2QCPX 4TQUS 1XMOL 1I94Q 1EZ6A 3DWAA 3HOVB 4EQOA 1BO0A 1X3QA 2L12A 2QDBA 2VW9A 1CUKA 1TT2A 1K83B 4JI8L 3Q6SA 1WD0A 4RHSA 4ZAIA 2DUDA 3DEPA 4P72A 1S4ZA 2KCCA 5IYDG 1SMYC 1T9HA 2QGQA 3PSIA 4PQXA 5IOCA 3GTMB 1HJPA 3V2TA 1B4OA 3G7LA 3I72A 4C3JH 3HRZC 4HN7A 4A3MH 4IZ8A 4I7AA 5J39A 4B9WA 3Q23A 1EIGA 1NR4A 4QIWE 1TS3A 3LWEA 3GTOB 4IUQA 4R1JA 2OF1A 2JP1A 1BKBA 1EYCA 2A6HC 1BBUA 1EY9A 4J15A 1CKMA 2N55A 4V0BA 2FJ2A 3I4MG 1RL2A 5EPJA 1D2BA 1ONLA 4C3IG 5IYCH 1ET9A 1E2VA 2HQLA 5FJ8G 1EZ8A 1GUTA 4GNXB 3A0JA 2X69A 1V43A 1ILQA 3KFUA 1HTPA 1PH8A 4RWSC 4IOAA 1O80A 1RHPA 2BE5C 1CI3M 4O2DA 3KOJA 5C0XJ 4K0KL 2AQ1B 1HUMA 1QUQB 2HCIA 4BXXG 1SXTA 1YNND 4O42A 1W3SA 4IURA 2R93B 4JV5Q 5C0XI 2EY5A 4GN3B 4A93G 1MJEA 1NMGA 5CGKA 2RCNA 5I2XA 3F8TA 3KLSX 2E2DC 2NYZD 3PO2H 3J7A5 3FDTA 1EY6A 2UXCQ 3E6ZX 4GKJL 2IX3A 4QJFA 4HTHA 1FGUA 3I73A 4B9XA 2LMCB 4ZYSA 3IL8A 3SK4A 1A3TA 1QVGA 5FOBB 4O0AA 1JJCB 5DLQE 2TMPA 3GTGB 1HA5A 3I56A 2R3ZA 2K28A 2E2JH 2WKCA 1Q46A 4IFDI 2IPKD 3LNNA 4LF9Q 1TWCH 4XQQA 4XIGS 3PQIA 4X65L 2F0FA 4CDDC 1MKHA 4JPBW 3S16B 3G4SA 1FNWA 3SEBA 1XXGA 3CMEA 5KNBA 1SNMA 2PQAB 4PZ6A 4C3HH 3RN2A 1EWHA 2O5IC 1D7QA 1WD1A 2MO0A 1ASZA 3D3RA 2VY3A 3OIQA 2UU9L 3ERSX 3HOYH 2I5MX 2GA4B 4DR3L 1E2ZA 2K5DA 4BWGB 3WOEA 1R9TH 1VQ9A 2L0CA 3H3VC 4JI5Q 4IPGA 2ZTEA 1HNWL 2UU9Q 1DOMA 2Y0SG 3SK6A 3BVGA 2QW7A 2EYHA 5EBDA 3CCSA 5M3MB 1QB5D 2F3WA 5LMUQ 4DR3Q 1FGBD 3NSWA 3GQBA 1VQ7A 1STAA 4OWTB 5I6YA 1YIJA 3K57A 2JA8H 2E2HH 4CGYB 5ELFA 2F0QA 2KHIA 3MFGA 4GKKQ 2EXDA 3HOWH 2EOTA 1JR0D 2PYKA 4OO1I 4A3BB 1UUPA 2R6GA 1SROA 1Z6HA 2WB1G 3MTSA 3T1YL 1WVLA 3SR1A 1STGA 2N8NA 2B2VA 5ELEA 3J7ZC 4F8MA 1G6PA 1P16A 1IBML 1N33L 1F2LA 1SRUA 1EYDA 2OTLA 1CA5A 3BZCA 2IY5B 4HJAA 2EY1A 4A3FB 2F0SA 1U4RA 2RDGA 5GAGC 5C44H 3MVVA 1NY4A 4X3UA 2EZVA 5IP7G 1A3VA 2BOSA 1BCPD 4QGUA 1ML0D 1YJNA 3OWFA 3T1HQ 3VR3A 1JB3A 3A7AB 1F9QA 1ZEQX 3MWYW 2R92G 1TWAH 1PH6A 3KLRA 4IJLA 3M4PA 4FDBA 4DR7L 3WWVA 1EL0A 5IGBA 2XRSD 2E5LL 1QUQA 5FLXL 2HIVA 3S1QH 1WTHA 5IWAQ 5HGQA 2K50A 1UE7A 4PG3A 3EA6A 4DR7Q 3BZKA 4UHVA 4DN4M 1GD7A 3H94A 5C3EH 3TP8A 3D8GA 1E1TA 3MXPA 4YHHQ 3CC7A 3R93A 1DGSA 4BY1H 4Z9CB 2PW7A 4R4QA 4RCOA 4I7ZC 4FF3A 3CCUA 2WIIB 4Q5VA 1NAPA 1AH9A 5K36G 4A3JH 2BA1A 5JEAJ 4RA8A 3F2DA 5NUCA 4A3LH 1EYAA 3I3CA 3KK7A 3C2PA 4A4IA 5FKAC 5G3LD 1VQCA 3S2HB 2A69C 3SXHA 3HOZB 3QG1A 1EYGA 1FYCA 4KHPL 2SDFA 4DK6C 4DV1Q 1NCVA 4EX5A 3RZDH 4UDUC 2E2IH 2Z6KC 2BA0A 4AYBB 3A5UA 4L5SA 2ASBA 4IUPA 3RZOB 2I0QA 1WTVA 2GVAA 4KJOA 1FJGL 1XNQQ 2Z4HA 4BA1I 4KHPQ 2EPBA 5D65A 4LAAA 2UUCQ 4WJ4A 4BA2I 4P71A 4A75A 3PIP3 1LTAD 2J7ZA 4P2CB 2K5VA 4DV3Q 3EJIA 4OWXB 4DV4L 2JA5G 2NZOA 2VQFL 2YV5A 5COYA 3J81L 3U58A 3OWEB 1CSQA 2LFNA 2K33A 1GM5A 4QY7A 3PO3G 2AUKA 1AEXA 3Q8DA 5CBAE 3S17H 4DR5Q 4L5QA 1SN8A 5BR8L 1YI2A 3SHLA 2L55A 4A3DH 5EGTA 1IYUA 3C1FA 1KQSA 2JA6G 1Y1WB 3NPPA 2VUMB 3CU7A 1N8RC 4BY7H 4JI2L 4DAPA 2RHSB 4JI6Q 1Y1VB 2LXKA 3PIPA 3KF8B 2K5NA 4JG2A 1LLRD 3F2BA 3S1RH 5IGFA 4FYDA 1SYEA 2JYOA 3TZUA 1VQAA 2JSOA 4C56C 2L15A 3UDXA 1E0BA 2F03A 5ELNA 3TP6A 4B3SQ 2IX0A 3CRKC 5H1SE 3AMUA 5CV7A 5IT9c 1ZKOA 5JOBA 2A6EC 4X66L 4ID6A 1ICWA 3LX0A 3ND9A 3BYTB 5EQ0A 5FLMH 4XTCS 3SGIA 4HIOA 4DU9A 5IE8A 3HOUG 1L1OB 2SNSA 4B3MQ 4JBMA 3EQLC 4JOIC 1JE4A 2F0KA 1PH2A 3STBD 5C0XG 3K5MA 1U9RA 4DR6Q 4X66Q 3J80L 4K14A 3HGBA 3DMUA 1VQIA 3MFYA 3JAML 4JC0A 3W2DA 4K2LA 2IHFA 4RH6A 1S5ED 4OL7A 4KKSA 4APVA 2CKZB 2AWOA 3M4YA 1HQMC 3QIAA 2ZJRA 1MBYA 1TVXA 2A69D 1Q90A 2KCNA 3P20A 1HFNA 1KTKA 2XVSA 3EBEA 2B8FA 5CV4A 4BBRG 4LF4L 4P74A 5JAVA 2LKVA 2A73B 2UXDQ 1BCPF 2DJGC 3NBIA 1K8MA 3HOVH 1JE5A 3D4DA 3ICEA 1T5XD 1H9RA 4HMJA 1IXRA 2K5HA 4MHEA 2KEEA 1K83H 2Z9HA 4X3TA 1YNJD 2O2LD 4M8AA 1A8VA 4A3EG 4LFCQ 4JYAQ 2RVLA 2XNAC 4FXDA 4A3CG 1VQNA 2BDOA 3KYHC 4H44C 3TDQA 4RMFA 3AU7A 4X64L 1NJIC 3HOXG 3GTMH 4X3SA 2FFKB 1O7LA 2HDMA 3HKZG 1Q86C 1VQJA 1HNZL 1EY7A 4RGNA 1SR3A 5E4WC 2MUYA 1CFMA 3U9SA 1Q82C 1QVFA 5FO8B 2Q8TA 1PYSB 4AQYL 4G7HC 3GTOH 2NVYB 3S15B 2DY7A 4H0LC 3CCRA 2CW0D 2UXBQ 4U673 2CWPA 2PNHA 3GTJB 4ZLTF 3MC0B 4HIDA 3BG3A 1VQ5A 3G48A 4K6DA 4B3TL 3EFXD 4C3IB 4IALA 1JWMD 1BQQT 4B3RQ 2CQAA 5G3LF 1HA6A 4IO9A 3WOFA 4C3JG 3CCJA 1LTBD 2NZ1D 3H0GG 4A3MG 5J1ZA 3JC66 1U4LA 1K9MC 1Q1BA 1OXSC 4A3KB 1V1PB 4OO1G 3ZJYC 2FHTA 5IGDA 4OGQC 4XT1B 3M85A 2R93H 1ESFA 1STYA 2B3GA 3T13A 4A93B 1JB7A 4NP5A 3NXWA 4DK1A 4DR2L 1RTNA 1JJGA 4QL5A 5DNFA 2ZXOA 2YTYA 3NQTA 1AE3A 1ENCA 2ZXPA 1KAWA 1I4XA 5KNDA 4RGMA 1HZBA 1DCZA 1CKOA 4MN3A 1GXDC 1H9KA 2XTIA 4YCUA 2LXJA 2OXPA 4A3IG 3J81i 3CCQA 1V8QA 3GTGH 3T4AC 1NUCA 1IHZA 4C1NK 1JOOA 1G51A 5C4XH 4HCEA 5E4XA 5I4DA 1Q81C 3GTPB 1A3UA 4WJWA 2N78A 5JJKA 5GQOA 2YU9B 2WAQG 5DM73 3TZDA 1A63A 2M00A 4LF8L 2F3IA 3A8KE 5I9OA 5HURA 3KF6B 1S40A 2R61A 3GTLB 2UUBL 4OX9L 1VQFA 4YWLA 2F0GA 1Q8KA 2HIXA 4AH6A 4EQPA 4NW2A 4HJ8A 1IBKQ 2H1EA 1A15A 2B63G 2EQSA 4CKCA 3FPPA 5J22A 3DWQA 1EU4A 2XN9C 2UUBQ 4DAYA 2PZWA 4JI0Q 1Q1EA 2LS01 4R4IA 3A5ZB 4BBSG 2MFIA 1I6HH 2Y0SB 3M9BA 5M3MH 3PUYA 2WP8J 4HEDA 2Z0SA 4LMQD 3FP9A 4C3HG 3M4OB 3NE5B 5DM63 1WTWA 5JEAG 3J80i 1GJXA 1KRTA 3JAMi 1N34L 4LF5L 1YNNC 3SVMA 4KLKA 2PI2E 4ODGA 1RODA 4HSPA 3AYHB 1U4PA 1SNCA 2D62A 1RDPD 4A3BH 2MPMA 4IQZA 1LABA 4IUTA 3C3LA 2K6AA 1EEID 1I94L 2WB1B 3V96A 1G8ZD 1NE3A 3BU2A 1IKLA 2RF4A 3CXCA 1B1ZA 1W6KA 3AFPA 1GUOA 4IFDH 3X3MA 4JI4Q 2PZTA 2MHVA 3BVZA 3J81j 4A3FH 4CJ0B 4N8X1 1H9SB 3C46A 2M9VA 2AUJD 3PGZA 1WOCA 2VQEL 1VQMA 3PCOB 2L4NA 4O1NA 4ZK9B 5FO9B 1N36Q 3T53B 1YJWA 1O7YA 3HS0C 3M3YB 2VB2X 1WYDA 2R7DA 3P7JA 1J5EQ 3OIPA 2VQEQ 4F88A 3VR4A 1PRTF 4R4CA 3UI2A 1JICA 1V1PA 1DZ1A 2D5DA 3FRPB 3E9IA 3EN2A 1HRJA 5BN5A 2IWHA 1D8LA 1PFNA 3OOCA 1DONA 3CF5A 3UDIA 3RLNA 1CQVA 1JMCA 1UAPA 2R7FA 2I5LX 1EFWA 1YHQA 4A3GG 2G9HD 4XT3B 1WJJA 4IN3A 1N32Q 4KD4A 2PMZB 1SLJA 1VCIA 4FO2A 1F77A 1K8AC 1F2YA 2I46A 5JPMC 4GOPC 4PMWA 5EBCA 2QKIC 4JV5L 4ZQ3A 4QF4A 1VMPA 1KL9A 4ME5A 4DPGA 2SNMA 4FF4A 3F2UA 3SE0A 1XPRA 1K28A 1Q7YC 4AYBE 3S2HH 1OXVA 2NVTB 3HOZH 4GZYC 3PV0A 4DV6Q 1KNAA 2WFWA 1PLFA 3QR8A 4K5XA 4QUCA 2UXCL 1GUGA 4IUUA 1A0IA 3KF6A 3TQYA 2I5HA 2IW3A 3S1MB 1PMRA 2K5QA 1PH3A 5M5YB 5LHY1 3RZOH 4F87A 4X3KA 1WTRA 2NN6G 2DNEA 2K05A 1PH7A 5M9OA 4XXEA 1SYCA 5ELBA 4U68A 1CZGA 2F0DA 4TVAB 3T56B 1VS0A 1BCPC 1CK1A 3K7AB 4LF9L 3T16A 1KXLA 2KENA 5T1GA 1SNPA 1V1QA 1QZGA 2JA5B 2MGSA 2OQ0A 3GTQB 5I9PA 1PV4A 2VB3X 2Q2TA 4NKLA 5C4XB 3PO3B 1XX8A 1KDAA 4KN4C 4R4OA 2ZM6Q 1A2TA 2EDGA 3V05A 4KY6A 2DJFC 5IODA 2UUAL 2F4VQ 4DV7Q 3GV6A 1Y1WH 2VUMH 1I6VC 1X65A 3A55A 3NBHA 1DOLA 4HJ9A 1QE6A 1HH2P 1Y1VH 3NTIA 1SE2A 4JI5L 1IL2A 4LW1A 4OIJA 3D6CA 3KDFB 4QMGA 1PXUA 5A2QE 1JWUD 3C1EA 4JOIA 2JE6I 2UUAQ 5LMUL 3PMFA 3ER0A 4RCNA 3MXGA 1L1OC 2OWOA 2E76C 1OTCA 1F9RA 1HTLD 1ZYRD 3KUPA 2EJFC 5IY0A 4ALPA 1I6HB 3I4NH 3HOUB 3H3VH 3VYTA 2AWNA
chains in the Genus database with same CATH topology
1D5ZC 1GUNA 2F0PA 4YIJA 1LTSD 3K6OA 4PNYA 3FKIB 1PZJD 5IGGA 2J0TD 4ZUIA 4KKUA 2F0OA 3VYSA 2OT2A 2JEAI 1I3QB 3O13A 4BBRB 5JVH3 4QB4A 5EJWA 2DY8A 2NVXB 3TN2A 4A3EB 1SE3A 5DEHA 1S5FD 3GO5A 3S14B 3FPUB 4QUFA 5IT9E 1I4GA 2B39A 3HOXB 4RAUC 1JC7A 1LT4D 1PZKD 3QJYA 1B53A 5C4JB 1Y8OB 3HKZB 5M5XB 5TSSA 2KEDA 2WINB 2JA7B 1WTXA 3N6RA 5EKLA 3BS1A 4XDXA 1QWYA 4FF2A 1FR3A 3Q22A 3J7AV 1D6EC 2F0UA 3Q24A 5AFWA 3GD7A 5CR3A 1SFOB 4G57A 4XYQA 1IW7D 2EYFA 5E1FA 1SSOA 1QOHA 3H0GB 2HCCA 3M7NA 4DA2A 4JBWA 1QJOA 1KLUD 2RDHA 1I4QA 2AQ3B 2B2YC 1EOTA 1VF5C 1PFBA 5CBEE 4G4KA 1SJED 4CJ2C 3MEHA 1GUWA 1AP0A 1EY8A 5ELCA 3AB9A 1AFPA 1LTRD 4J1MA 4BS9A 3S2DB 1RCVD 3CKIB 4HR7B 4ILWA 2NVQB 1X32A 3GP7A 1ENFA 1YNJC 3OMGA 3I90A 4RKBA 1QNKA 1JCKB 3K5LA 4TRDA 4A3IB 1LO5D 3ND8A 5EPKA 2XWBB 5CC4A 1SNOA 1Z7TA 4DK0A 5KYIA 3RMHA 5JPNC 4DXFA 1O78A 2WAQB 2A74C 3D31A 1TR5A 1BCPB 2X6GA 1SYFA 1PRTC 2CW0C 1F2ZA 3QOLA 1ILPA 2B63B 1CHPD 1D1KA 1TWFB 2ICIA 2Q8RE 1Z47A 4BBSB 2FMCA 1D1IA 1JQYD 4I65A 2FINB 2WACA 4OHJA 5ELDA 4UAIA 2A68D 3CHBD 4LJZC 5A35A 3IFTA 3I4NB 3I91A 1MSGA 2C9OA 1EY4A 1EY5A 1WTOA 2O5JC 2L5TA 2F0WA 2KQ3A 2SOBA 4DAVA 1STBA 4DNRB 4XYOA 3L9AX 2KOLA 5CV6A 1EQVA 1MSHA 3I70A 3R3OA 2B2UC 1PDQA 4KMUC 2NN6I 4J6HA 4DXGA 3NWTA 1EWCA 4KI0A 1G2SA 2X6LA 2RKSA 2XSCA 3OMCA 2PNRC 1JWSD 4C2MB 4R9WA 3NTHA 2DN8A 3A8IE 2JEBI 4K2KA 3DM1A 2EYOA 4HCSA 4FF1A 2KECA 4KD3A 3K0YA 2F0EA 4L8JA 1I4RA 1I50B 1PRTD 1GOZA 3QO2A 2E75C 1FNVA 4DNTB 1LTGD 4A3GB 1JOQA 1K8OA 2J4XA 3Q0AA 2Z1CA 3TP5A 3I4MB 3KBXA 5K36H 4EGVA 4F7XA 1TS2A 1H9JA 4WORA 2TSSA 3N52A 1TIID 2NTTA 3SDZA 4RFBA 1LT6D 3E0JA 1I4PA 2IL8A 1EEFD 3D6WA 1CZWA 5DAUA 1M4VA 1EU3A 2O4XA 5C6AA 4L63B 1F9SA 1Q8IA 4TKOB 1W6JA 1HFGA 3KF8A 3FMCA 3DEOA 3HP3A 1S5BD 1Q12A 3MAQA 1CT1D 5EKIA 1AN8A 4Q0FA 1HUNA 1KDCA 1VF7A 4CKBA 1KABA 1S5DD 2DNCA 4S3SA 5E3FA 5LL6X 1IKMA 2A5HA 3URYA 5M5WB 2IT1A 2CHBD 4KHVA 4RGTA 1C48A 2XIWA 1FD7D 4EQNA 5EPLA 3BDOA 1PRTB 3OHXC 1KLGD 2MJ8A 5EKKA 1RJTA 3CQZB 1RD9D 5FO7B 4NMZA 1V1OA 2RQXA 3DXJC 5C0XH 3CRLC 1DD2A 2I07B 1HHVA 1TWGB 3RLFA 4C1NI 4CKEA 3GV3A 2NWGA 2VXWA 4OIKA 4V190 4EVOA 2CVRA 5IGEA 1M8AA 5C3XA 4ABNA 2F0LA 2EXZA 2K01A 5A2QL 1LT3D 4KKTA 2EVBA 3MZ5A 1L0YB 3SK8A 2D2CC 3S1NB 4H13C 4FNFA 4XQNA 5C4HA 5CV8A 1PZID 1TS5A 4WRDA 1JORA 2K7VA 3DWPA 2R92B 5CMDA 1ESRA 1UEAB 1F9PA 2KVMA 1PTOD 4H7BA 3PUXA 5JVG3 2PW5A 3LWUA 2R7ZB 4J8QA 4RKLA 3NTKA 1OO9B 3VR5A 2ENBA 1ZYRC 3A54A 1XWEA 4JK1C 1TWHB 5D3DA 2B2YA 5LL6S 2V4DA 1A6XA 2F0MA 2HUGA 4R8IA 3A8JE 5IT9L 4OO1H 1STEA 4M1UB 1DXMA 4XQJA 3NWSA 2NB0A 5ISRA 1WCMB 2K03A 1F2MA 1B3AA 3L3OC 3P1HA 2Z8LA 3R2IA 3TMEA 1IL8A 1QNUA 4DF7A 2B2WC 1SYDA 1NSNS 5FK9C 3RUZA 2YYZA 1SYGA 3K58A 1S5CD 2EJMA 1JOKA 5KNCA 2WKDA 2JXMB 4FXKC 3R2TA 3OSOA 2ZT9C 2L11A 1FNUA 2NUCA 1LTID 1SNQA 2EY6A 3MA2B 1X3PA 2NBFA 1LACA 3M7GA 3K59A 3PUZA 1XTCD 1GHKA 3H6MA 1KAAA 1PYWD 3PUWA 4B08A 2EYJA 5KYLA 2JA6B 1WTPA 4IFDJ 4CBVA 2QILA 1PTOB 5KRUA 5M3FB 1D5MC 1SJHD 1STHA 3P75A 2D9UA 1J8IA 3H91A 1IW7C 2NTSA 4Y7NB 4PMBA 3MHBA 3NHHA 1SMYD 3GTKB 1TU2B 5JEAH 1B44D 1H9SA 3FEWX 2B2TC 2RSNA 1LV9A 1HPCA 3TBIB 1R4PB 1CHQD 3HEJA 1D5XC 3FVQA 2B2UA 4N9TA 5D14A 2RDFA 3BDLA 1QILA 2A6HD 2QEJC 1BBXC 5IGCA 3D4RA 5C3WA 2BCOA 4ZKCB 1HCZA 1I4HA 1L0XB 1LTTD 1A2UA 2BE5D 2K32A 3MXUA 2KJXA 1PTOF 1AW7A 1OXXK 1Y8NB 1Q3LA 1AZPA 2RBMA 4ULLA 4NDXA 5CV9A 3IFDA 4QCLA 1MI2A 5KIXA 2N88A 1II3A 3QOJA 2A68C 4CJ1B 3MXNA 2ZXRA 5JJZA 4K8JA 1G291 1DOKA 4FP5D 4C3JB 3BZDB 4A3MB 2F3VA 3HZXA 1BF4A 1EY0A 2HDLA 2F0NA 2B8GA 3BVMA 1ENAA 3ERQA 4N9PA 4ZRZA 3VR2A 2NN6H 3ITPA 4FVMA 4KN7C 4QIWB 5I6WA 1EFID 3IAYA 1EIHA 5BN4A 1RF2D 3NK9A 5K5PA 1G6ZA 3TP7A 3BYYB 4RHRA 3NP8A 2F0TA 3K5OA 3PO2B 1STNA 5IIFA 1NR2A 3OW7A 1BDOA 3I8ZA 1OXTA 1Y69U 1TKWB 4KK7A 1IYVA 2PZUA 1BUVT 1R4QB 1ZXTA 2E2JB 1O7ZA 2AQ2B 1TWCB 5F2DA 3U9OA 4RGOS 4KTAA 4C3HB 1DJRD 4MIUA 2F0VA 1XYIA 2IX1A 2L1BA 1SDFA 1VDZA 3HOYB 1TQOA 3HG9A 3J7YW 1B50A 2F0HA 1R9TB 4E6IA 3QWNA 3WDNA 1CM9A 2RA4A 2WV6D 3SK5A 3J7AF 3VA5A 2QF7A 3OPOA 4HSVA 1H9MA 2MP1A 4K6LA 4KY7A 2EYLA 3A7LA 2JA8B 3ZYYX 2E2HB 5FLXE 2RSOA 3A56A 3VR6A 5BN3A 1C8CA 1SE4A 3D4WA 5C5MA 3HOWB 4KY5A 2PO4A 2XRQD 1T5EA 3EROA 3T51B 3PIO3 4KJNA 1CA6A 3VYUA 2EYPA 1BOSA 4IFDG 4TSSA 4IUVA 2PPBC 5CYUA 2L9HA 1VMCA 1OXUA 1MD2D 2C5CA 5C44B 4ZKBB 3G6JB 4KHZA 1B2TA 1PFMA 2LY7A 1B9NA 2B2VC 3KBGA 4HMIA 1TWAB 3QB3A 2KUMA 3W3AA 2FMMA 2B2WA 1LT5D 2OEOA 1QG7A 3S1QB 1RTOA 1C4QA 3S9WA 1EQTA 1SEBD 1TY0A 5C3EB 2BDNA 2EY2A 3NQIA 3X3NA 1SYBA 4BY1B 2HQEA 2KHSA 2ICEC 4ZUJA 4FXGC 3J81E 2A6ED 5KEEA 2G9DA 4A3JB 3DUZA 2K5WA 1KDBA 2M2LA 1SNDA 1UNSA 2F1MA 4HAEA 4L6TB 3VYRA 1KNEA 2EJGC 4PMCA 4DFAA 4G7OC 1PTOC 3RZDB 4PV1C 3KLSA 2E2IB 4CHTB 1SAPA 1TS4A 4WFN3 3VA7A 1PTOH 1QCBD 4KV6A 1GHJA 2B2TA 3PUVA 1Y8PB 5HGTA 4K5WA 1GUSA 2Z4IA 1G2TA 4K5VA 3H09A 1BR9A 2IJ0A 1MGSA 4DGZA 3I4LA 3J80E 1E2WA 5CORA 3JAME 3S17B 3L7ZC 1BNZA 3TSSA 2Q8IB 2E74C 3E5SA 4A3DB 3NUCA 4LK1C 2ID0A 4G7ZC 2SEBD 2F4IA 2KA7A 5T1IA 4BY7B 1AZQA 3RD4A 1CTMA 3EVQA 3K5NA 3S1RB 1ET6A 5CV5A 1DM0B 1TY2A 1CQFA 5C5LA 1BXTA 1WTQA 1G91A 1J9OA 2EYMA 2PQEA 1DYQA 2VNUD 4R8NA 2PCFB 1B9MA 2K04A 1HQRD 2H4OA 2F0JA 3R8BA 1HXYD 1RKNA 3IKJA 5C4ZA 5KGUA 2EE1A 1U4MA 4K8IA 2K1BA 3ONAB 2F0IA 3DHQA 1SBBB 4IUNA 5D3IB 5I2YA 3BDCA 2XWJB 2QCPX 4TQUS 1EZ6A 3DWAA 3HOVB 4EQOA 1BO0A 1X3QA 2L12A 2QDBA 1TT2A 1K83B 3Q6SA 1WD0A 4RHSA 4ZAIA 3DEPA 1S4ZA 2KCCA 1SMYC 4PQXA 5IOCA 3GTMB 3V2TA 1B4OA 3G7LA 3I72A 3HRZC 4HN7A 4IZ8A 5J39A 4B9WA 3Q23A 1EIGA 1NR4A 1TS3A 3LWEA 3GTOB 4IUQA 2OF1A 2JP1A 1EYCA 2A6HC 1EY9A 2N55A 4V0BA 2FJ2A 5EPJA 1D2BA 1ONLA 4C3IG 1ET9A 1E2VA 1EZ8A 1GUTA 2X69A 1V43A 1ILQA 1HTPA 4RWSC 1O80A 1RHPA 2BE5C 1CI3M 5C0XJ 2AQ1B 1HUMA 2HCIA 1SXTA 1YNND 4O42A 4IURA 2R93B 5C0XI 2EY5A 5CGKA 5I2XA 3KLSX 2E2DC 2NYZD 3FDTA 1EY6A 3E6ZX 2IX3A 4HTHA 3I73A 4B9XA 2LMCB 4ZYSA 3IL8A 3SK4A 1A3TA 5FOBB 2TMPA 3GTGB 1HA5A 2R3ZA 2K28A 2WKCA 4IFDI 2IPKD 3LNNA 4XQQA 4XIGS 2F0FA 3S16B 1FNWA 3SEBA 1XXGA 5KNBA 1SNMA 1EWHA 2O5IC 1WD1A 3D3RA 3OIQA 2GA4B 1E2ZA 2K5DA 4BWGB 3WOEA 2L0CA 3H3VC 1DOMA 3SK6A 3BVGA 2EYHA 5EBDA 5M3MB 1QB5D 2F3WA 1FGBD 3NSWA 3GQBA 1STAA 5I6YA 3K57A 4CGYB 5ELFA 2F0QA 3MFGA 2EOTA 1JR0D 2PYKA 4OO1I 4A3BB 1UUPA 2R6GA 1Z6HA 3MTSA 1WVLA 3SR1A 1STGA 2B2VA 5ELEA 4F8MA 1F2LA 1EYDA 1CA5A 2EY1A 4A3FB 2F0SA 1U4RA 2RDGA 3MVVA 4X3UA 2EZVA 1A3VA 2BOSA 1BCPD 1ML0D 3OWFA 3VR3A 1JB3A 3A7AB 1F9QA 1ZEQX 3MWYW 3KLRA 1EL0A 5IGBA 2XRSD 5FLXL 3EA6A 4DN4M 3H94A 3TP8A 3D8GA 3MXPA 3R93A 4Z9CB 2PW7A 4RCOA 4I7ZC 4FF3A 2WIIB 4Q5VA 1NAPA 5K36G 2BA1A 5JEAJ 4RA8A 5NUCA 1EYAA 3I3CA 3KK7A 3C2PA 5FKAC 5G3LD 3S2HB 2A69C 3SXHA 3HOZB 3QG1A 1FYCA 2SDFA 1NCVA 4UDUC 2BA0A 4AYBB 4IUPA 3RZOB 1WTVA 4KJOA 2Z4HA 4BA1I 2EPBA 5D65A 4LAAA 4BA2I 3PIP3 1LTAD 2J7ZA 4P2CB 3EJIA 5COYA 3J81L 3OWEB 2LFNA 2K33A 2AUKA 1AEXA 5CBAE 3SHLA 2L55A 5EGTA 1IYUA 3C1FA 1Y1WB 3NPPA 2VUMB 3CU7A 4DAPA 1Y1VB 1LLRD 5IGFA 4FYDA 1SYEA 2JYOA 3TZUA 2JSOA 4C56C 1E0BA 2F03A 3TP6A 2IX0A 3CRKC 3AMUA 5CV7A 1ZKOA 5JOBA 2A6EC 4ID6A 1ICWA 3LX0A 3ND9A 3BYTB 5EQ0A 4XTCS 4DU9A 2SNSA 3EQLC 1JE4A 2F0KA 5C0XG 3K5MA 1U9RA 3J80L 4K14A 3HGBA 3DMUA 3MFYA 3JAML 3W2DA 4K2LA 4RH6A 1S5ED 4OL7A 4KKSA 2AWOA 3M4YA 1HQMC 3QIAA 1MBYA 1TVXA 2A69D 1Q90A 2KCNA 3P20A 1HFNA 1KTKA 2XVSA 2B8FA 5CV4A 5JAVA 2LKVA 2A73B 1BCPF 3NBIA 1K8MA 3D4DA 1T5XD 1H9RA 4HMJA 4MHEA 2KEEA 4X3TA 1YNJD 2O2LD 4M8AA 2RVLA 2XNAC 4FXDA 2BDOA 3TDQA 4H44C 3AU7A 4X3SA 2FFKB 1O7LA 2HDMA 1EY7A 4RGNA 5E4WC 2MUYA 1CFMA 3U9SA 5FO8B 2Q8TA 4G7HC 2NVYB 3S15B 2DY7A 4H0LC 2CW0D 4U673 3GTJB 4ZLTF 3MC0B 3BG3A 4K6DA 3EFXD 4C3IB 4IALA 1JWMD 1BQQT 2CQAA 5G3LF 1HA6A 3WOFA 4C3JG 1LTBD 2NZ1D 5J1ZA 1U4LA 1Q1BA 1OXSC 4A3KB 1V1PB 4OO1G 2FHTA 5IGDA 4OGQC 4XT1B 3M85A 1ESFA 1STYA 3T13A 4A93B 4NP5A 3NXWA 4DK1A 1RTNA 5DNFA 2ZXOA 3NQTA 1ENCA 2ZXPA 1I4XA 5KNDA 4RGMA 1DCZA 4MN3A 1GXDC 1H9KA 2OXPA 1V8QA 3T4AC 1NUCA 1IHZA 4C1NK 1JOOA 4HCEA 5E4XA 5I4DA 3GTPB 1A3UA 4WJWA 2YU9B 5DM73 3TZDA 2M00A 3A8KE 5I9OA 5HURA 2R61A 3GTLB 2F0GA 4EQPA 4NW2A 2H1EA 1A15A 4CKCA 3FPPA 5J22A 3DWQA 1EU4A 2XN9C 4DAYA 2PZWA 1Q1EA 2LS01 2Y0SB 3PUYA 2WP8J 4HEDA 4LMQD 4C3HG 3M4OB 3NE5B 5DM63 1WTWA 5JEAG 1GJXA 1YNNC 3SVMA 4ODGA 1RODA 4HSPA 1U4PA 1SNCA 2D62A 1RDPD 2MPMA 4IQZA 1LABA 4IUTA 3C3LA 2K6AA 1EEID 2WB1B 3V96A 1G8ZD 1IKLA 1B1ZA 1W6KA 1GUOA 4IFDH 3X3MA 2PZTA 2MHVA 3BVZA 4CJ0B 1H9SB 3C46A 2M9VA 2AUJD 2L4NA 4O1NA 4ZK9B 5FO9B 3T53B 1O7YA 3HS0C 3M3YB 2VB2X 3P7JA 3OIPA 4F88A 3VR4A 1PRTF 3UI2A 1JICA 1V1PA 1DZ1A 2D5DA 3FRPB 1HRJA 5BN5A 2IWHA 1PFNA 3OOCA 1DONA 1CQVA 1UAPA 2G9HD 4XT3B 4IN3A 4KD4A 2PMZB 1VCIA 4FO2A 1F77A 1F2YA 2I46A 5JPMC 4PMWA 5EBCA 2QKIC 4ZQ3A 4QF4A 1VMPA 4ME5A 2SNMA 4FF4A 3F2UA 3SE0A 1OXVA 2NVTB 4GZYC 3PV0A 1KNAA 1PLFA 4K5XA 4QUCA 1GUGA 4IUUA 2IW3A 3S1MB 1PMRA 2K5QA 5M5YB 5LHY1 4F87A 4X3KA 1WTRA 2NN6G 2DNEA 2K05A 5M9OA 4XXEA 1SYCA 5ELBA 4U68A 1CZGA 2F0DA 3T56B 3K7AB 1BCPC 1CK1A 3T16A 5T1GA 1SNPA 2JA5B 2MGSA 3GTQB 5I9PA 2VB3X 4NKLA 5C4XB 3PO3B 1XX8A 1KDAA 4KN4C 1A2TA 2EDGA 3V05A 4KY6A 5IODA 3GV6A 1I6VC 3A55A 3NBHA 1DOLA 1QE6A 3NTIA 1SE2A 4OIJA 3D6CA 4QMGA 1PXUA 5A2QE 1JWUD 3C1EA 2JE6I 3PMFA 4RCNA 3MXGA 2E76C 1F9RA 1HTLD 1ZYRD 3KUPA 2EJFC 1I6HB 3HOUB 3VYTA 2AWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFK B;  1EQT A;  4NW2 A;  1WVL A;  4O42 A;  1ESR A;  2HDM A;  1XYI A;  2H1E A;  4IUR A;  1MSH A;  4XT3 B;  2K04 A;  1A15 A;  2B2V A;  2BDN A;  2L1B A;  5COY A;  5JJZ A;  1SDF A;  1F2L A;  1F9P A;  2B2U C;  2KVM A;  2D9U A;  5EKI A;  5E4W C;  3H91 A;  1PDQ A;  1DOK A;  1X32 A;  1CA5 A;  1B50 A;  1J8I A;  1HUN A;  1U4R A;  2NYZ D;  2Q8T A;  2EE1 A;  1CM9 A;  2RA4 A;  3FDT A;  5CBA E;  4X3U A;  1BF4 A;  1VMP A;  2HDL A;  3I90 A;  4HED A;  2DY7 A;  1IKM A;  1U4M A;  1QNK A;  2K1B A;  1ML0 D;  3F2U A;  4LMQ D;  3ONA B;  2B2Y A;  2M2L A;  4ZLT F;  1G2S A;  1F9Q A;  3MWY W;  1KNA A;  2X6L A;  1PLF A;  2B2T C;  2RSN A;  3IL8 A;  1WTW A;  5EPK A;  1LV9 A;  4QUC A;  4HAE A;  4HSV A;  4IUU A;  5EJW A;  2XIW A;  2HUG A;  2R3Z A;  1EL0 A;  2K28 A;  1KNE A;  2DY8 A;  4R8I A;  2MP1 A;  2JYO A;  3SVM A;  1HA6 A;  5EPL A;  2B2U A;  1X3Q A;  1BO0 A;  2L12 A;  4R9W A;  1ROD A;  4X3K A;  1U4P A;  3DM1 A;  4HCS A;  1E0B A;  2NZ1 D;  2KEC A;  3TN2 A;  5D14 A;  1WTR A;  2K05 A;  2MPM A;  2MJ8 A;  1U4L A;  2X6G A;  4IUT A;  3Q6S A;  1WD0 A;  2RSO A;  4ZAI A;  1SAP A;  1RJT A;  3FPU B;  4QUF A;  1ICW A;  3QO2 A;  1C8C A;  3DEP A;  5EQ0 A;  4U68 A;  1WD1 A;  1GUW A;  2FHT A;  4DN4 M;  1EIH A;  1S4Z A;  4RAU C;  4XT1 B;  1BBX C;  1B53 A;  2K03 A;  1IKL A;  5T1G A;  1ILP A;  1B3A A;  4ZKC B;  2B2T A;  2KED A;  1JE4 A;  2MGS A;  3R93 A;  1G6Z A;  1HHV A;  1IL8 A;  1B4O A;  3KBX A;  3G7L A;  1WTX A;  1CA6 A;  1G2T A;  2B2W C;  4CJ0 B;  1WTP A;  5CMD A;  3GV3 A;  1RTN A;  2NWG A;  2Q8R E;  2VXW A;  4IUV A;  1NAP A;  1XX8 A;  1MGS A;  5DNF A;  2L4N A;  2L9H A;  4OIK A;  4ZK9 B;  1VMC A;  2FIN B;  4XDX A;  1O7Y A;  1DOM A;  5COR A;  2CVR A;  3N52 A;  1EIG A;  1NR4 A;  4ZKB B;  3P7J A;  1M8A A;  4UAI A;  3GV6 A;  4RA8 A;  3LWE A;  1NR2 A;  4IUQ A;  1BNZ A;  4MN3 A;  3I3C A;  1B2T A;  1TVX A;  1HFN A;  1DOL A;  2JP1 A;  1QE6 A;  2K01 A;  1PFM A;  1Q3L A;  2L11 A;  1AZP A;  3I91 A;  1MSG A;  4OIJ A;  5AFW A;  2B2V C;  2IL8 A;  3I8Z A;  3D6W A;  1WTO A;  5T1I A;  2N55 A;  2KUM A;  1JIC A;  2SDF A;  2FJ2 A;  3UI2 A;  1AZQ A;  1DZ1 A;  5EPJ A;  5E4X A;  1X3P A;  2FMM A;  1HRJ A;  1NCV A;  3IFD A;  1ZXT A;  4MHE A;  2B2W A;  1PFN A;  2KEE A;  1F9S A;  1SSO A;  4X3T A;  2X69 A;  1ILQ A;  1MI2 A;  2HCC A;  1DON A;  1QG7 A;  3TZD A;  1O7Z A;  1F9R A;  4IUP A;  4RWS C;  1O80 A;  3KUP A;  1WTV A;  1HFG A;  1RHP A;  1RTO A;  2N88 A;  2RVL A;  2EOT A;  3DEO A;  2EPB A;  3HP3 A;  5D65 A;  1WTQ A;  2B2Y C;  1G91 A;  1J9O A;  1EOT A;  1PFB A;  2KOL A;  1HUM A;  5CBE E;  2HCI A;  3MTS A;  4CJ2 C;  4CJ1 B;  2J7Z A;  4X3S A;  1AP0 A; 
#chains in the Genus database with same CATH topology
 1D5Z C;  4GKK L;  1GUN A;  2F0P A;  4YIJ A;  1LTS D;  3K6O A;  1HNX Q;  4X6A H;  4PNY A;  3FKI B;  3AQQ A;  4DR1 Q;  1PZJ D;  5IGG A;  2J0T D;  4ZUI A;  4KKU A;  1UWV A;  2F0O A;  3VYS A;  4NXN Q;  4PZ8 A;  2OT2 A;  2JEA I;  1I3Q B;  3O13 A;  4BBR B;  5JVH 3;  2OQK A;  4QB4 A;  5EJW A;  3OTO Q;  2DY8 A;  3T1H L;  2NVX B;  5L37 A;  1E22 A;  3TN2 A;  4A3E B;  1SE3 A;  5DEH A;  1S5F D;  3GO5 A;  3S14 B;  4PZ7 A;  3FPU B;  4QUF A;  5IYD H;  1U0L A;  5IT9 E;  1I4G A;  4AIM A;  4GNX A;  2B39 A;  3HOX B;  1JC7 A;  1LT4 D;  1PZK D;  3QJY A;  4RAU C;  3KJO A;  1B53 A;  5C4J B;  1Y8O B;  3HKZ B;  5IWA L;  5M5X B;  3CAM A;  5TSS A;  2KED A;  1K73 C;  2WIN B;  2JA7 B;  2K4K A;  4OXP A;  4X62 Q;  1WTX A;  1VQD A;  3N6R A;  2JN4 A;  5EKL A;  2NVY H;  3BS1 A;  3S15 H;  2KBN A;  4XDX A;  1XMQ Q;  4YHH L;  3GTJ H;  2R7Z G;  2EIF A;  1QWY A;  4FF2 A;  1FR3 A;  3Q22 A;  3J7A V;  1D6E C;  2F0U A;  3K80 C;  3CC2 A;  3Q24 A;  1B3Q A;  5AFW A;  4C3I H;  3GD7 A;  5FJ8 H;  5CR3 A;  1SFO B;  1X56 A;  4G57 A;  5LMN Q;  4XYQ A;  1IW7 D;  2XGT A;  2EYF A;  5E1F A;  3STB C;  1SSO A;  1QOH A;  5AJ3 Q;  3H0G B;  4H02 A;  3I4O A;  2HCC A;  4A3K H;  3M7N A;  3AEV A;  4DA2 A;  4JBW A;  1QJO A;  1KLU D;  2RDH A;  1XNR L;  1I4Q A;  2AQ3 B;  2B2Y C;  1EOT A;  1VF5 C;  1PFB A;  4DV1 L;  5CBE E;  4G4K A;  4GLV B;  1SJE D;  4CJ2 C;  3MEH A;  1GUW A;  1AP0 A;  1EY8 A;  4A93 H;  1WCM G;  5ELC A;  3AB9 A;  1AFP A;  3BJU A;  1LTR D;  4J1M A;  4BS9 A;  4GOP B;  1XNQ L;  3S2D B;  4GLX A;  1RCV D;  3CKI B;  2PQA A;  2UUC L;  1XNR Q;  4HR7 B;  1EWI A;  2JQO A;  4ILW A;  2NVQ B;  3KJP A;  1X32 A;  4DUZ Q;  3GP7 A;  3KDF A;  1ENF A;  2JA9 A;  4DV3 L;  1YNJ C;  3OMG A;  3I90 A;  1ICF B;  4P73 A;  4RKB A;  1QNK A;  1JCK B;  3K5L A;  4TRD A;  1XJV A;  4A3I B;  1ASY A;  1LO5 D;  3ND8 A;  2K52 A;  5EPK A;  2XWB B;  4YCW A;  4DR5 L;  5CC4 A;  1SNO A;  3GTP H;  1Z7T A;  4DK0 A;  5KYI A;  1I5F A;  3RMH A;  2YU9 H;  5JPN C;  4DXF A;  1O78 A;  2WAQ B;  2A74 C;  3D31 A;  1TR5 A;  1BVS A;  1BCP B;  5IP9 G;  2X6G A;  4JI6 L;  3GTL H;  1SYF A;  1E24 A;  4JI3 Q;  1VQO A;  2E8G A;  3UE0 A;  1PFS A;  1PRT C;  1PVO A;  2CW0 C;  2HHH Q;  1F2Z A;  1TXY A;  2Y0S E;  2VZA A;  3RLO A;  1RIP A;  3QOL A;  1ILP A;  4B3S L;  2B63 B;  1CHP D;  1D1K A;  1TWF B;  5M3F G;  2ICI A;  1M90 C;  4IPD A;  1HR0 Q;  2Q8R E;  1Z47 A;  4BBS B;  4JVZ A;  2FMC A;  2N3S A;  1D1I A;  1JQY D;  5IYB G;  2PI2 A;  4I65 A;  4B3M L;  2FIN B;  2WAC A;  4OHJ A;  5ELD A;  4UAI A;  2A68 D;  3M4O H;  4DR6 L;  3CHB D;  1AE2 A;  4LJZ C;  5A35 A;  3IFT A;  2V1C C;  3I4N B;  3I91 A;  1MSG A;  2C9O A;  1KRS A;  1EY4 A;  1EY5 A;  1WTO A;  2WB1 E;  2O5J C;  2L5T A;  4MZ9 A;  1KD1 C;  2F0W A;  1IYJ B;  5EAY A;  4ZCK A;  1O7I A;  1IBL Q;  2UXD L;  2KQ3 A;  2SOB A;  4DAV A;  1STB A;  3TRE A;  4DNR B;  4LNQ A;  4XYO A;  1B7Y B;  3L9A X;  4Y52 H;  3L0O A;  2NZH A;  2KOL A;  5CV6 A;  4DV5 L;  3H15 A;  4JYA L;  1EQV A;  1MSH A;  4LFC L;  3I70 A;  2CH4 A;  1B8A A;  3R3O A;  1EQQ A;  2B2U C;  3I7F A;  1YEZ A;  1PDQ A;  5IP7 H;  4KMU C;  3M3Y H;  1EOV A;  2NN6 I;  4J6H A;  4DV5 Q;  1C0A A;  4DXG A;  2CWA A;  3NWT A;  1EWC A;  2N49 A;  4KI0 A;  1G2S A;  2VS1 A;  2X6L A;  2DGY A;  3CCE A;  2RKS A;  2XSC A;  4DUY Q;  3OMC A;  2UXB L;  2PNR C;  4UP9 A;  1KIX A;  1JWS D;  4C2M B;  3U4V A;  4R9W A;  3NTH A;  2DN8 A;  3A8I E;  2JEB I;  4K2K A;  3DM1 A;  2EYO A;  2GN5 A;  4HCS A;  4FF1 A;  2KEC A;  2A8V A;  4GOP A;  4KD3 A;  1CKN B;  3K0Y A;  2F0E A;  3CP0 A;  1I4R A;  1I50 B;  2PMZ E;  4L8J A;  5JJL A;  1PRT D;  1GOZ A;  3QO2 A;  2E75 C;  1FNV A;  4DNT B;  4B3R L;  4LFB Q;  1LTG D;  4A3G B;  1JOQ A;  1K8O A;  2J4X A;  4DR4 Q;  1X55 A;  3Q0A A;  2Z1C A;  3TP5 A;  2CCZ A;  3I4M B;  1NMF A;  1W2B A;  3KBX A;  1B70 B;  5GAE C;  5K36 H;  1E1O A;  4EGV A;  4F7X A;  1TS2 A;  1H9J A;  4WOR A;  1QZH A;  1BBW A;  4HJ7 A;  2TSS A;  3N52 A;  4GS3 A;  2H5X A;  3CCM A;  1TII D;  2NVT H;  2NTT A;  1VQE A;  1K0S A;  2HD3 A;  3SDZ A;  4RFB A;  1LT6 D;  3E0J A;  1C9O A;  1I4P A;  3UDF A;  3ULL A;  2IL8 A;  1EEF D;  3D6W A;  1CZW A;  5DAU A;  3S1M H;  2ZJP A;  1M4V A;  1EU3 A;  2O4X A;  3I2Z A;  5M5Y H;  5C6A A;  4JI7 Q;  4NPS A;  2CH4 W;  4L63 B;  1F9S A;  1Q8I A;  4TKO B;  5IYC G;  1W6J A;  1HFG A;  3KF8 A;  3FMC A;  5GRO A;  3DEO A;  3HP3 A;  3K7A H;  3RR5 A;  3TS0 A;  3AFQ A;  1H95 A;  1S5B D;  4N8F A;  1Q12 A;  2JA5 H;  2YTV A;  3F1Z A;  4POF A;  3GTQ H;  3MAQ A;  3PO3 H;  1CT1 D;  5EKI A;  1AN8 A;  4Q0F A;  1HUN A;  1FL0 A;  4AYB G;  1L1O A;  3OW2 A;  1KDC A;  2BH8 A;  1IBK L;  1VF7 A;  4CKB A;  1KAB A;  1S5D D;  2DNC A;  4OEM B;  4S3S A;  5E3F A;  5LL6 X;  1IKM A;  3PO2 G;  2A5H A;  4P75 A;  3K7U C;  1PH1 A;  3URY A;  4JI0 L;  5M5W B;  2IT1 A;  1UE5 A;  2CHB D;  4KHV A;  4RGT A;  1A62 A;  1C48 A;  2XIW A;  1XPU A;  1FD7 D;  4LUV A;  4EQN A;  4MNO A;  5EPL A;  2K14 A;  3BDO A;  5FLX c;  2QEX A;  1PRT B;  3OHX C;  4QQB X;  4LFA L;  1P8L A;  1EUJ A;  1KLG D;  2MJ8 A;  5EKK A;  1PYB A;  1RJT A;  3E0E A;  3HOU H;  4DV0 Q;  4R4T A;  3CQZ B;  2K75 A;  1RD9 D;  4EQ5 A;  5FO7 B;  2ATW A;  4NMZ A;  1V1O A;  2RQX A;  3DXJ C;  5C0X H;  2B29 A;  3CRL C;  4LFA Q;  1DD2 A;  3FKI H;  2I07 B;  1HHV A;  1TWG B;  3RLF A;  4C1N I;  4CKE A;  3HOY G;  3GV3 A;  2NWG A;  2VXW A;  3DM3 A;  3GDE A;  4OIK A;  4V19 0;  5E7N A;  3U4Z A;  1Y14 B;  4EVO A;  1J6Q A;  2CVR A;  4JI4 L;  1I3Q H;  5IGE A;  1M8A A;  4BBR H;  5C3X A;  4ABN A;  4OON A;  4YCV A;  2F0L A;  2EXZ A;  2K01 A;  2G5D A;  1LT3 D;  5A2Q L;  4KKT A;  1X6O A;  1N36 L;  1CKN A;  2EVB A;  2VL6 A;  3MZ5 A;  1K8G A;  2NVX H;  4YWK A;  1J5E L;  3HKZ E;  1L0Y B;  3MEF A;  3SK8 A;  4A3E H;  2D2C C;  1WI5 A;  3S1N B;  3S14 H;  4H13 C;  4FNF A;  2JA8 G;  4A3C H;  4XQN A;  2ZTC A;  5C4H A;  4JI1 Q;  5CV8 A;  1PZI D;  1TS5 A;  4WRD A;  1JOR A;  3HOX H;  2K7V A;  5C4J H;  5M5X H;  3HOW G;  3DWP A;  4YY3 Q;  2R92 B;  5CMD A;  2JA7 H;  1YJ9 A;  1ESR A;  3UE1 A;  1UEA B;  1F9P A;  2KVM A;  1PTO D;  4H7B A;  1FVI A;  3K0X A;  3PUX A;  3J81 c;  5JVG 3;  2PW5 A;  3LWU A;  2R7Z B;  1C7Y A;  4J8Q A;  4RKL A;  3NTK A;  1OO9 B;  1YBY A;  3VR5 A;  5C44 G;  2ENB A;  1ZYR C;  1PHJ A;  3A54 A;  2ES2 A;  1XMO Q;  1N32 L;  1XWE A;  4JK1 C;  1TWH B;  5D3D A;  3CMA A;  2B2Y A;  1QVC A;  5LL6 S;  2V4D A;  1SFO H;  4JI8 Q;  5J3B A;  1A6X A;  2F0M A;  4L5R C;  2HUG A;  4OWW B;  3H0G H;  4R8I A;  3A8J E;  3CD6 A;  4JBJ A;  4DV6 L;  3RNU A;  5IT9 L;  4OO1 H;  1STE A;  2Z6K A;  4M1U B;  1DXM A;  4XQJ A;  1HZA A;  1S72 A;  3E9H A;  3NWS A;  2NB0 A;  5ISR A;  2D0O A;  1WCM B;  2K03 A;  1F2M A;  2Q2I A;  3S2D H;  4JBK A;  1B3A A;  3L3O C;  1VQG A;  4DV2 L;  3P1H A;  2Z8L A;  3R2I A;  2NVQ H;  3TME A;  1IL8 A;  5C3E G;  2QA4 A;  1QNU A;  2OTJ A;  4DF7 A;  1NTG A;  1SYD A;  1NSN S;  1U5K A;  2B2W C;  5FK9 C;  3RUZ A;  2YYZ A;  1SYG A;  4BY1 G;  3J80 c;  3K58 A;  1S5C D;  1GVP A;  3MXN B;  3JAM c;  2EJM A;  3L2P A;  1JOK A;  5KNC A;  2WKD A;  4DV2 Q;  3B6Y A;  2JXM B;  4A3I H;  4A3K G;  4FXK C;  4A3J G;  2WAQ E;  3R2T A;  3OSO A;  2ZT9 C;  2ZM6 L;  2L11 A;  1FNU A;  4A3L G;  2NUC A;  1LTI D;  1SNQ A;  2EY6 A;  2F4V L;  4DV7 L;  3MA2 B;  1X3P A;  4UPA A;  2NBF A;  3PF4 A;  1LAC A;  3M7G A;  3K59 A;  4K0K Q;  3PUZ A;  2ZJQ A;  1XTC D;  4HIK A;  3H6M A;  1GHK A;  1KAA A;  1PYW D;  3PUW A;  2QDL A;  4B08 A;  2ALY B;  4LF7 L;  4LUZ A;  2EYJ A;  4MTN A;  1N9W A;  5KYL A;  2JA6 B;  1WTP A;  2B63 H;  1TWF H;  4IFD J;  4CBV A;  4IPH A;  2QIL A;  1UE6 A;  3A74 A;  1PTO B;  5KRU A;  5M3F B;  1JJ2 A;  1D5M C;  1SJH D;  4GKJ Q;  1STH A;  3P75 A;  4BBS H;  4LF7 Q;  2D9U A;  1LUZ A;  1J8I A;  3H91 A;  2ZTD A;  1IW7 C;  2NTS A;  4Y7N B;  4GN5 A;  4PMB A;  2MO1 A;  3MHB A;  1SMX A;  3NHH A;  1MJC A;  1LYL A;  3IRB A;  1XPO A;  2CFM A;  1SMY D;  1HNX L;  3GTK B;  4IOC A;  1TU2 B;  5JEA H;  1B44 D;  1H9S A;  4DR1 L;  3RN5 A;  1L2F A;  1PH9 A;  3CPW A;  3FEW X;  4X65 Q;  4A3D G;  2B2T C;  2RSN A;  1LV9 A;  1HPC A;  3TBI B;  1SE8 A;  1R4P B;  4NXN L;  4BY7 G;  1VQL A;  1CHQ D;  3HEJ A;  1D5X C;  3FVQ A;  2B2U A;  4N9T A;  1GKH A;  5D14 A;  2RDF A;  3BDL A;  4LF6 L;  1QIL A;  3OTO L;  2A6H D;  2QEJ C;  1BBX C;  5FLM G;  1V9P A;  3D4R A;  5IGC A;  5C3W A;  2BCO A;  1HNW Q;  4ZKC B;  1MIU A;  4LF6 Q;  1K0R A;  1HCZ A;  1I4H A;  2F52 A;  2OCE A;  4A76 A;  1L0X B;  1YIT A;  1LTT D;  4JW0 A;  3ULJ A;  1MHW C;  1A2U A;  2BE5 D;  2K32 A;  3MXU A;  2KJX A;  1PTO F;  1AW7 A;  4X62 L;  1OXX K;  1Y8N B;  1Q3L A;  1AZP A;  2RBM A;  1XMQ L;  4C2M H;  4ULL A;  3LGJ A;  4NDX A;  5CV9 A;  2JJQ A;  3IFD A;  3HOV G;  4QCL A;  3T1Y Q;  2GVB A;  3NEN A;  1MI2 A;  1I50 H;  5KIX A;  4MTK A;  2N88 A;  4UP8 A;  1II3 A;  5LMN L;  1N33 Q;  1IBM Q;  2MQH A;  3QOJ A;  4A3G H;  1L0W A;  2A68 C;  5AJ3 L;  1CSP A;  4CJ1 B;  3MXN A;  3I4M H;  1WFQ A;  1K3R A;  2ZXR A;  3D0F A;  5JJZ A;  2RHQ B;  5LMN W;  4K8J A;  1YZ6 A;  1G29 1;  1DOK A;  4FP5 D;  4GN4 B;  1VQ4 A;  4C3J B;  1IZ6 A;  3BZD B;  4A3M B;  3CW2 C;  2F3V A;  3HZX A;  1BF4 A;  1EY0 A;  2HDL A;  4WJ3 M;  4BXX H;  2E5L Q;  3PF5 A;  2F0N A;  2B8G A;  1X54 A;  2CQO A;  3BVM A;  1ENA A;  3ERQ A;  4DUZ L;  4N9P A;  2KCM A;  1E3P A;  1KHI A;  4ZRZ A;  2JK8 A;  3VR2 A;  2NN6 H;  3ITP A;  4FVM A;  3ULP A;  4KN7 C;  4QIW B;  3CCL A;  3TS2 A;  4ME3 A;  3G6E A;  5I6W A;  5GAD C;  1EFI D;  3IAY A;  3E3X A;  4UP7 A;  1YHB A;  1X3F A;  1EIH A;  1E7Z A;  5BN4 A;  5ELO A;  3H3V I;  1RF2 D;  2R93 G;  3NK9 A;  5K5P A;  1G6Z A;  3TP7 A;  4JI3 L;  4IJH A;  1M1K C;  3BYY B;  1GO3 E;  4RHR A;  2HHH L;  3NP8 A;  1HZC A;  2F0T A;  3K5O A;  1EIY B;  3PO2 B;  3U50 C;  2YTX A;  1STN A;  5IIF A;  5M5W H;  1NR2 A;  1HR0 L;  4UY8 C;  4DAM A;  3OW7 A;  1BDO A;  3I8Z A;  1OXT A;  1Y69 U;  1TKW B;  4KK7 A;  1FJG Q;  1IYV A;  2PZU A;  1BUV T;  1R4Q B;  1UE1 A;  2C35 B;  1ZXT A;  5C4X G;  2E2J B;  3OYY A;  1HR0 W;  1O7Z A;  2AQ2 B;  1TWC B;  3I55 A;  4DV4 Q;  3CQZ H;  3CPF A;  2VQF Q;  5F2D A;  3U9O A;  4RGO S;  4KTA A;  4C3H B;  1DJR D;  1S3O A;  4MIU A;  2F0V A;  1IBL L;  4NB3 A;  1XYI A;  1TWG H;  2IX1 A;  5BR8 Q;  2L1B A;  1SDF A;  1VDZ A;  3HOY B;  1LTL A;  1TQO A;  3HG9 A;  3J7Y W;  1B50 A;  1VQK A;  2F0H A;  1R9T B;  4E6I A;  3QWN A;  3WDN A;  1CM9 A;  2RA4 A;  4JI2 Q;  3W1G A;  2WV6 D;  3SK5 A;  3J7A F;  3EIV A;  4L5T A;  3F2C A;  3M4Q A;  5M3M G;  2KCT A;  3VA5 A;  4DNI A;  5HY6 A;  2QF7 A;  4CDC C;  1EQR A;  1NBW A;  3OPO A;  4CDF C;  4HSV A;  1HZ9 A;  2KHJ A;  1VQB A;  1H9M A;  3FHW A;  2MP1 A;  3FKI G;  3S1N H;  4K6L A;  4RG1 A;  4KY7 A;  2EYL A;  3A7L A;  2JA8 B;  3ZYY X;  2E2H B;  1PH4 A;  5FLX E;  4DUY L;  3KLW A;  1K3B C;  2RSO A;  3A56 A;  3VR6 A;  5BN3 A;  4A3B G;  1C8C A;  1SE4 A;  2R92 H;  3D4W A;  5C5M A;  3NEL A;  3HOW B;  4DAY B;  4KY5 A;  3CCV A;  2PO4 A;  2XRQ D;  1T5E A;  3ERO A;  1EIF A;  3T51 B;  3PIO 3;  2HT1 A;  4KJN A;  1CA6 A;  3VYU A;  4HIM A;  4IPC A;  2EYP A;  1BOS A;  4IFD G;  4LFB L;  4TSS A;  4IUV A;  2PPB C;  4LF4 Q;  5CYU A;  2R7Z H;  1YNX A;  2L9H A;  3NEM A;  5GAH C;  4A3F G;  1VMC A;  4DR4 L;  1OXU A;  1MD2 D;  2C5C A;  5C44 B;  1TWH H;  4ZKB B;  1XTD A;  2MNA A;  3G6J B;  4CDE C;  4KHZ A;  1B2T A;  2Q2H A;  1PFM A;  2LY7 A;  1Z9F A;  1B9N A;  2B2V C;  3KBG A;  4HMI A;  1TWA B;  3QB3 A;  2KUM A;  2JA7 G;  3W3A A;  2FMM A;  3HFZ B;  2B2W A;  4X64 Q;  1LT5 D;  3PIO A;  2OEO A;  3HKS A;  1QG7 A;  3S1Q B;  1RTO A;  4GNX C;  1HNZ Q;  1WCM H;  1C4Q A;  4JI7 L;  4OEL B;  4GLA C;  3UDG A;  3S9W A;  1EQT A;  1SEB D;  1TY0 A;  3G71 A;  4LUO A;  4AQY Q;  1VQP A;  1PH5 A;  5C3E B;  2BDN A;  2EY2 A;  3NQI A;  4POG A;  3X3N A;  1SYB A;  3S24 A;  4BY1 B;  2HQE A;  2KHS A;  2ICE C;  4ZUJ A;  4FXG C;  3J81 E;  2A6E D;  1VQ6 A;  5KEE A;  3W5O A;  4B3T Q;  2G9D A;  4A3J B;  5JJI A;  3DUZ A;  4NXM L;  2K5W A;  1KDB A;  1X3G A;  2M2L A;  1SND A;  1UNS A;  2F1M A;  2RCF A;  4JCV E;  3W1B A;  4HAE A;  3HOZ G;  4L6T B;  3VYR A;  1KNE A;  4NXM Q;  2EJG C;  5IP9 H;  4PMC A;  4DFA A;  4G7O C;  1PTO C;  3RZD B;  4PV1 C;  3KLS A;  2E2I B;  4CHT B;  1SAP A;  1TS4 A;  2JA6 H;  4WFN 3;  3VA7 A;  4DR2 Q;  1PTO H;  1QCB D;  4KV6 A;  5M3F H;  3K81 C;  1GHJ A;  3K8A A;  2D0P A;  2B2T A;  3PUV A;  1VQ8 A;  1Y8P B;  5HGT A;  4K5W A;  1GUS A;  2Z4I A;  5IYB H;  4K5V A;  3H09 A;  1YHA A;  4Y7N H;  4DV0 L;  1G2T A;  1KC8 C;  1BR9 A;  2IJ0 A;  3S16 H;  1MGS A;  4DK3 C;  4DGZ A;  3TRZ A;  3I4L A;  2Z6B A;  3J80 E;  1JT8 A;  1E2W A;  3GTK H;  5COR A;  3JAM E;  3S17 B;  3L7Z C;  1BNZ A;  1PA6 A;  3TSS A;  2A19 A;  2Q8I B;  2E74 C;  3E5S A;  4A3D B;  3NUC A;  1Y1W G;  4LK1 C;  2ID0 A;  2VUM G;  4G7Z C;  2SEB D;  2F4I A;  2KA7 A;  5T1I A;  4LF8 Q;  2LSS A;  4BY7 B;  1X9N A;  1Y1V G;  1AZQ A;  3CC4 A;  3RD4 A;  2AMC B;  1CTM A;  4OX9 Q;  3EVQ A;  3K5N A;  3S1R B;  1ET6 A;  1YVC A;  1VQH A;  5CV5 A;  1DM0 B;  1TY2 A;  1CQF A;  1UEB A;  5C5L A;  2AKW B;  1BXT A;  1WTQ A;  1G91 A;  1J9O A;  3TEH B;  2EYM A;  2PQE A;  2A1A A;  4HJ5 A;  1DYQ A;  3I4N G;  2VNU D;  4R8N A;  2PCF B;  1B9M A;  2AHO B;  2K04 A;  4JI1 L;  1HQR D;  1X3E A;  2H4O A;  2F0J A;  3R8B A;  1NNX A;  4LWC A;  3NBH B;  1HXY D;  1RKN A;  4YY3 L;  3IKJ A;  5C4Z A;  5KGU A;  2EE1 A;  2BH2 A;  4YWM A;  1N34 Q;  4LF5 Q;  1U4M A;  2P5Z X;  4K8I A;  2K1B A;  3DLL A;  3VDY A;  2FXQ A;  1LM0 A;  3ONA B;  2F0I A;  3DHQ A;  2Q2U A;  1SBB B;  4DKA C;  4IUN A;  2IHE A;  5D3I B;  5I2Y A;  3BDC A;  2XWJ B;  2QCP X;  4TQU S;  1XMO L;  1I94 Q;  1EZ6 A;  3DWA A;  3HOV B;  4EQO A;  1BO0 A;  1X3Q A;  2L12 A;  2QDB A;  2VW9 A;  1CUK A;  1TT2 A;  1K83 B;  4JI8 L;  3Q6S A;  1WD0 A;  4RHS A;  4ZAI A;  2DUD A;  3DEP A;  4P72 A;  1S4Z A;  2KCC A;  5IYD G;  1SMY C;  1T9H A;  2QGQ A;  3PSI A;  4PQX A;  5IOC A;  3GTM B;  1HJP A;  3V2T A;  1B4O A;  3G7L A;  3I72 A;  4C3J H;  3HRZ C;  4HN7 A;  4A3M H;  4IZ8 A;  4I7A A;  5J39 A;  4B9W A;  3Q23 A;  1EIG A;  1NR4 A;  4QIW E;  1TS3 A;  3LWE A;  3GTO B;  4IUQ A;  4R1J A;  2OF1 A;  2JP1 A;  1BKB A;  1EYC A;  2A6H C;  1BBU A;  1EY9 A;  4J15 A;  1CKM A;  2N55 A;  4V0B A;  2FJ2 A;  3I4M G;  1RL2 A;  5EPJ A;  1D2B A;  1ONL A;  4C3I G;  5IYC H;  1ET9 A;  1E2V A;  2HQL A;  5FJ8 G;  1EZ8 A;  1GUT A;  4GNX B;  3A0J A;  2X69 A;  1V43 A;  1ILQ A;  3KFU A;  1HTP A;  1PH8 A;  4RWS C;  4IOA A;  1O80 A;  1RHP A;  2BE5 C;  1CI3 M;  4O2D A;  3KOJ A;  5C0X J;  4K0K L;  2AQ1 B;  1HUM A;  1QUQ B;  2HCI A;  4BXX G;  1SXT A;  1YNN D;  4O42 A;  1W3S A;  4IUR A;  2R93 B;  4JV5 Q;  5C0X I;  2EY5 A;  4GN3 B;  4A93 G;  1MJE A;  1NMG A;  5CGK A;  2RCN A;  5I2X A;  3F8T A;  3KLS X;  2E2D C;  2NYZ D;  3PO2 H;  3J7A 5;  3FDT A;  1EY6 A;  2UXC Q;  3E6Z X;  4GKJ L;  2IX3 A;  4QJF A;  4HTH A;  1FGU A;  3I73 A;  4B9X A;  2LMC B;  4ZYS A;  3IL8 A;  3SK4 A;  1A3T A;  1QVG A;  5FOB B;  4O0A A;  1JJC B;  5DLQ E;  2TMP A;  3GTG B;  1HA5 A;  3I56 A;  2R3Z A;  2K28 A;  2E2J H;  2WKC A;  1Q46 A;  4IFD I;  2IPK D;  3LNN A;  4LF9 Q;  1TWC H;  4XQQ A;  4XIG S;  3PQI A;  4X65 L;  2F0F A;  4CDD C;  1MKH A;  4JPB W;  3S16 B;  3G4S A;  1FNW A;  3SEB A;  1XXG A;  3CME A;  5KNB A;  1SNM A;  2PQA B;  4PZ6 A;  4C3H H;  3RN2 A;  1EWH A;  2O5I C;  1D7Q A;  1WD1 A;  2MO0 A;  1ASZ A;  3D3R A;  2VY3 A;  3OIQ A;  2UU9 L;  3ERS X;  3HOY H;  2I5M X;  2GA4 B;  4DR3 L;  1E2Z A;  2K5D A;  4BWG B;  3WOE A;  1R9T H;  1VQ9 A;  2L0C A;  3H3V C;  4JI5 Q;  4IPG A;  2ZTE A;  1HNW L;  2UU9 Q;  1DOM A;  2Y0S G;  3SK6 A;  3BVG A;  2QW7 A;  2EYH A;  5EBD A;  3CCS A;  5M3M B;  1QB5 D;  2F3W A;  5LMU Q;  4DR3 Q;  1FGB D;  3NSW A;  3GQB A;  1VQ7 A;  1STA A;  4OWT B;  5I6Y A;  1YIJ A;  3K57 A;  2JA8 H;  2E2H H;  4CGY B;  5ELF A;  2F0Q A;  2KHI A;  3MFG A;  4GKK Q;  2EXD A;  3HOW H;  2EOT A;  1JR0 D;  2PYK A;  4OO1 I;  4A3B B;  1UUP A;  2R6G A;  1SRO A;  1Z6H A;  2WB1 G;  3MTS A;  3T1Y L;  1WVL A;  3SR1 A;  1STG A;  2N8N A;  2B2V A;  5ELE A;  3J7Z C;  4F8M A;  1G6P A;  1P16 A;  1IBM L;  1N33 L;  1F2L A;  1SRU A;  1EYD A;  2OTL A;  1CA5 A;  3BZC A;  2IY5 B;  4HJA A;  2EY1 A;  4A3F B;  2F0S A;  1U4R A;  2RDG A;  5GAG C;  5C44 H;  3MVV A;  1NY4 A;  4X3U A;  2EZV A;  5IP7 G;  1A3V A;  2BOS A;  1BCP D;  4QGU A;  1ML0 D;  1YJN A;  3OWF A;  3T1H Q;  3VR3 A;  1JB3 A;  3A7A B;  1F9Q A;  1ZEQ X;  3MWY W;  2R92 G;  1TWA H;  1PH6 A;  3KLR A;  4IJL A;  3M4P A;  4FDB A;  4DR7 L;  3WWV A;  1EL0 A;  5IGB A;  2XRS D;  2E5L L;  1QUQ A;  5FLX L;  2HIV A;  3S1Q H;  1WTH A;  5IWA Q;  5HGQ A;  2K50 A;  1UE7 A;  4PG3 A;  3EA6 A;  4DR7 Q;  3BZK A;  4UHV A;  4DN4 M;  1GD7 A;  3H94 A;  5C3E H;  3TP8 A;  3D8G A;  1E1T A;  3MXP A;  4YHH Q;  3CC7 A;  3R93 A;  1DGS A;  4BY1 H;  4Z9C B;  2PW7 A;  4R4Q A;  4RCO A;  4I7Z C;  4FF3 A;  3CCU A;  2WII B;  4Q5V A;  1NAP A;  1AH9 A;  5K36 G;  4A3J H;  2BA1 A;  5JEA J;  4RA8 A;  3F2D A;  5NUC A;  4A3L H;  1EYA A;  3I3C A;  3KK7 A;  3C2P A;  4A4I A;  5FKA C;  5G3L D;  1VQC A;  3S2H B;  2A69 C;  3SXH A;  3HOZ B;  3QG1 A;  1EYG A;  1FYC A;  4KHP L;  2SDF A;  4DK6 C;  4DV1 Q;  1NCV A;  4EX5 A;  3RZD H;  4UDU C;  2E2I H;  2Z6K C;  2BA0 A;  4AYB B;  3A5U A;  4L5S A;  2ASB A;  4IUP A;  3RZO B;  2I0Q A;  1WTV A;  2GVA A;  4KJO A;  1FJG L;  1XNQ Q;  2Z4H A;  4BA1 I;  4KHP Q;  2EPB A;  5D65 A;  4LAA A;  2UUC Q;  4WJ4 A;  4BA2 I;  4P71 A;  4A75 A;  3PIP 3;  1LTA D;  2J7Z A;  4P2C B;  2K5V A;  4DV3 Q;  3EJI A;  4OWX B;  4DV4 L;  2JA5 G;  2NZO A;  2VQF L;  2YV5 A;  5COY A;  3J81 L;  3U58 A;  3OWE B;  1CSQ A;  2LFN A;  2K33 A;  1GM5 A;  4QY7 A;  3PO3 G;  2AUK A;  1AEX A;  3Q8D A;  5CBA E;  3S17 H;  4DR5 Q;  4L5Q A;  1SN8 A;  5BR8 L;  1YI2 A;  3SHL A;  2L55 A;  4A3D H;  5EGT A;  1IYU A;  3C1F A;  1KQS A;  2JA6 G;  1Y1W B;  3NPP A;  2VUM B;  3CU7 A;  1N8R C;  4BY7 H;  4JI2 L;  4DAP A;  2RHS B;  4JI6 Q;  1Y1V B;  2LXK A;  3PIP A;  3KF8 B;  2K5N A;  4JG2 A;  1LLR D;  3F2B A;  3S1R H;  5IGF A;  4FYD A;  1SYE A;  2JYO A;  3TZU A;  1VQA A;  2JSO A;  4C56 C;  2L15 A;  3UDX A;  1E0B A;  2F03 A;  5ELN A;  3TP6 A;  4B3S Q;  2IX0 A;  3CRK C;  5H1S E;  3AMU A;  5CV7 A;  5IT9 c;  1ZKO A;  5JOB A;  2A6E C;  4X66 L;  4ID6 A;  1ICW A;  3LX0 A;  3ND9 A;  3BYT B;  5EQ0 A;  5FLM H;  4XTC S;  3SGI A;  4HIO A;  4DU9 A;  5IE8 A;  3HOU G;  1L1O B;  2SNS A;  4B3M Q;  4JBM A;  3EQL C;  4JOI C;  1JE4 A;  2F0K A;  1PH2 A;  3STB D;  5C0X G;  3K5M A;  1U9R A;  4DR6 Q;  4X66 Q;  3J80 L;  4K14 A;  3HGB A;  3DMU A;  1VQI A;  3MFY A;  3JAM L;  4JC0 A;  3W2D A;  4K2L A;  2IHF A;  4RH6 A;  1S5E D;  4OL7 A;  4KKS A;  4APV A;  2CKZ B;  2AWO A;  3M4Y A;  1HQM C;  3QIA A;  2ZJR A;  1MBY A;  1TVX A;  2A69 D;  1Q90 A;  2KCN A;  3P20 A;  1HFN A;  1KTK A;  2XVS A;  3EBE A;  2B8F A;  5CV4 A;  4BBR G;  4LF4 L;  4P74 A;  5JAV A;  2LKV A;  2A73 B;  2UXD Q;  1BCP F;  2DJG C;  3NBI A;  1K8M A;  3HOV H;  1JE5 A;  3D4D A;  3ICE A;  1T5X D;  1H9R A;  4HMJ A;  1IXR A;  2K5H A;  4MHE A;  2KEE A;  1K83 H;  2Z9H A;  4X3T A;  1YNJ D;  2O2L D;  4M8A A;  1A8V A;  4A3E G;  4LFC Q;  4JYA Q;  2RVL A;  2XNA C;  4FXD A;  4A3C G;  1VQN A;  2BDO A;  3KYH C;  4H44 C;  3TDQ A;  4RMF A;  3AU7 A;  4X64 L;  1NJI C;  3HOX G;  3GTM H;  4X3S A;  2FFK B;  1O7L A;  2HDM A;  3HKZ G;  1Q86 C;  1VQJ A;  1HNZ L;  1EY7 A;  4RGN A;  1SR3 A;  5E4W C;  2MUY A;  1CFM A;  3U9S A;  1Q82 C;  1QVF A;  5FO8 B;  2Q8T A;  1PYS B;  4AQY L;  4G7H C;  3GTO H;  2NVY B;  3S15 B;  2DY7 A;  4H0L C;  3CCR A;  2CW0 D;  2UXB Q;  4U67 3;  2CWP A;  2PNH A;  3GTJ B;  4ZLT F;  3MC0 B;  4HID A;  3BG3 A;  1VQ5 A;  3G48 A;  4K6D A;  4B3T L;  3EFX D;  4C3I B;  4IAL A;  1JWM D;  1BQQ T;  4B3R Q;  2CQA A;  5G3L F;  1HA6 A;  4IO9 A;  3WOF A;  4C3J G;  3CCJ A;  1LTB D;  2NZ1 D;  3H0G G;  4A3M G;  5J1Z A;  3JC6 6;  1U4L A;  1K9M C;  1Q1B A;  1OXS C;  4A3K B;  1V1P B;  4OO1 G;  3ZJY C;  2FHT A;  5IGD A;  4OGQ C;  4XT1 B;  3M85 A;  2R93 H;  1ESF A;  1STY A;  2B3G A;  3T13 A;  4A93 B;  1JB7 A;  4NP5 A;  3NXW A;  4DK1 A;  4DR2 L;  1RTN A;  1JJG A;  4QL5 A;  5DNF A;  2ZXO A;  2YTY A;  3NQT A;  1AE3 A;  1ENC A;  2ZXP A;  1KAW A;  1I4X A;  5KND A;  4RGM A;  1HZB A;  1DCZ A;  1CKO A;  4MN3 A;  1GXD C;  1H9K A;  2XTI A;  4YCU A;  2LXJ A;  2OXP A;  4A3I G;  3J81 i;  3CCQ A;  1V8Q A;  3GTG H;  3T4A C;  1NUC A;  1IHZ A;  4C1N K;  1JOO A;  1G51 A;  5C4X H;  4HCE A;  5E4X A;  5I4D A;  1Q81 C;  3GTP B;  1A3U A;  4WJW A;  2N78 A;  5JJK A;  5GQO A;  2YU9 B;  2WAQ G;  5DM7 3;  3TZD A;  1A63 A;  2M00 A;  4LF8 L;  2F3I A;  3A8K E;  5I9O A;  5HUR A;  3KF6 B;  1S40 A;  2R61 A;  3GTL B;  2UUB L;  4OX9 L;  1VQF A;  4YWL A;  2F0G A;  1Q8K A;  2HIX A;  4AH6 A;  4EQP A;  4NW2 A;  4HJ8 A;  1IBK Q;  2H1E A;  1A15 A;  2B63 G;  2EQS A;  4CKC A;  3FPP A;  5J22 A;  3DWQ A;  1EU4 A;  2XN9 C;  2UUB Q;  4DAY A;  2PZW A;  4JI0 Q;  1Q1E A;  2LS0 1;  4R4I A;  3A5Z B;  4BBS G;  2MFI A;  1I6H H;  2Y0S B;  3M9B A;  5M3M H;  3PUY A;  2WP8 J;  4HED A;  2Z0S A;  4LMQ D;  3FP9 A;  4C3H G;  3M4O B;  3NE5 B;  5DM6 3;  1WTW A;  5JEA G;  3J80 i;  1GJX A;  1KRT A;  3JAM i;  1N34 L;  4LF5 L;  1YNN C;  3SVM A;  4KLK A;  2PI2 E;  4ODG A;  1ROD A;  4HSP A;  3AYH B;  1U4P A;  1SNC A;  2D62 A;  1RDP D;  4A3B H;  2MPM A;  4IQZ A;  1LAB A;  4IUT A;  3C3L A;  2K6A A;  1EEI D;  1I94 L;  2WB1 B;  3V96 A;  1G8Z D;  1NE3 A;  3BU2 A;  1IKL A;  2RF4 A;  3CXC A;  1B1Z A;  1W6K A;  3AFP A;  1GUO A;  4IFD H;  3X3M A;  4JI4 Q;  2PZT A;  2MHV A;  3BVZ A;  3J81 j;  4A3F H;  4CJ0 B;  4N8X 1;  1H9S B;  3C46 A;  2M9V A;  2AUJ D;  3PGZ A;  1WOC A;  2VQE L;  1VQM A;  3PCO B;  2L4N A;  4O1N A;  4ZK9 B;  5FO9 B;  1N36 Q;  3T53 B;  1YJW A;  1O7Y A;  3HS0 C;  3M3Y B;  2VB2 X;  1WYD A;  2R7D A;  3P7J A;  1J5E Q;  3OIP A;  2VQE Q;  4F88 A;  3VR4 A;  1PRT F;  4R4C A;  3UI2 A;  1JIC A;  1V1P A;  1DZ1 A;  2D5D A;  3FRP B;  3E9I A;  3EN2 A;  1HRJ A;  5BN5 A;  2IWH A;  1D8L A;  1PFN A;  3OOC A;  1DON A;  3CF5 A;  3UDI A;  3RLN A;  1CQV A;  1JMC A;  1UAP A;  2R7F A;  2I5L X;  1EFW A;  1YHQ A;  4A3G G;  2G9H D;  4XT3 B;  1WJJ A;  4IN3 A;  1N32 Q;  4KD4 A;  2PMZ B;  1SLJ A;  1VCI A;  4FO2 A;  1F77 A;  1K8A C;  1F2Y A;  2I46 A;  5JPM C;  4GOP C;  4PMW A;  5EBC A;  2QKI C;  4JV5 L;  4ZQ3 A;  4QF4 A;  1VMP A;  1KL9 A;  4ME5 A;  4DPG A;  2SNM A;  4FF4 A;  3F2U A;  3SE0 A;  1XPR A;  1K28 A;  1Q7Y C;  4AYB E;  3S2H H;  1OXV A;  2NVT B;  3HOZ H;  4GZY C;  3PV0 A;  4DV6 Q;  1KNA A;  2WFW A;  1PLF A;  3QR8 A;  4K5X A;  4QUC A;  2UXC L;  1GUG A;  4IUU A;  1A0I A;  3KF6 A;  3TQY A;  2I5H A;  2IW3 A;  3S1M B;  1PMR A;  2K5Q A;  1PH3 A;  5M5Y B;  5LHY 1;  3RZO H;  4F87 A;  4X3K A;  1WTR A;  2NN6 G;  2DNE A;  2K05 A;  1PH7 A;  5M9O A;  4XXE A;  1SYC A;  5ELB A;  4U68 A;  1CZG A;  2F0D A;  4TVA B;  3T56 B;  1VS0 A;  1BCP C;  1CK1 A;  3K7A B;  4LF9 L;  3T16 A;  1KXL A;  2KEN A;  5T1G A;  1SNP A;  1V1Q A;  1QZG A;  2JA5 B;  2MGS A;  2OQ0 A;  3GTQ B;  5I9P A;  1PV4 A;  2VB3 X;  2Q2T A;  4NKL A;  5C4X B;  3PO3 B;  1XX8 A;  1KDA A;  4KN4 C;  4R4O A;  2ZM6 Q;  1A2T A;  2EDG A;  3V05 A;  4KY6 A;  2DJF C;  5IOD A;  2UUA L;  2F4V Q;  4DV7 Q;  3GV6 A;  1Y1W H;  2VUM H;  1I6V C;  1X65 A;  3A55 A;  3NBH A;  1DOL A;  4HJ9 A;  1QE6 A;  1HH2 P;  1Y1V H;  3NTI A;  1SE2 A;  4JI5 L;  1IL2 A;  4LW1 A;  4OIJ A;  3D6C A;  3KDF B;  4QMG A;  1PXU A;  5A2Q E;  1JWU D;  3C1E A;  4JOI A;  2JE6 I;  2UUA Q;  5LMU L;  3PMF A;  3ER0 A;  4RCN A;  3MXG A;  1L1O C;  2OWO A;  2E76 C;  1OTC A;  1F9R A;  1HTL D;  1ZYR D;  3KUP A;  2EJF C;  5IY0 A;  4ALP A;  1I6H B;  3I4N H;  3HOU B;  3H3V H;  3VYT A;  2AWN A; 
#chains in the Genus database with same CATH homology
 1D5Z C;  1GUN A;  2F0P A;  4YIJ A;  1LTS D;  3K6O A;  4PNY A;  3FKI B;  1PZJ D;  5IGG A;  2J0T D;  4ZUI A;  4KKU A;  2F0O A;  3VYS A;  2OT2 A;  2JEA I;  1I3Q B;  3O13 A;  4BBR B;  5JVH 3;  4QB4 A;  5EJW A;  2DY8 A;  2NVX B;  3TN2 A;  4A3E B;  1SE3 A;  5DEH A;  1S5F D;  3GO5 A;  3S14 B;  3FPU B;  4QUF A;  5IT9 E;  1I4G A;  2B39 A;  3HOX B;  4RAU C;  1JC7 A;  1LT4 D;  1PZK D;  3QJY A;  1B53 A;  5C4J B;  1Y8O B;  3HKZ B;  5M5X B;  5TSS A;  2KED A;  2WIN B;  2JA7 B;  1WTX A;  3N6R A;  5EKL A;  3BS1 A;  4XDX A;  1QWY A;  4FF2 A;  1FR3 A;  3Q22 A;  3J7A V;  1D6E C;  2F0U A;  3Q24 A;  5AFW A;  3GD7 A;  5CR3 A;  1SFO B;  4G57 A;  4XYQ A;  1IW7 D;  2EYF A;  5E1F A;  1SSO A;  1QOH A;  3H0G B;  2HCC A;  3M7N A;  4DA2 A;  4JBW A;  1QJO A;  1KLU D;  2RDH A;  1I4Q A;  2AQ3 B;  2B2Y C;  1EOT A;  1VF5 C;  1PFB A;  5CBE E;  4G4K A;  1SJE D;  4CJ2 C;  3MEH A;  1GUW A;  1AP0 A;  1EY8 A;  5ELC A;  3AB9 A;  1AFP A;  1LTR D;  4J1M A;  4BS9 A;  3S2D B;  1RCV D;  3CKI B;  4HR7 B;  4ILW A;  2NVQ B;  1X32 A;  3GP7 A;  1ENF A;  1YNJ C;  3OMG A;  3I90 A;  4RKB A;  1QNK A;  1JCK B;  3K5L A;  4TRD A;  4A3I B;  1LO5 D;  3ND8 A;  5EPK A;  2XWB B;  5CC4 A;  1SNO A;  1Z7T A;  4DK0 A;  5KYI A;  3RMH A;  5JPN C;  4DXF A;  1O78 A;  2WAQ B;  2A74 C;  3D31 A;  1TR5 A;  1BCP B;  2X6G A;  1SYF A;  1PRT C;  2CW0 C;  1F2Z A;  3QOL A;  1ILP A;  2B63 B;  1CHP D;  1D1K A;  1TWF B;  2ICI A;  2Q8R E;  1Z47 A;  4BBS B;  2FMC A;  1D1I A;  1JQY D;  4I65 A;  2FIN B;  2WAC A;  4OHJ A;  5ELD A;  4UAI A;  2A68 D;  3CHB D;  4LJZ C;  5A35 A;  3IFT A;  3I4N B;  3I91 A;  1MSG A;  2C9O A;  1EY4 A;  1EY5 A;  1WTO A;  2O5J C;  2L5T A;  2F0W A;  2KQ3 A;  2SOB A;  4DAV A;  1STB A;  4DNR B;  4XYO A;  3L9A X;  2KOL A;  5CV6 A;  1EQV A;  1MSH A;  3I70 A;  3R3O A;  2B2U C;  1PDQ A;  4KMU C;  2NN6 I;  4J6H A;  4DXG A;  3NWT A;  1EWC A;  4KI0 A;  1G2S A;  2X6L A;  2RKS A;  2XSC A;  3OMC A;  2PNR C;  1JWS D;  4C2M B;  4R9W A;  3NTH A;  2DN8 A;  3A8I E;  2JEB I;  4K2K A;  3DM1 A;  2EYO A;  4HCS A;  4FF1 A;  2KEC A;  4KD3 A;  3K0Y A;  2F0E A;  4L8J A;  1I4R A;  1I50 B;  1PRT D;  1GOZ A;  3QO2 A;  2E75 C;  1FNV A;  4DNT B;  1LTG D;  4A3G B;  1JOQ A;  1K8O A;  2J4X A;  3Q0A A;  2Z1C A;  3TP5 A;  3I4M B;  3KBX A;  5K36 H;  4EGV A;  4F7X A;  1TS2 A;  1H9J A;  4WOR A;  2TSS A;  3N52 A;  1TII D;  2NTT A;  3SDZ A;  4RFB A;  1LT6 D;  3E0J A;  1I4P A;  2IL8 A;  1EEF D;  3D6W A;  1CZW A;  5DAU A;  1M4V A;  1EU3 A;  2O4X A;  5C6A A;  4L63 B;  1F9S A;  1Q8I A;  4TKO B;  1W6J A;  1HFG A;  3KF8 A;  3FMC A;  3DEO A;  3HP3 A;  1S5B D;  1Q12 A;  3MAQ A;  1CT1 D;  5EKI A;  1AN8 A;  4Q0F A;  1HUN A;  1KDC A;  1VF7 A;  4CKB A;  1KAB A;  1S5D D;  2DNC A;  4S3S A;  5E3F A;  5LL6 X;  1IKM A;  2A5H A;  3URY A;  5M5W B;  2IT1 A;  2CHB D;  4KHV A;  4RGT A;  1C48 A;  2XIW A;  1FD7 D;  4EQN A;  5EPL A;  3BDO A;  1PRT B;  3OHX C;  1KLG D;  2MJ8 A;  5EKK A;  1RJT A;  3CQZ B;  1RD9 D;  5FO7 B;  4NMZ A;  1V1O A;  2RQX A;  3DXJ C;  5C0X H;  3CRL C;  1DD2 A;  2I07 B;  1HHV A;  1TWG B;  3RLF A;  4C1N I;  4CKE A;  3GV3 A;  2NWG A;  2VXW A;  4OIK A;  4V19 0;  4EVO A;  2CVR A;  5IGE A;  1M8A A;  5C3X A;  4ABN A;  2F0L A;  2EXZ A;  2K01 A;  5A2Q L;  1LT3 D;  4KKT A;  2EVB A;  3MZ5 A;  1L0Y B;  3SK8 A;  2D2C C;  3S1N B;  4H13 C;  4FNF A;  4XQN A;  5C4H A;  5CV8 A;  1PZI D;  1TS5 A;  4WRD A;  1JOR A;  2K7V A;  3DWP A;  2R92 B;  5CMD A;  1ESR A;  1UEA B;  1F9P A;  2KVM A;  1PTO D;  4H7B A;  3PUX A;  5JVG 3;  2PW5 A;  3LWU A;  2R7Z B;  4J8Q A;  4RKL A;  3NTK A;  1OO9 B;  3VR5 A;  2ENB A;  1ZYR C;  3A54 A;  1XWE A;  4JK1 C;  1TWH B;  5D3D A;  2B2Y A;  5LL6 S;  2V4D A;  1A6X A;  2F0M A;  2HUG A;  4R8I A;  3A8J E;  5IT9 L;  4OO1 H;  1STE A;  4M1U B;  1DXM A;  4XQJ A;  3NWS A;  2NB0 A;  5ISR A;  1WCM B;  2K03 A;  1F2M A;  1B3A A;  3L3O C;  3P1H A;  2Z8L A;  3R2I A;  3TME A;  1IL8 A;  1QNU A;  4DF7 A;  2B2W C;  1SYD A;  1NSN S;  5FK9 C;  3RUZ A;  2YYZ A;  1SYG A;  3K58 A;  1S5C D;  2EJM A;  1JOK A;  5KNC A;  2WKD A;  2JXM B;  4FXK C;  3R2T A;  3OSO A;  2ZT9 C;  2L11 A;  1FNU A;  2NUC A;  1LTI D;  1SNQ A;  2EY6 A;  3MA2 B;  1X3P A;  2NBF A;  1LAC A;  3M7G A;  3K59 A;  3PUZ A;  1XTC D;  1GHK A;  3H6M A;  1KAA A;  1PYW D;  3PUW A;  4B08 A;  2EYJ A;  5KYL A;  2JA6 B;  1WTP A;  4IFD J;  4CBV A;  2QIL A;  1PTO B;  5KRU A;  5M3F B;  1D5M C;  1SJH D;  1STH A;  3P75 A;  2D9U A;  1J8I A;  3H91 A;  1IW7 C;  2NTS A;  4Y7N B;  4PMB A;  3MHB A;  3NHH A;  1SMY D;  3GTK B;  1TU2 B;  5JEA H;  1B44 D;  1H9S A;  3FEW X;  2B2T C;  2RSN A;  1LV9 A;  1HPC A;  3TBI B;  1R4P B;  1CHQ D;  3HEJ A;  1D5X C;  3FVQ A;  2B2U A;  4N9T A;  5D14 A;  2RDF A;  3BDL A;  1QIL A;  2A6H D;  2QEJ C;  1BBX C;  5IGC A;  3D4R A;  5C3W A;  2BCO A;  4ZKC B;  1HCZ A;  1I4H A;  1L0X B;  1LTT D;  1A2U A;  2BE5 D;  2K32 A;  3MXU A;  2KJX A;  1PTO F;  1AW7 A;  1OXX K;  1Y8N B;  1Q3L A;  1AZP A;  2RBM A;  4ULL A;  4NDX A;  5CV9 A;  3IFD A;  4QCL A;  1MI2 A;  5KIX A;  2N88 A;  1II3 A;  3QOJ A;  2A68 C;  4CJ1 B;  3MXN A;  2ZXR A;  5JJZ A;  4K8J A;  1G29 1;  1DOK A;  4FP5 D;  4C3J B;  3BZD B;  4A3M B;  2F3V A;  3HZX A;  1BF4 A;  1EY0 A;  2HDL A;  2F0N A;  2B8G A;  3BVM A;  1ENA A;  3ERQ A;  4N9P A;  4ZRZ A;  3VR2 A;  2NN6 H;  3ITP A;  4FVM A;  4KN7 C;  4QIW B;  5I6W A;  1EFI D;  3IAY A;  1EIH A;  5BN4 A;  1RF2 D;  3NK9 A;  5K5P A;  1G6Z A;  3TP7 A;  3BYY B;  4RHR A;  3NP8 A;  2F0T A;  3K5O A;  3PO2 B;  1STN A;  5IIF A;  1NR2 A;  3OW7 A;  1BDO A;  3I8Z A;  1OXT A;  1Y69 U;  1TKW B;  4KK7 A;  1IYV A;  2PZU A;  1BUV T;  1R4Q B;  1ZXT A;  2E2J B;  1O7Z A;  2AQ2 B;  1TWC B;  5F2D A;  3U9O A;  4RGO S;  4KTA A;  4C3H B;  1DJR D;  4MIU A;  2F0V A;  1XYI A;  2IX1 A;  2L1B A;  1SDF A;  1VDZ A;  3HOY B;  1TQO A;  3HG9 A;  3J7Y W;  1B50 A;  2F0H A;  1R9T B;  4E6I A;  3QWN A;  3WDN A;  1CM9 A;  2RA4 A;  2WV6 D;  3SK5 A;  3J7A F;  3VA5 A;  2QF7 A;  3OPO A;  4HSV A;  1H9M A;  2MP1 A;  4K6L A;  4KY7 A;  2EYL A;  3A7L A;  2JA8 B;  3ZYY X;  2E2H B;  5FLX E;  2RSO A;  3A56 A;  3VR6 A;  5BN3 A;  1C8C A;  1SE4 A;  3D4W A;  5C5M A;  3HOW B;  4KY5 A;  2PO4 A;  2XRQ D;  1T5E A;  3ERO A;  3T51 B;  3PIO 3;  4KJN A;  1CA6 A;  3VYU A;  2EYP A;  1BOS A;  4IFD G;  4TSS A;  4IUV A;  2PPB C;  5CYU A;  2L9H A;  1VMC A;  1OXU A;  1MD2 D;  2C5C A;  5C44 B;  4ZKB B;  3G6J B;  4KHZ A;  1B2T A;  1PFM A;  2LY7 A;  1B9N A;  2B2V C;  3KBG A;  4HMI A;  1TWA B;  3QB3 A;  2KUM A;  3W3A A;  2FMM A;  2B2W A;  1LT5 D;  2OEO A;  1QG7 A;  3S1Q B;  1RTO A;  1C4Q A;  3S9W A;  1EQT A;  1SEB D;  1TY0 A;  5C3E B;  2BDN A;  2EY2 A;  3NQI A;  3X3N A;  1SYB A;  4BY1 B;  2HQE A;  2KHS A;  2ICE C;  4ZUJ A;  4FXG C;  3J81 E;  2A6E D;  5KEE A;  2G9D A;  4A3J B;  3DUZ A;  2K5W A;  1KDB A;  2M2L A;  1SND A;  1UNS A;  2F1M A;  4HAE A;  4L6T B;  3VYR A;  1KNE A;  2EJG C;  4PMC A;  4DFA A;  4G7O C;  1PTO C;  3RZD B;  4PV1 C;  3KLS A;  2E2I B;  4CHT B;  1SAP A;  1TS4 A;  4WFN 3;  3VA7 A;  1PTO H;  1QCB D;  4KV6 A;  1GHJ A;  2B2T A;  3PUV A;  1Y8P B;  5HGT A;  4K5W A;  1GUS A;  2Z4I A;  1G2T A;  4K5V A;  3H09 A;  1BR9 A;  2IJ0 A;  1MGS A;  4DGZ A;  3I4L A;  3J80 E;  1E2W A;  5COR A;  3JAM E;  3S17 B;  3L7Z C;  1BNZ A;  3TSS A;  2Q8I B;  2E74 C;  3E5S A;  4A3D B;  3NUC A;  4LK1 C;  2ID0 A;  4G7Z C;  2SEB D;  2F4I A;  2KA7 A;  5T1I A;  4BY7 B;  1AZQ A;  3RD4 A;  1CTM A;  3EVQ A;  3K5N A;  3S1R B;  1ET6 A;  5CV5 A;  1DM0 B;  1TY2 A;  1CQF A;  5C5L A;  1BXT A;  1WTQ A;  1G91 A;  1J9O A;  2EYM A;  2PQE A;  1DYQ A;  2VNU D;  4R8N A;  2PCF B;  1B9M A;  2K04 A;  1HQR D;  2H4O A;  2F0J A;  3R8B A;  1HXY D;  1RKN A;  3IKJ A;  5C4Z A;  5KGU A;  2EE1 A;  1U4M A;  4K8I A;  2K1B A;  3ONA B;  2F0I A;  3DHQ A;  1SBB B;  4IUN A;  5D3I B;  5I2Y A;  3BDC A;  2XWJ B;  2QCP X;  4TQU S;  1EZ6 A;  3DWA A;  3HOV B;  4EQO A;  1BO0 A;  1X3Q A;  2L12 A;  2QDB A;  1TT2 A;  1K83 B;  3Q6S A;  1WD0 A;  4RHS A;  4ZAI A;  3DEP A;  1S4Z A;  2KCC A;  1SMY C;  4PQX A;  5IOC A;  3GTM B;  3V2T A;  1B4O A;  3G7L A;  3I72 A;  3HRZ C;  4HN7 A;  4IZ8 A;  5J39 A;  4B9W A;  3Q23 A;  1EIG A;  1NR4 A;  1TS3 A;  3LWE A;  3GTO B;  4IUQ A;  2OF1 A;  2JP1 A;  1EYC A;  2A6H C;  1EY9 A;  2N55 A;  4V0B A;  2FJ2 A;  5EPJ A;  1D2B A;  1ONL A;  4C3I G;  1ET9 A;  1E2V A;  1EZ8 A;  1GUT A;  2X69 A;  1V43 A;  1ILQ A;  1HTP A;  4RWS C;  1O80 A;  1RHP A;  2BE5 C;  1CI3 M;  5C0X J;  2AQ1 B;  1HUM A;  2HCI A;  1SXT A;  1YNN D;  4O42 A;  4IUR A;  2R93 B;  5C0X I;  2EY5 A;  5CGK A;  5I2X A;  3KLS X;  2E2D C;  2NYZ D;  3FDT A;  1EY6 A;  3E6Z X;  2IX3 A;  4HTH A;  3I73 A;  4B9X A;  2LMC B;  4ZYS A;  3IL8 A;  3SK4 A;  1A3T A;  5FOB B;  2TMP A;  3GTG B;  1HA5 A;  2R3Z A;  2K28 A;  2WKC A;  4IFD I;  2IPK D;  3LNN A;  4XQQ A;  4XIG S;  2F0F A;  3S16 B;  1FNW A;  3SEB A;  1XXG A;  5KNB A;  1SNM A;  1EWH A;  2O5I C;  1WD1 A;  3D3R A;  3OIQ A;  2GA4 B;  1E2Z A;  2K5D A;  4BWG B;  3WOE A;  2L0C A;  3H3V C;  1DOM A;  3SK6 A;  3BVG A;  2EYH A;  5EBD A;  5M3M B;  1QB5 D;  2F3W A;  1FGB D;  3NSW A;  3GQB A;  1STA A;  5I6Y A;  3K57 A;  4CGY B;  5ELF A;  2F0Q A;  3MFG A;  2EOT A;  1JR0 D;  2PYK A;  4OO1 I;  4A3B B;  1UUP A;  2R6G A;  1Z6H A;  3MTS A;  1WVL A;  3SR1 A;  1STG A;  2B2V A;  5ELE A;  4F8M A;  1F2L A;  1EYD A;  1CA5 A;  2EY1 A;  4A3F B;  2F0S A;  1U4R A;  2RDG A;  3MVV A;  4X3U A;  2EZV A;  1A3V A;  2BOS A;  1BCP D;  1ML0 D;  3OWF A;  3VR3 A;  1JB3 A;  3A7A B;  1F9Q A;  1ZEQ X;  3MWY W;  3KLR A;  1EL0 A;  5IGB A;  2XRS D;  5FLX L;  3EA6 A;  4DN4 M;  3H94 A;  3TP8 A;  3D8G A;  3MXP A;  3R93 A;  4Z9C B;  2PW7 A;  4RCO A;  4I7Z C;  4FF3 A;  2WII B;  4Q5V A;  1NAP A;  5K36 G;  2BA1 A;  5JEA J;  4RA8 A;  5NUC A;  1EYA A;  3I3C A;  3KK7 A;  3C2P A;  5FKA C;  5G3L D;  3S2H B;  2A69 C;  3SXH A;  3HOZ B;  3QG1 A;  1FYC A;  2SDF A;  1NCV A;  4UDU C;  2BA0 A;  4AYB B;  4IUP A;  3RZO B;  1WTV A;  4KJO A;  2Z4H A;  4BA1 I;  2EPB A;  5D65 A;  4LAA A;  4BA2 I;  3PIP 3;  1LTA D;  2J7Z A;  4P2C B;  3EJI A;  5COY A;  3J81 L;  3OWE B;  2LFN A;  2K33 A;  2AUK A;  1AEX A;  5CBA E;  3SHL A;  2L55 A;  5EGT A;  1IYU A;  3C1F A;  1Y1W B;  3NPP A;  2VUM B;  3CU7 A;  4DAP A;  1Y1V B;  1LLR D;  5IGF A;  4FYD A;  1SYE A;  2JYO A;  3TZU A;  2JSO A;  4C56 C;  1E0B A;  2F03 A;  3TP6 A;  2IX0 A;  3CRK C;  3AMU A;  5CV7 A;  1ZKO A;  5JOB A;  2A6E C;  4ID6 A;  1ICW A;  3LX0 A;  3ND9 A;  3BYT B;  5EQ0 A;  4XTC S;  4DU9 A;  2SNS A;  3EQL C;  1JE4 A;  2F0K A;  5C0X G;  3K5M A;  1U9R A;  3J80 L;  4K14 A;  3HGB A;  3DMU A;  3MFY A;  3JAM L;  3W2D A;  4K2L A;  4RH6 A;  1S5E D;  4OL7 A;  4KKS A;  2AWO A;  3M4Y A;  1HQM C;  3QIA A;  1MBY A;  1TVX A;  2A69 D;  1Q90 A;  2KCN A;  3P20 A;  1HFN A;  1KTK A;  2XVS A;  2B8F A;  5CV4 A;  5JAV A;  2LKV A;  2A73 B;  1BCP F;  3NBI A;  1K8M A;  3D4D A;  1T5X D;  1H9R A;  4HMJ A;  4MHE A;  2KEE A;  4X3T A;  1YNJ D;  2O2L D;  4M8A A;  2RVL A;  2XNA C;  4FXD A;  2BDO A;  3TDQ A;  4H44 C;  3AU7 A;  4X3S A;  2FFK B;  1O7L A;  2HDM A;  1EY7 A;  4RGN A;  5E4W C;  2MUY A;  1CFM A;  3U9S A;  5FO8 B;  2Q8T A;  4G7H C;  2NVY B;  3S15 B;  2DY7 A;  4H0L C;  2CW0 D;  4U67 3;  3GTJ B;  4ZLT F;  3MC0 B;  3BG3 A;  4K6D A;  3EFX D;  4C3I B;  4IAL A;  1JWM D;  1BQQ T;  2CQA A;  5G3L F;  1HA6 A;  3WOF A;  4C3J G;  1LTB D;  2NZ1 D;  5J1Z A;  1U4L A;  1Q1B A;  1OXS C;  4A3K B;  1V1P B;  4OO1 G;  2FHT A;  5IGD A;  4OGQ C;  4XT1 B;  3M85 A;  1ESF A;  1STY A;  3T13 A;  4A93 B;  4NP5 A;  3NXW A;  4DK1 A;  1RTN A;  5DNF A;  2ZXO A;  3NQT A;  1ENC A;  2ZXP A;  1I4X A;  5KND A;  4RGM A;  1DCZ A;  4MN3 A;  1GXD C;  1H9K A;  2OXP A;  1V8Q A;  3T4A C;  1NUC A;  1IHZ A;  4C1N K;  1JOO A;  4HCE A;  5E4X A;  5I4D A;  3GTP B;  1A3U A;  4WJW A;  2YU9 B;  5DM7 3;  3TZD A;  2M00 A;  3A8K E;  5I9O A;  5HUR A;  2R61 A;  3GTL B;  2F0G A;  4EQP A;  4NW2 A;  2H1E A;  1A15 A;  4CKC A;  3FPP A;  5J22 A;  3DWQ A;  1EU4 A;  2XN9 C;  4DAY A;  2PZW A;  1Q1E A;  2LS0 1;  2Y0S B;  3PUY A;  2WP8 J;  4HED A;  4LMQ D;  4C3H G;  3M4O B;  3NE5 B;  5DM6 3;  1WTW A;  5JEA G;  1GJX A;  1YNN C;  3SVM A;  4ODG A;  1ROD A;  4HSP A;  1U4P A;  1SNC A;  2D62 A;  1RDP D;  2MPM A;  4IQZ A;  1LAB A;  4IUT A;  3C3L A;  2K6A A;  1EEI D;  2WB1 B;  3V96 A;  1G8Z D;  1IKL A;  1B1Z A;  1W6K A;  1GUO A;  4IFD H;  3X3M A;  2PZT A;  2MHV A;  3BVZ A;  4CJ0 B;  1H9S B;  3C46 A;  2M9V A;  2AUJ D;  2L4N A;  4O1N A;  4ZK9 B;  5FO9 B;  3T53 B;  1O7Y A;  3HS0 C;  3M3Y B;  2VB2 X;  3P7J A;  3OIP A;  4F88 A;  3VR4 A;  1PRT F;  3UI2 A;  1JIC A;  1V1P A;  1DZ1 A;  2D5D A;  3FRP B;  1HRJ A;  5BN5 A;  2IWH A;  1PFN A;  3OOC A;  1DON A;  1CQV A;  1UAP A;  2G9H D;  4XT3 B;  4IN3 A;  4KD4 A;  2PMZ B;  1VCI A;  4FO2 A;  1F77 A;  1F2Y A;  2I46 A;  5JPM C;  4PMW A;  5EBC A;  2QKI C;  4ZQ3 A;  4QF4 A;  1VMP A;  4ME5 A;  2SNM A;  4FF4 A;  3F2U A;  3SE0 A;  1OXV A;  2NVT B;  4GZY C;  3PV0 A;  1KNA A;  1PLF A;  4K5X A;  4QUC A;  1GUG A;  4IUU A;  2IW3 A;  3S1M B;  1PMR A;  2K5Q A;  5M5Y B;  5LHY 1;  4F87 A;  4X3K A;  1WTR A;  2NN6 G;  2DNE A;  2K05 A;  5M9O A;  4XXE A;  1SYC A;  5ELB A;  4U68 A;  1CZG A;  2F0D A;  3T56 B;  3K7A B;  1BCP C;  1CK1 A;  3T16 A;  5T1G A;  1SNP A;  2JA5 B;  2MGS A;  3GTQ B;  5I9P A;  2VB3 X;  4NKL A;  5C4X B;  3PO3 B;  1XX8 A;  1KDA A;  4KN4 C;  1A2T A;  2EDG A;  3V05 A;  4KY6 A;  5IOD A;  3GV6 A;  1I6V C;  3A55 A;  3NBH A;  1DOL A;  1QE6 A;  3NTI A;  1SE2 A;  4OIJ A;  3D6C A;  4QMG A;  1PXU A;  5A2Q E;  1JWU D;  3C1E A;  2JE6 I;  3PMF A;  4RCN A;  3MXG A;  2E76 C;  1F9R A;  1HTL D;  1ZYR D;  3KUP A;  2EJF C;  1I6H B;  3HOU B;  3VYT A;  2AWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...