2KW3C

Heterotrimeric interaction between rfx5 and rfxap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
b'GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RFX5
molecule tags Dna binding protein
source organism Homo sapiens
publication title Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression
rcsb
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kw3C00
2KW3C
chains in the Genus database with same CATH superfamily
1N1CA 1WTYA 2KC3A 4XWJA 2OJED 1WATA 3GEHA 5BQIA 4CS9C 2IXNA 4P9FA 2XL8A 1OKKD 1PD0A 3DMDA 3U8VA 4O7GA 4WJ0A 3B0UX 4G7OF 3NYLA 4H54A 2BE5F 4NQFA 4JC7A 1YLMA 3LUTB 2VB6A 1EA8A 1HW1A 3V5ZA 3T6JA 3WG7C 2ZPAA 4BEJA 1Z63A 1M2VB 4Z9IA 4IAOA 4EUKB 1E86A 1G8XA 4LLEA 3ZWIA 1ZYRF 2QY9A 1K05A 2L9JA 3ZQVA 2KSFA 2NSFA 2RSEB 4G0HA 4XEVA 4RBNA 5A6JA 2J9BA 2IBFA 2IXOA 1A7VA 4EBBA 2QLAA 3LNRA 4CIPA 3SXKA 3U3BA 3S9OA 1QQ3A 2DYSC 3I5QA 5AGFA 4J7TA 1OCRC 4LDQA 1NFOA 4PJJA 2M4EA 5E3AA 3GEIA 2J9UA 1D0ZA 2XLOA 3HKKA 2PFDA 2ICWG 4XTKA 1V54C 4MTFA 3GORA 1A0BA 2ETSA 4BEMJ 2EIKC 2GWWA 1T6IA 1XWJA 2H7VC 4HEAJ 3PDMP 2YVKA 2R7XA 1C02A 3LS0A 1PD1A 3MX3A 1TWAA 3NKEA 4BJ6C 4C7OB 5BQGA 2VCCA 4N6HA 2EPOA 4WGZA 3OEOA 3M15A 4NTFA 1GQAA 4JJFA 3UMHA 3QTHA 2Q4FA 1K04A 3AG2C 3ATPA 3NDBB 1Q0MA 3H65A 3A9CA 1ZHWA 4XPWA 2EIMC 4CS7A 4FWVA 5T3WA 1Z23A 1TFKB 4O6MA 4JTCB 1YVIA 3K7DA 2R02A 3B0PA 1VYKA 4XPYA 4RD9A 4U5HA 1TQGA 3MBGA 3PCVA 3I4UA 2I8BA 3EFOB 1FAPB 1V74B 4OD4A 1WGWA 1LPEA 2XRHA 3E9VA 3U9JA 5EHHA 3V5YA 5L0CA 1T9KA 4BJTA 4OINF 3B29A 4Q5SF 1G4US 3HNIA 4MS2A 1Y6DA 2BC5A 1OR2A 2NUTB 3LAYA 4MVMA 3S84A 3N0TA 1Z7Qc 1QVXA 5D92A 1T5OA 3DE8A 2NUPA 4CX9A 2HSBA 2J0XA 1NFNA 5A6KA 4JURI 4BG0A 3BEHA 1NSGB 2KW3C 1TWGA 4PJNA 3L0IA 5DQZA 3RH3A 5L0HA 3W8IA 3GM1A 4KC9A 4E0IA 2AVKA 2A1DD 1JOGA 3CQZA 1TWCA 5KYUA 2P7VA 4HE8D 4MVQA 3CAXA 4ZLCA 2OEXA 4RDAA 1QSPA 2CDQA 2GFHA 3JYYA 2W45A 4IARA 1FNTc 1D0XA 1NU9C 2PP4A 2FAPB 1E84A 3EPVA 3C18A 5KYNA 2R7SA 1Z5ZA 1VLSA 2LD6A 3FOPA 5JRAA 1JAFA 5L3VA 3DXJF 2NUPB 1F1MA 3OWTA 4MVUA 2R9RB 2CW0F 2Y69C 2QNLA 1QPUA 3HTKC 1MQVA 4DRHB 4J30B 4NTAA 1E83A 1Z3IX 1I5NA 2H7OA 2Q7RA 4CDVA 4YT2A 3PMRA 1NLXA 1A7DA 3IQTA 1NG1A 2WZFA 3N2ZB 4U5FE 1TKNA 1FMWA 2YLDA 4MW8A 1OKKA 2XL6A 2EPLX 5CI9A 1SMYF 4HFKB 4WGYA 1XZQA 2YQYA 4BJ1A 4Z9HA 4JCZA 5L0FA 2A69F 4MVOA 4D4NA 2YEVA 2ZXOA 3ASOC 4YK5A 4ZLDA 4IWBA 1ZHXA 1D1BA 3VM6A 2DI3A 4JRZA 3X2QC 3ITFA 1IW7F 2WVNA 5DS4A 4O6YA 2J7PA 4W8KA 1LM3B 2XLVA 1RMVA 3Q7LA 1B68A 3DI5A 5COMA 1ZHYA 4U5DE 1VK5A 4IGGA 4L6RA 4KI2A 3ZG1A 2HJMA 4DXWA 2LFFA 1GS9A 1U89A 1YA9A 2YKZA 3HNKA 1JRAA 3HLZA 5DQTA 3EJNA 2MWQA 5KYYB 3EG9B 3Q6MA 4A4AA 4F4BA 2YL1A 3MYFA 3SXYA 3IQCA 4U5GA 2WVOA 5BUOA 4E18A 1OCCC 5D91A 2IM8A 4U9DA 2W4MA 5IY5C 3T6BA 2R7VA 4QI0A 2HMZA 1G5ZA 2DB4A 3CZ6A 3FHDA 3GODA 1FMVA 2V26A 2O9XA 2PF4E 3EFOA 5KYWB 2YRFA 2FFHA 2IYLD 1DOWA 2XLHA 1RKEB 4BJ6A 1S05A 4YL0A 2WZLA 4H4KC 1O87A 4K1OA 1R5ID 4GQHA 5COGA 5JP7A 5DVWA 4EWCA 1LVKA 4MNDA 4NTBA 3EZHA 4PFOA 3ZVRA 1Y4CA 2VASA 4XQ1A 1OW6A 2AU5A 3LS1A 3JZ0A 1SF8A 4BPMA 3SP1A 4PFPA 3C8GD 3EGDA 5FCLA 3EQLF 4JVSA 1GM5A 3EGXB 4XPXA 4GYTA 1AVOB 4M63A 1AEPA 3W2WA 2D5RB 4YL3A 3RVZA 2R7TA 3GWLA 4YT4A 2IOQA 2X51A 2R7RA 1K40A 4AL0A 1RKEA 3NYJA 3O55A 4OIOF 4XLNF 4I1OB 2Q00A 1RCPA 2VH3A 1C03A 2BL2A 3AQCA 2FGYA 4DBQA 3GANA 2A6EF 2CNWD 4OIRF 2HV7A 1ZHZA 3EH2A 5TJ5E 1JPNA 4O6NA 1ORYA 3EH1A 3NG1A 2PBEA 3JSZA 1RXQA 3AG4C 3WHNA 2HFIA 4IAQA 1M57C 5JVEA 1KTMA 4ULVA 3RQFA 1HMDA 3UMIA 3B71A 3DJUB 2MYSA 3DD7A 4JTAB 1SZIA 4LDKA 1Z6AA 4D4XA 4U5CE 2J46A 2UUIA 1M6TA 2IXMA 2KJGA 1Q0DA 4YJWA 2VC9A 3SXMA 4JE9A 2WVQA 2GDCA 3TK0A 4FAPB 4XLPF 4KBLA 3RKOF 3QVYA 4N6CA 3T9OA 3GWNA 1YA7O 2Y3DA 4AE4A 2LFDA 1E85A 2YL0A 5CI8A 3RF3A 2XS8A 1G4WR 4ER9A 3QW0A 4MVRA 5DS5A 2L7AA 1KU2A 2HJ3A 2LQGA 3AQBA 2A68F 4DRIB 1M2VA 1M2OA 3E70C 2HV6A 2J8WA 5B1BC 1XZPA 4IRUA 2ZXWC 4FX5A 3SYNA 4CDYA 3KPHA 4E0HA 2CCYA 1UFBA 3O39A 4AL1A 4P9TA 4CSAC 5F5HA 3NMIA 4MVSA 2XL4A 2P0NA 2XLDA 3EZIA 3V7OA 3JT1A 3TJ5A 4EIYA 1MMNA 2XLMA 4EKWA 5HV9A 3SNHA 4AE4B 2EPMX 5HSWA 1FR0A 1O3UA 5F28E 2ZD9A 2I15A 3US6A 4OIQF 4OIPF 4N4WA 1ZW2A 1HY5A 5JUAA 5L0DA 3S0XA 1QKRA 2TMVP 1T01A 3DE9A 3M1CB 3UNGC 3SZRA 1MMDA 2H7BA 1I4YA 3ABMC 3TJ6A 1J8YF 1APCA 3ZTMA 4C3BA 4BJ5C 4EBKA 2L81A 2Y3GA 2ZXRA 5KYUB 1SYQA 3AGUA 3KKBA 5EK0A 3G4XA 1YJGA 1YZCA 4C3DA 4EHPA 5EGYA 4G7HF 1AUEA 1R4TA 3GEEA 2VCAA 2CYDA 4ULWA 3N24A 5B3SC 4PR9A 2L6FA 3LLKA 3IQ6A 2C03A 3B9QA 4W8PA 2MHRA 3U5SA 3UR3C 3C8GB 5FZTA 2P61A 1ZHTA 1OW8A 4DJ9A 4YWQA 5F5FA 3I5PA 1J8MF 1MMGA 3L1MA 4PK4A 3TOMA 2EPNA 2J0WA 4QI2A 5A6BA 1HMOA 5KYYA 1CGNA 2OOCA 3RVYA 1JPJA 3TQOA 2UUHA 5CIVA 3MLGA 4CJGA 3U9MA 3C8ZA 5T1DB 1CGME 3DAFA 4CJOA 3FDQA 1LS4A 3UMKA 1MMAA 2HKVA 2EINC 2GA0A 3EHMA 1WWPA 2G3KA 2XM4A 2YL7A 1LIHA 3G50A 3H2VA 3TOLA 3C8GA 4E7ZA 1Q0GA 1TR2A 4R32A 2CNWA 5A6AA 4CIHA 3K6BA 3C62A 5JSLA 3RW0A 1GGQA 3NMJA 3DAGA 4PACA 3LLIA 2ASRA 4IB4A 3B0VC 4CSAA 1NBBA 1H7IA 1VYIA 2KNHA 1DOVA 1V4AA 1ZZPA 2LP4A 3FAJA 2QUPA 3L8JA 4JW1A 4I44A 5JLIA 3SEOA 3ABKC 3M79A 3JSEO 3L8IA 5B3IA 3J06A 2B0JA 4JZAA 1U6HA 4ONSA 5T3TA 3WAQA 3TULA 3RIPA 3K1IC 4CS8C 2R7OA 1BBHA 3AOUA 3EGXA 3F47A 3L34A 1L7CA 2AWCA 1O5HA 3DKAA 4C3EA 2LIGA 3RQGA 1RJ9A 3TD7A 4DVYP 2J7PD 3PHF2 3ZSUA 3JCUQ 2KQ9A 1LKXA 1OXKA 3KMIA 4PJLA 3ZDLA 1YARO 3IPMO 4HFFB 3DJNB 3HNLA 4DRJB 2M64A 4DVZA 5A69A 1OR3A 2L6GA 1D1CA 3ASNC 4X0RA 1TWHA 1BR2A 256BA 3U0CA 1I4ZA 1Q0KA 1BDJB 2R25A 5L0JA 3S90A 1LI5A 1LE2A 2QTVA 3C63A 2Y39A 3RYLA 3ZIBA 4CS9A 5L3QA 4MTOA 2EPKX 2B0HA 3CSKA 2YLGA 1RJ9B 1LE4A 3EGDB 3H2UA 3U2LA 3KYJA 1QZXA 1WN0A 4MQ9F 4MVZA 3W2VA 4E17A 2OG2A 3RQEA 5DS6A 2V3CC 4NY3A 4K0DA 1L3PA 4FESA 3O10A 1KNYA 1D1AA 2Y3BA 1ZU5A 3U3FA 4UDVA 1BR4A 2NG1A 3EG9A 2XSEA 3IQ5A 3U2MA 2C04A 3HJCA 3KL4A 2Y3HA 3DM5A 1FFTC 4I1MA 2XLEA 2W9YA 3JRMO 5BQHA 2EILC 3DWWA 3M4BA 4G78A 3AGTA 2G62A 2XM0A 3MYIA 4K7BA 3JTLO 3LJBA 3ZQYA 2LSEA 4G7ZF 1FFHA 1WASA 1VB5A 1YDIA 4JJGA 4JKVA 5E2QA 2R7WA 4LACB 3S28A 3UGOA 3AJMA 3NKDA 2WB7A 2Q9AA 3OA1A 2W4BA 3R7CA 2LCHA 2PX0A 1H9GA 1HE9A 5JT4A 2WZGA 1ORJA 5DLJA 5K0IA 2HSQA 4JTDB 3LNMB 3T6GB 1RKCA 1OQCA 1C17M 2Z15A 2AP3A 4CBEA 3UGPA 3ECSA 4KNVA 3GM2A 1CPRA 5AC4A 3KH2A 2JPUA 2PNOA 3FMSA 4Z9JA 2YZSA 5L0IA 1EKYA 3G4ZA 3KYIA 1PV3A 4NC3A 1E2XA 3BRJA 1TFOB 3Q7GA 3QZCA 2YWAA 4LERA 1U0BB 1NU7D 1NZEA 1H6GA 4JCHA 2R7UA 4NCQA 3Q6NA 3ZC4A 1EI7A 1YYXA 4YT5A 3WODF 4U5EE 2P1AA 3NRHA 2YL3A 2A6HF 2EIJC 2G3VA 2H8AA 3U8PA 3QVZA 4YT8A 1JMWA 2YHSA 2XLWA 2IXPA 2OQMA 5KYXA 2QE9A 1OCOC 1D0YA 5KYWA 4AX2A 4WABA 4B6IA 5B1AC 2DGJA 2KGOA 1YAUO 1VOMA 2RD9A 3NMKA 1BR1A 3RFYA 2R03A 3EHNA 4DBRA 1W2WA 2HZ8A 1QLEC 4EBJA 4PJMA 3F46A 4YL1A 4A2NB 1VTMP 1OCZC 1CGOA 2F22A 3JRTA 3S29A 2J45A 1MNEA 1ORSC 1ST6A 5AC5A 3DM9B 1SR2A 5COFA 4MW3A 5KYXB 2R05A 2AWYA 3QW1A 4LLCA 3V5XA 2XS1A 3LEOA 3GM3A 3K1IA 4CS8A 4LDRA 5E3CA 1FTSA 1LI7A 2R7QA 3K66A 3CEXA 3DZAA 3NYMA 4J7YA 4JEAA 3AG3C 4KNWA 2XXAA 1OW7A 2A0UA 4QDLA 3O6XA 1YYJA 2ZXPA 1HE1A 3ZTZA 1CPQA 1M56C 1Q0FA 3VRCA 4AK9A 4MTGA 1IZMA 3LEVA 2OCCC 1HW2A 3IEEA 2NPUA 4IJJA 4E7SA 1BZ4A 1LS1A 2GAQA 4CDAA 5GPGB 2LK4A 3FOOA 2Q9CA 3R2PA 3VYWA 4C7OA 3VF0A 3JYHA 4OD5A 3AG1C 3M4CA 4U5BE 1VLTA 3T4RA 1OXBA 2JD3A 2A0BA 2E87A 3X1OA 4DOZA 4I3MA 3QMKA 3VAYA 3ABLC 5A6BD 2L6HA 2XXAB 1JR8A 5E33A 2X0CA 2HMQA 2Q3TA 2P6VA 3MFNA 3SXZA 1VMAA 1S7ZA 2HUJA 2VCBA 2KK1A 3FXHA 1H9TA 1PCXA 2PX3A 2OJQA 2JX0A 4XEKA 3W4YA 5L0GA 1T6QA 1V55C 2OU6A 4O79A 2WL8A 4J32B 1ZU4A 5JS5A 2DYRC 4Q4ZF 2OKUA 3K1HA 3A11A 4ANJA 1A41A 1WOLA 3LESA 1ZW3A 4Q7CA 4YN0B 2NUTA 3FVYA 2NSGA 1EQ1A 2J9VA 3C7JA 4N06A 2HS5A 3IHUA 4XEFA 3FAPB 3S27A 3K33A 3W8HA 2Q9BA 4JIOA 1UG7A 1A7EA 4JEBA 4P6IC 4U9EA 4BJ5A 2KYHA 1MNDA 1YZAA 2D4UA 1ZVZA 2OEVA 2YLIA 4GEHA 1T6UA 3HNJA 2J9WA 3POVA 2CGEA
chains in the Genus database with same CATH topology
1N1CA 4XWJA 4CS9C 2IXNA 1OKKD 1PD0A 3DMDA 4O7GA 4WJ0A 3B0UX 4G7OF 3NYLA 2BE5F 4BEJA 2VB6A 3WG7C 1Z63A 3T6JA 2ZPAA 1M2VB 4IAOA 1G8XA 4LLEA 1ZYRF 2QY9A 2L9JA 4G0HA 4RBNA 2IXOA 4EBBA 3LNRA 2DYSC 3I5QA 1OCRC 5E3AA 4PJJA 2M4EA 2J9UA 1D0ZA 2PFDA 4XTKA 1V54C 2EIKC 4HEAJ 2H7VC 2R7XA 3LS0A 1PD1A 3MX3A 1TWAA 3NKEA 4BJ6C 4C7OB 3OEOA 3UMHA 4JJFA 3AG2C 3NDBB 3H65A 1ZHWA 2EIMC 4CS7A 4FWVA 5T3WA 1Z23A 4O6MA 3K7DA 3B0PA 1VYKA 4RD9A 4U5HA 3I4UA 2I8BA 3EFOB 5KYWA 4OD4A 1WGWA 3E9VA 2XRHA 5EHHA 4BJTA 4OINF 4Q5SF 2NUTB 3LAYA 3N0TA 5D92A 2NUPA 2J0XA 4JURI 4BG0A 2KW3C 1TWGA 4PJNA 3L0IA 5DQZA 3RH3A 3W8IA 4KC9A 2A1DD 3CQZA 1TWCA 5KYUA 2P7VA 4HE8D 4ZLCA 4RDAA 2CDQA 2GFHA 2W45A 1D0XA 1NU9C 2PP4A 3EPVA 5KYNA 2R7SA 1Z5ZA 5L3VA 3DXJF 2NUPB 3OWTA 2CW0F 2Y69C 3HTKC 4J30B 1Z3IX 2H7OA 4YT2A 3PMRA 1NG1A 2WZFA 3N2ZB 4U5FE 1TKNA 1FMWA 1OKKA 5CI9A 1SMYF 4HFKB 4BJ1A 2A69F 2YEVA 2ZXOA 3ASOC 4ZLDA 4IWBA 1ZHXA 1D1BA 3X2QC 3ITFA 1IW7F 2WVNA 5DS4A 4O6YA 2J7PA 4W8KA 3Q7LA 1ZHYA 4U5DE 1VK5A 4KI2A 3ZG1A 5FCLA 5DQTA 3HLZA 3EJNA 2MWQA 5KYYB 3EG9B 3Q6MA 4F4BA 5BUOA 4U5GA 2WVOA 1OCCC 5D91A 5IY5C 2W4MA 3T6BA 2R7VA 4QI0A 3CZ6A 3FHDA 3GODA 1FMVA 2V26A 2O9XA 2PF4E 3EFOA 5KYWB 2FFHA 2IYLD 4BJ6A 2WZLA 4H4KC 1O87A 4EWCA 5DVWA 1LVKA 4MNDA 3EZHA 4PFOA 3ZVRA 2VASA 3LS1A 1SF8A 3SP1A 4PFPA 3EGDA 3EQLF 4JVSA 3EGXB 4GYTA 4M63A 3W2WA 2D5RB 2R7TA 4YT4A 2IOQA 2X51A 2R7RA 3NYJA 4OIOF 4XLNF 4I1OB 2VH3A 3AQCA 2FGYA 4DBQA 3GANA 2A6EF 2CNWD 4OIRF 2HV7A 1ZHZA 3EH2A 1JPNA 4O6NA 3NG1A 3EH1A 3JSZA 3AG4C 1M57C 3UMIA 3DJUB 2MYSA 3DD7A 1SZIA 1Z6AA 4U5CE 2J46A 2IXMA 2KJGA 4YJWA 2WVQA 4XLPF 4KBLA 3RKOF 2Y3DA 4AE4A 5CI8A 5DS5A 1KU2A 3AQBA 2A68F 1M2VA 1M2OA 3E70C 2HV6A 5B1BC 4IRUA 2ZXWC 4FX5A 3SYNA 3O39A 4CSAC 5F5HA 2XL4A 3V7OA 3EZIA 3JT1A 1MMNA 3SNHA 4AE4B 5HSWA 4OIQF 4OIPF 3S0XA 3M1CB 3UNGC 3SZRA 1MMDA 2H7BA 3ABMC 1J8YF 4C3BA 5KYUB 4BJ5C 2L81A 2Y3GA 2ZXRA 3KKBA 4C3DA 5EGYA 4G7HF 4ULWA 3N24A 3LLKA 2C03A 3B9QA 3UR3C 1ZHTA 4YWQA 5F5FA 3I5PA 1J8MF 1MMGA 4PK4A 2J0WA 4QI2A 5KYYA 1JPJA 3MLGA 5T1DB 3DAFA 3FDQA 3UMKA 1MMAA 2EINC 3EHMA 2G3KA 4E7ZA 1TR2A 2CNWA 3K6BA 3DAGA 3LLIA 3B0VC 4CSAA 2KNHA 1VYIA 3FAJA 4JW1A 4I44A 3SEOA 3ABKC 2B0JA 4JZAA 5T3TA 3RIPA 3K1IC 4CS8C 2R7OA 3EGXA 3F47A 3L34A 1O5HA 4C3EA 1RJ9A 3TD7A 4DVYP 2J7PD 3PHF2 3ZSUA 3JCUQ 2KQ9A 1LKXA 3KMIA 4PJLA 4HFFB 3DJNB 4DVZA 1D1CA 3ASNC 4X0RA 1TWHA 1BR2A 3RYLA 2QTVA 2Y39A 3ZIBA 4CS9A 5L3QA 3EGDB 3CSKA 1RJ9B 4CIHA 1QZXA 4MQ9F 3W2VA 5DS6A 2V3CC 2OG2A 4NY3A 4K0DA 4FESA 2Y3BA 1D1AA 1ZU5A 1BR4A 2NG1A 3EG9A 2XSEA 2C04A 3HJCA 3KL4A 2Y3HA 3DM5A 1FFTC 4I1MA 2W9YA 2EILC 2G62A 4K7BA 3LJBA 4G7ZF 2LSEA 1FFHA 4JJGA 5E2QA 2R7WA 4LACB 3S28A 3UGOA 3NKDA 2WB7A 2Q9AA 3OA1A 2W4BA 2PX0A 2WZGA 5DLJA 2Z15A 4CBEA 3UGPA 3ECSA 4KNVA 3KH2A 2YZSA 3Q7GA 3QZCA 4LERA 1NU7D 1NZEA 4JCHA 2R7UA 3Q6NA 3ZC4A 3WODF 4YT5A 4U5EE 3NRHA 2A6HF 2EIJC 2G3VA 4YT8A 2YHSA 2IXPA 5KYXA 1OCOC 1D0YA 4AX2A 4B6IA 5B1AC 2DGJA 2KGOA 1VOMA 1BR1A 3RFYA 3EHNA 4DBRA 1W2WA 1QLEC 4PJMA 3F46A 4A2NB 1OCZC 3JRTA 3S29A 1MNEA 2J45A 1ST6A 3DM9B 5KYXB 4LLCA 4CS8A 5E3CA 1FTSA 3K66A 2R7QA 3NYMA 5B3SC 3DZAA 4KNWA 2XXAA 3AG3C 4QDLA 3O6XA 2ZXPA 1M56C 4AK9A 1IZMA 3LEVA 2OCCC 3IEEA 4IJJA 4E7SA 1LS1A 4C7OA 2Q9CA 3VYWA 3JYHA 4OD5A 3AG1C 4U5BE 3T4RA 2JD3A 2E87A 3X1OA 4DOZA 4I3MA 3QMKA 3VAYA 3ABLC 2XXAB 5E33A 2Q3TA 2P6VA 1VMAA 1S7ZA 1PCXA 2PX3A 1V55C 4O79A 2WL8A 4J32B 1ZU4A 2DYRC 4Q4ZF 3K1HA 4ANJA 3LESA 4Q7CA 4YN0B 2NUTA 3FVYA 2J9VA 4N06A 3S27A 3K33A 3W8HA 2Q9BA 4P6IC 4BJ5A 1MNDA 4GEHA 2J9WA 3POVA 2CGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW3 C; 
#chains in the Genus database with same CATH topology
 1N1C A;  1WTY A;  2KC3 A;  4XWJ A;  2OJE D;  1WAT A;  3GEH A;  5BQI A;  4CS9 C;  2IXN A;  4P9F A;  2XL8 A;  1OKK D;  1PD0 A;  3DMD A;  3U8V A;  4O7G A;  4WJ0 A;  3B0U X;  4G7O F;  3NYL A;  4H54 A;  2BE5 F;  4NQF A;  4JC7 A;  1YLM A;  3LUT B;  2VB6 A;  1EA8 A;  1HW1 A;  3V5Z A;  3T6J A;  3WG7 C;  2ZPA A;  4BEJ A;  1Z63 A;  1M2V B;  4Z9I A;  4IAO A;  4EUK B;  1E86 A;  1G8X A;  4LLE A;  3ZWI A;  1ZYR F;  2QY9 A;  1K05 A;  2L9J A;  3ZQV A;  2KSF A;  2NSF A;  2RSE B;  4G0H A;  4XEV A;  4RBN A;  5A6J A;  2J9B A;  2IBF A;  2IXO A;  1A7V A;  4EBB A;  2QLA A;  3LNR A;  4CIP A;  3SXK A;  3U3B A;  3S9O A;  1QQ3 A;  2DYS C;  3I5Q A;  5AGF A;  4J7T A;  1OCR C;  4LDQ A;  1NFO A;  4PJJ A;  2M4E A;  5E3A A;  3GEI A;  2J9U A;  1D0Z A;  2XLO A;  3HKK A;  2PFD A;  2ICW G;  4XTK A;  1V54 C;  4MTF A;  3GOR A;  1A0B A;  2ETS A;  4BEM J;  2EIK C;  2GWW A;  1T6I A;  1XWJ A;  2H7V C;  4HEA J;  3PDM P;  2YVK A;  2R7X A;  1C02 A;  3LS0 A;  1PD1 A;  3MX3 A;  1TWA A;  3NKE A;  4BJ6 C;  4C7O B;  5BQG A;  2VCC A;  4N6H A;  2EPO A;  4WGZ A;  3OEO A;  3M15 A;  4NTF A;  1GQA A;  4JJF A;  3UMH A;  3QTH A;  2Q4F A;  1K04 A;  3AG2 C;  3ATP A;  3NDB B;  1Q0M A;  3H65 A;  3A9C A;  1ZHW A;  4XPW A;  2EIM C;  4CS7 A;  4FWV A;  5T3W A;  1Z23 A;  1TFK B;  4O6M A;  4JTC B;  1YVI A;  3K7D A;  2R02 A;  3B0P A;  1VYK A;  4XPY A;  4RD9 A;  4U5H A;  1TQG A;  3MBG A;  3PCV A;  3I4U A;  2I8B A;  3EFO B;  1FAP B;  1V74 B;  4OD4 A;  1WGW A;  1LPE A;  2XRH A;  3E9V A;  3U9J A;  5EHH A;  3V5Y A;  5L0C A;  1T9K A;  4BJT A;  4OIN F;  3B29 A;  4Q5S F;  1G4U S;  3HNI A;  4MS2 A;  1Y6D A;  2BC5 A;  1OR2 A;  2NUT B;  3LAY A;  4MVM A;  3S84 A;  3N0T A;  1Z7Q c;  1QVX A;  5D92 A;  1T5O A;  3DE8 A;  2NUP A;  4CX9 A;  2HSB A;  2J0X A;  1NFN A;  5A6K A;  4JUR I;  4BG0 A;  3BEH A;  1NSG B;  2KW3 C;  1TWG A;  4PJN A;  3L0I A;  5DQZ A;  3RH3 A;  5L0H A;  3W8I A;  3GM1 A;  4KC9 A;  4E0I A;  2AVK A;  2A1D D;  1JOG A;  3CQZ A;  1TWC A;  5KYU A;  2P7V A;  4HE8 D;  4MVQ A;  3CAX A;  4ZLC A;  2OEX A;  4RDA A;  1QSP A;  2CDQ A;  2GFH A;  3JYY A;  2W45 A;  4IAR A;  1FNT c;  1D0X A;  1NU9 C;  2PP4 A;  2FAP B;  1E84 A;  3EPV A;  3C18 A;  5KYN A;  2R7S A;  1Z5Z A;  1VLS A;  2LD6 A;  3FOP A;  5JRA A;  1JAF A;  5L3V A;  3DXJ F;  2NUP B;  1F1M A;  3OWT A;  4MVU A;  2R9R B;  2CW0 F;  2Y69 C;  2QNL A;  1QPU A;  3HTK C;  1MQV A;  4DRH B;  4J30 B;  4NTA A;  1E83 A;  1Z3I X;  1I5N A;  2H7O A;  2Q7R A;  4CDV A;  4YT2 A;  3PMR A;  1NLX A;  1A7D A;  3IQT A;  1NG1 A;  2WZF A;  3N2Z B;  4U5F E;  1TKN A;  1FMW A;  2YLD A;  4MW8 A;  1OKK A;  2XL6 A;  2EPL X;  5CI9 A;  1SMY F;  4HFK B;  4WGY A;  1XZQ A;  2YQY A;  4BJ1 A;  4Z9H A;  4JCZ A;  5L0F A;  2A69 F;  4MVO A;  4D4N A;  2YEV A;  2ZXO A;  3ASO C;  4YK5 A;  4ZLD A;  4IWB A;  1ZHX A;  1D1B A;  3VM6 A;  2DI3 A;  4JRZ A;  3X2Q C;  3ITF A;  1IW7 F;  2WVN A;  5DS4 A;  4O6Y A;  2J7P A;  4W8K A;  1LM3 B;  2XLV A;  1RMV A;  3Q7L A;  1B68 A;  3DI5 A;  5COM A;  1ZHY A;  4U5D E;  1VK5 A;  4IGG A;  4L6R A;  4KI2 A;  3ZG1 A;  2HJM A;  4DXW A;  2LFF A;  1GS9 A;  1U89 A;  1YA9 A;  2YKZ A;  3HNK A;  1JRA A;  3HLZ A;  5DQT A;  3EJN A;  2MWQ A;  5KYY B;  3EG9 B;  3Q6M A;  4A4A A;  4F4B A;  2YL1 A;  3MYF A;  3SXY A;  3IQC A;  4U5G A;  2WVO A;  5BUO A;  4E18 A;  1OCC C;  5D91 A;  2IM8 A;  4U9D A;  2W4M A;  5IY5 C;  3T6B A;  2R7V A;  4QI0 A;  2HMZ A;  1G5Z A;  2DB4 A;  3CZ6 A;  3FHD A;  3GOD A;  1FMV A;  2V26 A;  2O9X A;  2PF4 E;  3EFO A;  5KYW B;  2YRF A;  2FFH A;  2IYL D;  1DOW A;  2XLH A;  1RKE B;  4BJ6 A;  1S05 A;  4YL0 A;  2WZL A;  4H4K C;  1O87 A;  4K1O A;  1R5I D;  4GQH A;  5COG A;  5JP7 A;  5DVW A;  4EWC A;  1LVK A;  4MND A;  4NTB A;  3EZH A;  4PFO A;  3ZVR A;  1Y4C A;  2VAS A;  4XQ1 A;  1OW6 A;  2AU5 A;  3LS1 A;  3JZ0 A;  1SF8 A;  4BPM A;  3SP1 A;  4PFP A;  3C8G D;  3EGD A;  5FCL A;  3EQL F;  4JVS A;  1GM5 A;  3EGX B;  4XPX A;  4GYT A;  1AVO B;  4M63 A;  1AEP A;  3W2W A;  2D5R B;  4YL3 A;  3RVZ A;  2R7T A;  3GWL A;  4YT4 A;  2IOQ A;  2X51 A;  2R7R A;  1K40 A;  4AL0 A;  1RKE A;  3NYJ A;  3O55 A;  4OIO F;  4XLN F;  4I1O B;  2Q00 A;  1RCP A;  2VH3 A;  1C03 A;  2BL2 A;  3AQC A;  2FGY A;  4DBQ A;  3GAN A;  2A6E F;  2CNW D;  4OIR F;  2HV7 A;  1ZHZ A;  3EH2 A;  5TJ5 E;  1JPN A;  4O6N A;  1ORY A;  3EH1 A;  3NG1 A;  2PBE A;  3JSZ A;  1RXQ A;  3AG4 C;  3WHN A;  2HFI A;  4IAQ A;  1M57 C;  5JVE A;  1KTM A;  4ULV A;  3RQF A;  1HMD A;  3UMI A;  3B71 A;  3DJU B;  2MYS A;  3DD7 A;  4JTA B;  1SZI A;  4LDK A;  1Z6A A;  4D4X A;  4U5C E;  2J46 A;  2UUI A;  1M6T A;  2IXM A;  2KJG A;  1Q0D A;  4YJW A;  2VC9 A;  3SXM A;  4JE9 A;  2WVQ A;  2GDC A;  3TK0 A;  4FAP B;  4XLP F;  4KBL A;  3RKO F;  3QVY A;  4N6C A;  3T9O A;  3GWN A;  1YA7 O;  2Y3D A;  4AE4 A;  2LFD A;  1E85 A;  2YL0 A;  5CI8 A;  3RF3 A;  2XS8 A;  1G4W R;  4ER9 A;  3QW0 A;  4MVR A;  5DS5 A;  2L7A A;  1KU2 A;  2HJ3 A;  2LQG A;  3AQB A;  2A68 F;  4DRI B;  1M2V A;  1M2O A;  3E70 C;  2HV6 A;  2J8W A;  5B1B C;  1XZP A;  4IRU A;  2ZXW C;  4FX5 A;  3SYN A;  4CDY A;  3KPH A;  4E0H A;  2CCY A;  1UFB A;  3O39 A;  4AL1 A;  4P9T A;  4CSA C;  5F5H A;  3NMI A;  4MVS A;  2XL4 A;  2P0N A;  2XLD A;  3EZI A;  3V7O A;  3JT1 A;  3TJ5 A;  4EIY A;  1MMN A;  2XLM A;  4EKW A;  5HV9 A;  3SNH A;  4AE4 B;  2EPM X;  5HSW A;  1FR0 A;  1O3U A;  5F28 E;  2ZD9 A;  2I15 A;  3US6 A;  4OIQ F;  4OIP F;  4N4W A;  1ZW2 A;  1HY5 A;  5JUA A;  5L0D A;  3S0X A;  1QKR A;  2TMV P;  1T01 A;  3DE9 A;  3M1C B;  3UNG C;  3SZR A;  1MMD A;  2H7B A;  1I4Y A;  3ABM C;  3TJ6 A;  1J8Y F;  1APC A;  3ZTM A;  4C3B A;  4BJ5 C;  4EBK A;  2L81 A;  2Y3G A;  2ZXR A;  5KYU B;  1SYQ A;  3AGU A;  3KKB A;  5EK0 A;  3G4X A;  1YJG A;  1YZC A;  4C3D A;  4EHP A;  5EGY A;  4G7H F;  1AUE A;  1R4T A;  3GEE A;  2VCA A;  2CYD A;  4ULW A;  3N24 A;  5B3S C;  4PR9 A;  2L6F A;  3LLK A;  3IQ6 A;  2C03 A;  3B9Q A;  4W8P A;  2MHR A;  3U5S A;  3UR3 C;  3C8G B;  5FZT A;  2P61 A;  1ZHT A;  1OW8 A;  4DJ9 A;  4YWQ A;  5F5F A;  3I5P A;  1J8M F;  1MMG A;  3L1M A;  4PK4 A;  3TOM A;  2EPN A;  2J0W A;  4QI2 A;  5A6B A;  1HMO A;  5KYY A;  1CGN A;  2OOC A;  3RVY A;  1JPJ A;  3TQO A;  2UUH A;  5CIV A;  3MLG A;  4CJG A;  3U9M A;  3C8Z A;  5T1D B;  1CGM E;  3DAF A;  4CJO A;  3FDQ A;  1LS4 A;  3UMK A;  1MMA A;  2HKV A;  2EIN C;  2GA0 A;  3EHM A;  1WWP A;  2G3K A;  2XM4 A;  2YL7 A;  1LIH A;  3G50 A;  3H2V A;  3TOL A;  3C8G A;  4E7Z A;  1Q0G A;  1TR2 A;  4R32 A;  2CNW A;  5A6A A;  4CIH A;  3K6B A;  3C62 A;  5JSL A;  3RW0 A;  1GGQ A;  3NMJ A;  3DAG A;  4PAC A;  3LLI A;  2ASR A;  4IB4 A;  3B0V C;  4CSA A;  1NBB A;  1H7I A;  1VYI A;  2KNH A;  1DOV A;  1V4A A;  1ZZP A;  2LP4 A;  3FAJ A;  2QUP A;  3L8J A;  4JW1 A;  4I44 A;  5JLI A;  3SEO A;  3ABK C;  3M79 A;  3JSE O;  3L8I A;  5B3I A;  3J06 A;  2B0J A;  4JZA A;  1U6H A;  4ONS A;  5T3T A;  3WAQ A;  3TUL A;  3RIP A;  3K1I C;  4CS8 C;  2R7O A;  1BBH A;  3AOU A;  3EGX A;  3F47 A;  3L34 A;  1L7C A;  2AWC A;  1O5H A;  3DKA A;  4C3E A;  2LIG A;  3RQG A;  1RJ9 A;  3TD7 A;  4DVY P;  2J7P D;  3PHF 2;  3ZSU A;  3JCU Q;  2KQ9 A;  1LKX A;  1OXK A;  3KMI A;  4PJL A;  3ZDL A;  1YAR O;  3IPM O;  4HFF B;  3DJN B;  3HNL A;  4DRJ B;  2M64 A;  4DVZ A;  5A69 A;  1OR3 A;  2L6G A;  1D1C A;  3ASN C;  4X0R A;  1TWH A;  1BR2 A;  256B A;  3U0C A;  1I4Z A;  1Q0K A;  1BDJ B;  2R25 A;  5L0J A;  3S90 A;  1LI5 A;  1LE2 A;  2QTV A;  3C63 A;  2Y39 A;  3RYL A;  3ZIB A;  4CS9 A;  5L3Q A;  4MTO A;  2EPK X;  2B0H A;  3CSK A;  2YLG A;  1RJ9 B;  1LE4 A;  3EGD B;  3H2U A;  3U2L A;  3KYJ A;  1QZX A;  1WN0 A;  4MQ9 F;  4MVZ A;  3W2V A;  4E17 A;  2OG2 A;  3RQE A;  5DS6 A;  2V3C C;  4NY3 A;  4K0D A;  1L3P A;  4FES A;  3O10 A;  1KNY A;  1D1A A;  2Y3B A;  1ZU5 A;  3U3F A;  4UDV A;  1BR4 A;  2NG1 A;  3EG9 A;  2XSE A;  3IQ5 A;  3U2M A;  2C04 A;  3HJC A;  3KL4 A;  2Y3H A;  3DM5 A;  1FFT C;  4I1M A;  2XLE A;  2W9Y A;  3JRM O;  5BQH A;  2EIL C;  3DWW A;  3M4B A;  4G78 A;  3AGT A;  2G62 A;  2XM0 A;  3MYI A;  4K7B A;  3JTL O;  3LJB A;  3ZQY A;  2LSE A;  4G7Z F;  1FFH A;  1WAS A;  1VB5 A;  1YDI A;  4JJG A;  4JKV A;  5E2Q A;  2R7W A;  4LAC B;  3S28 A;  3UGO A;  3AJM A;  3NKD A;  2WB7 A;  2Q9A A;  3OA1 A;  2W4B A;  3R7C A;  2LCH A;  2PX0 A;  1H9G A;  1HE9 A;  5JT4 A;  2WZG A;  1ORJ A;  5DLJ A;  5K0I A;  2HSQ A;  4JTD B;  3LNM B;  3T6G B;  1RKC A;  1OQC A;  1C17 M;  2Z15 A;  2AP3 A;  4CBE A;  3UGP A;  3ECS A;  4KNV A;  3GM2 A;  1CPR A;  5AC4 A;  3KH2 A;  2JPU A;  2PNO A;  3FMS A;  4Z9J A;  2YZS A;  5L0I A;  1EKY A;  3G4Z A;  3KYI A;  1PV3 A;  4NC3 A;  1E2X A;  3BRJ A;  1TFO B;  3Q7G A;  3QZC A;  2YWA A;  4LER A;  1U0B B;  1NU7 D;  1NZE A;  1H6G A;  4JCH A;  2R7U A;  4NCQ A;  3Q6N A;  3ZC4 A;  1EI7 A;  1YYX A;  4YT5 A;  3WOD F;  4U5E E;  2P1A A;  3NRH A;  2YL3 A;  2A6H F;  2EIJ C;  2G3V A;  2H8A A;  3U8P A;  3QVZ A;  4YT8 A;  1JMW A;  2YHS A;  2XLW A;  2IXP A;  2OQM A;  5KYX A;  2QE9 A;  1OCO C;  1D0Y A;  5KYW A;  4AX2 A;  4WAB A;  4B6I A;  5B1A C;  2DGJ A;  2KGO A;  1YAU O;  1VOM A;  2RD9 A;  3NMK A;  1BR1 A;  3RFY A;  2R03 A;  3EHN A;  4DBR A;  1W2W A;  2HZ8 A;  1QLE C;  4EBJ A;  4PJM A;  3F46 A;  4YL1 A;  4A2N B;  1VTM P;  1OCZ C;  1CGO A;  2F22 A;  3JRT A;  3S29 A;  2J45 A;  1MNE A;  1ORS C;  1ST6 A;  5AC5 A;  3DM9 B;  1SR2 A;  5COF A;  4MW3 A;  5KYX B;  2R05 A;  2AWY A;  3QW1 A;  4LLC A;  3V5X A;  2XS1 A;  3LEO A;  3GM3 A;  3K1I A;  4CS8 A;  4LDR A;  5E3C A;  1FTS A;  1LI7 A;  2R7Q A;  3K66 A;  3CEX A;  3DZA A;  3NYM A;  4J7Y A;  4JEA A;  3AG3 C;  4KNW A;  2XXA A;  1OW7 A;  2A0U A;  4QDL A;  3O6X A;  1YYJ A;  2ZXP A;  1HE1 A;  3ZTZ A;  1CPQ A;  1M56 C;  1Q0F A;  3VRC A;  4AK9 A;  4MTG A;  1IZM A;  3LEV A;  2OCC C;  1HW2 A;  3IEE A;  2NPU A;  4IJJ A;  4E7S A;  1BZ4 A;  1LS1 A;  2GAQ A;  4CDA A;  5GPG B;  2LK4 A;  3FOO A;  2Q9C A;  3R2P A;  3VYW A;  4C7O A;  3VF0 A;  3JYH A;  4OD5 A;  3AG1 C;  3M4C A;  4U5B E;  1VLT A;  3T4R A;  1OXB A;  2JD3 A;  2A0B A;  2E87 A;  3X1O A;  4DOZ A;  4I3M A;  3QMK A;  3VAY A;  3ABL C;  5A6B D;  2L6H A;  2XXA B;  1JR8 A;  5E33 A;  2X0C A;  2HMQ A;  2Q3T A;  2P6V A;  3MFN A;  3SXZ A;  1VMA A;  1S7Z A;  2HUJ A;  2VCB A;  2KK1 A;  3FXH A;  1H9T A;  1PCX A;  2PX3 A;  2OJQ A;  2JX0 A;  4XEK A;  3W4Y A;  5L0G A;  1T6Q A;  1V55 C;  2OU6 A;  4O79 A;  2WL8 A;  4J32 B;  1ZU4 A;  5JS5 A;  2DYR C;  4Q4Z F;  2OKU A;  3K1H A;  3A11 A;  4ANJ A;  1A41 A;  1WOL A;  3LES A;  1ZW3 A;  4Q7C A;  4YN0 B;  2NUT A;  3FVY A;  2NSG A;  1EQ1 A;  2J9V A;  3C7J A;  4N06 A;  2HS5 A;  3IHU A;  4XEF A;  3FAP B;  3S27 A;  3K33 A;  3W8H A;  2Q9B A;  4JIO A;  1UG7 A;  1A7E A;  4JEB A;  4P6I C;  4U9E A;  4BJ5 A;  2KYH A;  1MND A;  1YZA A;  2D4U A;  1ZVZ A;  2OEV A;  2YLI A;  4GEH A;  1T6U A;  3HNJ A;  2J9W A;  3POV A;  2CGE A; 
#chains in the Genus database with same CATH homology
 1N1C A;  4XWJ A;  4CS9 C;  2IXN A;  1OKK D;  1PD0 A;  3DMD A;  4O7G A;  4WJ0 A;  3B0U X;  4G7O F;  3NYL A;  2BE5 F;  4BEJ A;  2VB6 A;  3WG7 C;  1Z63 A;  3T6J A;  2ZPA A;  1M2V B;  4IAO A;  1G8X A;  4LLE A;  1ZYR F;  2QY9 A;  2L9J A;  4G0H A;  4RBN A;  2IXO A;  4EBB A;  3LNR A;  2DYS C;  3I5Q A;  1OCR C;  5E3A A;  4PJJ A;  2M4E A;  2J9U A;  1D0Z A;  2PFD A;  4XTK A;  1V54 C;  2EIK C;  4HEA J;  2H7V C;  2R7X A;  3LS0 A;  1PD1 A;  3MX3 A;  1TWA A;  3NKE A;  4BJ6 C;  4C7O B;  3OEO A;  3UMH A;  4JJF A;  3AG2 C;  3NDB B;  3H65 A;  1ZHW A;  2EIM C;  4CS7 A;  4FWV A;  5T3W A;  1Z23 A;  4O6M A;  3K7D A;  3B0P A;  1VYK A;  4RD9 A;  4U5H A;  3I4U A;  2I8B A;  3EFO B;  5KYW A;  4OD4 A;  1WGW A;  3E9V A;  2XRH A;  5EHH A;  4BJT A;  4OIN F;  4Q5S F;  2NUT B;  3LAY A;  3N0T A;  5D92 A;  2NUP A;  2J0X A;  4JUR I;  4BG0 A;  2KW3 C;  1TWG A;  4PJN A;  3L0I A;  5DQZ A;  3RH3 A;  3W8I A;  4KC9 A;  2A1D D;  3CQZ A;  1TWC A;  5KYU A;  2P7V A;  4HE8 D;  4ZLC A;  4RDA A;  2CDQ A;  2GFH A;  2W45 A;  1D0X A;  1NU9 C;  2PP4 A;  3EPV A;  5KYN A;  2R7S A;  1Z5Z A;  5L3V A;  3DXJ F;  2NUP B;  3OWT A;  2CW0 F;  2Y69 C;  3HTK C;  4J30 B;  1Z3I X;  2H7O A;  4YT2 A;  3PMR A;  1NG1 A;  2WZF A;  3N2Z B;  4U5F E;  1TKN A;  1FMW A;  1OKK A;  5CI9 A;  1SMY F;  4HFK B;  4BJ1 A;  2A69 F;  2YEV A;  2ZXO A;  3ASO C;  4ZLD A;  4IWB A;  1ZHX A;  1D1B A;  3X2Q C;  3ITF A;  1IW7 F;  2WVN A;  5DS4 A;  4O6Y A;  2J7P A;  4W8K A;  3Q7L A;  1ZHY A;  4U5D E;  1VK5 A;  4KI2 A;  3ZG1 A;  5FCL A;  5DQT A;  3HLZ A;  3EJN A;  2MWQ A;  5KYY B;  3EG9 B;  3Q6M A;  4F4B A;  5BUO A;  4U5G A;  2WVO A;  1OCC C;  5D91 A;  5IY5 C;  2W4M A;  3T6B A;  2R7V A;  4QI0 A;  3CZ6 A;  3FHD A;  3GOD A;  1FMV A;  2V26 A;  2O9X A;  2PF4 E;  3EFO A;  5KYW B;  2FFH A;  2IYL D;  4BJ6 A;  2WZL A;  4H4K C;  1O87 A;  4EWC A;  5DVW A;  1LVK A;  4MND A;  3EZH A;  4PFO A;  3ZVR A;  2VAS A;  3LS1 A;  1SF8 A;  3SP1 A;  4PFP A;  3EGD A;  3EQL F;  4JVS A;  3EGX B;  4GYT A;  4M63 A;  3W2W A;  2D5R B;  2R7T A;  4YT4 A;  2IOQ A;  2X51 A;  2R7R A;  3NYJ A;  4OIO F;  4XLN F;  4I1O B;  2VH3 A;  3AQC A;  2FGY A;  4DBQ A;  3GAN A;  2A6E F;  2CNW D;  4OIR F;  2HV7 A;  1ZHZ A;  3EH2 A;  1JPN A;  4O6N A;  3NG1 A;  3EH1 A;  3JSZ A;  3AG4 C;  1M57 C;  3UMI A;  3DJU B;  2MYS A;  3DD7 A;  1SZI A;  1Z6A A;  4U5C E;  2J46 A;  2IXM A;  2KJG A;  4YJW A;  2WVQ A;  4XLP F;  4KBL A;  3RKO F;  2Y3D A;  4AE4 A;  5CI8 A;  5DS5 A;  1KU2 A;  3AQB A;  2A68 F;  1M2V A;  1M2O A;  3E70 C;  2HV6 A;  5B1B C;  4IRU A;  2ZXW C;  4FX5 A;  3SYN A;  3O39 A;  4CSA C;  5F5H A;  2XL4 A;  3V7O A;  3EZI A;  3JT1 A;  1MMN A;  3SNH A;  4AE4 B;  5HSW A;  4OIQ F;  4OIP F;  3S0X A;  3M1C B;  3UNG C;  3SZR A;  1MMD A;  2H7B A;  3ABM C;  1J8Y F;  4C3B A;  5KYU B;  4BJ5 C;  2L81 A;  2Y3G A;  2ZXR A;  3KKB A;  4C3D A;  5EGY A;  4G7H F;  4ULW A;  3N24 A;  3LLK A;  2C03 A;  3B9Q A;  3UR3 C;  1ZHT A;  4YWQ A;  5F5F A;  3I5P A;  1J8M F;  1MMG A;  4PK4 A;  2J0W A;  4QI2 A;  5KYY A;  1JPJ A;  3MLG A;  5T1D B;  3DAF A;  3FDQ A;  3UMK A;  1MMA A;  2EIN C;  3EHM A;  2G3K A;  4E7Z A;  1TR2 A;  2CNW A;  3K6B A;  3DAG A;  3LLI A;  3B0V C;  4CSA A;  2KNH A;  1VYI A;  3FAJ A;  4JW1 A;  4I44 A;  3SEO A;  3ABK C;  2B0J A;  4JZA A;  5T3T A;  3RIP A;  3K1I C;  4CS8 C;  2R7O A;  3EGX A;  3F47 A;  3L34 A;  1O5H A;  4C3E A;  1RJ9 A;  3TD7 A;  4DVY P;  2J7P D;  3PHF 2;  3ZSU A;  3JCU Q;  2KQ9 A;  1LKX A;  3KMI A;  4PJL A;  4HFF B;  3DJN B;  4DVZ A;  1D1C A;  3ASN C;  4X0R A;  1TWH A;  1BR2 A;  3RYL A;  2QTV A;  2Y39 A;  3ZIB A;  4CS9 A;  5L3Q A;  3EGD B;  3CSK A;  1RJ9 B;  4CIH A;  1QZX A;  4MQ9 F;  3W2V A;  5DS6 A;  2V3C C;  2OG2 A;  4NY3 A;  4K0D A;  4FES A;  2Y3B A;  1D1A A;  1ZU5 A;  1BR4 A;  2NG1 A;  3EG9 A;  2XSE A;  2C04 A;  3HJC A;  3KL4 A;  2Y3H A;  3DM5 A;  1FFT C;  4I1M A;  2W9Y A;  2EIL C;  2G62 A;  4K7B A;  3LJB A;  4G7Z F;  2LSE A;  1FFH A;  4JJG A;  5E2Q A;  2R7W A;  4LAC B;  3S28 A;  3UGO A;  3NKD A;  2WB7 A;  2Q9A A;  3OA1 A;  2W4B A;  2PX0 A;  2WZG A;  5DLJ A;  2Z15 A;  4CBE A;  3UGP A;  3ECS A;  4KNV A;  3KH2 A;  2YZS A;  3Q7G A;  3QZC A;  4LER A;  1NU7 D;  1NZE A;  4JCH A;  2R7U A;  3Q6N A;  3ZC4 A;  3WOD F;  4YT5 A;  4U5E E;  3NRH A;  2A6H F;  2EIJ C;  2G3V A;  4YT8 A;  2YHS A;  2IXP A;  5KYX A;  1OCO C;  1D0Y A;  4AX2 A;  4B6I A;  5B1A C;  2DGJ A;  2KGO A;  1VOM A;  1BR1 A;  3RFY A;  3EHN A;  4DBR A;  1W2W A;  1QLE C;  4PJM A;  3F46 A;  4A2N B;  1OCZ C;  3JRT A;  3S29 A;  1MNE A;  2J45 A;  1ST6 A;  3DM9 B;  5KYX B;  4LLC A;  4CS8 A;  5E3C A;  1FTS A;  3K66 A;  2R7Q A;  3NYM A;  5B3S C;  3DZA A;  4KNW A;  2XXA A;  3AG3 C;  4QDL A;  3O6X A;  2ZXP A;  1M56 C;  4AK9 A;  1IZM A;  3LEV A;  2OCC C;  3IEE A;  4IJJ A;  4E7S A;  1LS1 A;  4C7O A;  2Q9C A;  3VYW A;  3JYH A;  4OD5 A;  3AG1 C;  4U5B E;  3T4R A;  2JD3 A;  2E87 A;  3X1O A;  4DOZ A;  4I3M A;  3QMK A;  3VAY A;  3ABL C;  2XXA B;  5E33 A;  2Q3T A;  2P6V A;  1VMA A;  1S7Z A;  1PCX A;  2PX3 A;  1V55 C;  4O79 A;  2WL8 A;  4J32 B;  1ZU4 A;  2DYR C;  4Q4Z F;  3K1H A;  4ANJ A;  3LES A;  4Q7C A;  4YN0 B;  2NUT A;  3FVY A;  2J9V A;  4N06 A;  3S27 A;  3K33 A;  3W8H A;  2Q9B A;  4P6I C;  4BJ5 A;  1MND A;  4GEH A;  2J9W A;  3POV A;  2CGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...