2KUMA

Solution structure of the human chemokine ccl27
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
88
structure length
88
Chain Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C motif chemokine 27
publication title NMR analysis of the structure, dynamics, and unique oligomerization properties of the chemokine CCL27.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kumA01
4RA8A 1MI2A 4X3KA 5D14A 2KECA 4R9WA 1CA5A 3GV6A 1QNKA 4HSVA 1WTXA 1VMCA 1ESRA 4HEDA 2B2WC 2K04A 5CBAE 3P7JA 1G6ZA 1PDQA 5EKIA 1SAPA 2NZ1D 1E0BA 3I8ZA 1IKMA 1EL0A 4QUFA 1F2LA 2KEEA 1CA6A 4CJ2C 1RHPA 1IL8A 5E4WC 2FINB 2X69A 4IUPA 1B2TA 3FPUB 1B50A 2Q8RE 1HFNA 1RTOA 2CVRA 2EE1A 2X6GA 4IUQA 2B2YA 3FDTA 4MHEA 1F9RA 1PFMA 5EPLA 1HUMA 2K05A 5CBEE 1WD0A 2XIWA 1DZ1A 1O80A 2B2WA 4DN4M 2H1EA 1U4LA 2HDLA 2K03A 2B2UA 2HUGA 4IUUA 4ZKCB 4OIJA 1RODA 1QG7A 2RA4A 4RAUC 1WD1A 1HA6A 1MSHA 4X3SA 1SSOA 1RTNA 1X3QA 1G2SA 1BO0A 2RSNA 1PFNA 2K28A 1IKLA 2IL8A 1RJTA 3IL8A 1ICWA 4HAEA 4ZKBB 5T1GA 1WVLA 1DOLA 1EOTA 1WTRA 1PLFA 3DEOA 2JYOA 4MN3A 1WTQA 1G2TA 5CORA 1WTVA 1AP0A 4IUTA 4ZLTF 2FFKB 3MTSA 4NW2A 3I91A 2J7ZA 4ZAIA 3Q6SA 1ML0D 1EQTA 3H91A 5EPKA 1WTOA 1C8CA 2K01A 2JP1A 5E4XA 2KEDA 5EQ0A 2FMMA 1WTPA 1PFBA 1XYIA 1ILPA 1MSGA 1BBXC 2B2VC 1A15A 1NR2A 2RSOA 4XT3B 2EOTA 3D6WA 3I90A 3KBXA 2L12A 1HFGA 1ZXTA 1JE4A 1B53A 1DOKA 2HDMA 1F9QA 1U4RA 1VMPA 1XX8A 2FHTA 3F2UA 1BNZA 1NR4A 5JJZA 3R93A 1EIHA 2KUMA 3IFDA 4O42A 1O7ZA 2MGSA 4HCSA 5T1IA 1J9OA 1ILQA 5DNFA 1S4ZA 4QUCA 2MPMA 5EPJA 1HRJA 1TVXA 2KOLA 4CJ0B 2BDNA 1BF4A 2N55A 3TN2A 1EIGA 3N52A 2FJ2A 5COYA 1DOMA 2N88A 3SVMA 2KVMA 2NWGA 1DONA 2DY7A 1U4PA 3GV3A 1X32A 4X3TA 3G7LA 2K1BA 1Q3LA 3I3CA 1HUNA 2X6LA 5AFWA 1M8AA 1NCVA 1O7YA 2HCCA 3DM1A 2SDFA 3KUPA 1NAPA 5CMDA 2B2TC 1AZQA 2B2YC 2DY8A 2MP1A 1J8IA 4XDXA 2D9UA 1X3PA 2Q8TA 1G91A 4UAIA 1B4OA 4OIKA 4RWSC 4U68A 3DEPA 3LWEA 2NYZD 2M2LA 2B2UC 2L9HA 2R3ZA 4LMQD 2L11A 1KNEA 2EPBA 2L1BA 2L4NA 1LV9A 1CM9A 2VXWA 4ZK9B 1AZPA 3QO2A 1MGSA 3MWYW 2B2VA 1GUWA 2B2TA 5EJWA 1WTWA 2MJ8A 2RVLA 5D65A 1B3AA 3ONAB 4CJ1B 3TZDA 1U4MA 1SDFA 1F9PA 1QE6A 1HHVA 3HP3A 4IURA 1KNAA 4IUVA 3UI2A 1F9SA 4R8IA 4X3UA 4XT1B 1JICA 2HCIA
chains in the Genus database with same CATH superfamily
3ULLA 5D14A 4POFA 2Z4HA 4GKJQ 3T1HL 2L55A 5IP7G 1D5ZC 1JJ2A 3S1QH 1HPCA 2LXJA 2BA0A 4RCNA 5EKIA 4JI0Q 1E0BA 4I7AA 4LW1A 4BY7B 3CC2A 4NPSA 5J1ZA 5IWAQ 2JA7H 1B2TA 5KNDA 1HTPA 1VQCA 2B2YA 4X66Q 2ASBA 1F9RA 4DV4L 2NN6I 3HOZG 3PF5A 2YTVA 1O80A 2CW0C 3GTOH 2N8NA 2H1EA 2UUBL 3ERQA 3BG3A 1YNJC 1K8AC 4KKSA 1DD2A 2DGYA 5JJKA 4KY7A 3S1QB 2DN8A 3WOFA 3HOXG 3D31A 2IL8A 1WVLA 2MQHA 2JA7B 1C48A 2EXDA 2KENA 4JI8Q 1G2TA 2XSCA 2EIFA 2CCZA 2ZTCA 3UE1A 4EX5A 1QJOA 1KABA 3CCLA 4AYBB 1FVIA 2PO4A 4HN7A 1MSGA 2Z9HA 3CPFA 3NTIA 1LT4D 4HR7B 4A3MG 1PXUA 4HCEA 4R4QA 3X3NA 5HGTA 4IN3A 4ABNA 1XX8A 2NVQH 1VQLA 5FO7B 4C3JH 3R93A 1ZYRD 1TS2A 4O42A 3Q23A 4KN4C 5FOBB 1STAA 4A75A 3FMCA 5EPJA 5DAUA 3T1HQ 1BF4A 1C4QA 2FJ2A 2KQ3A 4FVMA 5COYA 1IW7D 1O7LA 4XYQA 2NVQB 4DV5L 1NAPA 4NXML 1UE6A 4C3JB 1Y1VG 4DUZL 5EKKA 4DR7Q 1G91A 2WAQB 5C44H 2CQOA 2UUBQ 1S5FD 1JMCA 1LM0A 1V9PA 4LMQD 2VXWA 3EQLC 3QIAA 4LWCA 4ID6A 1K3BC 1AZPA 4XYOA 4IPDA 3BYYB 5EKLA 3I4MG 3J7A5 4A3CG 4JI1L 1E2VA 5C4ZA 2MJ8A 4LF8L 1A3UA 4QF4A 2K4KA 2KA7A 3CCEA 1F9PA 4P72A 5IODA 1OXTA 4IURA 1NTGA 1EEID 1I4RA 2F03A 4PMCA 3J80L 5C44B 3I70A 1F2ZA 3EROA 3KYHC 1EOVA 5D3IB 3GV6A 4Q5VA 3GTPH 5IY0A 2VY3A 2WKCA 3P7JA 1PDQA 4FXDA 1H9SB 2Y0SB 4H7BA 2K14A 4GN5A 2XGTA 1E24A 1HZ9A 4FXGC 1IBKL 3BVGA 3H0GG 1HUMA 2IHEA 2R7ZG 3G6EA 5FLMG 1Z47A 2VUMG 3I4NH 3EFXD 2O4XA 5CV9A 4AH6A 2RBMA 5LL6S 1X56A 2B63G 1X3QA 5IGCA 1UEAB 1G8ZD 2K6AA 1PH7A 2Z6KA 2K28A 2GVAA 1IKLA 1RJTA 1WOCA 5IYCH 5C4XG 1EOTA 4DV5Q 3OSOA 1VCIA 4DUZQ 1Q1BA 3PQIA 3MVVA 1I4PA 1KDAA 1YJ9A 2K5DA 2G5DA 4M1UB 5LL6X 3I4NB 3DWQA 2A68D 4JV5L 1C8CA 1AEXA 2F1MA 1BBXC 4YHHQ 3Q24A 3VA5A 5C0XG 2RQXA 3FPPA 3BDLA 4ME5A 2HDMA 4DAYA 4R4OA 2FHTA 4DK0A 1EFWA 2L5TA 3DUZA 3WOEA 1LLRD 1SXTA 2AUJD 4LF9Q 1K73C 3ICEA 1E1TA 3E5SA 3KF8B 4A3DG 2N55A 1VDZA 5IT9E 4KHPL 2WV6D 3M7NA 5LHY1 3E0EA 1IXRA 5IYBH 2PQEA 1NCVA 5CV4A 3CXCA 4K6LA 1AZQA 4WFN3 3WDNA 1VQ5A 2A6ED 3I7FA 3PSIA 4U673 2Q2UA 4LF5L 4NP5A 1DJRD 2ZT9C 4H02A 1GHJA 1LT5D 3HOWG 3T56B 1PH3A 1PTOC 3STBC 5M3FH 4HMIA 2G9DA 4EVOA 4HJ8A 4G7ZC 4CKBA 4B3SL 1X3GA 3R8BA 3AYHB 1QZHA 3OOCA 5JEAH 3HP3A 3RMHA 2JA9A 3T51B 5JPNC 4DR5L 4JV5Q 3CQZB 1WFQA 2K52A 3F2CA 2KECA 1BDOA 1V1PA 3V05A 1BR9A 1VQGA 4YWMA 5M3FB 3S15H 1SAPA 2OF1A 4TRDA 1LO5D 3BDCA 4DPGA 3AEVA 1CKOA 2CVRA 3S1RH 2X6GA 5CV7A 3SGIA 3D0FA 1WI5A 5ELOA 2A8VA 5JEAJ 1ZYRC 3K57A 1DZ1A 1U9RA 4BA2I 1LABA 3NE5B 1CZWA 2HUGA 5FJ8H 3CPWA 1RODA 1WCMH 2LY7A 3EBEA 1PFNA 5HGQA 3S15B 1PTOH 2XTIA 3VDYA 3K7UC 3RZOH 3K5LA 3L3OC 4BBRH 1LYLA 2N49A 3S1RB 1TWHH 4B3TL 3A0JA 3PIOA 2PI2A 3MTSA 3CCMA 4V190 3J81L 3KF6B 1BQQT 2F0SA 3D6CA 1OTCA 1NSNS 2GA4B 4XQNA 3M4OH 1ILPA 1OXVA 1HZAA 1G6PA 2F0LA 4TQUS 3LGJA 2CFMA 1A15A 1PTOB 2K50A 2EOTA 4QL5A 1CQVA 3RZOB 1SYEA 4BBRB 4DNIA 1UE5A 1TWHB 1HCZA 4FO2A 3L7ZC 4C3HG 4KY5A 4B3RQ 3AFPA 4P75A 5J22A 1WYDA 3S2DH 4JCVE 2RHQB 2MGSA 5T1IA 5M5WH 5J39A 1M90C 5CR3A 3ITPA 3M4OB 4JI6L 3S9WA 2PNHA 2Z4IA 1VQJA 1GOZA 1IYJB 1U4PA 1D7QA 4DGZA 1BUVT 3T16A 3OTOQ 4A76A 2E2HH 2D62A 2UXCQ 4GLVB 1YBYA 5IYDH 3PF4A 4LF4Q 3GTGH 3S2DB 1K28A 2KJXA 5M5WB 1JB3A 2F0MA 4NDXA 2NVXH 2K5HA 1ZKOA 3DEPA 3GTJH 1N8RC 4JYAL 4MTNA 4ZK9B 2EZVA 2NZHA 4A3FH 2B2TA 2RF4A 2VB2X 2E2HB 4B3TQ 1TIID 1L1OB 3I2ZA 4AYBE 4A4IA 3GTGB 2BE5D 3GD7A 1FGBD 4UPAA 3PO2H 2NVXB 1F2MA 3GTJB 1JICA 1KL9A 3F2BA 1WTXA 4RA8A 1MI2A 4B08A 1FL0A 1CA5A 2EVBA 3OMCA 3GO5A 4A3EG 1K83H 4A3FB 1NY4A 3G6JB 1LUZA 2F0OA 3GP7A 1B70B 1KDCA 4AQYL 1CUKA 3F1ZA 4RKLA 1EYGA 4OL7A 5M5YH 3KLRA 2CKZB 1RKNA 3PO2B 5D3DA 1PZJD 4FF4A 2PZUA 1HA6A 3RUZA 3VR4A 5C3WA 1K83B 1SNMA 2EYHA 5LMUL 2N3SA 3ULJA 3T1YQ 5M5YB 5IT9c 2A6EC 1ICFB 4A3KG 4PNYA 4A3JG 3PV0A 4DR4L 4JYAQ 3GTQH 3NQIA 3A5UA 2ZJQA 4LAAA 4KD3A 3V2TA 5AJ3L 1VF7A 4LF6L 4A3GH 3RZDH 2UUAL 2VW9A 2UXBL 4XQJA 3HS0C 3GTQB 1SNPA 3BVMA 1TVXA 2BDNA 4DFAA 3NHHA 1CSQA 1DOMA 1DONA 3MXNA 2AWNA 4IPCA 3HOYG 1I5FA 3E3XA 5TSSA 4DV2Q 1GVPA 1Y14B 2SNMA 3FKIG 4JOIA 4A3GB 4X6AH 3RZDB 1L0YB 1IBLL 1B4OA 1SMYD 1GD7A 2A6HC 4K8JA 1MIUA 2R93G 2JA5H 2R3ZA 2F3IA 3MXPA 1LV9A 1TR5A 1JWUD 5I6WA 2EY6A 5LMUQ 5NUCA 3J7AF 1GUWA 4JBJA 1VQNA 3IRBA 1UEBA 1D2BA 4OELB 3JAME 2JSOA 1PYBA 1T5EA 1LTLA 4HSPA 1AN8A 2IPKD 1SBBB 2HIXA 2NTTA 2JA5B 2AUKA 5K5PA 3LWUA 1C9OA 1SNQA 2F0DA 4X65Q 2WB1E 4FDBA 5AJ3Q 2PW5A 4A3LG 1EZ8A 1HFNA 4LF6Q 1UWVA 5ELFA 2EE1A 1UE7A 3FDTA 1NJIC 4DNRB 2UUAQ 1D1KA 1I4QA 2K05A 3PUZA 3K0XA 4GS3A 3OIPA 3KK7A 1S5DD 4PMWA 1MSHA 3IL8A 4GNXB 3K58A 4BY7G 1VQHA 2QKIC 4TKOB 1WTVA 2ALYB 1EY4A 4H13C 5HY6A 2FFKB 3L9AX 2R92G 4RHRA 1BCPF 1EUJA 3HFZB 1TS5A 1EU4A 3I4OA 4WJWA 4OO1G 4C3IB 1VQ9A 5JAVA 1VQFA 4FP5D 3OYYA 1F9QA 1V1QA 2JA7G 1HJPA 1S3OA 1K0RA 4HTHA 2K5QA 1O7ZA 2CWPA 4A3IB 1K8MA 2PZTA 1STBA 4AYBG 5M3MH 4DV7Q 1TKWB 2K75A 2SEBD 3BZDB 4R1JA 3A7LA 3FRPB 2K1BA 3U9SA 4B3MQ 1P16A 1HUNA 2X6LA 5AFWA 1M8AA 4CDDC 4CDEC 2B2YC 1W3SA 1GUNA 4DKAC 4KI0A 1BCPD 2D0PA 2K5NA 1EU3A 2JA6H 3K5NA 2F0VA 1KNEA 5M3MB 3MHBA 1HNWL 1I94Q 3MEFA 1WTHA 1PVOA 2ENBA 2B39A 5E3FA 2E2JH 3EN2A 1SN8A 1B3AA 4DR6L 1JJCB 2CH4A 1BVSA 3TREA 1HNXL 4LFBL 5I9PA 2VZAA 2I5LX 4IUNA 1XMQQ 1B50A 3CCQA 1QNKA 1SMXA 3CCRA 1K8GA 4UHVA 5CBAE 5M5XB 2E2JB 2NVTB 2NN6H 2WP8J 2KEEA 2RCFA 4IZ8A 4RKBA 5E4WC 4KMUC 2FINB 5GQOA 3I72A 2PYKA 3HOVG 1F77A 2ZTEA 1V1OA 3RR5A 3O13A 1VQPA 5K36H 2B2WA 5CV5A 1KAWA 4DK6C 1JR0D 5LMNW 3GDEA 4KK7A 3DLLA 3A55A 2K7VA 3PO3H 4MZ9A 5FK9C 4IFDI 5FO8B 1CKNB 1KAAA 3NQTA 1HH2P 1PRTF 3ZYYX 2VQEL 1NUCA 2JA8G 3K81C 4LUOA 4JI7Q 2NB0A 1NMFA 2EDGA 4JI4L 4JI3L 4WORA 2B29A 3S1NB 3OWFA 2EJFC 3NSWA 2VQFL 5ELBA 1SYBA 3PUVA 3D6WA 4OWTB 3PO3B 4YCWA 1G51A 3NBHA 3OMGA 1TXYA 3E0JA 4BY1H 2RDFA 1CFMA 1SFOH 2HT1A 2PMZE 3JAMc 2BA1A 4B9WA 1EFID 1OXSC 1O7IA 5GROA 3BDOA 3SVMA 1E22A 2DY7A 1PRTD 2NVYH 5IYCG 4K5XA 5KNCA 2SDFA 3OW2A 4BY1B 1V43A 1G291 4JVZA 1SFOB 2WB1G 5C6AA 4U68A 1SYCA 3J80i 2WIIB 3BZCA 2DJFC 2E8GA 2Z6KC 4Q0FA 5IGBA 2NVYB 3H15A 4OX9L 1CHQD 3L0OA 4V0BA 1U0LA 2IX1A 3MEHA 2VQEQ 4GLXA 1I6HB 4HJ5A 4DV1L 1L2FA 2G9HD 4JI3Q 4X3UA 2A69C 4DV4Q 1N36L 5FLXL 4QIWB 2VQFQ 1JB7A 3MXUA 2FXQA 3KFUA 2UUCL 1SROA 2XRSD 5I9OA 4CJ2C 1IL8A 5JJLA 3NELA 3K0YA 1PMRA 1EY5A 1FGUA 3TSSA 5EPLA 3K59A 2XVSA 1WD0A 4OWXB 1N33L 4ZUJA 2QF7A 2K03A 2B2UA 1QG7A 4N9TA 1G2SA 2M9VA 3G48A 1XWEA 3W1GA 5IGEA 2RSNA 2IX0A 1S72A 1KRTA 5M3FG 2DNEA 1YJNA 4JBWA 1LTBD 2JYOA 1E7ZA 2A19A 1SRUA 1UUPA 4K5WA 5JEAG 1KLUD 4CBVA 5IP7H 3ER0A 4GOPC 4YWKA 1VQ7A 3Q6SA 4GLAC 5HURA 3N6RA 2JP1A 4OGQC 2FMMA 2YTYA 3HKSA 1ZEQX 4GN4B 2RSOA 5A2QE 4EGVA 1JE4A 1LTGD 4MNOA 1VMPA 3K5MA 4DV1Q 1BNZA 2K5WA 4DUYL 1Y8OB 5JJZA 3GTLH 3D4WA 4NXMQ 3HOXH 1N36Q 1VQIA 3K80C 1CHPD 1H9JA 2KOLA 3A54A 5I2XA 1KD1C 5FJ8G 1H9SA 1A8VA 1WCMG 3CF5A 3M9BA 3N52A 1HNZL 2PCFB 2A1AA 4JI2L 2ES2A 5KYLA 2K32A 1J5EL 4JI1Q 1KDBA 4PV1C 4BBRG 4LF8Q 2VL6A 4C56C 2V4DA 3GTLB 2QDBA 4JBKA 2D9UA 3HOXB 3KJPA 4A3MH 2BH8A 1VQEA 2XNAC 2ZXRA 2E2IH 1XNRL 3TP7A 3K5OA 1K8OA 1I4XA 5C3EH 3EIVA 5EJWA 5A35A 1KQSA 3S17H 1A63A 1IZ6A 4RGTA 4KLKA 4RHSA 4GKKL 3VR5A 1F9SA 4GOPB 1IBKQ 4A3MB 2F0JA 2IW3A 1XPRA 3OWEB 2E2IB 5KNBA 3I4LA 4P73A 5C3EB 1H9MA 1AW7A 2A5HA 2JEBI 3AQQA 3HOUG 4OXPA 3CQZH 3S17B 1SYFA 1Y1VH 4L5TA 2C5CA 3FP9A 2OQKA 4IJLA 2QW7A 4QMGA 4WRDA 2O5JC 1ASYA 3HEJA 3KF8A 3I4MH 2KBNA 1PH2A 2KCCA 4MTKA 1SJED 3PIPA 4ZKCB 4IUUA 2BCOA 3J81i 3PUWA 1HNZQ 1XTDA 2F0GA 2OQ0A 3CCSA 1Y1VB 4A3FG 2VB3X 2OTLA 1J5EQ 4CGYB 2PNRC 5C5LA 1B1ZA 4L5SA 1Y1WG 4OWWB 3NENA 2EJGC 4ZLTF 5ELEA 5GAGC 3I4MB 3CC7A 4PMBA 2J7ZA 1EQVA 3NP8A 4IPHA 1XYIA 3SK8A 3SXHA 3PIO3 1JE5A 2ZXOA 5IGGA 2R7ZH 1EY0A 2A73B 1E1OA 4KHPQ 2VUMH 2XN9C 4IALA 4OEMB 4HJAA 3U4VA 1YIJA 1IW7C 3RNUA 2B63H 4CKEA 1DCZA 4KJOA 1R4QB 3AU7A 1EY6A 3JC66 1STYA 5IGDA 3KDFB 3QR8A 1EYAA 2JK8A 4LF5Q 4K14A 3RN5A 3F8TA 1TT2A 3A8JE 2F0IA 3H0GB 2Z0SA 2R7ZB 2CWAA 1X65A 2UU9L 2VUMB 4XQQA 3KUPA 3DM1A 5ELNA 2PZWA 2MFIA 1JOKA 1YHBA 4O1NA 4BXXG 4JK1C 1QWYA 4B3SQ 2B63B 1KRSA 3X3MA 3R3OA 4FF3A 1XTCD 4DR5Q 1CM9A 3CCUA 2K33A 4DV3L 1BBUA 1E2ZA 5IT9L 4DXGA 1KHIA 5D65A 2KHJA 1CKMA 3C3LA 3NTHA 3AB9A 3HG9A 1CZGA 3D4DA 3KF6A 4G57A 4QJFA 2R61A 4A3GG 4F8MA 3TBIB 3GTKH 3TP5A 4YIJA 2HHHL 3D8GA 1PHJA 1XMOL 4JI5L 2B8GA 3CHBD 3A56A 3K8AA 1X3FA 4QUFA 2MHVA 3D3RA 2F0QA 5KGUA 2X69A 4IUPA 4KKTA 3DWPA 3CMEA 5C0XI 1HTLD 1JC7A 1CQFA 1PFMA 4UDUC 1VF5C 2IHFA 3GTKB 3IFTA 3ND9A 4JBMA 2OXPA 4DN4M 2N78A 4RAUC 2IWHA 3NK9A 1TS3A 4X3SA 1STEA 4WJ3M 4BS9A 2A68C 4RFBA 2VNUD 4N8X1 3DEOA 3DXJC 4LK1C 2F0KA 4KKUA 3M85A 4JOIC 5I2YA 3KLWA 1Q46A 3CW2C 4DK1A 1GHKA 2DNCA 2V1CC 1WTOA 3IKJA 4ME3A 4NB3A 1PFBA 1Z6HA 2JJQA 4JI6Q 1C0AA 1L1OA 1VQBA 1ZXTA 1B53A 1DOKA 3TZUA 5BR8L 1I6VC 4QIWE 2XWJB 1BXTA 1EY9A 1LACA 4XIGS 2WAQE 3U58A 5IGFA 1EQRA 4DAMA 4UP7A 3VYTA 3U9OA 1XNQL 4X62L 4C2MH 3G7LA 3QWNA 4FXKC 3FHWA 2HCCA 1EWIA 4IJHA 2H4OA 2AQ3B 1FNWA 5LMNL 3Q8DA 2EYPA 2L4NA 1XJVA 1GM5A 3E6ZX 3QOJA 5KYIA 2Y0SE 4C3HH 1WTWA 1EWCA 4C2MB 3P20A 5GADC 3I55A 1YVCA 3A8KE 4DAVA 4AQYQ 3EA6A 2LMCB 5IP9H 1MJCA 3TEHB 4O2DA 4QGUA 5CC4A 5J3BA 1VMCA 1SEBD 4C3HB 1I4HA 2NZ1D 4R4TA 2EXZA 5BR8Q 3J81j 3FPUB 4DV0L 2Q8RE 4N8FA 1QUQB 4BBSG 4MHEA 3TRZA 3M7GA 4EQ5A 1Q7YC 4LFAL 1X55A 2ZXPA 2LXKA 1WD1A 2JA6G 4DR4Q 3KLSX 4J1MA 2ZM6L 3VA7A 4ZKBB 1ICWA 4HAEA 4E6IA 1V8QA 2F0NA 5FKAC 2CW0D 2JN4A 2PQAA 2C35B 2KCTA 2OCEA 3VYSA 4OHJA 5LMNQ 1F2YA 4NW2A 1GXDC 4JW0A 4DR3L 2A74C 5EBCA 4DR2L 1SE2A 3CMAA 1EQTA 2UXBQ 1KLGD 3AMUA 1PH1A 3LNNA 1STGA 1LT6D 1K0SA 1NR2A 3RD4A 4J6HA 3M4YA 5G3LF 1QVCA 2L12A 3BYTB 2NN6G 4RCOA 4H0LC 1CT1D 3F2UA 4C3IH 3SHLA 1Q81C 4B9XA 4A3EB 1MJEA 3NEMA 2AMCB 5DNFA 2IT1A 3MZ5A 4QUCA 1IBLQ 1TWAH 4K6DA 4CJ0B 1N34L 1GUOA 4A3IH 2KVMA 4TVAB 1X32A 4PQXA 2Z1CA 3K7AH 1O7YA 1YHAA 1R9TH 1STHA 2EYLA 4XDXA 1TU2B 1FR3A 4KN7C 1TWAB 2NTSA 2CH4W 3TMEA 5JVG3 3MAQA 2BE5C 2ZM6Q 2EQSA 4GNXA 2NUCA 5G3LD 3DHQA 3QO2A 5IOCA 5EAYA 1JT8A 1JWSD 1X9NA 1U5KA 4F7XA 1CI3M 1HR0W 2Z6BA 1A3TA 1JOQA 4A3JB 1IYVA 3ONAB 1IHZA 3K7AB 3KLSA 4DR1L 1R9TB 5E1FA 4I65A 4NXNL 2YTXA 4X3KA 1FD7D 4R9WA 3G71A 4I7ZC 3J7AV 2D0OA 2J4XA 1ESRA 1G6ZA 3TP6A 3S14B 1IBML 1EL0A 3KOJA 4A3BH 1F2LA 3CKIB 2Q8IB 3JAML 3Q22A 5C4JH 4ZCKA 2WINB 1QNUA 2R93H 4IUQA 5M5XH 2NVTH 5CBEE 1JORA 1EYDA 1KC8C 3J7YW 1N34Q 2F3VA 3C46A 4C3JG 4OIJA 1LTID 1LTSD 4IFDH 4JI0L 4R4IA 4P71A 4N9PA 2WAQG 5IWAL 1PH6A 1Y69U 4A3BB 5C4JB 1WTRA 4X66L 1D6EC 2R93B 5DM73 1X54A 3BVZA 1AP0A 2BDOA 3NWSA 1ENAA 2ZTDA 3H91A 1RF2D 1PH9A 1EIYB 1MBYA 1Q86C 4A3LH 4IFDJ 3H3VC 1P8LA 5C44G 1TY2A 2H5XA 1JOOA 3CRKC 4DR1Q 1HZCA 3S1NH 3W5OA 3OIQA 1PZKD 2I0QA 1LT3D 2F0FA 5DLQE 2Y0SG 1T9HA 3VR2A 4HCSA 4HIOA 1Q8IA 1J9OA 2EYOA 4QY7A 4EQNA 3L2PA 1ASZA 3TQYA 2YU9H 4NXNQ 2MPMA 3A8IE 2B8FA 2YYZA 4K8IA 1QZGA 1PTOF 2L15A 4O0AA 3CU7A 1IBMQ 1SMYC 2N88A 1WJJA 2EJMA 1UAPA 2ICIA 3SK6A 1HNWQ 2R92H 4HIMA 4DR6Q 2JE6I 1W6JA 4IQZA 1PYSB 3UDFA 3J80E 4OO1H 2YU9B 4A93H 2I07B 1HNXQ 1E3PA 4LFBQ 1A62A 1H95A 2B2UC 1KIXA 2EPBA 3CRLC 4JPBW 3TS0A 3H3VH 1YITA 1I4GA 3KBGA 2B2VA 3RLNA 1CKNA 2CQAA 5CGKA 5FO9B 1HQRD 4HJ9A 1YHQA 3I4NG 5BN4A 2LSSA 1HZBA 2R92B 4CJ1B 2DJGC 4DR7L 4DAPA 2R7DA 3A5ZB 1ONLA 3A7AB 3NXWA 3Q0AA 4L63B 1ENFA 4A93B 1I6HH 2BOSA 1PTOD 3H94A 3STBD 1JQYD 1PH5A 3VYRA 4HEDA 4HMJA 4FYDA 1FNUA 1Y8NB 3UDXA 4DV6L 4OO1I 3MC0B 3GTOB 2D2CC 1EY7A 1Z7TA 3U50C 1CTMA 1FYCA 2XIWA 3H3VI 1RL2A 3W1BA 1VQ6A 2KCNA 3PMFA 4JI4Q 3TDQA 1GKHA 5C3EG 2WKDA 1FNVA 1SE3A 1VS0A 4YY3L 1B44D 1Y8PB 1QB5D 3DM3A 3U4ZA 5CORA 4KTAA 1E2WA 1W6KA 1XPUA 1B9NA 2XRQD 5IYBG 1LTAD 2K01A 3D4RA 2KEDA 3QB3A 3HOVH 3MFYA 1AE3A 4QB4A 4XT3B 3ZJYC 4KHVA 1Q82C 1IYUA 1U4RA 4H44C 3URYA 1D5XC 2DUDA 5CYUA 3S16H 1TWGH 1ILQA 3RLFA 1HRJA 4YHHL 1KTKA 4MIUA 2E75C 1VQOA 3HOVB 3LX0A 1BCPC 3ULPA 1XXGA 4EQPA 1ET9A 3KJOA 2JA8H 4DV6Q 1A3VA 1D1IA 2RHSB 1J6QA 4RMFA 5M9OA 2QILA 4OX9Q 5C3XA 4AIMA 3S16B 3HKZB 1VQKA 4LF9L 1TWGB 1OO9B 3HOZH 2L0CA 4UAIA 2QGQA 3CD6A 2D5DA 2CHBD 3GQBA 3LWEA 2M2LA 1Q8KA 1MGSA 2LFNA 3EVQA 2JA8B 2RDGA 2OEOA 3EJIA 4KHZA 4YY3Q 2FMCA 4EQOA 4YCUA 3R2IA 3S24A 5GAEC 5I6YA 1UNSA 1B8AA 2UUCQ 1DYQA 1EQQA 2P5ZX 4K5VA 1HHVA 4IO9A 2HQEA 3H09A 3HOZB 4DAYB 4R8IA 2IX3A 2KHIA 2Q2TA 3GTPB 4JG2A 4LF7L 1Q90A 1BKBA 1IL2A 2NZOA 4KY6A 1MHWC 4POGA 1N33Q 1PV4A 4BA1I 4UP9A 3G4SA 1Z9FA 1MD2D 3QJYA 3I8ZA 3PUXA 2AHOB 4G4KA 1CA6A 3B6YA 4KJNA 2XWBB 2IY5B 2ICEC 3J81E 4DF7A 1U4LA 1N32L 1BCPB 1SSOA 5FLXc 2AQ2B 1YNND 4M8AA 1VQ8A 4G7HC 3PIP3 3RN2A 2WB1B 2LKVA 4APVA 2WFWA 3AFQA 1TWFH 1VQAA 5ELCA 3IAYA 2HIVA 5DM63 4DUYQ 4QCLA 1DGSA 1JJGA 4Z9CB 5KEEA 1SJHD 5EPKA 4FNFA 5IYDG 5E4XA 1L0WA 4ZRZA 2GVBA 2OWOA 3J80c 4A3CH 4QQBX 2MO0A 3I90A 1V1PB 4JI2Q 3CC4A 4GOPA 4CDCC 3FVQA 1TWFB 2AKWB 3FEWX 4LF7Q 1PRTC 4WJ4A 1LTRD 4ODGA 2RCNA 1PH8A 2C9OA 2JXMB 3TN2A 3PO2G 3VR3A 1XNRQ 1CK1A 3PGZA 1M1KC 1W2BA 3P1HA 5A2QL 3S1MH 1A2TA 4RH6A 1NMGA 4P2CB 4B3RL 5CMDA 3H0GH 4K2KA 2B2TC 3OPOA 3HRZC 2F0WA 2LS01 5FLMH 4GKKQ 4OIKA 3MFGA 4RWSC 2ZJRA 1N32Q 2L9HA 3OHXC 5C4HA 4IOCA 5JJIA 3MWYW 3OTOL 1PA6A 1SYGA 3S1MB 5C4XH 2UXCL 2F0UA 2A6HD 4LF4L 1S5CD 1SDFA 3CCJA 1KNAA 2HD3A 4IUVA 1OXUA 3BJUA 2E2DC 4XT1B 2MNAA 1YJWA 4DK3C 3NPPA 4DXFA 2MUYA 1EWHA 3BU2A 1A2UA 5C0XH 5C4XB 1L1OC 1IKMA 4L6TB 3P75A 4R4CA 4HIKA 2EYFA 1WCMB 1PRTB 3KDFA 3CCVA 5EGTA 4OONA 4LFCL 4IPGA 5E7NA 4A3DH 4BWGB 2RA4A 1RTNA 2Q2HA 4CDFC 2F4VL 3K6OA 1PFSA 5C0XJ 1PLFA 1PH4A 3RLOA 1CSPA 1OXXK 1WTQA 1QCBD 4L5QA 1RDPD 2EY5A 1HXYD 4IUTA 3VR6A 3HOUH 2E5LL 5IP9G 4ZAIA 1ML0D 1KXLA 4A3DB 4TSSA 5EQ0A 1HR0L 3HOWH 3NTKA 4J15A 3T13A 3T4AC 2B3GA 3KBXA 4X64L 2JA5G 3GTMH 3T1YL 1X3EA 2KCMA 4F87A 3MA2B 2UU9Q 2TMPA 1EIHA 2KUMA 3HOUB 2Z8LA 1A0IA 4LUVA 5KRUA 3PUYA 3HZXA 4K0KL 4UY8C 1A6XA 1GO3E 4FF2A 2JQOA 1TY0A 1SR3A 1M4VA 2O5IC 3HOWB 1Y1WH 4RGMA 1QILA 1S5ED 4L8JA 3C1FA 3GTMB 3GV3A 2MO1A 4X3TA 1STNA 3I3CA 4DV3Q 2I5MX 3F2DA 4HIDA 2AWOA 3C1EA 1D8LA 1TQOA 2UXDL 1SNCA 1J8IA 3W3AA 4LFCQ 3A74A 2ZJPA 2F3WA 3DWAA 2PMZB 4S3SA 2HHHQ 4G7OC 1Y1WB 2F4VQ 1XMOQ 4JI5Q 4JC0A 3PCOB 4DV2L 1YNNC 3J81c 2F0EA 4DNTB 1AFPA 3MXGA 2M00A 5H1SE 2PW7A 4C3IG 1N9WA 2E5LQ 4IOAA 5JOBA 5KIXA 3BS1A 1NE3A 1RCVD 1HR0Q 1AH9A 1RIPA 3NBIA 4X64Q 3V96A 2K04A 1ET6A 4A3IG 4BXXH 1YI2A 2F0PA 1SNOA 1JWMD 2GN5A 4KV6A 3MXNB 3UDGA 4ULLA 4PG3A 2YV5A 3T53B 4GN3B 4K0KQ 4Y52H 4L5RC 1I50H 2HDLA 1MKHA 3DMUA 4X65L 1BO0A 5ELDA 3HKZE 4P74A 2QCPX 3WWVA 2R6GA 1R4PB 5T1GA 2R7FA 1Q1EA 1DOLA 4HJ7A 2UXDQ 5M3MG 3ND8A 4Y7NH 4RGNA 5BN3A 4ZYSA 4ZQ3A 1I50B 3HGBA 4XXEA 3J7ZC 3NWTA 4NMZA 1SNDA 4GNXC 3E9IA 1BBWA 2KHSA 1EZ6A 1II3A 3BZKA 1HFGA 4A3BG 4ILWA 1XNQQ 2PQAB 3SE0A 2RKSA 5IIFA 4X62Q 2QEXA 4FF1A 4Y7NB 1NR4A 3TP8A 4PZ6A 1FJGL 1EY8A 1ENCA 3QOLA 3W2DA 4DU9A 5CV6A 1NNXA 1QOHA 1YNJD 2QDLA 2AQ1B 3E9HA 4A3EH 4IFDG 2EY2A 1EIGA 2SNSA 1QUQA 4CHTB 1L0XB 2DY8A 3SDZA 1X3PA 1SE8A 2O2LD 4ZUIA 4DV7L 1GJXA 1SE4A 2PPBC 2QA4A 5ISRA 4UP8A 5K36G 1ESFA 4B3ML 1K3RA 1NBWA 2RVLA 5L37A 3QG1A 3TZDA 1U4MA 3JAMi 1VQ4A 5GAHC 3UI2A 4A3KH 3PO3G 3S2HH 1PZID 4DV0Q 4A3JH 1O78A 2EYJA 2I46A 4PZ8A 5C5MA 2VS1A 5I4DA 1I94L 1H9RA 3VYUA 1TS4A 2E76C 4HSVA 2Q2IA 4LFAQ 2B2WC 1QVFA 4K2LA 4RGOS 1VQDA 2A69D 1RHPA 3C2PA 3NUCA 3M3YH 1FJGQ 1EYCA 1RTOA 1SLJA 3S14H 4A3KB 3S2HB 3UE0A 4NKLA 1XMQL 1K9MC 2OT2A 1BOSA 1UE1A 1TWCH 1XPOA 3SR1A 4A93G 2TSSA 4ALPA 2F0HA 4DR3Q 1AE2A 3SK5A 1T5XD 4BY1G 4DR2Q 1PYWD 5F2DA 3HOYH 4KD4A 3M4PA 1QVGA 1SYDA 2EYMA 4F88A 1VQMA 5IE8A 4MN3A 2F52A 5JVH3 3M3YB 3FKIH 2PI2E 5EBDA 2NBFA 5BN5A 5JPMC 1EIFA 1TWCB 3I91A 2ATWA 1D5MC 2HQLA 2OTJA 1WTPA 1B7YB 1X6OA 4GKJL 2WACA 2B2VC 4YWLA 3HOYB 4BBSH 1YZ6A 3SEBA 1HQMC 1C7YA 4JI7L 1B3QA 2ID0A 3FKIB 1S40A 3I73A 1I3QH 4RG1A 3CP0A 4LNQA 3IFDA 2RDHA 1S4ZA 1LTTD 1GUSA 2J0TD 4R8NA 1Q12A 1YNXA 1S5BD 2F4IA 3H6MA 3OW7A 4BBSB 2I5HA 2NWGA 5CV8A 3R2TA 1Q3LA 3CAMA 2EY1A 1HA5A 1I3QB 2JA6B 2MP1A 4JI8L 1EEFD 2QEJC 2Q8TA 3TS2A 4LUZA 4PZ7A 5DEHA 2F0TA 2K5VA 2NYZD 5FLXE 2L11A 2L1BA 1DXMA 1GUGA 2JEAI 3UDIA 2BH2A 4GZYC 1RD9D 4YCVA 3ERSX 4C1NI 3M4QA 2IJ0A 3SK4A 4DA2A 4BY7H 1DM0B 4LJZC 1GUTA 4CKCA 1H9KA 4J8QA 1QE6A 4C1NK 2E74C 3NBHB 1B9MA 1YEZA 2SOBA 4XTCS 3HKZG 1JCKB 3I56A 2HCIA
chains in the Genus database with same CATH topology
5D14A 2Z4HA 2L55A 1D5ZC 1HPCA 2BA0A 4RCNA 5EKIA 1E0BA 4BY7B 5J1ZA 1B2TA 5KNDA 1HTPA 2B2YA 1F9RA 2NN6I 1O80A 2CW0C 2H1EA 3ERQA 3BG3A 1YNJC 1DD2A 4KKSA 4KY7A 3S1QB 2DN8A 3WOFA 3D31A 2IL8A 1WVLA 2JA7B 1C48A 1G2TA 2XSCA 1QJOA 1KABA 4AYBB 2PO4A 4HN7A 1MSGA 4HR7B 3NTIA 1LT4D 1PXUA 4HCEA 3X3NA 5HGTA 4IN3A 4ABNA 1XX8A 5FO7B 3R93A 1ZYRD 1TS2A 4O42A 3Q23A 4KN4C 5FOBB 1STAA 3FMCA 5EPJA 5DAUA 1BF4A 1C4QA 2FJ2A 2KQ3A 4FVMA 5COYA 1IW7D 1O7LA 4XYQA 2NVQB 1NAPA 4C3JB 5EKKA 1G91A 2WAQB 1S5FD 4LMQD 2VXWA 3EQLC 3QIAA 1AZPA 4ID6A 4XYOA 3BYYB 5EKLA 1E2VA 5C4ZA 2MJ8A 1A3UA 4QF4A 2KA7A 1F9PA 5IODA 1OXTA 4IURA 2F03A 1EEID 1I4RA 4PMCA 3J80L 5C44B 3I70A 1F2ZA 3EROA 5D3IB 3GV6A 4Q5VA 2WKCA 3P7JA 1PDQA 4FXDA 1H9SB 2Y0SB 4H7BA 4FXGC 3BVGA 1HUMA 1Z47A 3EFXD 2O4XA 5CV9A 2RBMA 5LL6S 1X3QA 5IGCA 1UEAB 1G8ZD 2K6AA 2K28A 1IKLA 1RJTA 1EOTA 1VCIA 3OSOA 1Q1BA 3MVVA 1I4PA 1KDAA 2K5DA 4M1UB 5LL6X 3I4NB 3DWQA 2A68D 1C8CA 1AEXA 2F1MA 1BBXC 3Q24A 3VA5A 5C0XG 2RQXA 3FPPA 3BDLA 4ME5A 2HDMA 4DAYA 2FHTA 4DK0A 2L5TA 3DUZA 3WOEA 1LLRD 1SXTA 2AUJD 3E5SA 2N55A 1VDZA 5IT9E 2WV6D 3M7NA 5LHY1 2PQEA 1NCVA 5CV4A 1AZQA 4K6LA 4WFN3 3WDNA 2A6ED 4U673 4NP5A 1DJRD 2ZT9C 1GHJA 1LT5D 3T56B 1PTOC 4HMIA 2G9DA 4EVOA 4G7ZC 4CKBA 3R8BA 3OOCA 5JEAH 3HP3A 3RMHA 3T51B 5JPNC 3CQZB 2KECA 1BDOA 1V1PA 3V05A 1BR9A 5M3FB 1SAPA 2OF1A 4TRDA 1LO5D 3BDCA 2CVRA 2X6GA 5CV7A 5JEAJ 1ZYRC 3K57A 1DZ1A 1U9RA 4BA2I 1LABA 3NE5B 1CZWA 2HUGA 1RODA 2LY7A 1PFNA 3S15B 1PTOH 3K5LA 3L3OC 3S1RB 3MTSA 4V190 3J81L 1BQQT 2F0SA 3D6CA 1NSNS 2GA4B 4XQNA 1ILPA 1OXVA 2F0LA 4TQUS 1A15A 1PTOB 2EOTA 1CQVA 3RZOB 1SYEA 4BBRB 1TWHB 1HCZA 4FO2A 3L7ZC 4C3HG 4KY5A 5J22A 2MGSA 5T1IA 5J39A 5CR3A 3ITPA 3M4OB 3S9WA 2Z4IA 1GOZA 1U4PA 4DGZA 1BUVT 3T16A 2D62A 3S2DB 2KJXA 5M5WB 1JB3A 2F0MA 4NDXA 1ZKOA 3DEPA 4ZK9B 2EZVA 2B2TA 2VB2X 2E2HB 1TIID 3GTGB 2BE5D 3GD7A 1FGBD 2NVXB 1F2MA 3GTJB 1JICA 1WTXA 4RA8A 1MI2A 4B08A 1CA5A 2EVBA 3OMCA 3GO5A 4A3FB 3G6JB 2F0OA 3GP7A 1KDCA 4RKLA 4OL7A 3KLRA 1RKNA 3PO2B 5D3DA 1PZJD 4FF4A 2PZUA 1HA6A 3RUZA 3VR4A 5C3WA 1K83B 1SNMA 2EYHA 5M5YB 2A6EC 4PNYA 3PV0A 3NQIA 4LAAA 4KD3A 3V2TA 1VF7A 4XQJA 3HS0C 3GTQB 1SNPA 3BVMA 1TVXA 2BDNA 4DFAA 3NHHA 1DOMA 1DONA 3MXNA 2AWNA 5TSSA 2SNMA 4A3GB 3RZDB 1L0YB 1B4OA 1SMYD 2A6HC 4K8JA 2R3ZA 3MXPA 1LV9A 1TR5A 1JWUD 5I6WA 2EY6A 5NUCA 3J7AF 1GUWA 1D2BA 3JAME 2JSOA 1T5EA 4HSPA 1AN8A 2IPKD 1SBBB 2NTTA 2JA5B 2AUKA 5K5PA 3LWUA 1SNQA 2F0DA 2PW5A 1EZ8A 1HFNA 5ELFA 2EE1A 3FDTA 4DNRB 1D1KA 1I4QA 2K05A 3PUZA 3OIPA 3KK7A 1S5DD 4PMWA 1MSHA 3IL8A 3K58A 2QKIC 4TKOB 1WTVA 1EY4A 4H13C 2FFKB 3L9AX 4RHRA 1BCPF 1TS5A 1EU4A 4WJWA 4OO1G 4C3IB 5JAVA 4FP5D 1F9QA 4HTHA 2K5QA 1O7ZA 4A3IB 1K8MA 2PZTA 1STBA 1TKWB 2SEBD 3BZDB 3A7LA 3FRPB 2K1BA 3U9SA 1HUNA 2X6LA 5AFWA 1M8AA 2B2YC 1GUNA 4KI0A 1BCPD 1EU3A 3K5NA 2F0VA 1KNEA 5M3MB 3MHBA 2ENBA 2B39A 5E3FA 1B3AA 5I9PA 4IUNA 1B50A 1QNKA 5CBAE 5M5XB 2E2JB 2NVTB 2NN6H 2WP8J 2KEEA 4IZ8A 4RKBA 5E4WC 4KMUC 2FINB 3I72A 2PYKA 1F77A 1V1OA 3O13A 5K36H 2B2WA 5CV5A 1JR0D 4KK7A 3A55A 2K7VA 5FK9C 4IFDI 5FO8B 1KAAA 3NQTA 1PRTF 3ZYYX 1NUCA 2NB0A 2EDGA 4WORA 3S1NB 3OWFA 2EJFC 3NSWA 5ELBA 1SYBA 3PUVA 3D6WA 3PO3B 3NBHA 3OMGA 3E0JA 2RDFA 1CFMA 2BA1A 4B9WA 1EFID 1OXSC 3BDOA 3SVMA 2DY7A 1PRTD 4K5XA 5KNCA 2SDFA 4BY1B 1V43A 1G291 1SFOB 5C6AA 4U68A 1SYCA 2WIIB 4Q0FA 5IGBA 2NVYB 1CHQD 4V0BA 2IX1A 3MEHA 1I6HB 2G9HD 4X3UA 2A69C 5FLXL 4QIWB 3MXUA 2XRSD 5I9OA 4CJ2C 1IL8A 3K0YA 1PMRA 1EY5A 3TSSA 5EPLA 3K59A 2XVSA 1WD0A 4ZUJA 2QF7A 2K03A 2B2UA 1QG7A 4N9TA 1G2SA 2M9VA 5IGEA 1XWEA 2RSNA 2IX0A 2DNEA 4JBWA 1LTBD 2JYOA 4K5WA 1UUPA 5JEAG 1KLUD 4CBVA 3Q6SA 5HURA 3N6RA 2JP1A 4OGQC 2FMMA 1ZEQX 2RSOA 5A2QE 4EGVA 1JE4A 1LTGD 1VMPA 3K5MA 1BNZA 2K5WA 1Y8OB 5JJZA 3D4WA 5I2XA 1CHPD 1H9JA 2KOLA 3A54A 1H9SA 3N52A 2PCFB 5KYLA 2K32A 1KDBA 4PV1C 4C56C 2V4DA 3GTLB 2QDBA 2D9UA 3HOXB 2XNAC 2ZXRA 3TP7A 3K5OA 1K8OA 1I4XA 5EJWA 5A35A 4RGTA 4RHSA 3VR5A 1F9SA 4A3MB 2F0JA 2IW3A 3OWEB 2E2IB 5KNBA 3I4LA 5C3EB 1H9MA 1AW7A 2A5HA 2JEBI 3S17B 1SYFA 2C5CA 4QMGA 4WRDA 2O5JC 3HEJA 3KF8A 2KCCA 1SJED 4ZKCB 4IUUA 2BCOA 3PUWA 2F0GA 1Y1VB 2VB3X 4CGYB 2PNRC 5C5LA 1B1ZA 2EJGC 4ZLTF 5ELEA 3I4MB 4PMBA 2J7ZA 1EQVA 3NP8A 1XYIA 3SK8A 3SXHA 3PIO3 2ZXOA 5IGGA 1EY0A 2A73B 2XN9C 4IALA 1IW7C 4CKEA 1DCZA 4KJOA 1R4QB 3AU7A 1EY6A 1STYA 5IGDA 1EYAA 4K14A 1TT2A 3A8JE 2F0IA 3H0GB 2R7ZB 2VUMB 4XQQA 3KUPA 3DM1A 2PZWA 1JOKA 4O1NA 4JK1C 1QWYA 2B63B 3X3MA 3R3OA 4FF3A 1XTCD 1CM9A 2K33A 1E2ZA 5IT9L 4DXGA 5D65A 3C3LA 3NTHA 3AB9A 3HG9A 1CZGA 3D4DA 4G57A 2R61A 4F8MA 3TBIB 3TP5A 4YIJA 3D8GA 2B8GA 3CHBD 3A56A 4QUFA 2MHVA 3D3RA 2F0QA 5KGUA 2X69A 4IUPA 4KKTA 3DWPA 5C0XI 1HTLD 1JC7A 1CQFA 1PFMA 4UDUC 1VF5C 3GTKB 3IFTA 3ND9A 2OXPA 4DN4M 4RAUC 2IWHA 3NK9A 1TS3A 4X3SA 1STEA 4BS9A 2A68C 4RFBA 2VNUD 3DEOA 3DXJC 4LK1C 2F0KA 4KKUA 3M85A 5I2YA 4DK1A 1GHKA 2DNCA 1WTOA 3IKJA 1PFBA 1Z6HA 1ZXTA 1B53A 1DOKA 3TZUA 1I6VC 2XWJB 1BXTA 1EY9A 1LACA 4XIGS 5IGFA 3VYTA 3U9OA 3G7LA 3QWNA 4FXKC 2HCCA 2H4OA 2AQ3B 1FNWA 2EYPA 2L4NA 3E6ZX 3QOJA 5KYIA 1WTWA 1EWCA 4C2MB 3P20A 3A8KE 4DAVA 3EA6A 2LMCB 5CC4A 1VMCA 1SEBD 4C3HB 1I4HA 2NZ1D 2EXZA 3FPUB 2Q8RE 4MHEA 3M7GA 2ZXPA 1WD1A 3KLSX 4J1MA 3VA7A 4ZKBB 1ICWA 4HAEA 4E6IA 1V8QA 2F0NA 5FKAC 2CW0D 3VYSA 4OHJA 1F2YA 4NW2A 1GXDC 2A74C 5EBCA 1SE2A 1EQTA 1KLGD 3AMUA 3LNNA 1STGA 1LT6D 1NR2A 3RD4A 4J6HA 3M4YA 5G3LF 2L12A 3BYTB 2NN6G 4RCOA 4H0LC 1CT1D 3F2UA 3SHLA 4B9XA 4A3EB 5DNFA 2IT1A 3MZ5A 4QUCA 4K6DA 4CJ0B 1GUOA 2KVMA 1X32A 4PQXA 2Z1CA 1O7YA 1STHA 2EYLA 4XDXA 1TU2B 1FR3A 4KN7C 1TWAB 2NTSA 3TMEA 5JVG3 3MAQA 2BE5C 2NUCA 5G3LD 3DHQA 3QO2A 5IOCA 1JWSD 4F7XA 1JOQA 1CI3M 1A3TA 4A3JB 1IYVA 3ONAB 1IHZA 3K7AB 3KLSA 1R9TB 5E1FA 4I65A 4X3KA 1FD7D 4R9WA 4I7ZC 3J7AV 2J4XA 1ESRA 1G6ZA 3TP6A 3S14B 1EL0A 1F2LA 3CKIB 2Q8IB 3JAML 3Q22A 2WINB 1QNUA 4IUQA 5CBEE 1JORA 1EYDA 3J7YW 2F3VA 3C46A 4C3JG 4OIJA 1LTID 1LTSD 4IFDH 4N9PA 4A3BB 1Y69U 5C4JB 1WTRA 1D6EC 2R93B 5DM73 3BVZA 1AP0A 2BDOA 3NWSA 1ENAA 3H91A 1RF2D 1MBYA 4IFDJ 3H3VC 1TY2A 1JOOA 3CRKC 3OIQA 1PZKD 1LT3D 2F0FA 3VR2A 4HCSA 1Q8IA 1J9OA 2EYOA 4EQNA 2MPMA 3A8IE 2B8FA 2YYZA 4K8IA 1PTOF 3CU7A 1SMYC 2N88A 2EJMA 1UAPA 2ICIA 3SK6A 2JE6I 1W6JA 4IQZA 3J80E 4OO1H 2YU9B 2I07B 2B2UC 2EPBA 3CRLC 1I4GA 3KBGA 2B2VA 2CQAA 5CGKA 5FO9B 1HQRD 5BN4A 2R92B 4CJ1B 4DAPA 1ONLA 3A7AB 3NXWA 3Q0AA 4L63B 1ENFA 4A93B 2BOSA 1PTOD 3H94A 1JQYD 3VYRA 4HEDA 4HMJA 4FYDA 1FNUA 1Y8NB 4OO1I 3MC0B 3GTOB 2D2CC 1EY7A 1Z7TA 1CTMA 1FYCA 2XIWA 2KCNA 3PMFA 3TDQA 2WKDA 1FNVA 1SE3A 1B44D 1Y8PB 1QB5D 5CORA 4KTAA 1E2WA 1W6KA 1B9NA 2XRQD 1LTAD 2K01A 3D4RA 2KEDA 3QB3A 3MFYA 4QB4A 4XT3B 4KHVA 1IYUA 1U4RA 4H44C 3URYA 1D5XC 5CYUA 3RLFA 1ILQA 1HRJA 1KTKA 4MIUA 2E75C 3HOVB 3LX0A 1BCPC 1XXGA 4EQPA 1ET9A 1A3VA 1D1IA 5M9OA 2QILA 5C3XA 3S16B 3HKZB 1TWGB 1OO9B 2L0CA 4UAIA 2D5DA 2CHBD 3GQBA 3LWEA 2M2LA 1MGSA 2LFNA 3EVQA 2JA8B 2RDGA 2OEOA 3EJIA 4KHZA 2FMCA 4EQOA 3R2IA 5I6YA 1UNSA 1DYQA 4K5VA 1HHVA 3HOZB 2HQEA 3H09A 4R8IA 2IX3A 3GTPB 1Q90A 4KY6A 4BA1I 1MD2D 3QJYA 3I8ZA 3PUXA 4G4KA 1CA6A 4KJNA 2XWBB 2ICEC 3J81E 4DF7A 1U4LA 1BCPB 1SSOA 2AQ2B 1YNND 4M8AA 4G7HC 3PIP3 2WB1B 2LKVA 3IAYA 5ELCA 5DM63 4QCLA 4Z9CB 5KEEA 1SJHD 5EPKA 4FNFA 5E4XA 4ZRZA 3I90A 1V1PB 3FVQA 1TWFB 3FEWX 1PRTC 1LTRD 4ODGA 2C9OA 2JXMB 3TN2A 3VR3A 1CK1A 3P1HA 5A2QL 1A2TA 4RH6A 4P2CB 5CMDA 4K2KA 2B2TC 3OPOA 3HRZC 2F0WA 2LS01 4OIKA 3MFGA 4RWSC 2L9HA 3OHXC 5C4HA 3MWYW 1SYGA 3S1MB 2F0UA 2A6HD 1S5CD 1SDFA 1KNAA 4IUVA 1OXUA 2E2DC 4XT1B 3NPPA 4DXFA 2MUYA 1EWHA 1A2UA 5C0XH 5C4XB 1IKMA 4L6TB 3P75A 2EYFA 1WCMB 1PRTB 5EGTA 4BWGB 2RA4A 1RTNA 3K6OA 5C0XJ 1PLFA 1OXXK 1WTQA 1QCBD 1RDPD 2EY5A 1HXYD 4IUTA 3VR6A 4ZAIA 1ML0D 4A3DB 4TSSA 5EQ0A 3NTKA 3T13A 3T4AC 3KBXA 4F87A 3MA2B 2TMPA 1EIHA 2KUMA 3HOUB 2Z8LA 5KRUA 3PUYA 3HZXA 1A6XA 4FF2A 1TY0A 1M4VA 2O5IC 3HOWB 4RGMA 1QILA 1S5ED 4L8JA 3C1FA 3GTMB 3GV3A 4X3TA 1STNA 3I3CA 2AWOA 3C1EA 1TQOA 1SNCA 1J8IA 3W3AA 2F3WA 3DWAA 2PMZB 4S3SA 4G7OC 1Y1WB 1YNNC 2F0EA 4DNTB 1AFPA 3MXGA 2M00A 2PW7A 4C3IG 5JOBA 5KIXA 3BS1A 1RCVD 3NBIA 3V96A 2K04A 1ET6A 2F0PA 1SNOA 1JWMD 4KV6A 4ULLA 3T53B 2HDLA 3DMUA 1BO0A 5ELDA 2QCPX 2R6GA 1R4PB 5T1GA 1Q1EA 1DOLA 3ND8A 4RGNA 5BN3A 4ZYSA 4ZQ3A 1I50B 3HGBA 4XXEA 3NWTA 4NMZA 1SNDA 2KHSA 1EZ6A 1II3A 1HFGA 4ILWA 3SE0A 2RKSA 5IIFA 4FF1A 4Y7NB 1NR4A 3TP8A 1EY8A 1ENCA 3QOLA 3W2DA 4DU9A 5CV6A 1QOHA 1YNJD 2AQ1B 4IFDG 2EY2A 1EIGA 2SNSA 4CHTB 1L0XB 2DY8A 3SDZA 1X3PA 2O2LD 4ZUIA 1GJXA 1SE4A 2PPBC 5ISRA 5K36G 1ESFA 2RVLA 3QG1A 3TZDA 1U4MA 3UI2A 1PZID 1O78A 2EYJA 2I46A 5C5MA 5I4DA 1H9RA 3VYUA 1TS4A 2E76C 4HSVA 2B2WC 4K2LA 4RGOS 2A69D 1RHPA 3C2PA 3NUCA 1EYCA 1RTOA 4A3KB 3S2HB 4NKLA 2OT2A 1BOSA 3SR1A 2TSSA 2F0HA 3SK5A 1T5XD 1PYWD 5F2DA 4KD4A 1SYDA 2EYMA 4F88A 4MN3A 3M3YB 5JVH3 5EBDA 2NBFA 5BN5A 5JPMC 1TWCB 3I91A 1D5MC 1WTPA 2WACA 2B2VC 3HOYB 3SEBA 1HQMC 2ID0A 3FKIB 3I73A 3IFDA 2RDHA 1S4ZA 1LTTD 1GUSA 2J0TD 4R8NA 1Q12A 1S5BD 2F4IA 3H6MA 3OW7A 4BBSB 2NWGA 5CV8A 3R2TA 1Q3LA 2EY1A 1HA5A 1I3QB 2JA6B 2MP1A 1EEFD 2QEJC 2Q8TA 5DEHA 2F0TA 2NYZD 5FLXE 2L11A 2L1BA 1DXMA 1GUGA 2JEAI 4GZYC 1RD9D 4C1NI 2IJ0A 3SK4A 4DA2A 1DM0B 4LJZC 1GUTA 4CKCA 1H9KA 4J8QA 1QE6A 4C1NK 2E74C 1B9MA 2SOBA 4XTCS 1JCKB 2HCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RA8 A;  1MI2 A;  4X3K A;  5D14 A;  2KEC A;  4R9W A;  1CA5 A;  3GV6 A;  1QNK A;  4HSV A;  1WTX A;  1VMC A;  1ESR A;  4HED A;  2B2W C;  2K04 A;  5CBA E;  3P7J A;  1G6Z A;  1PDQ A;  5EKI A;  1SAP A;  2NZ1 D;  1E0B A;  3I8Z A;  1IKM A;  1EL0 A;  4QUF A;  1F2L A;  2KEE A;  1CA6 A;  4CJ2 C;  1RHP A;  1IL8 A;  5E4W C;  2FIN B;  2X69 A;  4IUP A;  1B2T A;  3FPU B;  1B50 A;  2Q8R E;  1HFN A;  1RTO A;  2CVR A;  2EE1 A;  2X6G A;  4IUQ A;  2B2Y A;  3FDT A;  4MHE A;  1F9R A;  1PFM A;  5EPL A;  1HUM A;  2K05 A;  5CBE E;  1WD0 A;  2XIW A;  1DZ1 A;  1O80 A;  2B2W A;  4DN4 M;  2H1E A;  1U4L A;  2HDL A;  2K03 A;  2B2U A;  2HUG A;  4IUU A;  4ZKC B;  4OIJ A;  1ROD A;  1QG7 A;  2RA4 A;  4RAU C;  1WD1 A;  1HA6 A;  1MSH A;  4X3S A;  1SSO A;  1RTN A;  1X3Q A;  1G2S A;  1BO0 A;  2RSN A;  1PFN A;  2K28 A;  1IKL A;  2IL8 A;  1RJT A;  3IL8 A;  1ICW A;  4HAE A;  4ZKB B;  5T1G A;  1WVL A;  1DOL A;  1EOT A;  1WTR A;  1PLF A;  3DEO A;  2JYO A;  4MN3 A;  1WTQ A;  1G2T A;  5COR A;  1WTV A;  1AP0 A;  4IUT A;  4ZLT F;  2FFK B;  3MTS A;  4NW2 A;  3I91 A;  2J7Z A;  4ZAI A;  3Q6S A;  1ML0 D;  1EQT A;  3H91 A;  5EPK A;  1WTO A;  1C8C A;  2K01 A;  2JP1 A;  5E4X A;  2KED A;  5EQ0 A;  2FMM A;  1WTP A;  1PFB A;  1XYI A;  1ILP A;  1MSG A;  1BBX C;  2B2V C;  1A15 A;  1NR2 A;  2RSO A;  4XT3 B;  2EOT A;  3D6W A;  3I90 A;  3KBX A;  2L12 A;  1HFG A;  1ZXT A;  1JE4 A;  1B53 A;  1DOK A;  2HDM A;  1F9Q A;  1U4R A;  1VMP A;  1XX8 A;  2FHT A;  3F2U A;  1BNZ A;  1NR4 A;  5JJZ A;  3R93 A;  1EIH A;  2KUM A;  3IFD A;  4O42 A;  1O7Z A;  2MGS A;  4HCS A;  5T1I A;  1J9O A;  1ILQ A;  5DNF A;  1S4Z A;  4QUC A;  2MPM A;  5EPJ A;  1HRJ A;  1TVX A;  2KOL A;  4CJ0 B;  2BDN A;  1BF4 A;  2N55 A;  3TN2 A;  1EIG A;  3N52 A;  2FJ2 A;  5COY A;  1DOM A;  2N88 A;  3SVM A;  2KVM A;  2NWG A;  1DON A;  2DY7 A;  1U4P A;  3GV3 A;  1X32 A;  4X3T A;  3G7L A;  2K1B A;  1Q3L A;  3I3C A;  1HUN A;  2X6L A;  5AFW A;  1M8A A;  1NCV A;  1O7Y A;  2HCC A;  3DM1 A;  2SDF A;  3KUP A;  1NAP A;  5CMD A;  2B2T C;  1AZQ A;  2B2Y C;  2DY8 A;  2MP1 A;  1J8I A;  4XDX A;  2D9U A;  1X3P A;  2Q8T A;  1G91 A;  4UAI A;  1B4O A;  4OIK A;  4RWS C;  4U68 A;  3DEP A;  3LWE A;  2NYZ D;  2M2L A;  2B2U C;  2L9H A;  2R3Z A;  4LMQ D;  2L11 A;  1KNE A;  2EPB A;  2L1B A;  2L4N A;  1LV9 A;  1CM9 A;  2VXW A;  4ZK9 B;  1AZP A;  3QO2 A;  1MGS A;  3MWY W;  2B2V A;  1GUW A;  2B2T A;  5EJW A;  1WTW A;  2MJ8 A;  2RVL A;  5D65 A;  1B3A A;  3ONA B;  4CJ1 B;  3TZD A;  1U4M A;  1SDF A;  1F9P A;  1QE6 A;  1HHV A;  3HP3 A;  4IUR A;  1KNA A;  4IUV A;  3UI2 A;  1F9S A;  4R8I A;  4X3U A;  4XT1 B;  1JIC A;  2HCI A; 
#chains in the Genus database with same CATH topology
 3ULL A;  5D14 A;  4POF A;  2Z4H A;  4GKJ Q;  3T1H L;  2L55 A;  5IP7 G;  1D5Z C;  1JJ2 A;  3S1Q H;  1HPC A;  2LXJ A;  2BA0 A;  4RCN A;  5EKI A;  4JI0 Q;  1E0B A;  4I7A A;  4LW1 A;  4BY7 B;  3CC2 A;  4NPS A;  5J1Z A;  5IWA Q;  2JA7 H;  1B2T A;  5KND A;  1HTP A;  1VQC A;  2B2Y A;  4X66 Q;  2ASB A;  1F9R A;  4DV4 L;  2NN6 I;  3HOZ G;  3PF5 A;  2YTV A;  1O80 A;  2CW0 C;  3GTO H;  2N8N A;  2H1E A;  2UUB L;  3ERQ A;  3BG3 A;  1YNJ C;  1K8A C;  4KKS A;  1DD2 A;  2DGY A;  5JJK A;  4KY7 A;  3S1Q B;  2DN8 A;  3WOF A;  3HOX G;  3D31 A;  2IL8 A;  1WVL A;  2MQH A;  2JA7 B;  1C48 A;  2EXD A;  2KEN A;  4JI8 Q;  1G2T A;  2XSC A;  2EIF A;  2CCZ A;  2ZTC A;  3UE1 A;  4EX5 A;  1QJO A;  1KAB A;  3CCL A;  4AYB B;  1FVI A;  2PO4 A;  4HN7 A;  1MSG A;  2Z9H A;  3CPF A;  3NTI A;  1LT4 D;  4HR7 B;  4A3M G;  1PXU A;  4HCE A;  4R4Q A;  3X3N A;  5HGT A;  4IN3 A;  4ABN A;  1XX8 A;  2NVQ H;  1VQL A;  5FO7 B;  4C3J H;  3R93 A;  1ZYR D;  1TS2 A;  4O42 A;  3Q23 A;  4KN4 C;  5FOB B;  1STA A;  4A75 A;  3FMC A;  5EPJ A;  5DAU A;  3T1H Q;  1BF4 A;  1C4Q A;  2FJ2 A;  2KQ3 A;  4FVM A;  5COY A;  1IW7 D;  1O7L A;  4XYQ A;  2NVQ B;  4DV5 L;  1NAP A;  4NXM L;  1UE6 A;  4C3J B;  1Y1V G;  4DUZ L;  5EKK A;  4DR7 Q;  1G91 A;  2WAQ B;  5C44 H;  2CQO A;  2UUB Q;  1S5F D;  1JMC A;  1LM0 A;  1V9P A;  4LMQ D;  2VXW A;  3EQL C;  3QIA A;  4LWC A;  4ID6 A;  1K3B C;  1AZP A;  4XYO A;  4IPD A;  3BYY B;  5EKL A;  3I4M G;  3J7A 5;  4A3C G;  4JI1 L;  1E2V A;  5C4Z A;  2MJ8 A;  4LF8 L;  1A3U A;  4QF4 A;  2K4K A;  2KA7 A;  3CCE A;  1F9P A;  4P72 A;  5IOD A;  1OXT A;  4IUR A;  1NTG A;  1EEI D;  1I4R A;  2F03 A;  4PMC A;  3J80 L;  5C44 B;  3I70 A;  1F2Z A;  3ERO A;  3KYH C;  1EOV A;  5D3I B;  3GV6 A;  4Q5V A;  3GTP H;  5IY0 A;  2VY3 A;  2WKC A;  3P7J A;  1PDQ A;  4FXD A;  1H9S B;  2Y0S B;  4H7B A;  2K14 A;  4GN5 A;  2XGT A;  1E24 A;  1HZ9 A;  4FXG C;  1IBK L;  3BVG A;  3H0G G;  1HUM A;  2IHE A;  2R7Z G;  3G6E A;  5FLM G;  1Z47 A;  2VUM G;  3I4N H;  3EFX D;  2O4X A;  5CV9 A;  4AH6 A;  2RBM A;  5LL6 S;  1X56 A;  2B63 G;  1X3Q A;  5IGC A;  1UEA B;  1G8Z D;  2K6A A;  1PH7 A;  2Z6K A;  2K28 A;  2GVA A;  1IKL A;  1RJT A;  1WOC A;  5IYC H;  5C4X G;  1EOT A;  4DV5 Q;  3OSO A;  1VCI A;  4DUZ Q;  1Q1B A;  3PQI A;  3MVV A;  1I4P A;  1KDA A;  1YJ9 A;  2K5D A;  2G5D A;  4M1U B;  5LL6 X;  3I4N B;  3DWQ A;  2A68 D;  4JV5 L;  1C8C A;  1AEX A;  2F1M A;  1BBX C;  4YHH Q;  3Q24 A;  3VA5 A;  5C0X G;  2RQX A;  3FPP A;  3BDL A;  4ME5 A;  2HDM A;  4DAY A;  4R4O A;  2FHT A;  4DK0 A;  1EFW A;  2L5T A;  3DUZ A;  3WOE A;  1LLR D;  1SXT A;  2AUJ D;  4LF9 Q;  1K73 C;  3ICE A;  1E1T A;  3E5S A;  3KF8 B;  4A3D G;  2N55 A;  1VDZ A;  5IT9 E;  4KHP L;  2WV6 D;  3M7N A;  5LHY 1;  3E0E A;  1IXR A;  5IYB H;  2PQE A;  1NCV A;  5CV4 A;  3CXC A;  4K6L A;  1AZQ A;  4WFN 3;  3WDN A;  1VQ5 A;  2A6E D;  3I7F A;  3PSI A;  4U67 3;  2Q2U A;  4LF5 L;  4NP5 A;  1DJR D;  2ZT9 C;  4H02 A;  1GHJ A;  1LT5 D;  3HOW G;  3T56 B;  1PH3 A;  1PTO C;  3STB C;  5M3F H;  4HMI A;  2G9D A;  4EVO A;  4HJ8 A;  4G7Z C;  4CKB A;  4B3S L;  1X3G A;  3R8B A;  3AYH B;  1QZH A;  3OOC A;  5JEA H;  3HP3 A;  3RMH A;  2JA9 A;  3T51 B;  5JPN C;  4DR5 L;  4JV5 Q;  3CQZ B;  1WFQ A;  2K52 A;  3F2C A;  2KEC A;  1BDO A;  1V1P A;  3V05 A;  1BR9 A;  1VQG A;  4YWM A;  5M3F B;  3S15 H;  1SAP A;  2OF1 A;  4TRD A;  1LO5 D;  3BDC A;  4DPG A;  3AEV A;  1CKO A;  2CVR A;  3S1R H;  2X6G A;  5CV7 A;  3SGI A;  3D0F A;  1WI5 A;  5ELO A;  2A8V A;  5JEA J;  1ZYR C;  3K57 A;  1DZ1 A;  1U9R A;  4BA2 I;  1LAB A;  3NE5 B;  1CZW A;  2HUG A;  5FJ8 H;  3CPW A;  1ROD A;  1WCM H;  2LY7 A;  3EBE A;  1PFN A;  5HGQ A;  3S15 B;  1PTO H;  2XTI A;  3VDY A;  3K7U C;  3RZO H;  3K5L A;  3L3O C;  4BBR H;  1LYL A;  2N49 A;  3S1R B;  1TWH H;  4B3T L;  3A0J A;  3PIO A;  2PI2 A;  3MTS A;  3CCM A;  4V19 0;  3J81 L;  3KF6 B;  1BQQ T;  2F0S A;  3D6C A;  1OTC A;  1NSN S;  2GA4 B;  4XQN A;  3M4O H;  1ILP A;  1OXV A;  1HZA A;  1G6P A;  2F0L A;  4TQU S;  3LGJ A;  2CFM A;  1A15 A;  1PTO B;  2K50 A;  2EOT A;  4QL5 A;  1CQV A;  3RZO B;  1SYE A;  4BBR B;  4DNI A;  1UE5 A;  1TWH B;  1HCZ A;  4FO2 A;  3L7Z C;  4C3H G;  4KY5 A;  4B3R Q;  3AFP A;  4P75 A;  5J22 A;  1WYD A;  3S2D H;  4JCV E;  2RHQ B;  2MGS A;  5T1I A;  5M5W H;  5J39 A;  1M90 C;  5CR3 A;  3ITP A;  3M4O B;  4JI6 L;  3S9W A;  2PNH A;  2Z4I A;  1VQJ A;  1GOZ A;  1IYJ B;  1U4P A;  1D7Q A;  4DGZ A;  1BUV T;  3T16 A;  3OTO Q;  4A76 A;  2E2H H;  2D62 A;  2UXC Q;  4GLV B;  1YBY A;  5IYD H;  3PF4 A;  4LF4 Q;  3GTG H;  3S2D B;  1K28 A;  2KJX A;  5M5W B;  1JB3 A;  2F0M A;  4NDX A;  2NVX H;  2K5H A;  1ZKO A;  3DEP A;  3GTJ H;  1N8R C;  4JYA L;  4MTN A;  4ZK9 B;  2EZV A;  2NZH A;  4A3F H;  2B2T A;  2RF4 A;  2VB2 X;  2E2H B;  4B3T Q;  1TII D;  1L1O B;  3I2Z A;  4AYB E;  4A4I A;  3GTG B;  2BE5 D;  3GD7 A;  1FGB D;  4UPA A;  3PO2 H;  2NVX B;  1F2M A;  3GTJ B;  1JIC A;  1KL9 A;  3F2B A;  1WTX A;  4RA8 A;  1MI2 A;  4B08 A;  1FL0 A;  1CA5 A;  2EVB A;  3OMC A;  3GO5 A;  4A3E G;  1K83 H;  4A3F B;  1NY4 A;  3G6J B;  1LUZ A;  2F0O A;  3GP7 A;  1B70 B;  1KDC A;  4AQY L;  1CUK A;  3F1Z A;  4RKL A;  1EYG A;  4OL7 A;  5M5Y H;  3KLR A;  2CKZ B;  1RKN A;  3PO2 B;  5D3D A;  1PZJ D;  4FF4 A;  2PZU A;  1HA6 A;  3RUZ A;  3VR4 A;  5C3W A;  1K83 B;  1SNM A;  2EYH A;  5LMU L;  2N3S A;  3ULJ A;  3T1Y Q;  5M5Y B;  5IT9 c;  2A6E C;  1ICF B;  4A3K G;  4PNY A;  4A3J G;  3PV0 A;  4DR4 L;  4JYA Q;  3GTQ H;  3NQI A;  3A5U A;  2ZJQ A;  4LAA A;  4KD3 A;  3V2T A;  5AJ3 L;  1VF7 A;  4LF6 L;  4A3G H;  3RZD H;  2UUA L;  2VW9 A;  2UXB L;  4XQJ A;  3HS0 C;  3GTQ B;  1SNP A;  3BVM A;  1TVX A;  2BDN A;  4DFA A;  3NHH A;  1CSQ A;  1DOM A;  1DON A;  3MXN A;  2AWN A;  4IPC A;  3HOY G;  1I5F A;  3E3X A;  5TSS A;  4DV2 Q;  1GVP A;  1Y14 B;  2SNM A;  3FKI G;  4JOI A;  4A3G B;  4X6A H;  3RZD B;  1L0Y B;  1IBL L;  1B4O A;  1SMY D;  1GD7 A;  2A6H C;  4K8J A;  1MIU A;  2R93 G;  2JA5 H;  2R3Z A;  2F3I A;  3MXP A;  1LV9 A;  1TR5 A;  1JWU D;  5I6W A;  2EY6 A;  5LMU Q;  5NUC A;  3J7A F;  1GUW A;  4JBJ A;  1VQN A;  3IRB A;  1UEB A;  1D2B A;  4OEL B;  3JAM E;  2JSO A;  1PYB A;  1T5E A;  1LTL A;  4HSP A;  1AN8 A;  2IPK D;  1SBB B;  2HIX A;  2NTT A;  2JA5 B;  2AUK A;  5K5P A;  3LWU A;  1C9O A;  1SNQ A;  2F0D A;  4X65 Q;  2WB1 E;  4FDB A;  5AJ3 Q;  2PW5 A;  4A3L G;  1EZ8 A;  1HFN A;  4LF6 Q;  1UWV A;  5ELF A;  2EE1 A;  1UE7 A;  3FDT A;  1NJI C;  4DNR B;  2UUA Q;  1D1K A;  1I4Q A;  2K05 A;  3PUZ A;  3K0X A;  4GS3 A;  3OIP A;  3KK7 A;  1S5D D;  4PMW A;  1MSH A;  3IL8 A;  4GNX B;  3K58 A;  4BY7 G;  1VQH A;  2QKI C;  4TKO B;  1WTV A;  2ALY B;  1EY4 A;  4H13 C;  5HY6 A;  2FFK B;  3L9A X;  2R92 G;  4RHR A;  1BCP F;  1EUJ A;  3HFZ B;  1TS5 A;  1EU4 A;  3I4O A;  4WJW A;  4OO1 G;  4C3I B;  1VQ9 A;  5JAV A;  1VQF A;  4FP5 D;  3OYY A;  1F9Q A;  1V1Q A;  2JA7 G;  1HJP A;  1S3O A;  1K0R A;  4HTH A;  2K5Q A;  1O7Z A;  2CWP A;  4A3I B;  1K8M A;  2PZT A;  1STB A;  4AYB G;  5M3M H;  4DV7 Q;  1TKW B;  2K75 A;  2SEB D;  3BZD B;  4R1J A;  3A7L A;  3FRP B;  2K1B A;  3U9S A;  4B3M Q;  1P16 A;  1HUN A;  2X6L A;  5AFW A;  1M8A A;  4CDD C;  4CDE C;  2B2Y C;  1W3S A;  1GUN A;  4DKA C;  4KI0 A;  1BCP D;  2D0P A;  2K5N A;  1EU3 A;  2JA6 H;  3K5N A;  2F0V A;  1KNE A;  5M3M B;  3MHB A;  1HNW L;  1I94 Q;  3MEF A;  1WTH A;  1PVO A;  2ENB A;  2B39 A;  5E3F A;  2E2J H;  3EN2 A;  1SN8 A;  1B3A A;  4DR6 L;  1JJC B;  2CH4 A;  1BVS A;  3TRE A;  1HNX L;  4LFB L;  5I9P A;  2VZA A;  2I5L X;  4IUN A;  1XMQ Q;  1B50 A;  3CCQ A;  1QNK A;  1SMX A;  3CCR A;  1K8G A;  4UHV A;  5CBA E;  5M5X B;  2E2J B;  2NVT B;  2NN6 H;  2WP8 J;  2KEE A;  2RCF A;  4IZ8 A;  4RKB A;  5E4W C;  4KMU C;  2FIN B;  5GQO A;  3I72 A;  2PYK A;  3HOV G;  1F77 A;  2ZTE A;  1V1O A;  3RR5 A;  3O13 A;  1VQP A;  5K36 H;  2B2W A;  5CV5 A;  1KAW A;  4DK6 C;  1JR0 D;  5LMN W;  3GDE A;  4KK7 A;  3DLL A;  3A55 A;  2K7V A;  3PO3 H;  4MZ9 A;  5FK9 C;  4IFD I;  5FO8 B;  1CKN B;  1KAA A;  3NQT A;  1HH2 P;  1PRT F;  3ZYY X;  2VQE L;  1NUC A;  2JA8 G;  3K81 C;  4LUO A;  4JI7 Q;  2NB0 A;  1NMF A;  2EDG A;  4JI4 L;  4JI3 L;  4WOR A;  2B29 A;  3S1N B;  3OWF A;  2EJF C;  3NSW A;  2VQF L;  5ELB A;  1SYB A;  3PUV A;  3D6W A;  4OWT B;  3PO3 B;  4YCW A;  1G51 A;  3NBH A;  3OMG A;  1TXY A;  3E0J A;  4BY1 H;  2RDF A;  1CFM A;  1SFO H;  2HT1 A;  2PMZ E;  3JAM c;  2BA1 A;  4B9W A;  1EFI D;  1OXS C;  1O7I A;  5GRO A;  3BDO A;  3SVM A;  1E22 A;  2DY7 A;  1PRT D;  2NVY H;  5IYC G;  4K5X A;  5KNC A;  2SDF A;  3OW2 A;  4BY1 B;  1V43 A;  1G29 1;  4JVZ A;  1SFO B;  2WB1 G;  5C6A A;  4U68 A;  1SYC A;  3J80 i;  2WII B;  3BZC A;  2DJF C;  2E8G A;  2Z6K C;  4Q0F A;  5IGB A;  2NVY B;  3H15 A;  4OX9 L;  1CHQ D;  3L0O A;  4V0B A;  1U0L A;  2IX1 A;  3MEH A;  2VQE Q;  4GLX A;  1I6H B;  4HJ5 A;  4DV1 L;  1L2F A;  2G9H D;  4JI3 Q;  4X3U A;  2A69 C;  4DV4 Q;  1N36 L;  5FLX L;  4QIW B;  2VQF Q;  1JB7 A;  3MXU A;  2FXQ A;  3KFU A;  2UUC L;  1SRO A;  2XRS D;  5I9O A;  4CJ2 C;  1IL8 A;  5JJL A;  3NEL A;  3K0Y A;  1PMR A;  1EY5 A;  1FGU A;  3TSS A;  5EPL A;  3K59 A;  2XVS A;  1WD0 A;  4OWX B;  1N33 L;  4ZUJ A;  2QF7 A;  2K03 A;  2B2U A;  1QG7 A;  4N9T A;  1G2S A;  2M9V A;  3G48 A;  1XWE A;  3W1G A;  5IGE A;  2RSN A;  2IX0 A;  1S72 A;  1KRT A;  5M3F G;  2DNE A;  1YJN A;  4JBW A;  1LTB D;  2JYO A;  1E7Z A;  2A19 A;  1SRU A;  1UUP A;  4K5W A;  5JEA G;  1KLU D;  4CBV A;  5IP7 H;  3ER0 A;  4GOP C;  4YWK A;  1VQ7 A;  3Q6S A;  4GLA C;  5HUR A;  3N6R A;  2JP1 A;  4OGQ C;  2FMM A;  2YTY A;  3HKS A;  1ZEQ X;  4GN4 B;  2RSO A;  5A2Q E;  4EGV A;  1JE4 A;  1LTG D;  4MNO A;  1VMP A;  3K5M A;  4DV1 Q;  1BNZ A;  2K5W A;  4DUY L;  1Y8O B;  5JJZ A;  3GTL H;  3D4W A;  4NXM Q;  3HOX H;  1N36 Q;  1VQI A;  3K80 C;  1CHP D;  1H9J A;  2KOL A;  3A54 A;  5I2X A;  1KD1 C;  5FJ8 G;  1H9S A;  1A8V A;  1WCM G;  3CF5 A;  3M9B A;  3N52 A;  1HNZ L;  2PCF B;  2A1A A;  4JI2 L;  2ES2 A;  5KYL A;  2K32 A;  1J5E L;  4JI1 Q;  1KDB A;  4PV1 C;  4BBR G;  4LF8 Q;  2VL6 A;  4C56 C;  2V4D A;  3GTL B;  2QDB A;  4JBK A;  2D9U A;  3HOX B;  3KJP A;  4A3M H;  2BH8 A;  1VQE A;  2XNA C;  2ZXR A;  2E2I H;  1XNR L;  3TP7 A;  3K5O A;  1K8O A;  1I4X A;  5C3E H;  3EIV A;  5EJW A;  5A35 A;  1KQS A;  3S17 H;  1A63 A;  1IZ6 A;  4RGT A;  4KLK A;  4RHS A;  4GKK L;  3VR5 A;  1F9S A;  4GOP B;  1IBK Q;  4A3M B;  2F0J A;  2IW3 A;  1XPR A;  3OWE B;  2E2I B;  5KNB A;  3I4L A;  4P73 A;  5C3E B;  1H9M A;  1AW7 A;  2A5H A;  2JEB I;  3AQQ A;  3HOU G;  4OXP A;  3CQZ H;  3S17 B;  1SYF A;  1Y1V H;  4L5T A;  2C5C A;  3FP9 A;  2OQK A;  4IJL A;  2QW7 A;  4QMG A;  4WRD A;  2O5J C;  1ASY A;  3HEJ A;  3KF8 A;  3I4M H;  2KBN A;  1PH2 A;  2KCC A;  4MTK A;  1SJE D;  3PIP A;  4ZKC B;  4IUU A;  2BCO A;  3J81 i;  3PUW A;  1HNZ Q;  1XTD A;  2F0G A;  2OQ0 A;  3CCS A;  1Y1V B;  4A3F G;  2VB3 X;  2OTL A;  1J5E Q;  4CGY B;  2PNR C;  5C5L A;  1B1Z A;  4L5S A;  1Y1W G;  4OWW B;  3NEN A;  2EJG C;  4ZLT F;  5ELE A;  5GAG C;  3I4M B;  3CC7 A;  4PMB A;  2J7Z A;  1EQV A;  3NP8 A;  4IPH A;  1XYI A;  3SK8 A;  3SXH A;  3PIO 3;  1JE5 A;  2ZXO A;  5IGG A;  2R7Z H;  1EY0 A;  2A73 B;  1E1O A;  4KHP Q;  2VUM H;  2XN9 C;  4IAL A;  4OEM B;  4HJA A;  3U4V A;  1YIJ A;  1IW7 C;  3RNU A;  2B63 H;  4CKE A;  1DCZ A;  4KJO A;  1R4Q B;  3AU7 A;  1EY6 A;  3JC6 6;  1STY A;  5IGD A;  3KDF B;  3QR8 A;  1EYA A;  2JK8 A;  4LF5 Q;  4K14 A;  3RN5 A;  3F8T A;  1TT2 A;  3A8J E;  2F0I A;  3H0G B;  2Z0S A;  2R7Z B;  2CWA A;  1X65 A;  2UU9 L;  2VUM B;  4XQQ A;  3KUP A;  3DM1 A;  5ELN A;  2PZW A;  2MFI A;  1JOK A;  1YHB A;  4O1N A;  4BXX G;  4JK1 C;  1QWY A;  4B3S Q;  2B63 B;  1KRS A;  3X3M A;  3R3O A;  4FF3 A;  1XTC D;  4DR5 Q;  1CM9 A;  3CCU A;  2K33 A;  4DV3 L;  1BBU A;  1E2Z A;  5IT9 L;  4DXG A;  1KHI A;  5D65 A;  2KHJ A;  1CKM A;  3C3L A;  3NTH A;  3AB9 A;  3HG9 A;  1CZG A;  3D4D A;  3KF6 A;  4G57 A;  4QJF A;  2R61 A;  4A3G G;  4F8M A;  3TBI B;  3GTK H;  3TP5 A;  4YIJ A;  2HHH L;  3D8G A;  1PHJ A;  1XMO L;  4JI5 L;  2B8G A;  3CHB D;  3A56 A;  3K8A A;  1X3F A;  4QUF A;  2MHV A;  3D3R A;  2F0Q A;  5KGU A;  2X69 A;  4IUP A;  4KKT A;  3DWP A;  3CME A;  5C0X I;  1HTL D;  1JC7 A;  1CQF A;  1PFM A;  4UDU C;  1VF5 C;  2IHF A;  3GTK B;  3IFT A;  3ND9 A;  4JBM A;  2OXP A;  4DN4 M;  2N78 A;  4RAU C;  2IWH A;  3NK9 A;  1TS3 A;  4X3S A;  1STE A;  4WJ3 M;  4BS9 A;  2A68 C;  4RFB A;  2VNU D;  4N8X 1;  3DEO A;  3DXJ C;  4LK1 C;  2F0K A;  4KKU A;  3M85 A;  4JOI C;  5I2Y A;  3KLW A;  1Q46 A;  3CW2 C;  4DK1 A;  1GHK A;  2DNC A;  2V1C C;  1WTO A;  3IKJ A;  4ME3 A;  4NB3 A;  1PFB A;  1Z6H A;  2JJQ A;  4JI6 Q;  1C0A A;  1L1O A;  1VQB A;  1ZXT A;  1B53 A;  1DOK A;  3TZU A;  5BR8 L;  1I6V C;  4QIW E;  2XWJ B;  1BXT A;  1EY9 A;  1LAC A;  4XIG S;  2WAQ E;  3U58 A;  5IGF A;  1EQR A;  4DAM A;  4UP7 A;  3VYT A;  3U9O A;  1XNQ L;  4X62 L;  4C2M H;  3G7L A;  3QWN A;  4FXK C;  3FHW A;  2HCC A;  1EWI A;  4IJH A;  2H4O A;  2AQ3 B;  1FNW A;  5LMN L;  3Q8D A;  2EYP A;  2L4N A;  1XJV A;  1GM5 A;  3E6Z X;  3QOJ A;  5KYI A;  2Y0S E;  4C3H H;  1WTW A;  1EWC A;  4C2M B;  3P20 A;  5GAD C;  3I55 A;  1YVC A;  3A8K E;  4DAV A;  4AQY Q;  3EA6 A;  2LMC B;  5IP9 H;  1MJC A;  3TEH B;  4O2D A;  4QGU A;  5CC4 A;  5J3B A;  1VMC A;  1SEB D;  4C3H B;  1I4H A;  2NZ1 D;  4R4T A;  2EXZ A;  5BR8 Q;  3J81 j;  3FPU B;  4DV0 L;  2Q8R E;  4N8F A;  1QUQ B;  4BBS G;  4MHE A;  3TRZ A;  3M7G A;  4EQ5 A;  1Q7Y C;  4LFA L;  1X55 A;  2ZXP A;  2LXK A;  1WD1 A;  2JA6 G;  4DR4 Q;  3KLS X;  4J1M A;  2ZM6 L;  3VA7 A;  4ZKB B;  1ICW A;  4HAE A;  4E6I A;  1V8Q A;  2F0N A;  5FKA C;  2CW0 D;  2JN4 A;  2PQA A;  2C35 B;  2KCT A;  2OCE A;  3VYS A;  4OHJ A;  5LMN Q;  1F2Y A;  4NW2 A;  1GXD C;  4JW0 A;  4DR3 L;  2A74 C;  5EBC A;  4DR2 L;  1SE2 A;  3CMA A;  1EQT A;  2UXB Q;  1KLG D;  3AMU A;  1PH1 A;  3LNN A;  1STG A;  1LT6 D;  1K0S A;  1NR2 A;  3RD4 A;  4J6H A;  3M4Y A;  5G3L F;  1QVC A;  2L12 A;  3BYT B;  2NN6 G;  4RCO A;  4H0L C;  1CT1 D;  3F2U A;  4C3I H;  3SHL A;  1Q81 C;  4B9X A;  4A3E B;  1MJE A;  3NEM A;  2AMC B;  5DNF A;  2IT1 A;  3MZ5 A;  4QUC A;  1IBL Q;  1TWA H;  4K6D A;  4CJ0 B;  1N34 L;  1GUO A;  4A3I H;  2KVM A;  4TVA B;  1X32 A;  4PQX A;  2Z1C A;  3K7A H;  1O7Y A;  1YHA A;  1R9T H;  1STH A;  2EYL A;  4XDX A;  1TU2 B;  1FR3 A;  4KN7 C;  1TWA B;  2NTS A;  2CH4 W;  3TME A;  5JVG 3;  3MAQ A;  2BE5 C;  2ZM6 Q;  2EQS A;  4GNX A;  2NUC A;  5G3L D;  3DHQ A;  3QO2 A;  5IOC A;  5EAY A;  1JT8 A;  1JWS D;  1X9N A;  1U5K A;  4F7X A;  1CI3 M;  1HR0 W;  2Z6B A;  1A3T A;  1JOQ A;  4A3J B;  1IYV A;  3ONA B;  1IHZ A;  3K7A B;  3KLS A;  4DR1 L;  1R9T B;  5E1F A;  4I65 A;  4NXN L;  2YTX A;  4X3K A;  1FD7 D;  4R9W A;  3G71 A;  4I7Z C;  3J7A V;  2D0O A;  2J4X A;  1ESR A;  1G6Z A;  3TP6 A;  3S14 B;  1IBM L;  1EL0 A;  3KOJ A;  4A3B H;  1F2L A;  3CKI B;  2Q8I B;  3JAM L;  3Q22 A;  5C4J H;  4ZCK A;  2WIN B;  1QNU A;  2R93 H;  4IUQ A;  5M5X H;  2NVT H;  5CBE E;  1JOR A;  1EYD A;  1KC8 C;  3J7Y W;  1N34 Q;  2F3V A;  3C46 A;  4C3J G;  4OIJ A;  1LTI D;  1LTS D;  4IFD H;  4JI0 L;  4R4I A;  4P71 A;  4N9P A;  2WAQ G;  5IWA L;  1PH6 A;  1Y69 U;  4A3B B;  5C4J B;  1WTR A;  4X66 L;  1D6E C;  2R93 B;  5DM7 3;  1X54 A;  3BVZ A;  1AP0 A;  2BDO A;  3NWS A;  1ENA A;  2ZTD A;  3H91 A;  1RF2 D;  1PH9 A;  1EIY B;  1MBY A;  1Q86 C;  4A3L H;  4IFD J;  3H3V C;  1P8L A;  5C44 G;  1TY2 A;  2H5X A;  1JOO A;  3CRK C;  4DR1 Q;  1HZC A;  3S1N H;  3W5O A;  3OIQ A;  1PZK D;  2I0Q A;  1LT3 D;  2F0F A;  5DLQ E;  2Y0S G;  1T9H A;  3VR2 A;  4HCS A;  4HIO A;  1Q8I A;  1J9O A;  2EYO A;  4QY7 A;  4EQN A;  3L2P A;  1ASZ A;  3TQY A;  2YU9 H;  4NXN Q;  2MPM A;  3A8I E;  2B8F A;  2YYZ A;  4K8I A;  1QZG A;  1PTO F;  2L15 A;  4O0A A;  3CU7 A;  1IBM Q;  1SMY C;  2N88 A;  1WJJ A;  2EJM A;  1UAP A;  2ICI A;  3SK6 A;  1HNW Q;  2R92 H;  4HIM A;  4DR6 Q;  2JE6 I;  1W6J A;  4IQZ A;  1PYS B;  3UDF A;  3J80 E;  4OO1 H;  2YU9 B;  4A93 H;  2I07 B;  1HNX Q;  1E3P A;  4LFB Q;  1A62 A;  1H95 A;  2B2U C;  1KIX A;  2EPB A;  3CRL C;  4JPB W;  3TS0 A;  3H3V H;  1YIT A;  1I4G A;  3KBG A;  2B2V A;  3RLN A;  1CKN A;  2CQA A;  5CGK A;  5FO9 B;  1HQR D;  4HJ9 A;  1YHQ A;  3I4N G;  5BN4 A;  2LSS A;  1HZB A;  2R92 B;  4CJ1 B;  2DJG C;  4DR7 L;  4DAP A;  2R7D A;  3A5Z B;  1ONL A;  3A7A B;  3NXW A;  3Q0A A;  4L63 B;  1ENF A;  4A93 B;  1I6H H;  2BOS A;  1PTO D;  3H94 A;  3STB D;  1JQY D;  1PH5 A;  3VYR A;  4HED A;  4HMJ A;  4FYD A;  1FNU A;  1Y8N B;  3UDX A;  4DV6 L;  4OO1 I;  3MC0 B;  3GTO B;  2D2C C;  1EY7 A;  1Z7T A;  3U50 C;  1CTM A;  1FYC A;  2XIW A;  3H3V I;  1RL2 A;  3W1B A;  1VQ6 A;  2KCN A;  3PMF A;  4JI4 Q;  3TDQ A;  1GKH A;  5C3E G;  2WKD A;  1FNV A;  1SE3 A;  1VS0 A;  4YY3 L;  1B44 D;  1Y8P B;  1QB5 D;  3DM3 A;  3U4Z A;  5COR A;  4KTA A;  1E2W A;  1W6K A;  1XPU A;  1B9N A;  2XRQ D;  5IYB G;  1LTA D;  2K01 A;  3D4R A;  2KED A;  3QB3 A;  3HOV H;  3MFY A;  1AE3 A;  4QB4 A;  4XT3 B;  3ZJY C;  4KHV A;  1Q82 C;  1IYU A;  1U4R A;  4H44 C;  3URY A;  1D5X C;  2DUD A;  5CYU A;  3S16 H;  1TWG H;  1ILQ A;  3RLF A;  1HRJ A;  4YHH L;  1KTK A;  4MIU A;  2E75 C;  1VQO A;  3HOV B;  3LX0 A;  1BCP C;  3ULP A;  1XXG A;  4EQP A;  1ET9 A;  3KJO A;  2JA8 H;  4DV6 Q;  1A3V A;  1D1I A;  2RHS B;  1J6Q A;  4RMF A;  5M9O A;  2QIL A;  4OX9 Q;  5C3X A;  4AIM A;  3S16 B;  3HKZ B;  1VQK A;  4LF9 L;  1TWG B;  1OO9 B;  3HOZ H;  2L0C A;  4UAI A;  2QGQ A;  3CD6 A;  2D5D A;  2CHB D;  3GQB A;  3LWE A;  2M2L A;  1Q8K A;  1MGS A;  2LFN A;  3EVQ A;  2JA8 B;  2RDG A;  2OEO A;  3EJI A;  4KHZ A;  4YY3 Q;  2FMC A;  4EQO A;  4YCU A;  3R2I A;  3S24 A;  5GAE C;  5I6Y A;  1UNS A;  1B8A A;  2UUC Q;  1DYQ A;  1EQQ A;  2P5Z X;  4K5V A;  1HHV A;  4IO9 A;  2HQE A;  3H09 A;  3HOZ B;  4DAY B;  4R8I A;  2IX3 A;  2KHI A;  2Q2T A;  3GTP B;  4JG2 A;  4LF7 L;  1Q90 A;  1BKB A;  1IL2 A;  2NZO A;  4KY6 A;  1MHW C;  4POG A;  1N33 Q;  1PV4 A;  4BA1 I;  4UP9 A;  3G4S A;  1Z9F A;  1MD2 D;  3QJY A;  3I8Z A;  3PUX A;  2AHO B;  4G4K A;  1CA6 A;  3B6Y A;  4KJN A;  2XWB B;  2IY5 B;  2ICE C;  3J81 E;  4DF7 A;  1U4L A;  1N32 L;  1BCP B;  1SSO A;  5FLX c;  2AQ2 B;  1YNN D;  4M8A A;  1VQ8 A;  4G7H C;  3PIP 3;  3RN2 A;  2WB1 B;  2LKV A;  4APV A;  2WFW A;  3AFQ A;  1TWF H;  1VQA A;  5ELC A;  3IAY A;  2HIV A;  5DM6 3;  4DUY Q;  4QCL A;  1DGS A;  1JJG A;  4Z9C B;  5KEE A;  1SJH D;  5EPK A;  4FNF A;  5IYD G;  5E4X A;  1L0W A;  4ZRZ A;  2GVB A;  2OWO A;  3J80 c;  4A3C H;  4QQB X;  2MO0 A;  3I90 A;  1V1P B;  4JI2 Q;  3CC4 A;  4GOP A;  4CDC C;  3FVQ A;  1TWF B;  2AKW B;  3FEW X;  4LF7 Q;  1PRT C;  4WJ4 A;  1LTR D;  4ODG A;  2RCN A;  1PH8 A;  2C9O A;  2JXM B;  3TN2 A;  3PO2 G;  3VR3 A;  1XNR Q;  1CK1 A;  3PGZ A;  1M1K C;  1W2B A;  3P1H A;  5A2Q L;  3S1M H;  1A2T A;  4RH6 A;  1NMG A;  4P2C B;  4B3R L;  5CMD A;  3H0G H;  4K2K A;  2B2T C;  3OPO A;  3HRZ C;  2F0W A;  2LS0 1;  5FLM H;  4GKK Q;  4OIK A;  3MFG A;  4RWS C;  2ZJR A;  1N32 Q;  2L9H A;  3OHX C;  5C4H A;  4IOC A;  5JJI A;  3MWY W;  3OTO L;  1PA6 A;  1SYG A;  3S1M B;  5C4X H;  2UXC L;  2F0U A;  2A6H D;  4LF4 L;  1S5C D;  1SDF A;  3CCJ A;  1KNA A;  2HD3 A;  4IUV A;  1OXU A;  3BJU A;  2E2D C;  4XT1 B;  2MNA A;  1YJW A;  4DK3 C;  3NPP A;  4DXF A;  2MUY A;  1EWH A;  3BU2 A;  1A2U A;  5C0X H;  5C4X B;  1L1O C;  1IKM A;  4L6T B;  3P75 A;  4R4C A;  4HIK A;  2EYF A;  1WCM B;  1PRT B;  3KDF A;  3CCV A;  5EGT A;  4OON A;  4LFC L;  4IPG A;  5E7N A;  4A3D H;  4BWG B;  2RA4 A;  1RTN A;  2Q2H A;  4CDF C;  2F4V L;  3K6O A;  1PFS A;  5C0X J;  1PLF A;  1PH4 A;  3RLO A;  1CSP A;  1OXX K;  1WTQ A;  1QCB D;  4L5Q A;  1RDP D;  2EY5 A;  1HXY D;  4IUT A;  3VR6 A;  3HOU H;  2E5L L;  5IP9 G;  4ZAI A;  1ML0 D;  1KXL A;  4A3D B;  4TSS A;  5EQ0 A;  1HR0 L;  3HOW H;  3NTK A;  4J15 A;  3T13 A;  3T4A C;  2B3G A;  3KBX A;  4X64 L;  2JA5 G;  3GTM H;  3T1Y L;  1X3E A;  2KCM A;  4F87 A;  3MA2 B;  2UU9 Q;  2TMP A;  1EIH A;  2KUM A;  3HOU B;  2Z8L A;  1A0I A;  4LUV A;  5KRU A;  3PUY A;  3HZX A;  4K0K L;  4UY8 C;  1A6X A;  1GO3 E;  4FF2 A;  2JQO A;  1TY0 A;  1SR3 A;  1M4V A;  2O5I C;  3HOW B;  1Y1W H;  4RGM A;  1QIL A;  1S5E D;  4L8J A;  3C1F A;  3GTM B;  3GV3 A;  2MO1 A;  4X3T A;  1STN A;  3I3C A;  4DV3 Q;  2I5M X;  3F2D A;  4HID A;  2AWO A;  3C1E A;  1D8L A;  1TQO A;  2UXD L;  1SNC A;  1J8I A;  3W3A A;  4LFC Q;  3A74 A;  2ZJP A;  2F3W A;  3DWA A;  2PMZ B;  4S3S A;  2HHH Q;  4G7O C;  1Y1W B;  2F4V Q;  1XMO Q;  4JI5 Q;  4JC0 A;  3PCO B;  4DV2 L;  1YNN C;  3J81 c;  2F0E A;  4DNT B;  1AFP A;  3MXG A;  2M00 A;  5H1S E;  2PW7 A;  4C3I G;  1N9W A;  2E5L Q;  4IOA A;  5JOB A;  5KIX A;  3BS1 A;  1NE3 A;  1RCV D;  1HR0 Q;  1AH9 A;  1RIP A;  3NBI A;  4X64 Q;  3V96 A;  2K04 A;  1ET6 A;  4A3I G;  4BXX H;  1YI2 A;  2F0P A;  1SNO A;  1JWM D;  2GN5 A;  4KV6 A;  3MXN B;  3UDG A;  4ULL A;  4PG3 A;  2YV5 A;  3T53 B;  4GN3 B;  4K0K Q;  4Y52 H;  4L5R C;  1I50 H;  2HDL A;  1MKH A;  3DMU A;  4X65 L;  1BO0 A;  5ELD A;  3HKZ E;  4P74 A;  2QCP X;  3WWV A;  2R6G A;  1R4P B;  5T1G A;  2R7F A;  1Q1E A;  1DOL A;  4HJ7 A;  2UXD Q;  5M3M G;  3ND8 A;  4Y7N H;  4RGN A;  5BN3 A;  4ZYS A;  4ZQ3 A;  1I50 B;  3HGB A;  4XXE A;  3J7Z C;  3NWT A;  4NMZ A;  1SND A;  4GNX C;  3E9I A;  1BBW A;  2KHS A;  1EZ6 A;  1II3 A;  3BZK A;  1HFG A;  4A3B G;  4ILW A;  1XNQ Q;  2PQA B;  3SE0 A;  2RKS A;  5IIF A;  4X62 Q;  2QEX A;  4FF1 A;  4Y7N B;  1NR4 A;  3TP8 A;  4PZ6 A;  1FJG L;  1EY8 A;  1ENC A;  3QOL A;  3W2D A;  4DU9 A;  5CV6 A;  1NNX A;  1QOH A;  1YNJ D;  2QDL A;  2AQ1 B;  3E9H A;  4A3E H;  4IFD G;  2EY2 A;  1EIG A;  2SNS A;  1QUQ A;  4CHT B;  1L0X B;  2DY8 A;  3SDZ A;  1X3P A;  1SE8 A;  2O2L D;  4ZUI A;  4DV7 L;  1GJX A;  1SE4 A;  2PPB C;  2QA4 A;  5ISR A;  4UP8 A;  5K36 G;  1ESF A;  4B3M L;  1K3R A;  1NBW A;  2RVL A;  5L37 A;  3QG1 A;  3TZD A;  1U4M A;  3JAM i;  1VQ4 A;  5GAH C;  3UI2 A;  4A3K H;  3PO3 G;  3S2H H;  1PZI D;  4DV0 Q;  4A3J H;  1O78 A;  2EYJ A;  2I46 A;  4PZ8 A;  5C5M A;  2VS1 A;  5I4D A;  1I94 L;  1H9R A;  3VYU A;  1TS4 A;  2E76 C;  4HSV A;  2Q2I A;  4LFA Q;  2B2W C;  1QVF A;  4K2L A;  4RGO S;  1VQD A;  2A69 D;  1RHP A;  3C2P A;  3NUC A;  3M3Y H;  1FJG Q;  1EYC A;  1RTO A;  1SLJ A;  3S14 H;  4A3K B;  3S2H B;  3UE0 A;  4NKL A;  1XMQ L;  1K9M C;  2OT2 A;  1BOS A;  1UE1 A;  1TWC H;  1XPO A;  3SR1 A;  4A93 G;  2TSS A;  4ALP A;  2F0H A;  4DR3 Q;  1AE2 A;  3SK5 A;  1T5X D;  4BY1 G;  4DR2 Q;  1PYW D;  5F2D A;  3HOY H;  4KD4 A;  3M4P A;  1QVG A;  1SYD A;  2EYM A;  4F88 A;  1VQM A;  5IE8 A;  4MN3 A;  2F52 A;  5JVH 3;  3M3Y B;  3FKI H;  2PI2 E;  5EBD A;  2NBF A;  5BN5 A;  5JPM C;  1EIF A;  1TWC B;  3I91 A;  2ATW A;  1D5M C;  2HQL A;  2OTJ A;  1WTP A;  1B7Y B;  1X6O A;  4GKJ L;  2WAC A;  2B2V C;  4YWL A;  3HOY B;  4BBS H;  1YZ6 A;  3SEB A;  1HQM C;  1C7Y A;  4JI7 L;  1B3Q A;  2ID0 A;  3FKI B;  1S40 A;  3I73 A;  1I3Q H;  4RG1 A;  3CP0 A;  4LNQ A;  3IFD A;  2RDH A;  1S4Z A;  1LTT D;  1GUS A;  2J0T D;  4R8N A;  1Q12 A;  1YNX A;  1S5B D;  2F4I A;  3H6M A;  3OW7 A;  4BBS B;  2I5H A;  2NWG A;  5CV8 A;  3R2T A;  1Q3L A;  3CAM A;  2EY1 A;  1HA5 A;  1I3Q B;  2JA6 B;  2MP1 A;  4JI8 L;  1EEF D;  2QEJ C;  2Q8T A;  3TS2 A;  4LUZ A;  4PZ7 A;  5DEH A;  2F0T A;  2K5V A;  2NYZ D;  5FLX E;  2L11 A;  2L1B A;  1DXM A;  1GUG A;  2JEA I;  3UDI A;  2BH2 A;  4GZY C;  1RD9 D;  4YCV A;  3ERS X;  4C1N I;  3M4Q A;  2IJ0 A;  3SK4 A;  4DA2 A;  4BY7 H;  1DM0 B;  4LJZ C;  1GUT A;  4CKC A;  1H9K A;  4J8Q A;  1QE6 A;  4C1N K;  2E74 C;  3NBH B;  1B9M A;  1YEZ A;  2SOB A;  4XTC S;  3HKZ G;  1JCK B;  3I56 A;  2HCI A; 
#chains in the Genus database with same CATH homology
 5D14 A;  2Z4H A;  2L55 A;  1D5Z C;  1HPC A;  2BA0 A;  4RCN A;  5EKI A;  1E0B A;  4BY7 B;  5J1Z A;  1B2T A;  5KND A;  1HTP A;  2B2Y A;  1F9R A;  2NN6 I;  1O80 A;  2CW0 C;  2H1E A;  3ERQ A;  3BG3 A;  1YNJ C;  1DD2 A;  4KKS A;  4KY7 A;  3S1Q B;  2DN8 A;  3WOF A;  3D31 A;  2IL8 A;  1WVL A;  2JA7 B;  1C48 A;  1G2T A;  2XSC A;  1QJO A;  1KAB A;  4AYB B;  2PO4 A;  4HN7 A;  1MSG A;  4HR7 B;  3NTI A;  1LT4 D;  1PXU A;  4HCE A;  3X3N A;  5HGT A;  4IN3 A;  4ABN A;  1XX8 A;  5FO7 B;  3R93 A;  1ZYR D;  1TS2 A;  4O42 A;  3Q23 A;  4KN4 C;  5FOB B;  1STA A;  3FMC A;  5EPJ A;  5DAU A;  1BF4 A;  1C4Q A;  2FJ2 A;  2KQ3 A;  4FVM A;  5COY A;  1IW7 D;  1O7L A;  4XYQ A;  2NVQ B;  1NAP A;  4C3J B;  5EKK A;  1G91 A;  2WAQ B;  1S5F D;  4LMQ D;  2VXW A;  3EQL C;  3QIA A;  1AZP A;  4ID6 A;  4XYO A;  3BYY B;  5EKL A;  1E2V A;  5C4Z A;  2MJ8 A;  1A3U A;  4QF4 A;  2KA7 A;  1F9P A;  5IOD A;  1OXT A;  4IUR A;  2F03 A;  1EEI D;  1I4R A;  4PMC A;  3J80 L;  5C44 B;  3I70 A;  1F2Z A;  3ERO A;  5D3I B;  3GV6 A;  4Q5V A;  2WKC A;  3P7J A;  1PDQ A;  4FXD A;  1H9S B;  2Y0S B;  4H7B A;  4FXG C;  3BVG A;  1HUM A;  1Z47 A;  3EFX D;  2O4X A;  5CV9 A;  2RBM A;  5LL6 S;  1X3Q A;  5IGC A;  1UEA B;  1G8Z D;  2K6A A;  2K28 A;  1IKL A;  1RJT A;  1EOT A;  1VCI A;  3OSO A;  1Q1B A;  3MVV A;  1I4P A;  1KDA A;  2K5D A;  4M1U B;  5LL6 X;  3I4N B;  3DWQ A;  2A68 D;  1C8C A;  1AEX A;  2F1M A;  1BBX C;  3Q24 A;  3VA5 A;  5C0X G;  2RQX A;  3FPP A;  3BDL A;  4ME5 A;  2HDM A;  4DAY A;  2FHT A;  4DK0 A;  2L5T A;  3DUZ A;  3WOE A;  1LLR D;  1SXT A;  2AUJ D;  3E5S A;  2N55 A;  1VDZ A;  5IT9 E;  2WV6 D;  3M7N A;  5LHY 1;  2PQE A;  1NCV A;  5CV4 A;  1AZQ A;  4K6L A;  4WFN 3;  3WDN A;  2A6E D;  4U67 3;  4NP5 A;  1DJR D;  2ZT9 C;  1GHJ A;  1LT5 D;  3T56 B;  1PTO C;  4HMI A;  2G9D A;  4EVO A;  4G7Z C;  4CKB A;  3R8B A;  3OOC A;  5JEA H;  3HP3 A;  3RMH A;  3T51 B;  5JPN C;  3CQZ B;  2KEC A;  1BDO A;  1V1P A;  3V05 A;  1BR9 A;  5M3F B;  1SAP A;  2OF1 A;  4TRD A;  1LO5 D;  3BDC A;  2CVR A;  2X6G A;  5CV7 A;  5JEA J;  1ZYR C;  3K57 A;  1DZ1 A;  1U9R A;  4BA2 I;  1LAB A;  3NE5 B;  1CZW A;  2HUG A;  1ROD A;  2LY7 A;  1PFN A;  3S15 B;  1PTO H;  3K5L A;  3L3O C;  3S1R B;  3MTS A;  4V19 0;  3J81 L;  1BQQ T;  2F0S A;  3D6C A;  1NSN S;  2GA4 B;  4XQN A;  1ILP A;  1OXV A;  2F0L A;  4TQU S;  1A15 A;  1PTO B;  2EOT A;  1CQV A;  3RZO B;  1SYE A;  4BBR B;  1TWH B;  1HCZ A;  4FO2 A;  3L7Z C;  4C3H G;  4KY5 A;  5J22 A;  2MGS A;  5T1I A;  5J39 A;  5CR3 A;  3ITP A;  3M4O B;  3S9W A;  2Z4I A;  1GOZ A;  1U4P A;  4DGZ A;  1BUV T;  3T16 A;  2D62 A;  3S2D B;  2KJX A;  5M5W B;  1JB3 A;  2F0M A;  4NDX A;  1ZKO A;  3DEP A;  4ZK9 B;  2EZV A;  2B2T A;  2VB2 X;  2E2H B;  1TII D;  3GTG B;  2BE5 D;  3GD7 A;  1FGB D;  2NVX B;  1F2M A;  3GTJ B;  1JIC A;  1WTX A;  4RA8 A;  1MI2 A;  4B08 A;  1CA5 A;  2EVB A;  3OMC A;  3GO5 A;  4A3F B;  3G6J B;  2F0O A;  3GP7 A;  1KDC A;  4RKL A;  4OL7 A;  3KLR A;  1RKN A;  3PO2 B;  5D3D A;  1PZJ D;  4FF4 A;  2PZU A;  1HA6 A;  3RUZ A;  3VR4 A;  5C3W A;  1K83 B;  1SNM A;  2EYH A;  5M5Y B;  2A6E C;  4PNY A;  3PV0 A;  3NQI A;  4LAA A;  4KD3 A;  3V2T A;  1VF7 A;  4XQJ A;  3HS0 C;  3GTQ B;  1SNP A;  3BVM A;  1TVX A;  2BDN A;  4DFA A;  3NHH A;  1DOM A;  1DON A;  3MXN A;  2AWN A;  5TSS A;  2SNM A;  4A3G B;  3RZD B;  1L0Y B;  1B4O A;  1SMY D;  2A6H C;  4K8J A;  2R3Z A;  3MXP A;  1LV9 A;  1TR5 A;  1JWU D;  5I6W A;  2EY6 A;  5NUC A;  3J7A F;  1GUW A;  1D2B A;  3JAM E;  2JSO A;  1T5E A;  4HSP A;  1AN8 A;  2IPK D;  1SBB B;  2NTT A;  2JA5 B;  2AUK A;  5K5P A;  3LWU A;  1SNQ A;  2F0D A;  2PW5 A;  1EZ8 A;  1HFN A;  5ELF A;  2EE1 A;  3FDT A;  4DNR B;  1D1K A;  1I4Q A;  2K05 A;  3PUZ A;  3OIP A;  3KK7 A;  1S5D D;  4PMW A;  1MSH A;  3IL8 A;  3K58 A;  2QKI C;  4TKO B;  1WTV A;  1EY4 A;  4H13 C;  2FFK B;  3L9A X;  4RHR A;  1BCP F;  1TS5 A;  1EU4 A;  4WJW A;  4OO1 G;  4C3I B;  5JAV A;  4FP5 D;  1F9Q A;  4HTH A;  2K5Q A;  1O7Z A;  4A3I B;  1K8M A;  2PZT A;  1STB A;  1TKW B;  2SEB D;  3BZD B;  3A7L A;  3FRP B;  2K1B A;  3U9S A;  1HUN A;  2X6L A;  5AFW A;  1M8A A;  2B2Y C;  1GUN A;  4KI0 A;  1BCP D;  1EU3 A;  3K5N A;  2F0V A;  1KNE A;  5M3M B;  3MHB A;  2ENB A;  2B39 A;  5E3F A;  1B3A A;  5I9P A;  4IUN A;  1B50 A;  1QNK A;  5CBA E;  5M5X B;  2E2J B;  2NVT B;  2NN6 H;  2WP8 J;  2KEE A;  4IZ8 A;  4RKB A;  5E4W C;  4KMU C;  2FIN B;  3I72 A;  2PYK A;  1F77 A;  1V1O A;  3O13 A;  5K36 H;  2B2W A;  5CV5 A;  1JR0 D;  4KK7 A;  3A55 A;  2K7V A;  5FK9 C;  4IFD I;  5FO8 B;  1KAA A;  3NQT A;  1PRT F;  3ZYY X;  1NUC A;  2NB0 A;  2EDG A;  4WOR A;  3S1N B;  3OWF A;  2EJF C;  3NSW A;  5ELB A;  1SYB A;  3PUV A;  3D6W A;  3PO3 B;  3NBH A;  3OMG A;  3E0J A;  2RDF A;  1CFM A;  2BA1 A;  4B9W A;  1EFI D;  1OXS C;  3BDO A;  3SVM A;  2DY7 A;  1PRT D;  4K5X A;  5KNC A;  2SDF A;  4BY1 B;  1V43 A;  1G29 1;  1SFO B;  5C6A A;  4U68 A;  1SYC A;  2WII B;  4Q0F A;  5IGB A;  2NVY B;  1CHQ D;  4V0B A;  2IX1 A;  3MEH A;  1I6H B;  2G9H D;  4X3U A;  2A69 C;  5FLX L;  4QIW B;  3MXU A;  2XRS D;  5I9O A;  4CJ2 C;  1IL8 A;  3K0Y A;  1PMR A;  1EY5 A;  3TSS A;  5EPL A;  3K59 A;  2XVS A;  1WD0 A;  4ZUJ A;  2QF7 A;  2K03 A;  2B2U A;  1QG7 A;  4N9T A;  1G2S A;  2M9V A;  5IGE A;  1XWE A;  2RSN A;  2IX0 A;  2DNE A;  4JBW A;  1LTB D;  2JYO A;  4K5W A;  1UUP A;  5JEA G;  1KLU D;  4CBV A;  3Q6S A;  5HUR A;  3N6R A;  2JP1 A;  4OGQ C;  2FMM A;  1ZEQ X;  2RSO A;  5A2Q E;  4EGV A;  1JE4 A;  1LTG D;  1VMP A;  3K5M A;  1BNZ A;  2K5W A;  1Y8O B;  5JJZ A;  3D4W A;  5I2X A;  1CHP D;  1H9J A;  2KOL A;  3A54 A;  1H9S A;  3N52 A;  2PCF B;  5KYL A;  2K32 A;  1KDB A;  4PV1 C;  4C56 C;  2V4D A;  3GTL B;  2QDB A;  2D9U A;  3HOX B;  2XNA C;  2ZXR A;  3TP7 A;  3K5O A;  1K8O A;  1I4X A;  5EJW A;  5A35 A;  4RGT A;  4RHS A;  3VR5 A;  1F9S A;  4A3M B;  2F0J A;  2IW3 A;  3OWE B;  2E2I B;  5KNB A;  3I4L A;  5C3E B;  1H9M A;  1AW7 A;  2A5H A;  2JEB I;  3S17 B;  1SYF A;  2C5C A;  4QMG A;  4WRD A;  2O5J C;  3HEJ A;  3KF8 A;  2KCC A;  1SJE D;  4ZKC B;  4IUU A;  2BCO A;  3PUW A;  2F0G A;  1Y1V B;  2VB3 X;  4CGY B;  2PNR C;  5C5L A;  1B1Z A;  2EJG C;  4ZLT F;  5ELE A;  3I4M B;  4PMB A;  2J7Z A;  1EQV A;  3NP8 A;  1XYI A;  3SK8 A;  3SXH A;  3PIO 3;  2ZXO A;  5IGG A;  1EY0 A;  2A73 B;  2XN9 C;  4IAL A;  1IW7 C;  4CKE A;  1DCZ A;  4KJO A;  1R4Q B;  3AU7 A;  1EY6 A;  1STY A;  5IGD A;  1EYA A;  4K14 A;  1TT2 A;  3A8J E;  2F0I A;  3H0G B;  2R7Z B;  2VUM B;  4XQQ A;  3KUP A;  3DM1 A;  2PZW A;  1JOK A;  4O1N A;  4JK1 C;  1QWY A;  2B63 B;  3X3M A;  3R3O A;  4FF3 A;  1XTC D;  1CM9 A;  2K33 A;  1E2Z A;  5IT9 L;  4DXG A;  5D65 A;  3C3L A;  3NTH A;  3AB9 A;  3HG9 A;  1CZG A;  3D4D A;  4G57 A;  2R61 A;  4F8M A;  3TBI B;  3TP5 A;  4YIJ A;  3D8G A;  2B8G A;  3CHB D;  3A56 A;  4QUF A;  2MHV A;  3D3R A;  2F0Q A;  5KGU A;  2X69 A;  4IUP A;  4KKT A;  3DWP A;  5C0X I;  1HTL D;  1JC7 A;  1CQF A;  1PFM A;  4UDU C;  1VF5 C;  3GTK B;  3IFT A;  3ND9 A;  2OXP A;  4DN4 M;  4RAU C;  2IWH A;  3NK9 A;  1TS3 A;  4X3S A;  1STE A;  4BS9 A;  2A68 C;  4RFB A;  2VNU D;  3DEO A;  3DXJ C;  4LK1 C;  2F0K A;  4KKU A;  3M85 A;  5I2Y A;  4DK1 A;  1GHK A;  2DNC A;  1WTO A;  3IKJ A;  1PFB A;  1Z6H A;  1ZXT A;  1B53 A;  1DOK A;  3TZU A;  1I6V C;  2XWJ B;  1BXT A;  1EY9 A;  1LAC A;  4XIG S;  5IGF A;  3VYT A;  3U9O A;  3G7L A;  3QWN A;  4FXK C;  2HCC A;  2H4O A;  2AQ3 B;  1FNW A;  2EYP A;  2L4N A;  3E6Z X;  3QOJ A;  5KYI A;  1WTW A;  1EWC A;  4C2M B;  3P20 A;  3A8K E;  4DAV A;  3EA6 A;  2LMC B;  5CC4 A;  1VMC A;  1SEB D;  4C3H B;  1I4H A;  2NZ1 D;  2EXZ A;  3FPU B;  2Q8R E;  4MHE A;  3M7G A;  2ZXP A;  1WD1 A;  3KLS X;  4J1M A;  3VA7 A;  4ZKB B;  1ICW A;  4HAE A;  4E6I A;  1V8Q A;  2F0N A;  5FKA C;  2CW0 D;  3VYS A;  4OHJ A;  1F2Y A;  4NW2 A;  1GXD C;  2A74 C;  5EBC A;  1SE2 A;  1EQT A;  1KLG D;  3AMU A;  3LNN A;  1STG A;  1LT6 D;  1NR2 A;  3RD4 A;  4J6H A;  3M4Y A;  5G3L F;  2L12 A;  3BYT B;  2NN6 G;  4RCO A;  4H0L C;  1CT1 D;  3F2U A;  3SHL A;  4B9X A;  4A3E B;  5DNF A;  2IT1 A;  3MZ5 A;  4QUC A;  4K6D A;  4CJ0 B;  1GUO A;  2KVM A;  1X32 A;  4PQX A;  2Z1C A;  1O7Y A;  1STH A;  2EYL A;  4XDX A;  1TU2 B;  1FR3 A;  4KN7 C;  1TWA B;  2NTS A;  3TME A;  5JVG 3;  3MAQ A;  2BE5 C;  2NUC A;  5G3L D;  3DHQ A;  3QO2 A;  5IOC A;  1JWS D;  4F7X A;  1JOQ A;  1CI3 M;  1A3T A;  4A3J B;  1IYV A;  3ONA B;  1IHZ A;  3K7A B;  3KLS A;  1R9T B;  5E1F A;  4I65 A;  4X3K A;  1FD7 D;  4R9W A;  4I7Z C;  3J7A V;  2J4X A;  1ESR A;  1G6Z A;  3TP6 A;  3S14 B;  1EL0 A;  1F2L A;  3CKI B;  2Q8I B;  3JAM L;  3Q22 A;  2WIN B;  1QNU A;  4IUQ A;  5CBE E;  1JOR A;  1EYD A;  3J7Y W;  2F3V A;  3C46 A;  4C3J G;  4OIJ A;  1LTI D;  1LTS D;  4IFD H;  4N9P A;  4A3B B;  1Y69 U;  5C4J B;  1WTR A;  1D6E C;  2R93 B;  5DM7 3;  3BVZ A;  1AP0 A;  2BDO A;  3NWS A;  1ENA A;  3H91 A;  1RF2 D;  1MBY A;  4IFD J;  3H3V C;  1TY2 A;  1JOO A;  3CRK C;  3OIQ A;  1PZK D;  1LT3 D;  2F0F A;  3VR2 A;  4HCS A;  1Q8I A;  1J9O A;  2EYO A;  4EQN A;  2MPM A;  3A8I E;  2B8F A;  2YYZ A;  4K8I A;  1PTO F;  3CU7 A;  1SMY C;  2N88 A;  2EJM A;  1UAP A;  2ICI A;  3SK6 A;  2JE6 I;  1W6J A;  4IQZ A;  3J80 E;  4OO1 H;  2YU9 B;  2I07 B;  2B2U C;  2EPB A;  3CRL C;  1I4G A;  3KBG A;  2B2V A;  2CQA A;  5CGK A;  5FO9 B;  1HQR D;  5BN4 A;  2R92 B;  4CJ1 B;  4DAP A;  1ONL A;  3A7A B;  3NXW A;  3Q0A A;  4L63 B;  1ENF A;  4A93 B;  2BOS A;  1PTO D;  3H94 A;  1JQY D;  3VYR A;  4HED A;  4HMJ A;  4FYD A;  1FNU A;  1Y8N B;  4OO1 I;  3MC0 B;  3GTO B;  2D2C C;  1EY7 A;  1Z7T A;  1CTM A;  1FYC A;  2XIW A;  2KCN A;  3PMF A;  3TDQ A;  2WKD A;  1FNV A;  1SE3 A;  1B44 D;  1Y8P B;  1QB5 D;  5COR A;  4KTA A;  1E2W A;  1W6K A;  1B9N A;  2XRQ D;  1LTA D;  2K01 A;  3D4R A;  2KED A;  3QB3 A;  3MFY A;  4QB4 A;  4XT3 B;  4KHV A;  1IYU A;  1U4R A;  4H44 C;  3URY A;  1D5X C;  5CYU A;  3RLF A;  1ILQ A;  1HRJ A;  1KTK A;  4MIU A;  2E75 C;  3HOV B;  3LX0 A;  1BCP C;  1XXG A;  4EQP A;  1ET9 A;  1A3V A;  1D1I A;  5M9O A;  2QIL A;  5C3X A;  3S16 B;  3HKZ B;  1TWG B;  1OO9 B;  2L0C A;  4UAI A;  2D5D A;  2CHB D;  3GQB A;  3LWE A;  2M2L A;  1MGS A;  2LFN A;  3EVQ A;  2JA8 B;  2RDG A;  2OEO A;  3EJI A;  4KHZ A;  2FMC A;  4EQO A;  3R2I A;  5I6Y A;  1UNS A;  1DYQ A;  4K5V A;  1HHV A;  3HOZ B;  2HQE A;  3H09 A;  4R8I A;  2IX3 A;  3GTP B;  1Q90 A;  4KY6 A;  4BA1 I;  1MD2 D;  3QJY A;  3I8Z A;  3PUX A;  4G4K A;  1CA6 A;  4KJN A;  2XWB B;  2ICE C;  3J81 E;  4DF7 A;  1U4L A;  1BCP B;  1SSO A;  2AQ2 B;  1YNN D;  4M8A A;  4G7H C;  3PIP 3;  2WB1 B;  2LKV A;  3IAY A;  5ELC A;  5DM6 3;  4QCL A;  4Z9C B;  5KEE A;  1SJH D;  5EPK A;  4FNF A;  5E4X A;  4ZRZ A;  3I90 A;  1V1P B;  3FVQ A;  1TWF B;  3FEW X;  1PRT C;  1LTR D;  4ODG A;  2C9O A;  2JXM B;  3TN2 A;  3VR3 A;  1CK1 A;  3P1H A;  5A2Q L;  1A2T A;  4RH6 A;  4P2C B;  5CMD A;  4K2K A;  2B2T C;  3OPO A;  3HRZ C;  2F0W A;  2LS0 1;  4OIK A;  3MFG A;  4RWS C;  2L9H A;  3OHX C;  5C4H A;  3MWY W;  1SYG A;  3S1M B;  2F0U A;  2A6H D;  1S5C D;  1SDF A;  1KNA A;  4IUV A;  1OXU A;  2E2D C;  4XT1 B;  3NPP A;  4DXF A;  2MUY A;  1EWH A;  1A2U A;  5C0X H;  5C4X B;  1IKM A;  4L6T B;  3P75 A;  2EYF A;  1WCM B;  1PRT B;  5EGT A;  4BWG B;  2RA4 A;  1RTN A;  3K6O A;  5C0X J;  1PLF A;  1OXX K;  1WTQ A;  1QCB D;  1RDP D;  2EY5 A;  1HXY D;  4IUT A;  3VR6 A;  4ZAI A;  1ML0 D;  4A3D B;  4TSS A;  5EQ0 A;  3NTK A;  3T13 A;  3T4A C;  3KBX A;  4F87 A;  3MA2 B;  2TMP A;  1EIH A;  2KUM A;  3HOU B;  2Z8L A;  5KRU A;  3PUY A;  3HZX A;  1A6X A;  4FF2 A;  1TY0 A;  1M4V A;  2O5I C;  3HOW B;  4RGM A;  1QIL A;  1S5E D;  4L8J A;  3C1F A;  3GTM B;  3GV3 A;  4X3T A;  1STN A;  3I3C A;  2AWO A;  3C1E A;  1TQO A;  1SNC A;  1J8I A;  3W3A A;  2F3W A;  3DWA A;  2PMZ B;  4S3S A;  4G7O C;  1Y1W B;  1YNN C;  2F0E A;  4DNT B;  1AFP A;  3MXG A;  2M00 A;  2PW7 A;  4C3I G;  5JOB A;  5KIX A;  3BS1 A;  1RCV D;  3NBI A;  3V96 A;  2K04 A;  1ET6 A;  2F0P A;  1SNO A;  1JWM D;  4KV6 A;  4ULL A;  3T53 B;  2HDL A;  3DMU A;  1BO0 A;  5ELD A;  2QCP X;  2R6G A;  1R4P B;  5T1G A;  1Q1E A;  1DOL A;  3ND8 A;  4RGN A;  5BN3 A;  4ZYS A;  4ZQ3 A;  1I50 B;  3HGB A;  4XXE A;  3NWT A;  4NMZ A;  1SND A;  2KHS A;  1EZ6 A;  1II3 A;  1HFG A;  4ILW A;  3SE0 A;  2RKS A;  5IIF A;  4FF1 A;  4Y7N B;  1NR4 A;  3TP8 A;  1EY8 A;  1ENC A;  3QOL A;  3W2D A;  4DU9 A;  5CV6 A;  1QOH A;  1YNJ D;  2AQ1 B;  4IFD G;  2EY2 A;  1EIG A;  2SNS A;  4CHT B;  1L0X B;  2DY8 A;  3SDZ A;  1X3P A;  2O2L D;  4ZUI A;  1GJX A;  1SE4 A;  2PPB C;  5ISR A;  5K36 G;  1ESF A;  2RVL A;  3QG1 A;  3TZD A;  1U4M A;  3UI2 A;  1PZI D;  1O78 A;  2EYJ A;  2I46 A;  5C5M A;  5I4D A;  1H9R A;  3VYU A;  1TS4 A;  2E76 C;  4HSV A;  2B2W C;  4K2L A;  4RGO S;  2A69 D;  1RHP A;  3C2P A;  3NUC A;  1EYC A;  1RTO A;  4A3K B;  3S2H B;  4NKL A;  2OT2 A;  1BOS A;  3SR1 A;  2TSS A;  2F0H A;  3SK5 A;  1T5X D;  1PYW D;  5F2D A;  4KD4 A;  1SYD A;  2EYM A;  4F88 A;  4MN3 A;  3M3Y B;  5JVH 3;  5EBD A;  2NBF A;  5BN5 A;  5JPM C;  1TWC B;  3I91 A;  1D5M C;  1WTP A;  2WAC A;  2B2V C;  3HOY B;  3SEB A;  1HQM C;  2ID0 A;  3FKI B;  3I73 A;  3IFD A;  2RDH A;  1S4Z A;  1LTT D;  1GUS A;  2J0T D;  4R8N A;  1Q12 A;  1S5B D;  2F4I A;  3H6M A;  3OW7 A;  4BBS B;  2NWG A;  5CV8 A;  3R2T A;  1Q3L A;  2EY1 A;  1HA5 A;  1I3Q B;  2JA6 B;  2MP1 A;  1EEF D;  2QEJ C;  2Q8T A;  5DEH A;  2F0T A;  2NYZ D;  5FLX E;  2L11 A;  2L1B A;  1DXM A;  1GUG A;  2JEA I;  4GZY C;  1RD9 D;  4C1N I;  2IJ0 A;  3SK4 A;  4DA2 A;  1DM0 B;  4LJZ C;  1GUT A;  4CKC A;  1H9K A;  4J8Q A;  1QE6 A;  4C1N K;  2E74 C;  1B9M A;  2SOB A;  4XTC S;  1JCK B;  2HCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...