2KW3C

Heterotrimeric interaction between rfx5 and rfxap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RFX5
publication title Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kw3C00
2KW3C
chains in the Genus database with same CATH superfamily
4Z9IA 2A6EF 3I5PA 3ITFA 3K1IA 3NMJA 4XPWA 1NBBA 2WVQA 4XEVA 4U5EE 3DXJF 2WB7A 5A69A 1VB5A 3Q7LA 4BPMA 1APCA 1DOWA 1ORSC 2FAPB 2YZSA 3EGXA 3NKDA 2NG1A 2A1DD 3SXZA 1NU9C 1S05A 4OIOF 4C3EA 4OD4A 1NFNA 1PCXA 5GPGB 3KPHA 4CDAA 3G50A 4FESA 4DBRA 3K33A 1MNDA 1O87A 1S7ZA 1ZHZA 5DQTA 3RQEA 3AJMA 3FVYA 2EPLX 1U6HA 4IB4A 4CBEA 1JPNA 3JSZA 5E2QA 1ZW3A 2VCCA 1T5OA 2R7QA 4WGYA 5T1DB 2LD6A 3ATPA 4KI2A 3G4ZA 4NTBA 2L7AA 1EQ1A 4YL3A 1JRAA 1ZHTA 1HY5A 3GWNA 1T01A 4YT4A 4LDRA 4PFOA 4WJ0A 3MBGA 2CCYA 5DQZA 2VASA 3KYJA 2ETSA 2ZD9A 3RQFA 2YKZA 4N06A 3IHUA 3MYIA 1QLEC 2YL7A 4JTDB 2XLMA 4PK4A 3FXHA 3IQ5A 2PFDA 4N4WA 1VLTA 2DYRC 5AC5A 1FFTC 3UMIA 2JPUA 4E0IA 5BUOA 1ST6A 3Q6NA 3EGDA 4XWJA 5BQIA 2XXAB 1OCZC 2IOQA 2P7VA 5COGA 3U0CA 4AL0A 1IZMA 2AWYA 3ASOC 2P0NA 3PCVA 2GWWA 3RKOF 3JRMO 5KYXB 2EIKC 3JRTA 2X0CA 4AL1A 2A6HF 1T6UA 4H4KC 1Z6AA 2W4MA 2H7BA 1V4AA 2LIGA 3GODA 3LNRA 3PMRA 1C03A 4PJLA 3ZG1A 1J8YF 3TQOA 4BG0A 4C3BA 4D4NA 4PR9A 1YYXA 2JX0A 3GEEA 3DMDA 4MTFA 5KYYB 5EHHA 2XLOA 4EKWA 5B1BC 4LERA 2EPOA 3L34A 4EHPA 2IXMA 1JAFA 2E87A 2XS8A 3RF3A 3R2PA 3EJNA 1KTMA 3QW0A 1Q0GA 4EBBA 2Q00A 2HMZA 2PX0A 1K05A 4Z9JA 4DBQA 4YWQA 3EHMA 3AOUA 2R7OA 2XLWA 3HNKA 4OD5A 3LEVA 4A4AA 4G7OF 1QKRA 5T3WA 2I8BA 1OXBA 1VLSA 2WL8A 3C8GA 1YJGA 1BR1A 4BJ1A 1W2WA 2YL3A 1LIHA 2BC5A 4O7GA 2XL6A 4AX2A 5B3SC 4JTCB 1GQAA 1A41A 4IWBA 4Z9HA 4MVZA 3RVZA 3U2LA 3NKEA 2A0BA 3LS1A 3M15A 4DRHB 1OR3A 3MX3A 4DJ9A 3GEIA 4DVYP 3DE8A 2Q9AA 4UDVA 1R5ID 2WZLA 3FOOA 1RJ9B 1YA7O 2Y3HA 1FFHA 3TOMA 3CEXA 5F5HA 5L0FA 2YWAA 1YAUO 2BE5F 4MNDA 2CGEA 3K1HA 3N2ZB 2J0WA 3C8ZA 2MYSA 3NYJA 3S90A 2OOCA 1U0BB 2R7UA 3N24A 4JIOA 3PHF2 2DGJA 2XM0A 3RVYA 3CQZA 3GWLA 1PD0A 4J32B 3DKAA 1E84A 3SXKA 1MMAA 4LLCA 4MS2A 1D0YA 4R32A 1G5ZA 3E70C 3X1OA 2OG2A 4YT8A 3M79A 1PV3A 2VCAA 4XQ1A 3S27A 1L3PA 4ANJA 1SF8A 4C3DA 1YYJA 3MYFA 4KBLA 4JZAA 1LPEA 2P6VA 4FAPB 1VK5A 2ASRA 2X51A 2YL0A 4FX5A 4XPXA 2Q9CA 1FAPB 2UUHA 3GM3A 4PJJA 3O10A 3QVZA 2OEVA 1MMNA 4XPYA 3S29A 3W8HA 3LUTB 2WVNA 1QQ3A 1Y4CA 2G3VA 2NUPB 3JT1A 4NTFA 4P9TA 1T6IA 2PX3A 5BQHA 1Q0KA 2R7VA 2GAQA 3FAJA 2ICWG 1YZCA 1PD1A 3TD7A 5JSLA 3SXMA 3PDMP 4U9EA 2P61A 2NPUA 2DYSC 4MVMA 2GFHA 2CYDA 2Q9BA 1CGME 2XLHA 1EI7A 3T6BA 1MQVA 3EG9A 3LJBA 1LS1A 5HSWA 2GA0A 5L0GA 5CIVA 1NU7D 4IARA 4EBKA 1G4WR 4CS8C 2EINC 5A6BA 1ZVZA 3ZQVA 1C17M 3DE9A 2YEVA 5L0IA 5COMA 3ZTMA 1D1AA 2F22A 3O6XA 1BR4A 5A6AA 1BR2A 3HTKC 1YDIA 4E7ZA 1YZAA 1QPUA 1ZHWA 1OW8A 1LS4A 3Q7GA 3W8IA 2KNHA 2OKUA 4MVOA 1H7IA 1U89A 2W4BA 1NG1A 2NUTB 3EZHA 3O39A 3NYMA 3ZWIA 3EH1A 2G3KA 3EPVA 3LAYA 3GORA 1T6QA 4I1MA 4CJOA 4CDVA 1RKEA 1QZXA 3RW0A 2XL8A 5JVEA 2KYHA 1NLXA 4HEAJ 3KKBA 4AE4A 4C7OB 4IRUA 2OQMA 5JT4A 5KYUA 4I3MA 3T9OA 1R4TA 2D4UA 3FOPA 1V55C 1AEPA 4BJ5C 1SMYF 1LVKA 3UGOA 3B0UX 1ZZPA 3GEHA 4CX9A 1UFBA 1A7VA 1Y6DA 2XM4A 1ZU5A 3LS0A 4KNWA 1K40A 1RCPA 1Z5ZA 2FGYA 4U5FE 2R02A 4G7HF 1A0BA 1WASA 3EG9B 5EK0A 5DS4A 4ZLDA 3TOLA 1NZEA 1B68A 2IM8A 2LFFA 5E3AA 5T3TA 4RBNA 4XLNF 1ZYRF 5TJ5E 2Q4FA 3MFNA 3UR3C 1LI5A 1SZIA 1E85A 2V3CC 4LACB 3B9QA 3AQBA 3AGTA 3RH3A 4KC9A 3TULA 3NRHA 2XL4A 1UG7A 2HSBA 3I4UA 5BQGA 3WG7C 1H6GA 2IYLD 3C62A 1I5NA 3HNLA 1C02A 2C03A 3RIPA 3EGXB 3V5YA 4CS8A 3UNGC 2H7VC 5F28E 1NSGB 1XZQA 4QI0A 2ZXOA 3SZRA 1K04A 2L6FA 4J7YA 3V5ZA 3OA1A 3U8VA 3AGUA 4MW3A 3UMKA 3GM2A 4G78A 3OWTA 2VC9A 1M56C 1Q0DA 2EPNA 1KU2A 2PP4A 4PFPA 4MVRA 4U5GA 1RKCA 4YT5A 3VAYA 3U8PA 2Q3TA 1ZHYA 1ORJA 1YARO 2QUPA 1D1CA 2R25A 3DJNB 2DI3A 3G4XA 4O6MA 4ULVA 3DZAA 4I44A 1LE4A 5L0DA 2A69F 1WTYA 2KGOA 2LSEA 3W2WA 3S0XA 3HLZA 5DLJA 1E2XA 4B6IA 3MLGA 4N6HA 1EA8A 5CI8A 1FMVA 1N1CA 4EBJA 3NDBB 3VF0A 2R7XA 5KYWA 4JURI 1JOGA 3JYHA 3GM1A 3ZQYA 3EFOA 3U5SA 4JCZA 4JEBA 3LLIA 2CNWD 2OJED 2R03A 4QI2A 2XLVA 3ASNC 1Z3IX 3RFYA 2A0UA 2DB4A 3EGDB 4K1OA 2J7PD 3TJ6A 5JS5A 1OKKD 1D1BA 2HV6A 3QVYA 1QSPA 4IAOA 4Q4ZF 4O6NA 2VH3A 2O9XA 4YL0A 1ZW2A 2KW3C 5D92A 5A6JA 2A68F 4M63A 2R7RA 4QDLA 4YT2A 5EGYA 3B0VC 2J8WA 3UMHA 4OIPF 1VOMA 2Y69C 3IEEA 4O6YA 4U5BE 3L8IA 4ONSA 4Q5SF 1JPJA 2YHSA 2OU6A 1WGWA 4WGZA 2Y3DA 1H9GA 4JW1A 4L6RA 2IXPA 4MW8A 4MQ9F 4PJMA 3KH2A 1FNTc 2YRFA 2GDCA 3T4RA 1CPRA 2YVKA 4IGGA 2HSQA 2XLEA 3QW1A 2RSEB 3T6GB 1ZHXA 3RQGA 2AU5A 1M2VA 1TR2A 4LDQA 4NTAA 3WAQA 4DXWA 1E83A 3DD7A 1GS9A 5DVWA 3C8GB 1OCOC 4GQHA 2HS5A 1HMOA 3VM6A 1FMWA 4GEHA 2PNOA 3B71A 2LQGA 1OR2A 1HMDA 4JC7A 5KYWB 1KNYA 2J46A 4BEJA 3S84A 2R9RB 4MVUA 2EPKX 2L6HA 4RDAA 4MVSA 3ZIBA 1I4YA 4LDKA 4P9FA 5FCLA 5JP7A 3RYLA 5HV9A 3WODF 2VCBA 2OCCC 3FHDA 3K66A 1Z7Qc 2HJMA 5JUAA 4MTOA 1HE9A 4JKVA 2KSFA 2ZXPA 5FZTA 5B3IA 1TWAA 2HV7A 4EIYA 2WZGA 3HNIA 4OINF 4XLPF 3SXYA 4CIPA 4OIRF 3ZC4A 2IBFA 2PF4E 5AC4A 4YN0B 1RXQA 1LKXA 5B1AC 1TWCA 3DAGA 1OCCC 5CI9A 3OEOA 3L0IA 2IXOA 3W4YA 2M64A 4JCHA 4DOZA 1VYIA 1JR8A 5L3VA 1NFOA 3Q6MA 1OCRC 2XS1A 4E17A 3LLKA 3BEHA 1BDJB 5E33A 1VYKA 1MMGA 2HUJA 1G8XA 3EZIA 1M2VB 2M4EA 2EIJC 2C04A 2RD9A 4YK5A 2AP3A 3V7OA 4DRJB 1G4US 4IJJA 1WOLA 5F5FA 1A7EA 3QZCA 2XXAA 3T6JA 1OXKA 1A7DA 1WATA 2HFIA 2QE9A 3SP1A 1YLMA 3J06A 3NYLA 3S9OA 2ZXWC 5COFA 3SYNA 4BJTA 2LP4A 4K7BA 2YLDA 3VRCA 4DRIB 4NCQA 5KYXA 4E0HA 2AWCA 3K6BA 4I1OB 3IQCA 1BBHA 1QVXA 2Y39A 3O55A 4H54A 1YA9A 256BA 3DAFA 2QY9A 1T9KA 4KNVA 4CDYA 2Z15A 5L0CA 1Z23A 5KYNA 4AK9A 1Q0FA 2HZ8A 4MVQA 1V54C 4MTGA 3ZTZA 4CS7A 5KYYA 3FMSA 2G62A 3JSEO 2KJGA 3ABLC 1GM5A 3JCUQ 4O79A 4RD9A 1VMAA 2V26A 4XEKA 2FFHA 3JYYA 1E86A 1DOVA 2I15A 1AUEA 3M4BA 3C18A 3S28A 2H8AA 3AG1C 2ZPAA 2KQ9A 2W45A 3C8GD 4ULWA 2XLDA 1RMVA 2WVOA 4U5HA 4W8PA 3NMKA 4U5DE 2JD3A 1ORYA 4LLEA 2LFDA 2KC3A 3FAPB 1CGOA 1O5HA 2HKVA 2EILC 4HFKB 1TWGA 1RKEB 3GANA 3POVA 3TJ5A 4CJGA 2NSFA 2KK1A 4CSAC 1D0ZA 3DM9B 4JJFA 1D0XA 2QNLA 4AE4B 4NQFA 5JLIA 2QTVA 4PACA 3UGPA 1RJ9A 1H9TA 2J9UA 2P1AA 2XSEA 4BJ6C 5KYUB 3A9CA 2J0XA 2J45A 4K0DA 2B0HA 1MNEA 3HNJA 2MWQA 2YLIA 2Q7RA 3M1CB 5A6KA 4W8KA 1ZU4A 3VYWA 3QTHA 1CGNA 2J9BA 1LI7A 1IW7F 3ZDLA 3U9MA 1SR2A 2EPMX 4CS9C 3QMKA 4OIQF 1YVIA 3LNMB 1Q0MA 2J9WA 5L3QA 4CIHA 2H7OA 3CZ6A 4E18A 3B0PA 3N0TA 5D91A 4BJ5A 1XZPA 2LK4A 3DI5A 2OJQA 3IPMO 2UUIA 1OW7A 3ZSUA 2R7SA 1OW6A 4DVZA 4G7ZF 4J7TA 2BL2A 3H2UA 1OQCA 2MHRA 4P6IC 3DM5A 1M57C 3SNHA 5E3CA 3EH2A 2YQYA 1O3UA 3ABMC 3L1MA 3US6A 4E7SA 5DS6A 2R05A 4U9DA 3TK0A 2L9JA 2VB6A 3I5QA 4BEMJ 2NUPA 3HKKA 3X2QC 4XTKA 1V74B 3DWWA 4JVSA 1WWPA 2R7TA 3W2VA 4X0RA 4YL1A 4EWCA 5L0JA 2EIMC 1L7CA 1CPQA 5L0HA 3L8JA 4ER9A 3NG1A 2ZXRA 3DJUB 4F4BA 1M6TA 3EHNA 3F47A 3K1IC 2L6GA 2AVKA 5DS5A 1Z63A 3C63A 4D4XA 2PBEA 1HW1A 3F46A 4NC3A 2TMVP 3CSKA 3HJCA 3KL4A 4HE8D 2WZFA 4IAQA 5A6BD 4JE9A 2CW0F 3E9VA 2B0JA 1MMDA 1M2OA 4CSAA 4XEFA 3IQ6A 1HE1A 2YLGA 2R7WA 3AG2C 5JRAA 2LCHA 1TWHA 2D5RB 1LM3B 3KYIA 3R7CA 4A2NB 1JMWA 3H2VA 4NY3A 4BJ6A 4JTAB 4WABA 3EFOB 2CDQA 4HFFB 1TFKB 3AG4C 1FTSA 3NMIA 2CNWA 1J8MF 2IXNA 5K0IA 4GYTA 3AQCA 2NUTA 2Y3GA 3U3BA 2J7PA 1LE2A 3WHNA 2J9VA 3K7DA 1OKKA 3U2MA 4CS9A 1EKYA 5AGFA 2HJ3A 1WN0A 3BRJA 3CAXA 3B29A 3M4CA 4JRZA 4JEAA 3U3FA 3FDQA 3SEOA 1TQGA 3ZVRA 3LEOA 3JZ0A 4C7OA 3IQTA 3JTLO 2NSGA 2YL1A 3AG3C 1GGQA 1TKNA 4N6CA 1VTMP 4YJWA 4FWVA 1TFOB 4G0HA 3U9JA 3H65A 1FR0A 3ECSA 4JJGA 1XWJA 2HMQA 1HW2A 1BZ4A 5IY5C 3EQLF 2W9YA 3C7JA 3ABKC 2XRHA 2L81A 2OEXA 2Y3BA 4Q7CA 4ZLCA 3KMIA 1SYQA 1F1MA 3A11A 4EUKB 4J30B 3LESA 4U5CE 4PJNA 2QLAA 1I4ZA 1AVOB 3V5XA
chains in the Genus database with same CATH topology
2A6EF 3I5PA 3ITFA 2WVQA 4U5EE 3DXJF 2WB7A 3Q7LA 2YZSA 3EGXA 3NKDA 2NG1A 2A1DD 1NU9C 4C3EA 4OD4A 4DBRA 1PCXA 4FESA 3K33A 1MNDA 1O87A 1S7ZA 1ZHZA 5DQTA 3FVYA 4CBEA 1JPNA 3JSZA 5E2QA 2R7QA 5T1DB 4KI2A 1ZHTA 4YT4A 4PFOA 4WJ0A 5DQZA 2VASA 4N06A 1QLEC 4PK4A 2PFDA 2DYRC 5BUOA 1FFTC 3UMIA 1ST6A 3Q6NA 3EGDA 4XWJA 2XXAB 1OCZC 2IOQA 2P7VA 1IZMA 3ASOC 3RKOF 5KYXB 2EIKC 3JRTA 2A6HF 4H4KC 1Z6AA 2W4MA 2H7BA 3GODA 3LNRA 3PMRA 4PJLA 4C3BA 4BG0A 3ZG1A 1J8YF 3DMDA 5KYYB 5EHHA 5B1BC 4LERA 3L34A 2IXMA 2E87A 3EJNA 4EBBA 2PX0A 4DBQA 4YWQA 3EHMA 2R7OA 4OD5A 3LEVA 4G7OF 5T3WA 2I8BA 2WL8A 1BR1A 4BJ1A 1W2WA 4O7GA 4AX2A 5B3SC 4IWBA 3NKEA 3LS1A 3MX3A 4DVYP 2Q9AA 2WZLA 1RJ9B 2Y3HA 1FFHA 5F5HA 4MNDA 2BE5F 2CGEA 3K1HA 3N2ZB 2J0WA 2MYSA 3NYJA 2R7UA 3N24A 3PHF2 2DGJA 3CQZA 1PD0A 4J32B 1MMAA 4LLCA 1D0YA 3E70C 3X1OA 2OG2A 4YT8A 3S27A 4ANJA 1SF8A 4C3DA 4JZAA 4KBLA 2P6VA 1VK5A 4FX5A 2X51A 2Q9CA 4PJJA 3W8HA 1MMNA 3S29A 2WVNA 2G3VA 2NUPB 2R7VA 3JT1A 2PX3A 3FAJA 3TD7A 1PD1A 2DYSC 2GFHA 2Q9BA 3T6BA 3EG9A 3LJBA 1LS1A 5HSWA 1NU7D 4CS8C 2EINC 2YEVA 1D1AA 3O6XA 1BR4A 1BR2A 3HTKC 4E7ZA 3Q7GA 1ZHWA 3W8IA 2KNHA 2W4BA 1NG1A 2NUTB 3EZHA 3O39A 3NYMA 3EH1A 2G3KA 3EPVA 3LAYA 4I1MA 1QZXA 4HEAJ 3KKBA 4AE4A 4C7OB 4IRUA 5KYUA 4I3MA 1V55C 4BJ5C 1SMYF 1LVKA 3UGOA 3B0UX 1ZU5A 3LS0A 4KNWA 4U5FE 1Z5ZA 4OIOF 2FGYA 4G7HF 3EG9B 4ZLDA 5DS4A 1NZEA 5E3AA 5T3TA 4XLNF 4RBNA 1ZYRF 3UR3C 1SZIA 2V3CC 4LACB 3B9QA 3AQBA 3RH3A 4KC9A 3NRHA 2XL4A 3I4UA 3WG7C 2IYLD 2C03A 3EGXB 4CS8A 3UNGC 2H7VC 4QI0A 2ZXOA 3SZRA 3OA1A 3UMKA 3OWTA 1M56C 1KU2A 2PP4A 4PFPA 4U5GA 4YT5A 3VAYA 2Q3TA 1ZHYA 3DJNB 1D1CA 4O6MA 3DZAA 4I44A 2A69F 2KGOA 2LSEA 3W2WA 3S0XA 3HLZA 5DLJA 4B6IA 3MLGA 5CI8A 2R7XA 1FMVA 1N1CA 3NDBB 5KYWA 4JURI 3JYHA 3EFOA 3LLIA 2CNWD 4QI2A 3ASNC 1Z3IX 3RFYA 3EGDB 2J7PD 1OKKD 1D1BA 2HV6A 4IAOA 4Q4ZF 4O6NA 2VH3A 2O9XA 2KW3C 5D92A 2A68F 4M63A 2R7RA 4QDLA 4YT2A 5EGYA 3B0VC 3UMHA 4OIPF 1VOMA 2Y69C 3IEEA 4O6YA 4U5BE 4Q5SF 1JPJA 2YHSA 1WGWA 2Y3DA 4JW1A 2IXPA 4MQ9F 4PJMA 3KH2A 3T4RA 1ZHXA 1M2VA 1TR2A 3DD7A 5DVWA 1OCOC 1FMWA 4GEHA 5KYWB 2J46A 4BEJA 4RDAA 3ZIBA 5FCLA 3RYLA 3WODF 2OCCC 3FHDA 3K66A 2ZXPA 1TWAA 2HV7A 2WZGA 4OINF 4XLPF 4OIRF 3ZC4A 2PF4E 4YN0B 1LKXA 5B1AC 1TWCA 3DAGA 1OCCC 5CI9A 3OEOA 3L0IA 2IXOA 4JCHA 4DOZA 1VYIA 5L3VA 3Q6MA 1OCRC 3LLKA 5E33A 1VYKA 1MMGA 3EZIA 1G8XA 2R7TA 1M2VB 2M4EA 2C04A 2EIJC 3V7OA 4IJJA 5F5FA 3QZCA 2XXAA 3T6JA 3SP1A 3NYLA 2ZXWC 3SYNA 4BJTA 4K7BA 5KYXA 3K6BA 4I1OB 2Y39A 3DAFA 4KNVA 2QY9A 5KYNA 2Z15A 1Z23A 4AK9A 5KYYA 1V54C 4CS7A 2G62A 2KJGA 3ABLC 3JCUQ 4O79A 4RD9A 1VMAA 2V26A 2FFHA 3S28A 3AG1C 2ZPAA 2KQ9A 2W45A 4ULWA 2WVOA 4U5HA 4U5DE 2JD3A 4LLEA 1O5HA 2EILC 4HFKB 1TWGA 3GANA 3POVA 4CSAC 1D0ZA 3DM9B 4JJFA 1D0XA 4AE4B 2QTVA 3UGPA 1RJ9A 2J9UA 4BJ6C 2XSEA 5KYUB 2J0XA 2J45A 4K0DA 1MNEA 2MWQA 3M1CB 4W8KA 1ZU4A 3VYWA 1IW7F 4CS9C 3QMKA 4OIQF 2J9WA 5L3QA 4CIHA 2H7OA 3CZ6A 3B0PA 3N0TA 5D91A 4BJ5A 2R7SA 3ZSUA 4DVZA 4G7ZF 4P6IC 3DM5A 1M57C 3SNHA 5E3CA 3EH2A 3ABMC 5DS6A 4E7SA 2L9JA 2VB6A 3I5QA 2NUPA 3X2QC 4XTKA 4JVSA 3W2VA 4X0RA 4EWCA 2EIMC 3NG1A 2ZXRA 3DJUB 4F4BA 3EHNA 3F47A 3K1IC 5DS5A 1Z63A 3F46A 3CSKA 3HJCA 3KL4A 4HE8D 2WZFA 2CW0F 3E9VA 2B0JA 1MMDA 1M2OA 4CSAA 2R7WA 3AG2C 1TWHA 2D5RB 4A2NB 4NY3A 4BJ6A 3EFOB 2CDQA 4HFFB 3AG4C 1FTSA 2CNWA 1J8MF 2IXNA 4GYTA 3AQCA 2NUTA 2Y3GA 2J7PA 2J9VA 3K7DA 1OKKA 4CS9A 3FDQA 3SEOA 3ZVRA 4C7OA 3AG3C 1TKNA 4YJWA 4FWVA 4G0HA 3H65A 3ECSA 4JJGA 5IY5C 3EQLF 2W9YA 3ABKC 2XRHA 2L81A 4Q7CA 2Y3BA 4ZLCA 3KMIA 4J30B 3LESA 4U5CE 4PJNA 3RIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW3 C; 
#chains in the Genus database with same CATH topology
 4Z9I A;  2A6E F;  3I5P A;  3ITF A;  3K1I A;  3NMJ A;  4XPW A;  1NBB A;  2WVQ A;  4XEV A;  4U5E E;  3DXJ F;  2WB7 A;  5A69 A;  1VB5 A;  3Q7L A;  4BPM A;  1APC A;  1DOW A;  1ORS C;  2FAP B;  2YZS A;  3EGX A;  3NKD A;  2NG1 A;  2A1D D;  3SXZ A;  1NU9 C;  1S05 A;  4OIO F;  4C3E A;  4OD4 A;  1NFN A;  1PCX A;  5GPG B;  3KPH A;  4CDA A;  3G50 A;  4FES A;  4DBR A;  3K33 A;  1MND A;  1O87 A;  1S7Z A;  1ZHZ A;  5DQT A;  3RQE A;  3AJM A;  3FVY A;  2EPL X;  1U6H A;  4IB4 A;  4CBE A;  1JPN A;  3JSZ A;  5E2Q A;  1ZW3 A;  2VCC A;  1T5O A;  2R7Q A;  4WGY A;  5T1D B;  2LD6 A;  3ATP A;  4KI2 A;  3G4Z A;  4NTB A;  2L7A A;  1EQ1 A;  4YL3 A;  1JRA A;  1ZHT A;  1HY5 A;  3GWN A;  1T01 A;  4YT4 A;  4LDR A;  4PFO A;  4WJ0 A;  3MBG A;  2CCY A;  5DQZ A;  2VAS A;  3KYJ A;  2ETS A;  2ZD9 A;  3RQF A;  2YKZ A;  4N06 A;  3IHU A;  3MYI A;  1QLE C;  2YL7 A;  4JTD B;  2XLM A;  4PK4 A;  3FXH A;  3IQ5 A;  2PFD A;  4N4W A;  1VLT A;  2DYR C;  5AC5 A;  1FFT C;  3UMI A;  2JPU A;  4E0I A;  5BUO A;  1ST6 A;  3Q6N A;  3EGD A;  4XWJ A;  5BQI A;  2XXA B;  1OCZ C;  2IOQ A;  2P7V A;  5COG A;  3U0C A;  4AL0 A;  1IZM A;  2AWY A;  3ASO C;  2P0N A;  3PCV A;  2GWW A;  3RKO F;  3JRM O;  5KYX B;  2EIK C;  3JRT A;  2X0C A;  4AL1 A;  2A6H F;  1T6U A;  4H4K C;  1Z6A A;  2W4M A;  2H7B A;  1V4A A;  2LIG A;  3GOD A;  3LNR A;  3PMR A;  1C03 A;  4PJL A;  3ZG1 A;  1J8Y F;  3TQO A;  4BG0 A;  4C3B A;  4D4N A;  4PR9 A;  1YYX A;  2JX0 A;  3GEE A;  3DMD A;  4MTF A;  5KYY B;  5EHH A;  2XLO A;  4EKW A;  5B1B C;  4LER A;  2EPO A;  3L34 A;  4EHP A;  2IXM A;  1JAF A;  2E87 A;  2XS8 A;  3RF3 A;  3R2P A;  3EJN A;  1KTM A;  3QW0 A;  1Q0G A;  4EBB A;  2Q00 A;  2HMZ A;  2PX0 A;  1K05 A;  4Z9J A;  4DBQ A;  4YWQ A;  3EHM A;  3AOU A;  2R7O A;  2XLW A;  3HNK A;  4OD5 A;  3LEV A;  4A4A A;  4G7O F;  1QKR A;  5T3W A;  2I8B A;  1OXB A;  1VLS A;  2WL8 A;  3C8G A;  1YJG A;  1BR1 A;  4BJ1 A;  1W2W A;  2YL3 A;  1LIH A;  2BC5 A;  4O7G A;  2XL6 A;  4AX2 A;  5B3S C;  4JTC B;  1GQA A;  1A41 A;  4IWB A;  4Z9H A;  4MVZ A;  3RVZ A;  3U2L A;  3NKE A;  2A0B A;  3LS1 A;  3M15 A;  4DRH B;  1OR3 A;  3MX3 A;  4DJ9 A;  3GEI A;  4DVY P;  3DE8 A;  2Q9A A;  4UDV A;  1R5I D;  2WZL A;  3FOO A;  1RJ9 B;  1YA7 O;  2Y3H A;  1FFH A;  3TOM A;  3CEX A;  5F5H A;  5L0F A;  2YWA A;  1YAU O;  2BE5 F;  4MND A;  2CGE A;  3K1H A;  3N2Z B;  2J0W A;  3C8Z A;  2MYS A;  3NYJ A;  3S90 A;  2OOC A;  1U0B B;  2R7U A;  3N24 A;  4JIO A;  3PHF 2;  2DGJ A;  2XM0 A;  3RVY A;  3CQZ A;  3GWL A;  1PD0 A;  4J32 B;  3DKA A;  1E84 A;  3SXK A;  1MMA A;  4LLC A;  4MS2 A;  1D0Y A;  4R32 A;  1G5Z A;  3E70 C;  3X1O A;  2OG2 A;  4YT8 A;  3M79 A;  1PV3 A;  2VCA A;  4XQ1 A;  3S27 A;  1L3P A;  4ANJ A;  1SF8 A;  4C3D A;  1YYJ A;  3MYF A;  4KBL A;  4JZA A;  1LPE A;  2P6V A;  4FAP B;  1VK5 A;  2ASR A;  2X51 A;  2YL0 A;  4FX5 A;  4XPX A;  2Q9C A;  1FAP B;  2UUH A;  3GM3 A;  4PJJ A;  3O10 A;  3QVZ A;  2OEV A;  1MMN A;  4XPY A;  3S29 A;  3W8H A;  3LUT B;  2WVN A;  1QQ3 A;  1Y4C A;  2G3V A;  2NUP B;  3JT1 A;  4NTF A;  4P9T A;  1T6I A;  2PX3 A;  5BQH A;  1Q0K A;  2R7V A;  2GAQ A;  3FAJ A;  2ICW G;  1YZC A;  1PD1 A;  3TD7 A;  5JSL A;  3SXM A;  3PDM P;  4U9E A;  2P61 A;  2NPU A;  2DYS C;  4MVM A;  2GFH A;  2CYD A;  2Q9B A;  1CGM E;  2XLH A;  1EI7 A;  3T6B A;  1MQV A;  3EG9 A;  3LJB A;  1LS1 A;  5HSW A;  2GA0 A;  5L0G A;  5CIV A;  1NU7 D;  4IAR A;  4EBK A;  1G4W R;  4CS8 C;  2EIN C;  5A6B A;  1ZVZ A;  3ZQV A;  1C17 M;  3DE9 A;  2YEV A;  5L0I A;  5COM A;  3ZTM A;  1D1A A;  2F22 A;  3O6X A;  1BR4 A;  5A6A A;  1BR2 A;  3HTK C;  1YDI A;  4E7Z A;  1YZA A;  1QPU A;  1ZHW A;  1OW8 A;  1LS4 A;  3Q7G A;  3W8I A;  2KNH A;  2OKU A;  4MVO A;  1H7I A;  1U89 A;  2W4B A;  1NG1 A;  2NUT B;  3EZH A;  3O39 A;  3NYM A;  3ZWI A;  3EH1 A;  2G3K A;  3EPV A;  3LAY A;  3GOR A;  1T6Q A;  4I1M A;  4CJO A;  4CDV A;  1RKE A;  1QZX A;  3RW0 A;  2XL8 A;  5JVE A;  2KYH A;  1NLX A;  4HEA J;  3KKB A;  4AE4 A;  4C7O B;  4IRU A;  2OQM A;  5JT4 A;  5KYU A;  4I3M A;  3T9O A;  1R4T A;  2D4U A;  3FOP A;  1V55 C;  1AEP A;  4BJ5 C;  1SMY F;  1LVK A;  3UGO A;  3B0U X;  1ZZP A;  3GEH A;  4CX9 A;  1UFB A;  1A7V A;  1Y6D A;  2XM4 A;  1ZU5 A;  3LS0 A;  4KNW A;  1K40 A;  1RCP A;  1Z5Z A;  2FGY A;  4U5F E;  2R02 A;  4G7H F;  1A0B A;  1WAS A;  3EG9 B;  5EK0 A;  5DS4 A;  4ZLD A;  3TOL A;  1NZE A;  1B68 A;  2IM8 A;  2LFF A;  5E3A A;  5T3T A;  4RBN A;  4XLN F;  1ZYR F;  5TJ5 E;  2Q4F A;  3MFN A;  3UR3 C;  1LI5 A;  1SZI A;  1E85 A;  2V3C C;  4LAC B;  3B9Q A;  3AQB A;  3AGT A;  3RH3 A;  4KC9 A;  3TUL A;  3NRH A;  2XL4 A;  1UG7 A;  2HSB A;  3I4U A;  5BQG A;  3WG7 C;  1H6G A;  2IYL D;  3C62 A;  1I5N A;  3HNL A;  1C02 A;  2C03 A;  3RIP A;  3EGX B;  3V5Y A;  4CS8 A;  3UNG C;  2H7V C;  5F28 E;  1NSG B;  1XZQ A;  4QI0 A;  2ZXO A;  3SZR A;  1K04 A;  2L6F A;  4J7Y A;  3V5Z A;  3OA1 A;  3U8V A;  3AGU A;  4MW3 A;  3UMK A;  3GM2 A;  4G78 A;  3OWT A;  2VC9 A;  1M56 C;  1Q0D A;  2EPN A;  1KU2 A;  2PP4 A;  4PFP A;  4MVR A;  4U5G A;  1RKC A;  4YT5 A;  3VAY A;  3U8P A;  2Q3T A;  1ZHY A;  1ORJ A;  1YAR O;  2QUP A;  1D1C A;  2R25 A;  3DJN B;  2DI3 A;  3G4X A;  4O6M A;  4ULV A;  3DZA A;  4I44 A;  1LE4 A;  5L0D A;  2A69 F;  1WTY A;  2KGO A;  2LSE A;  3W2W A;  3S0X A;  3HLZ A;  5DLJ A;  1E2X A;  4B6I A;  3MLG A;  4N6H A;  1EA8 A;  5CI8 A;  1FMV A;  1N1C A;  4EBJ A;  3NDB B;  3VF0 A;  2R7X A;  5KYW A;  4JUR I;  1JOG A;  3JYH A;  3GM1 A;  3ZQY A;  3EFO A;  3U5S A;  4JCZ A;  4JEB A;  3LLI A;  2CNW D;  2OJE D;  2R03 A;  4QI2 A;  2XLV A;  3ASN C;  1Z3I X;  3RFY A;  2A0U A;  2DB4 A;  3EGD B;  4K1O A;  2J7P D;  3TJ6 A;  5JS5 A;  1OKK D;  1D1B A;  2HV6 A;  3QVY A;  1QSP A;  4IAO A;  4Q4Z F;  4O6N A;  2VH3 A;  2O9X A;  4YL0 A;  1ZW2 A;  2KW3 C;  5D92 A;  5A6J A;  2A68 F;  4M63 A;  2R7R A;  4QDL A;  4YT2 A;  5EGY A;  3B0V C;  2J8W A;  3UMH A;  4OIP F;  1VOM A;  2Y69 C;  3IEE A;  4O6Y A;  4U5B E;  3L8I A;  4ONS A;  4Q5S F;  1JPJ A;  2YHS A;  2OU6 A;  1WGW A;  4WGZ A;  2Y3D A;  1H9G A;  4JW1 A;  4L6R A;  2IXP A;  4MW8 A;  4MQ9 F;  4PJM A;  3KH2 A;  1FNT c;  2YRF A;  2GDC A;  3T4R A;  1CPR A;  2YVK A;  4IGG A;  2HSQ A;  2XLE A;  3QW1 A;  2RSE B;  3T6G B;  1ZHX A;  3RQG A;  2AU5 A;  1M2V A;  1TR2 A;  4LDQ A;  4NTA A;  3WAQ A;  4DXW A;  1E83 A;  3DD7 A;  1GS9 A;  5DVW A;  3C8G B;  1OCO C;  4GQH A;  2HS5 A;  1HMO A;  3VM6 A;  1FMW A;  4GEH A;  2PNO A;  3B71 A;  2LQG A;  1OR2 A;  1HMD A;  4JC7 A;  5KYW B;  1KNY A;  2J46 A;  4BEJ A;  3S84 A;  2R9R B;  4MVU A;  2EPK X;  2L6H A;  4RDA A;  4MVS A;  3ZIB A;  1I4Y A;  4LDK A;  4P9F A;  5FCL A;  5JP7 A;  3RYL A;  5HV9 A;  3WOD F;  2VCB A;  2OCC C;  3FHD A;  3K66 A;  1Z7Q c;  2HJM A;  5JUA A;  4MTO A;  1HE9 A;  4JKV A;  2KSF A;  2ZXP A;  5FZT A;  5B3I A;  1TWA A;  2HV7 A;  4EIY A;  2WZG A;  3HNI A;  4OIN F;  4XLP F;  3SXY A;  4CIP A;  4OIR F;  3ZC4 A;  2IBF A;  2PF4 E;  5AC4 A;  4YN0 B;  1RXQ A;  1LKX A;  5B1A C;  1TWC A;  3DAG A;  1OCC C;  5CI9 A;  3OEO A;  3L0I A;  2IXO A;  3W4Y A;  2M64 A;  4JCH A;  4DOZ A;  1VYI A;  1JR8 A;  5L3V A;  1NFO A;  3Q6M A;  1OCR C;  2XS1 A;  4E17 A;  3LLK A;  3BEH A;  1BDJ B;  5E33 A;  1VYK A;  1MMG A;  2HUJ A;  1G8X A;  3EZI A;  1M2V B;  2M4E A;  2EIJ C;  2C04 A;  2RD9 A;  4YK5 A;  2AP3 A;  3V7O A;  4DRJ B;  1G4U S;  4IJJ A;  1WOL A;  5F5F A;  1A7E A;  3QZC A;  2XXA A;  3T6J A;  1OXK A;  1A7D A;  1WAT A;  2HFI A;  2QE9 A;  3SP1 A;  1YLM A;  3J06 A;  3NYL A;  3S9O A;  2ZXW C;  5COF A;  3SYN A;  4BJT A;  2LP4 A;  4K7B A;  2YLD A;  3VRC A;  4DRI B;  4NCQ A;  5KYX A;  4E0H A;  2AWC A;  3K6B A;  4I1O B;  3IQC A;  1BBH A;  1QVX A;  2Y39 A;  3O55 A;  4H54 A;  1YA9 A;  256B A;  3DAF A;  2QY9 A;  1T9K A;  4KNV A;  4CDY A;  2Z15 A;  5L0C A;  1Z23 A;  5KYN A;  4AK9 A;  1Q0F A;  2HZ8 A;  4MVQ A;  1V54 C;  4MTG A;  3ZTZ A;  4CS7 A;  5KYY A;  3FMS A;  2G62 A;  3JSE O;  2KJG A;  3ABL C;  1GM5 A;  3JCU Q;  4O79 A;  4RD9 A;  1VMA A;  2V26 A;  4XEK A;  2FFH A;  3JYY A;  1E86 A;  1DOV A;  2I15 A;  1AUE A;  3M4B A;  3C18 A;  3S28 A;  2H8A A;  3AG1 C;  2ZPA A;  2KQ9 A;  2W45 A;  3C8G D;  4ULW A;  2XLD A;  1RMV A;  2WVO A;  4U5H A;  4W8P A;  3NMK A;  4U5D E;  2JD3 A;  1ORY A;  4LLE A;  2LFD A;  2KC3 A;  3FAP B;  1CGO A;  1O5H A;  2HKV A;  2EIL C;  4HFK B;  1TWG A;  1RKE B;  3GAN A;  3POV A;  3TJ5 A;  4CJG A;  2NSF A;  2KK1 A;  4CSA C;  1D0Z A;  3DM9 B;  4JJF A;  1D0X A;  2QNL A;  4AE4 B;  4NQF A;  5JLI A;  2QTV A;  4PAC A;  3UGP A;  1RJ9 A;  1H9T A;  2J9U A;  2P1A A;  2XSE A;  4BJ6 C;  5KYU B;  3A9C A;  2J0X A;  2J45 A;  4K0D A;  2B0H A;  1MNE A;  3HNJ A;  2MWQ A;  2YLI A;  2Q7R A;  3M1C B;  5A6K A;  4W8K A;  1ZU4 A;  3VYW A;  3QTH A;  1CGN A;  2J9B A;  1LI7 A;  1IW7 F;  3ZDL A;  3U9M A;  1SR2 A;  2EPM X;  4CS9 C;  3QMK A;  4OIQ F;  1YVI A;  3LNM B;  1Q0M A;  2J9W A;  5L3Q A;  4CIH A;  2H7O A;  3CZ6 A;  4E18 A;  3B0P A;  3N0T A;  5D91 A;  4BJ5 A;  1XZP A;  2LK4 A;  3DI5 A;  2OJQ A;  3IPM O;  2UUI A;  1OW7 A;  3ZSU A;  2R7S A;  1OW6 A;  4DVZ A;  4G7Z F;  4J7T A;  2BL2 A;  3H2U A;  1OQC A;  2MHR A;  4P6I C;  3DM5 A;  1M57 C;  3SNH A;  5E3C A;  3EH2 A;  2YQY A;  1O3U A;  3ABM C;  3L1M A;  3US6 A;  4E7S A;  5DS6 A;  2R05 A;  4U9D A;  3TK0 A;  2L9J A;  2VB6 A;  3I5Q A;  4BEM J;  2NUP A;  3HKK A;  3X2Q C;  4XTK A;  1V74 B;  3DWW A;  4JVS A;  1WWP A;  2R7T A;  3W2V A;  4X0R A;  4YL1 A;  4EWC A;  5L0J A;  2EIM C;  1L7C A;  1CPQ A;  5L0H A;  3L8J A;  4ER9 A;  3NG1 A;  2ZXR A;  3DJU B;  4F4B A;  1M6T A;  3EHN A;  3F47 A;  3K1I C;  2L6G A;  2AVK A;  5DS5 A;  1Z63 A;  3C63 A;  4D4X A;  2PBE A;  1HW1 A;  3F46 A;  4NC3 A;  2TMV P;  3CSK A;  3HJC A;  3KL4 A;  4HE8 D;  2WZF A;  4IAQ A;  5A6B D;  4JE9 A;  2CW0 F;  3E9V A;  2B0J A;  1MMD A;  1M2O A;  4CSA A;  4XEF A;  3IQ6 A;  1HE1 A;  2YLG A;  2R7W A;  3AG2 C;  5JRA A;  2LCH A;  1TWH A;  2D5R B;  1LM3 B;  3KYI A;  3R7C A;  4A2N B;  1JMW A;  3H2V A;  4NY3 A;  4BJ6 A;  4JTA B;  4WAB A;  3EFO B;  2CDQ A;  4HFF B;  1TFK B;  3AG4 C;  1FTS A;  3NMI A;  2CNW A;  1J8M F;  2IXN A;  5K0I A;  4GYT A;  3AQC A;  2NUT A;  2Y3G A;  3U3B A;  2J7P A;  1LE2 A;  3WHN A;  2J9V A;  3K7D A;  1OKK A;  3U2M A;  4CS9 A;  1EKY A;  5AGF A;  2HJ3 A;  1WN0 A;  3BRJ A;  3CAX A;  3B29 A;  3M4C A;  4JRZ A;  4JEA A;  3U3F A;  3FDQ A;  3SEO A;  1TQG A;  3ZVR A;  3LEO A;  3JZ0 A;  4C7O A;  3IQT A;  3JTL O;  2NSG A;  2YL1 A;  3AG3 C;  1GGQ A;  1TKN A;  4N6C A;  1VTM P;  4YJW A;  4FWV A;  1TFO B;  4G0H A;  3U9J A;  3H65 A;  1FR0 A;  3ECS A;  4JJG A;  1XWJ A;  2HMQ A;  1HW2 A;  1BZ4 A;  5IY5 C;  3EQL F;  2W9Y A;  3C7J A;  3ABK C;  2XRH A;  2L81 A;  2OEX A;  2Y3B A;  4Q7C A;  4ZLC A;  3KMI A;  1SYQ A;  1F1M A;  3A11 A;  4EUK B;  4J30 B;  3LES A;  4U5C E;  4PJN A;  2QLA A;  1I4Z A;  1AVO B;  3V5X A; 
#chains in the Genus database with same CATH homology
 2A6E F;  3I5P A;  3ITF A;  2WVQ A;  4U5E E;  3DXJ F;  2WB7 A;  3Q7L A;  2YZS A;  3EGX A;  3NKD A;  2NG1 A;  2A1D D;  1NU9 C;  4C3E A;  4OD4 A;  4DBR A;  1PCX A;  4FES A;  3K33 A;  1MND A;  1O87 A;  1S7Z A;  1ZHZ A;  5DQT A;  3FVY A;  4CBE A;  1JPN A;  3JSZ A;  5E2Q A;  2R7Q A;  5T1D B;  4KI2 A;  1ZHT A;  4YT4 A;  4PFO A;  4WJ0 A;  5DQZ A;  2VAS A;  4N06 A;  1QLE C;  4PK4 A;  2PFD A;  2DYR C;  5BUO A;  1FFT C;  3UMI A;  1ST6 A;  3Q6N A;  3EGD A;  4XWJ A;  2XXA B;  1OCZ C;  2IOQ A;  2P7V A;  1IZM A;  3ASO C;  3RKO F;  5KYX B;  2EIK C;  3JRT A;  2A6H F;  4H4K C;  1Z6A A;  2W4M A;  2H7B A;  3GOD A;  3LNR A;  3PMR A;  4PJL A;  4C3B A;  4BG0 A;  3ZG1 A;  1J8Y F;  3DMD A;  5KYY B;  5EHH A;  5B1B C;  4LER A;  3L34 A;  2IXM A;  2E87 A;  3EJN A;  4EBB A;  2PX0 A;  4DBQ A;  4YWQ A;  3EHM A;  2R7O A;  4OD5 A;  3LEV A;  4G7O F;  5T3W A;  2I8B A;  2WL8 A;  1BR1 A;  4BJ1 A;  1W2W A;  4O7G A;  4AX2 A;  5B3S C;  4IWB A;  3NKE A;  3LS1 A;  3MX3 A;  4DVY P;  2Q9A A;  2WZL A;  1RJ9 B;  2Y3H A;  1FFH A;  5F5H A;  4MND A;  2BE5 F;  2CGE A;  3K1H A;  3N2Z B;  2J0W A;  2MYS A;  3NYJ A;  2R7U A;  3N24 A;  3PHF 2;  2DGJ A;  3CQZ A;  1PD0 A;  4J32 B;  1MMA A;  4LLC A;  1D0Y A;  3E70 C;  3X1O A;  2OG2 A;  4YT8 A;  3S27 A;  4ANJ A;  1SF8 A;  4C3D A;  4JZA A;  4KBL A;  2P6V A;  1VK5 A;  4FX5 A;  2X51 A;  2Q9C A;  4PJJ A;  3W8H A;  1MMN A;  3S29 A;  2WVN A;  2G3V A;  2NUP B;  2R7V A;  3JT1 A;  2PX3 A;  3FAJ A;  3TD7 A;  1PD1 A;  2DYS C;  2GFH A;  2Q9B A;  3T6B A;  3EG9 A;  3LJB A;  1LS1 A;  5HSW A;  1NU7 D;  4CS8 C;  2EIN C;  2YEV A;  1D1A A;  3O6X A;  1BR4 A;  1BR2 A;  3HTK C;  4E7Z A;  3Q7G A;  1ZHW A;  3W8I A;  2KNH A;  2W4B A;  1NG1 A;  2NUT B;  3EZH A;  3O39 A;  3NYM A;  3EH1 A;  2G3K A;  3EPV A;  3LAY A;  4I1M A;  1QZX A;  4HEA J;  3KKB A;  4AE4 A;  4C7O B;  4IRU A;  5KYU A;  4I3M A;  1V55 C;  4BJ5 C;  1SMY F;  1LVK A;  3UGO A;  3B0U X;  1ZU5 A;  3LS0 A;  4KNW A;  4U5F E;  1Z5Z A;  4OIO F;  2FGY A;  4G7H F;  3EG9 B;  4ZLD A;  5DS4 A;  1NZE A;  5E3A A;  5T3T A;  4XLN F;  4RBN A;  1ZYR F;  3UR3 C;  1SZI A;  2V3C C;  4LAC B;  3B9Q A;  3AQB A;  3RH3 A;  4KC9 A;  3NRH A;  2XL4 A;  3I4U A;  3WG7 C;  2IYL D;  2C03 A;  3EGX B;  4CS8 A;  3UNG C;  2H7V C;  4QI0 A;  2ZXO A;  3SZR A;  3OA1 A;  3UMK A;  3OWT A;  1M56 C;  1KU2 A;  2PP4 A;  4PFP A;  4U5G A;  4YT5 A;  3VAY A;  2Q3T A;  1ZHY A;  3DJN B;  1D1C A;  4O6M A;  3DZA A;  4I44 A;  2A69 F;  2KGO A;  2LSE A;  3W2W A;  3S0X A;  3HLZ A;  5DLJ A;  4B6I A;  3MLG A;  5CI8 A;  2R7X A;  1FMV A;  1N1C A;  3NDB B;  5KYW A;  4JUR I;  3JYH A;  3EFO A;  3LLI A;  2CNW D;  4QI2 A;  3ASN C;  1Z3I X;  3RFY A;  3EGD B;  2J7P D;  1OKK D;  1D1B A;  2HV6 A;  4IAO A;  4Q4Z F;  4O6N A;  2VH3 A;  2O9X A;  2KW3 C;  5D92 A;  2A68 F;  4M63 A;  2R7R A;  4QDL A;  4YT2 A;  5EGY A;  3B0V C;  3UMH A;  4OIP F;  1VOM A;  2Y69 C;  3IEE A;  4O6Y A;  4U5B E;  4Q5S F;  1JPJ A;  2YHS A;  1WGW A;  2Y3D A;  4JW1 A;  2IXP A;  4MQ9 F;  4PJM A;  3KH2 A;  3T4R A;  1ZHX A;  1M2V A;  1TR2 A;  3DD7 A;  5DVW A;  1OCO C;  1FMW A;  4GEH A;  5KYW B;  2J46 A;  4BEJ A;  4RDA A;  3ZIB A;  5FCL A;  3RYL A;  3WOD F;  2OCC C;  3FHD A;  3K66 A;  2ZXP A;  1TWA A;  2HV7 A;  2WZG A;  4OIN F;  4XLP F;  4OIR F;  3ZC4 A;  2PF4 E;  4YN0 B;  1LKX A;  5B1A C;  1TWC A;  3DAG A;  1OCC C;  5CI9 A;  3OEO A;  3L0I A;  2IXO A;  4JCH A;  4DOZ A;  1VYI A;  5L3V A;  3Q6M A;  1OCR C;  3LLK A;  5E33 A;  1VYK A;  1MMG A;  3EZI A;  1G8X A;  2R7T A;  1M2V B;  2M4E A;  2C04 A;  2EIJ C;  3V7O A;  4IJJ A;  5F5F A;  3QZC A;  2XXA A;  3T6J A;  3SP1 A;  3NYL A;  2ZXW C;  3SYN A;  4BJT A;  4K7B A;  5KYX A;  3K6B A;  4I1O B;  2Y39 A;  3DAF A;  4KNV A;  2QY9 A;  5KYN A;  2Z15 A;  1Z23 A;  4AK9 A;  5KYY A;  1V54 C;  4CS7 A;  2G62 A;  2KJG A;  3ABL C;  3JCU Q;  4O79 A;  4RD9 A;  1VMA A;  2V26 A;  2FFH A;  3S28 A;  3AG1 C;  2ZPA A;  2KQ9 A;  2W45 A;  4ULW A;  2WVO A;  4U5H A;  4U5D E;  2JD3 A;  4LLE A;  1O5H A;  2EIL C;  4HFK B;  1TWG A;  3GAN A;  3POV A;  4CSA C;  1D0Z A;  3DM9 B;  4JJF A;  1D0X A;  4AE4 B;  2QTV A;  3UGP A;  1RJ9 A;  2J9U A;  4BJ6 C;  2XSE A;  5KYU B;  2J0X A;  2J45 A;  4K0D A;  1MNE A;  2MWQ A;  3M1C B;  4W8K A;  1ZU4 A;  3VYW A;  1IW7 F;  4CS9 C;  3QMK A;  4OIQ F;  2J9W A;  5L3Q A;  4CIH A;  2H7O A;  3CZ6 A;  3B0P A;  3N0T A;  5D91 A;  4BJ5 A;  2R7S A;  3ZSU A;  4DVZ A;  4G7Z F;  4P6I C;  3DM5 A;  1M57 C;  3SNH A;  5E3C A;  3EH2 A;  3ABM C;  5DS6 A;  4E7S A;  2L9J A;  2VB6 A;  3I5Q A;  2NUP A;  3X2Q C;  4XTK A;  4JVS A;  3W2V A;  4X0R A;  4EWC A;  2EIM C;  3NG1 A;  2ZXR A;  3DJU B;  4F4B A;  3EHN A;  3F47 A;  3K1I C;  5DS5 A;  1Z63 A;  3F46 A;  3CSK A;  3HJC A;  3KL4 A;  4HE8 D;  2WZF A;  2CW0 F;  3E9V A;  2B0J A;  1MMD A;  1M2O A;  4CSA A;  2R7W A;  3AG2 C;  1TWH A;  2D5R B;  4A2N B;  4NY3 A;  4BJ6 A;  3EFO B;  2CDQ A;  4HFF B;  3AG4 C;  1FTS A;  2CNW A;  1J8M F;  2IXN A;  4GYT A;  3AQC A;  2NUT A;  2Y3G A;  2J7P A;  2J9V A;  3K7D A;  1OKK A;  4CS9 A;  3FDQ A;  3SEO A;  3ZVR A;  4C7O A;  3AG3 C;  1TKN A;  4YJW A;  4FWV A;  4G0H A;  3H65 A;  3ECS A;  4JJG A;  5IY5 C;  3EQL F;  2W9Y A;  3ABK C;  2XRH A;  2L81 A;  4Q7C A;  2Y3B A;  4ZLC A;  3KMI A;  4J30 B;  3LES A;  4U5C E;  4PJN A;  3RIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...