2KW3C

Heterotrimeric interaction between rfx5 and rfxap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RFX5
publication title Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kw3C00
2KW3C
chains in the Genus database with same CATH superfamily
3DJUB 3I4UA 4AL1A 1FFTC 2AWYA 3EPVA 1NFNA 2J9VA 1JMWA 3HKKA 1T6QA 3EG9A 3K33A 4KBLA 2R7WA 3UR3C 4CDYA 2ZPAA 4J32B 4MVZA 2A68F 1LI5A 2EPMX 4MVQA 2J9BA 2R7OA 2XL8A 3GM1A 5JRAA 3NMIA 2IXPA 2Q9BA 4BJ5C 4MVSA 3C63A 2XLMA 4D4XA 5FCLA 4XPWA 2A0BA 1R4TA 1Y6DA 2RD9A 3Q6NA 3AG1C 1MMDA 4FWVA 2L81A 2L7AA 1Z7Qc 4G7OF 4DOZA 1K05A 2M64A 3QZCA 5L0CA 1LKXA 4CS9C 3TOLA 5L3VA 4U5BE 3NKEA 3S0XA 2XXAB 1GM5A 1NU9C 3E70C 1U0BB 3JYHA 2OEXA 4HEAJ 3FVYA 3C8GB 3LNRA 5F5HA 2XLEA 4DRJB 4E7ZA 2O9XA 4U5HA 3LAYA 2HV6A 3ZTZA 4EBKA 3S84A 3GEEA 1CPQA 2G3KA 2XS8A 3KMIA 4JW1A 3ABKC 2P61A 4OINF 4W8KA 4YT4A 5KYNA 4KI2A 1J8MF 2KGOA 1AEPA 1LPEA 5B3IA 2GAQA 1JPNA 3HNJA 4JJFA 1JOGA 3RYLA 1KTMA 3ABMC 2XL4A 3HNLA 2EILC 3E9VA 4N6CA 4CS7A 5TJ5E 3TOMA 4MTGA 4C3BA 2R7VA 4GEHA 3TQOA 2IM8A 4YK5A 1Z3IX 1PV3A 1CGOA 1MNEA 2VCAA 1SMYF 2J45A 5B3SC 4DBRA 4IAOA 5CI9A 2AP3A 4XLNF 4PJJA 2NUPB 5F5FA 2WZGA 2YRFA 3ATPA 4NTAA 3AQBA 2J7PA 3MYFA 2VB6A 3KKBA 3RH3A 3U9JA 5L3QA 3DD7A 3MX3A 2HSBA 3IQTA 4Q7CA 1ZW3A 4PFOA 4MVMA 1SF8A 5L0JA 1TWAA 4LLEA 3ZSUA 2YQYA 2NSFA 1K04A 3MLGA 2LSEA 3L34A 2OJQA 4JE9A 3U2LA 1YVIA 3S29A 1EKYA 4N4WA 2ZXPA 4YWQA 2FAPB 4MTOA 3PHF2 5E2QA 4C3EA 5COFA 3F47A 2J46A 4C7OA 3GORA 1Z5ZA 4YJWA 1AVOB 3LLKA 3T6GB 2A1DD 2KK1A 4NCQA 3IEEA 1C17M 1ZHYA 1VK5A 1GQAA 1FMWA 4N06A 3RVZA 4CX9A 1H9TA 1QVXA 1WWPA 1A7DA 2OQMA 3WHNA 1A7EA 3US6A 2V3CC 3FMSA 5T3TA 3VAYA 1OCRC 2PBEA 1LE2A 3QVZA 3G50A 2Q00A 1M56C 3AG4C 1G4WR 3FAPB 1WASA 2YL3A 3EH1A 3JCUQ 1N1CA 3JSZA 3K66A 1HW1A 4HE8D 5KYUA 4CBEA 1ZHXA 2YHSA 3DMDA 2NSGA 3FOPA 2XLOA 4IARA 2CCYA 1D0ZA 3S27A 3IPMO 3QTHA 5HV9A 3OA1A 2WZLA 4CDAA 2EPNA 5DVWA 1JPJA 2MWQA 5DS5A 1TFOB 2GDCA 2KJGA 1IW7F 1SYQA 2PF4E 3OEOA 2J9WA 1PD1A 4O7GA 1H6GA 4NTBA 3W2VA 3A9CA 2ETSA 2IYLD 3NRHA 4LERA 4OIPF 3FAJA 3C62A 5DS6A 4NC3A 2HSQA 4H54A 5COMA 3ZTMA 2V26A 2G62A 2HZ8A 4YT2A 2EIJC 3F46A 2J8WA 1T9KA 1VTMP 2OCCC 1D1AA 2CNWA 3GWNA 1YA7O 1MMGA 3I5QA 1H7IA 4JIOA 1TWHA 4O6NA 4RBNA 4X0RA 3L1MA 5A6AA 1T5OA 1MMNA 2EPLX 1OW8A 2RSEB 1G4US 1H9GA 3EHMA 3VRCA 1ZYRF 4YL1A 5KYYA 1OW7A 3UMHA 2PFDA 2IXMA 1NLXA 3QW1A 1XZQA 1VLTA 3EQLF 4CJOA 4NQFA 2Y3HA 2MYSA 1B68A 4YL3A 4AE4A 4CJGA 2GFHA 1RKCA 2J7PD 1TWGA 3N0TA 3RF3A 5KYXB 3DI5A 4PK4A 1D0XA 1ZVZA 5BQIA 2WVOA 3UGOA 1LS1A 1EI7A 2A6EF 2FGYA 2ZD9A 3GM2A 2TMVP 1RKEB 2H8AA 2L6GA 2F22A 3FXHA 3LS0A 3EGDB 4MW8A 1XWJA 5EK0A 1JAFA 3AG2C 1HMOA 1LS4A 3S90A 4WGZA 3T6BA 1V74B 1M2VA 2HUJA 1Z23A 2IXOA 1D0YA 3IQ6A 4JTAB 4QI0A 5L0HA 1WTYA 1C03A 2HJMA 3VYWA 2J0WA 1E83A 2UUIA 3K1IC 2YWAA 3MFNA 3ASNC 3GEHA 2XLVA 2LFDA 3O10A 3NKDA 256BA 3B0PA 3KPHA 4JURI 1M2OA 1Z6AA 4GQHA 3S9OA 1YDIA 3IQCA 4FESA 4MQ9F 2LQGA 1VLSA 4YL0A 2CYDA 1BR2A 2IBFA 1FAPB 3RQEA 2R03A 3WAQA 2AWCA 1T6IA 3FOOA 3Q7GA 1YARO 2XM4A 3EZIA 3N24A 3RVYA 3DWWA 1ORYA 4DVZA 5B1BC 2QTVA 4E0HA 3GM3A 5KYXA 3IQ5A 1WGWA 4K1OA 1VYKA 3SXZA 3ZVRA 3L8JA 4EWCA 3W8HA 5D92A 3GEIA 4L6RA 5DLJA 2XM0A 1I4ZA 4LLCA 5IY5C 1OXBA 2Q7RA 4BJ6C 1IZMA 1U6HA 4JJGA 1BZ4A 4XPXA 2M4EA 2H7VC 2NUTB 1NG1A 4EUKB 4CSAA 3DAGA 1ZU4A 1VOMA 4ULWA 5A6BD 4EBJA 1K40A 1D1CA 4OIQF 4O6YA 4BJTA 4J7TA 1FFHA 3NMJA 4NTFA 3HLZA 2CNWD 3RKOF 3U3BA 3EH2A 4KNVA 3ZG1A 5DQZA 2Q4FA 3OWTA 4P9FA 2HS5A 2YL7A 4JRZA 1RJ9A 5E33A 1QKRA 3EFOA 1YYJA 3SXKA 4E18A 1MQVA 4WGYA 1WATA 5BQGA 3W4YA 5DQTA 1PD0A 3EG9B 3H65A 3LUTB 3SZRA 1DOWA 1TFKB 5F28E 2KNHA 3DKAA 1KNYA 2H7OA 2PP4A 5BUOA 2Y39A 5JUAA 3NG1A 3N2ZB 1BR4A 4GYTA 2OKUA 5CI8A 1RXQA 2ZXRA 5KYWA 2L6HA 4QI2A 1Q0DA 2KC3A 1SR2A 4MVRA 4XEKA 1VB5A 4PJMA 4F4BA 2R7XA 1R5ID 3LLIA 4YT8A 3B29A 3O55A 3X2QC 2J0XA 1A41A 3DZAA 1W2WA 1FTSA 4J30B 2JD3A 4LDRA 1OQCA 2P1AA 4BJ1A 2HMZA 2R7RA 2XL6A 4U5CE 5EHHA 3EGXA 5A69A 1QZXA 1ORSC 1L7CA 4Z9HA 2YVKA 3U8VA 3SP1A 3AGUA 2EIKC 4OIOF 4K0DA 1YA9A 4OIRF 2BL2A 3U9MA 1ZHWA 1TKNA 3ECSA 2PX3A 3U5SA 2PNOA 3EJNA 1V55C 4PJLA 4RD9A 4DJ9A 4BPMA 3U3FA 3TULA 4IAQA 2YLGA 4C3DA 2AU5A 3L0IA 4P6IC 3BRJA 2R7TA 2VASA 1I4YA 4JVSA 2JPUA 3LNMB 1RCPA 2DYRC 2YL0A 4H4KC 3M1CB 4JEAA 3ZWIA 5L0GA 4Z9JA 4CS8A 2HFIA 4JCHA 1NSGB 2AVKA 2R7QA 3NYLA 3ITFA 3JZ0A 2VCBA 1ST6A 2CDQA 3KL4A 2Q3TA 4JTDB 4LACB 2H7BA 3J06A 3VF0A 3V5XA 3I5PA 3TJ5A 4ANJA 4CIHA 3DM9B 2A0UA 3AQCA 1Z63A 1D1BA 2HKVA 2MHRA 1L3PA 1HE1A 2G3VA 3C7JA 5AGFA 5E3CA 3UMIA 2HJ3A 4QDLA 1GS9A 4K7BA 3Q6MA 2B0HA 1YAUO 2WVQA 2HMQA 3WODF 1C02A 3K7DA 4ER9A 1BBHA 3HNIA 3V5YA 1OCOC 1CPRA 5E3AA 3DXJF 3T6JA 2ZXWC 2I8BA 3O6XA 1QLEC 2PX0A 2YLDA 3ZQVA 4BJ5A 3CSKA 4EBBA 2BE5F 1LM3B 1VYIA 2OJED 4IGGA 2A6HF 4Z9IA 5A6JA 4C7OB 3NMKA 4Q5SF 4D4NA 3JYYA 2IXNA 4AX2A 5FZTA 3AJMA 4XPYA 3UMKA 4CS9A 2XXAA 3NDBB 3IHUA 4BEMJ 2I15A 4U5DE 3SXMA 1ZHZA 3C8GA 5A6BA 4O6MA 1FR0A 4P9TA 5KYUB 1YLMA 2R05A 2Y69C 3K1HA 2R9RB 4PACA 4JCZA 4PFPA 4JZAA 2W45A 4BG0A 1V4AA 2P7VA 1Q0MA 3G4ZA 2WZFA 2QY9A 1Q0FA 2W4BA 2YL1A 1QQ3A 4XWJA 3S28A 2KQ9A 3SYNA 4B6IA 2DI3A 4XTKA 4FAPB 3L8IA 2W9YA 4ONSA 1YYXA 4RDAA 4CDVA 3ZQYA 2GA0A 4NY3A 5B1AC 4HFFB 1APCA 3NYMA 3T9OA 2BC5A 1YZCA 5L0FA 1OR3A 3NYJA 4G0HA 4N6HA 2LCHA 1S7ZA 2Y3GA 2NUPA 4A2NB 4DXWA 1GGQA 3C18A 4R32A 5HSWA 4EHPA 3K6BA 1JR8A 2ICWG 4IB4A 3EZHA 1YJGA 5L0IA 3POVA 1OXKA 4U5EE 5AC5A 2QNLA 4BEJA 1NBBA 2YZSA 3LEVA 4IJJA 1S05A 4JEBA 2Q9AA 4MTFA 3R7CA 2Y3DA 3QVYA 3BEHA 2X51A 3ZIBA 5KYYB 2E87A 3VM6A 5EGYA 2L6FA 4WABA 1WN0A 2Y3BA 1E84A 2R7UA 4AE4B 2EINC 2R25A 2NPUA 1MMAA 4DRHB 3DE8A 2XS1A 5L0DA 2EPKX 3R2PA 4U5GA 4M63A 1PCXA 2D4UA 2OU6A 1HY5A 3DM5A 1CGME 2HV7A 2NG1A 3B0VC 4A4AA 4CS8C 3M4BA 4HFKB 1WOLA 3UGPA 1LIHA 1E2XA 2VCCA 2WVNA 3PMRA 3HJCA 3CAXA 4AK9A 1NZEA 2XLWA 2XLHA 2VH3A 4XEFA 2XSEA 1M2VB 3MBGA 4J7YA 3U0CA 4LDQA 2A69F 4PJNA 3AG3C 1J8YF 2WL8A 3B9QA 2DB4A 5COGA 1Q0GA 3LS1A 3RQGA 1YZAA 4YN0B 2OOCA 2C03A 1M6TA 2JX0A 5JLIA 2QLAA 2UUHA 4OD4A 3AOUA 2X0CA 1LE4A 2DYSC 2KSFA 2C04A 1OW6A 2EIMC 2VC9A 3C8GD 1G8XA 3KH2A 3ZDLA 3U2MA 5JP7A 5CIVA 2Q9CA 4IRUA 1ZU5A 4YT5A 3TJ6A 4ZLDA 3PCVA 1G5ZA 5AC4A 3QW0A 4E17A 3V7OA 3LESA 5BQHA 4AL0A 1I5NA 3X1OA 1O3UA 4DRIB 5JVEA 3T4RA 1ZW2A 1FMVA 4JKVA 2ZXOA 4JC7A 3B71A 3M4CA 5JSLA 3UNGC 3GANA 1OKKA 1FNTc 3M79A 4MVOA 4CIPA 2CW0F 4CSAC 3TK0A 1QSPA 4U9DA 2DGJA 2LK4A 2EPOA 1NU7D 1TWCA 1UG7A 2YKZA 3JRTA 4MVUA 2J9UA 1Q0KA 1NFOA 3G4XA 1QPUA 4U9EA 1BDJB 3JTLO 4WJ0A 4XQ1A 3SNHA 4XLPF 1AUEA 5D91A 3GWLA 3JSEO 3LEOA 1V54C 2KYHA 2D5RB 2P6VA 3W2WA 3JRMO 3KYJA 3RFYA 3V5ZA 4Q4ZF 4DBQA 4I3MA 3SEOA 3LJBA 1RJ9B 1TQGA 2CGEA 2ASRA 2KW3C 1RKEA 2XLDA 3EHNA 3EFOB 3O39A 3TD7A 1CGNA 3EGDA 3ASOC 3FHDA 1Y4CA 5JT4A 4IWBA 1RMVA 4KNWA 4W8PA 2LFFA 1M57C 3DJNB 1EQ1A 2YLIA 3PDMP 3MYIA 2OG2A 5JS5A 1HMDA 1ORJA 5T3WA 1JRAA 2L9JA 1VMAA 1O87A 5T1DB 2FFHA 3HTKC 4PR9A 4O79A 2R02A 3KYIA 5GPGB 3CZ6A 4MNDA 3K1IA 1UFBA 3M15A 5KYWB 2R7SA 1T6UA 4KC9A 2B0JA 4MS2A 2XRHA 3SXYA 2P0NA 4E0IA 4E7SA 1BR1A 5DS4A 2Z15A 1HW2A 1A7VA 1LVKA 4ULVA 4I1MA 2LP4A 3RW0A 2QE9A 1HE9A 1U89A 1ZHTA 4U5FE 4XEVA 3RIPA 3ABLC 3CEXA 1MNDA 3EGXB 3B0UX 2GWWA 1E85A 4I44A 3RQFA 4EIYA 3QMKA 1EA8A 4DVYP 1E86A 2QUPA 4G7ZF 3CQZA 4EKWA 3GODA 3DAFA 4I1OB 1OCCC 4BJ6A 3DE9A 2NUTA 1TR2A 1ZZPA 4MW3A 2W4MA 3W8IA 1XZPA 3HNKA 4FX5A 2OEVA 3JT1A 1F1MA 2WB7A 1DOVA 5K0IA 3WG7C 2LD6A 5A6KA 3U8PA 4LDKA 4G78A 1SZIA 4G7HF 1T01A 3H2UA 4ZLCA 4UDVA 2LIGA 3A11A 1O5HA 1A0BA 1OR2A 3H2VA 3ZC4A 2YEVA 4JTCB 1KU2A 2IOQA 3C8ZA 1LI7A 1OCZC 4OD5A 3FDQA 1OKKD 3Q7LA 3AGTA
chains in the Genus database with same CATH topology
3DJUB 3I4UA 1FFTC 3EPVA 3K33A 2J9VA 4KBLA 2R7WA 3EG9A 3UR3C 2ZPAA 4J32B 2A68F 2R7OA 2IXPA 2Q9BA 4BJ5C 5FCLA 3Q6NA 3AG1C 1MMDA 4FWVA 2L81A 4G7OF 4DOZA 3QZCA 1LKXA 4CS9C 5L3VA 4U5BE 3NKEA 3S0XA 2XXAB 1NU9C 3E70C 3JYHA 4HEAJ 3FVYA 3LNRA 5F5HA 4E7ZA 2O9XA 4U5HA 3LAYA 2HV6A 2G3KA 4JW1A 3KMIA 3ABKC 4OINF 4YT4A 4W8KA 5KYNA 4KI2A 1J8MF 2KGOA 1JPNA 4JJFA 3ABMC 2XL4A 2EILC 3E9VA 4CS7A 4C3BA 2R7VA 4GEHA 1Z3IX 1MNEA 1SMYF 2J45A 5B3SC 4IAOA 5CI9A 4XLNF 4PJJA 2NUPB 5F5FA 2WZGA 3AQBA 2J7PA 2VB6A 3KKBA 3RH3A 5L3QA 3DD7A 3MX3A 4Q7CA 4PFOA 1SF8A 1TWAA 4LLEA 3ZSUA 3MLGA 2LSEA 3L34A 3S29A 2ZXPA 4YWQA 3PHF2 5E2QA 4C3EA 3F47A 2J46A 4C7OA 4YJWA 1Z5ZA 3LLKA 2A1DD 3IEEA 1ZHYA 1VK5A 4N06A 1FMWA 2V3CC 5T3TA 3VAYA 1OCRC 1M56C 3AG4C 3K66A 3EH1A 3JCUQ 3JSZA 4HE8D 1N1CA 5KYUA 4CBEA 1ZHXA 2YHSA 3DMDA 1D0ZA 3S27A 3OA1A 2WZLA 5DVWA 1JPJA 2MWQA 5DS5A 2KJGA 1IW7F 2PF4E 4O7GA 2J9WA 1PD1A 3W2VA 2IYLD 3NRHA 4LERA 4OIPF 3FAJA 5DS6A 2V26A 2G62A 4YT2A 2EIJC 3F46A 2OCCC 1D1AA 2CNWA 4O6NA 1MMGA 3I5QA 1TWHA 4X0RA 4RBNA 1MMNA 3EHMA 1ZYRF 5KYYA 3UMHA 2PFDA 2IXMA 3EQLF 2Y3HA 2MYSA 4AE4A 2GFHA 2J7PD 1TWGA 3N0TA 5KYXB 4PK4A 1D0XA 2WVOA 3UGOA 1LS1A 2A6EF 2FGYA 3LS0A 4CS8A 3EGDB 3AG2C 3T6BA 1M2VA 1Z23A 2IXOA 1D0YA 4QI0A 3VYWA 2J0WA 3K1IC 4I44A 3OEOA 3ASNC 3RYLA 4JURI 3NKDA 3B0PA 1M2OA 1Z6AA 4FESA 4MQ9F 1BR2A 3Q7GA 3EZIA 3N24A 4DVZA 5B1BC 2QTVA 1WGWA 1VYKA 3ZVRA 4EWCA 3W8HA 5D92A 5DLJA 5IY5C 4LLCA 4BJ6C 1IZMA 4JJGA 2M4EA 2H7VC 2NUTB 1NG1A 4CSAA 3DAGA 1ZU4A 1VOMA 4ULWA 1D1CA 4OIQF 4O6YA 4BJTA 1FFHA 3HLZA 2CNWD 3RKOF 3ZG1A 3EH2A 4KNVA 5DQZA 3OWTA 5E33A 1RJ9A 3EFOA 5DQTA 1PD0A 3EG9B 3H65A 3SZRA 2KNHA 2H7OA 2PP4A 5BUOA 2Y39A 3NG1A 3N2ZB 1BR4A 4GYTA 5CI8A 4QI2A 2ZXRA 5KYWA 4F4BA 4PJMA 2R7XA 3LLIA 4YT8A 3X2QC 2J0XA 3DZAA 1W2WA 1FTSA 4J30B 2JD3A 4BJ1A 2R7RA 4U5CE 5EHHA 3EGXA 1QZXA 3SP1A 2EIKC 4OIOF 4K0DA 4OIRF 1ZHWA 1TKNA 3ECSA 2PX3A 3EJNA 1V55C 4PJLA 4RD9A 4C3DA 3L0IA 4P6IC 2R7TA 2VASA 4JVSA 4H4KC 2DYRC 3M1CB 4JCHA 2R7QA 3NYLA 3KL4A 3ITFA 4LACB 1ST6A 2CDQA 2Q3TA 2H7BA 3I5PA 4ANJA 4CIHA 3DM9B 3AQCA 1Z63A 1D1BA 2G3VA 5E3CA 3UMIA 4QDLA 4K7BA 3Q6MA 2WVQA 3WODF 3K7DA 1OCOC 5E3AA 3DXJF 3T6JA 2ZXWC 2I8BA 3O6XA 1QLEC 2PX0A 4BJ5A 4EBBA 3CSKA 2BE5F 1VYIA 2A6HF 4C7OB 4Q5SF 2IXNA 4AX2A 3UMKA 4CS9A 2XXAA 3NDBB 4U5DE 1ZHZA 4O6MA 5KYUB 2Y69C 3K1HA 4PFPA 4JZAA 2W45A 4BG0A 2P7VA 2WZFA 2QY9A 2W4BA 4XWJA 4B6IA 3S28A 2KQ9A 3SYNA 4XTKA 2W9YA 4RDAA 4NY3A 5B1AC 4HFFB 3NYMA 3NYJA 4G0HA 1S7ZA 2Y3GA 2NUPA 5HSWA 3K6BA 3EZHA 3POVA 4U5EE 4BEJA 2YZSA 3LEVA 4IJJA 2Q9AA 2Y3DA 2X51A 3ZIBA 5KYYB 2E87A 5EGYA 2Y3BA 2R7UA 4AE4B 2EINC 1MMAA 4U5GA 4M63A 1PCXA 3DM5A 2HV7A 2NG1A 3B0VC 4CS8C 4HFKB 3UGPA 2WVNA 3PMRA 3HJCA 4AK9A 1NZEA 2VH3A 2XSEA 1M2VB 2A69F 4PJNA 3AG3C 1J8YF 2WL8A 3B9QA 3LS1A 4YN0B 2C03A 4OD4A 2DYSC 2C04A 2EIMC 3KH2A 1G8XA 2Q9CA 4IRUA 1ZU5A 4YT5A 4ZLDA 3V7OA 3LESA 3X1OA 3T4RA 1FMVA 2ZXOA 3UNGC 3GANA 1OKKA 2CW0F 4CSAC 2DGJA 1NU7D 1TWCA 3JRTA 2J9UA 3SNHA 4WJ0A 4XLPF 5D91A 5KYXA 1V54C 2P6VA 2D5RB 3W2WA 4Q4ZF 3RFYA 4DBQA 4I3MA 3SEOA 3LJBA 1RJ9B 2CGEA 2KW3C 3EHNA 3EFOB 3O39A 3TD7A 3EGDA 3ASOC 3FHDA 4IWBA 4KNWA 1M57C 3DJNB 2OG2A 5T3WA 2L9JA 1VMAA 1O87A 5T1DB 2FFHA 3HTKC 4O79A 5KYWB 3CZ6A 4MNDA 2R7SA 4KC9A 2B0JA 2XRHA 4E7SA 1BR1A 5DS4A 2Z15A 1LVKA 4I1MA 4DBRA 1ZHTA 4U5FE 3RIPA 3B0UX 3ABLC 3EGXB 1MNDA 3QMKA 4DVYP 4G7ZF 3CQZA 3GODA 3DAFA 4I1OB 1OCCC 4BJ6A 2NUTA 1TR2A 2W4MA 3W8IA 4FX5A 3JT1A 2WB7A 3WG7C 1SZIA 4G7HF 4ZLCA 1O5HA 3ZC4A 2YEVA 1KU2A 2IOQA 1OCZC 4OD5A 3FDQA 1OKKD 3Q7LA 4A2NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW3 C; 
#chains in the Genus database with same CATH topology
 3DJU B;  3I4U A;  4AL1 A;  1FFT C;  2AWY A;  3EPV A;  1NFN A;  2J9V A;  1JMW A;  3HKK A;  1T6Q A;  3EG9 A;  3K33 A;  4KBL A;  2R7W A;  3UR3 C;  4CDY A;  2ZPA A;  4J32 B;  4MVZ A;  2A68 F;  1LI5 A;  2EPM X;  4MVQ A;  2J9B A;  2R7O A;  2XL8 A;  3GM1 A;  5JRA A;  3NMI A;  2IXP A;  2Q9B A;  4BJ5 C;  4MVS A;  3C63 A;  2XLM A;  4D4X A;  5FCL A;  4XPW A;  2A0B A;  1R4T A;  1Y6D A;  2RD9 A;  3Q6N A;  3AG1 C;  1MMD A;  4FWV A;  2L81 A;  2L7A A;  1Z7Q c;  4G7O F;  4DOZ A;  1K05 A;  2M64 A;  3QZC A;  5L0C A;  1LKX A;  4CS9 C;  3TOL A;  5L3V A;  4U5B E;  3NKE A;  3S0X A;  2XXA B;  1GM5 A;  1NU9 C;  3E70 C;  1U0B B;  3JYH A;  2OEX A;  4HEA J;  3FVY A;  3C8G B;  3LNR A;  5F5H A;  2XLE A;  4DRJ B;  4E7Z A;  2O9X A;  4U5H A;  3LAY A;  2HV6 A;  3ZTZ A;  4EBK A;  3S84 A;  3GEE A;  1CPQ A;  2G3K A;  2XS8 A;  3KMI A;  4JW1 A;  3ABK C;  2P61 A;  4OIN F;  4W8K A;  4YT4 A;  5KYN A;  4KI2 A;  1J8M F;  2KGO A;  1AEP A;  1LPE A;  5B3I A;  2GAQ A;  1JPN A;  3HNJ A;  4JJF A;  1JOG A;  3RYL A;  1KTM A;  3ABM C;  2XL4 A;  3HNL A;  2EIL C;  3E9V A;  4N6C A;  4CS7 A;  5TJ5 E;  3TOM A;  4MTG A;  4C3B A;  2R7V A;  4GEH A;  3TQO A;  2IM8 A;  4YK5 A;  1Z3I X;  1PV3 A;  1CGO A;  1MNE A;  2VCA A;  1SMY F;  2J45 A;  5B3S C;  4DBR A;  4IAO A;  5CI9 A;  2AP3 A;  4XLN F;  4PJJ A;  2NUP B;  5F5F A;  2WZG A;  2YRF A;  3ATP A;  4NTA A;  3AQB A;  2J7P A;  3MYF A;  2VB6 A;  3KKB A;  3RH3 A;  3U9J A;  5L3Q A;  3DD7 A;  3MX3 A;  2HSB A;  3IQT A;  4Q7C A;  1ZW3 A;  4PFO A;  4MVM A;  1SF8 A;  5L0J A;  1TWA A;  4LLE A;  3ZSU A;  2YQY A;  2NSF A;  1K04 A;  3MLG A;  2LSE A;  3L34 A;  2OJQ A;  4JE9 A;  3U2L A;  1YVI A;  3S29 A;  1EKY A;  4N4W A;  2ZXP A;  4YWQ A;  2FAP B;  4MTO A;  3PHF 2;  5E2Q A;  4C3E A;  5COF A;  3F47 A;  2J46 A;  4C7O A;  3GOR A;  1Z5Z A;  4YJW A;  1AVO B;  3LLK A;  3T6G B;  2A1D D;  2KK1 A;  4NCQ A;  3IEE A;  1C17 M;  1ZHY A;  1VK5 A;  1GQA A;  1FMW A;  4N06 A;  3RVZ A;  4CX9 A;  1H9T A;  1QVX A;  1WWP A;  1A7D A;  2OQM A;  3WHN A;  1A7E A;  3US6 A;  2V3C C;  3FMS A;  5T3T A;  3VAY A;  1OCR C;  2PBE A;  1LE2 A;  3QVZ A;  3G50 A;  2Q00 A;  1M56 C;  3AG4 C;  1G4W R;  3FAP B;  1WAS A;  2YL3 A;  3EH1 A;  3JCU Q;  1N1C A;  3JSZ A;  3K66 A;  1HW1 A;  4HE8 D;  5KYU A;  4CBE A;  1ZHX A;  2YHS A;  3DMD A;  2NSG A;  3FOP A;  2XLO A;  4IAR A;  2CCY A;  1D0Z A;  3S27 A;  3IPM O;  3QTH A;  5HV9 A;  3OA1 A;  2WZL A;  4CDA A;  2EPN A;  5DVW A;  1JPJ A;  2MWQ A;  5DS5 A;  1TFO B;  2GDC A;  2KJG A;  1IW7 F;  1SYQ A;  2PF4 E;  3OEO A;  2J9W A;  1PD1 A;  4O7G A;  1H6G A;  4NTB A;  3W2V A;  3A9C A;  2ETS A;  2IYL D;  3NRH A;  4LER A;  4OIP F;  3FAJ A;  3C62 A;  5DS6 A;  4NC3 A;  2HSQ A;  4H54 A;  5COM A;  3ZTM A;  2V26 A;  2G62 A;  2HZ8 A;  4YT2 A;  2EIJ C;  3F46 A;  2J8W A;  1T9K A;  1VTM P;  2OCC C;  1D1A A;  2CNW A;  3GWN A;  1YA7 O;  1MMG A;  3I5Q A;  1H7I A;  4JIO A;  1TWH A;  4O6N A;  4RBN A;  4X0R A;  3L1M A;  5A6A A;  1T5O A;  1MMN A;  2EPL X;  1OW8 A;  2RSE B;  1G4U S;  1H9G A;  3EHM A;  3VRC A;  1ZYR F;  4YL1 A;  5KYY A;  1OW7 A;  3UMH A;  2PFD A;  2IXM A;  1NLX A;  3QW1 A;  1XZQ A;  1VLT A;  3EQL F;  4CJO A;  4NQF A;  2Y3H A;  2MYS A;  1B68 A;  4YL3 A;  4AE4 A;  4CJG A;  2GFH A;  1RKC A;  2J7P D;  1TWG A;  3N0T A;  3RF3 A;  5KYX B;  3DI5 A;  4PK4 A;  1D0X A;  1ZVZ A;  5BQI A;  2WVO A;  3UGO A;  1LS1 A;  1EI7 A;  2A6E F;  2FGY A;  2ZD9 A;  3GM2 A;  2TMV P;  1RKE B;  2H8A A;  2L6G A;  2F22 A;  3FXH A;  3LS0 A;  3EGD B;  4MW8 A;  1XWJ A;  5EK0 A;  1JAF A;  3AG2 C;  1HMO A;  1LS4 A;  3S90 A;  4WGZ A;  3T6B A;  1V74 B;  1M2V A;  2HUJ A;  1Z23 A;  2IXO A;  1D0Y A;  3IQ6 A;  4JTA B;  4QI0 A;  5L0H A;  1WTY A;  1C03 A;  2HJM A;  3VYW A;  2J0W A;  1E83 A;  2UUI A;  3K1I C;  2YWA A;  3MFN A;  3ASN C;  3GEH A;  2XLV A;  2LFD A;  3O10 A;  3NKD A;  256B A;  3B0P A;  3KPH A;  4JUR I;  1M2O A;  1Z6A A;  4GQH A;  3S9O A;  1YDI A;  3IQC A;  4FES A;  4MQ9 F;  2LQG A;  1VLS A;  4YL0 A;  2CYD A;  1BR2 A;  2IBF A;  1FAP B;  3RQE A;  2R03 A;  3WAQ A;  2AWC A;  1T6I A;  3FOO A;  3Q7G A;  1YAR O;  2XM4 A;  3EZI A;  3N24 A;  3RVY A;  3DWW A;  1ORY A;  4DVZ A;  5B1B C;  2QTV A;  4E0H A;  3GM3 A;  5KYX A;  3IQ5 A;  1WGW A;  4K1O A;  1VYK A;  3SXZ A;  3ZVR A;  3L8J A;  4EWC A;  3W8H A;  5D92 A;  3GEI A;  4L6R A;  5DLJ A;  2XM0 A;  1I4Z A;  4LLC A;  5IY5 C;  1OXB A;  2Q7R A;  4BJ6 C;  1IZM A;  1U6H A;  4JJG A;  1BZ4 A;  4XPX A;  2M4E A;  2H7V C;  2NUT B;  1NG1 A;  4EUK B;  4CSA A;  3DAG A;  1ZU4 A;  1VOM A;  4ULW A;  5A6B D;  4EBJ A;  1K40 A;  1D1C A;  4OIQ F;  4O6Y A;  4BJT A;  4J7T A;  1FFH A;  3NMJ A;  4NTF A;  3HLZ A;  2CNW D;  3RKO F;  3U3B A;  3EH2 A;  4KNV A;  3ZG1 A;  5DQZ A;  2Q4F A;  3OWT A;  4P9F A;  2HS5 A;  2YL7 A;  4JRZ A;  1RJ9 A;  5E33 A;  1QKR A;  3EFO A;  1YYJ A;  3SXK A;  4E18 A;  1MQV A;  4WGY A;  1WAT A;  5BQG A;  3W4Y A;  5DQT A;  1PD0 A;  3EG9 B;  3H65 A;  3LUT B;  3SZR A;  1DOW A;  1TFK B;  5F28 E;  2KNH A;  3DKA A;  1KNY A;  2H7O A;  2PP4 A;  5BUO A;  2Y39 A;  5JUA A;  3NG1 A;  3N2Z B;  1BR4 A;  4GYT A;  2OKU A;  5CI8 A;  1RXQ A;  2ZXR A;  5KYW A;  2L6H A;  4QI2 A;  1Q0D A;  2KC3 A;  1SR2 A;  4MVR A;  4XEK A;  1VB5 A;  4PJM A;  4F4B A;  2R7X A;  1R5I D;  3LLI A;  4YT8 A;  3B29 A;  3O55 A;  3X2Q C;  2J0X A;  1A41 A;  3DZA A;  1W2W A;  1FTS A;  4J30 B;  2JD3 A;  4LDR A;  1OQC A;  2P1A A;  4BJ1 A;  2HMZ A;  2R7R A;  2XL6 A;  4U5C E;  5EHH A;  3EGX A;  5A69 A;  1QZX A;  1ORS C;  1L7C A;  4Z9H A;  2YVK A;  3U8V A;  3SP1 A;  3AGU A;  2EIK C;  4OIO F;  4K0D A;  1YA9 A;  4OIR F;  2BL2 A;  3U9M A;  1ZHW A;  1TKN A;  3ECS A;  2PX3 A;  3U5S A;  2PNO A;  3EJN A;  1V55 C;  4PJL A;  4RD9 A;  4DJ9 A;  4BPM A;  3U3F A;  3TUL A;  4IAQ A;  2YLG A;  4C3D A;  2AU5 A;  3L0I A;  4P6I C;  3BRJ A;  2R7T A;  2VAS A;  1I4Y A;  4JVS A;  2JPU A;  3LNM B;  1RCP A;  2DYR C;  2YL0 A;  4H4K C;  3M1C B;  4JEA A;  3ZWI A;  5L0G A;  4Z9J A;  4CS8 A;  2HFI A;  4JCH A;  1NSG B;  2AVK A;  2R7Q A;  3NYL A;  3ITF A;  3JZ0 A;  2VCB A;  1ST6 A;  2CDQ A;  3KL4 A;  2Q3T A;  4JTD B;  4LAC B;  2H7B A;  3J06 A;  3VF0 A;  3V5X A;  3I5P A;  3TJ5 A;  4ANJ A;  4CIH A;  3DM9 B;  2A0U A;  3AQC A;  1Z63 A;  1D1B A;  2HKV A;  2MHR A;  1L3P A;  1HE1 A;  2G3V A;  3C7J A;  5AGF A;  5E3C A;  3UMI A;  2HJ3 A;  4QDL A;  1GS9 A;  4K7B A;  3Q6M A;  2B0H A;  1YAU O;  2WVQ A;  2HMQ A;  3WOD F;  1C02 A;  3K7D A;  4ER9 A;  1BBH A;  3HNI A;  3V5Y A;  1OCO C;  1CPR A;  5E3A A;  3DXJ F;  3T6J A;  2ZXW C;  2I8B A;  3O6X A;  1QLE C;  2PX0 A;  2YLD A;  3ZQV A;  4BJ5 A;  3CSK A;  4EBB A;  2BE5 F;  1LM3 B;  1VYI A;  2OJE D;  4IGG A;  2A6H F;  4Z9I A;  5A6J A;  4C7O B;  3NMK A;  4Q5S F;  4D4N A;  3JYY A;  2IXN A;  4AX2 A;  5FZT A;  3AJM A;  4XPY A;  3UMK A;  4CS9 A;  2XXA A;  3NDB B;  3IHU A;  4BEM J;  2I15 A;  4U5D E;  3SXM A;  1ZHZ A;  3C8G A;  5A6B A;  4O6M A;  1FR0 A;  4P9T A;  5KYU B;  1YLM A;  2R05 A;  2Y69 C;  3K1H A;  2R9R B;  4PAC A;  4JCZ A;  4PFP A;  4JZA A;  2W45 A;  4BG0 A;  1V4A A;  2P7V A;  1Q0M A;  3G4Z A;  2WZF A;  2QY9 A;  1Q0F A;  2W4B A;  2YL1 A;  1QQ3 A;  4XWJ A;  3S28 A;  2KQ9 A;  3SYN A;  4B6I A;  2DI3 A;  4XTK A;  4FAP B;  3L8I A;  2W9Y A;  4ONS A;  1YYX A;  4RDA A;  4CDV A;  3ZQY A;  2GA0 A;  4NY3 A;  5B1A C;  4HFF B;  1APC A;  3NYM A;  3T9O A;  2BC5 A;  1YZC A;  5L0F A;  1OR3 A;  3NYJ A;  4G0H A;  4N6H A;  2LCH A;  1S7Z A;  2Y3G A;  2NUP A;  4A2N B;  4DXW A;  1GGQ A;  3C18 A;  4R32 A;  5HSW A;  4EHP A;  3K6B A;  1JR8 A;  2ICW G;  4IB4 A;  3EZH A;  1YJG A;  5L0I A;  3POV A;  1OXK A;  4U5E E;  5AC5 A;  2QNL A;  4BEJ A;  1NBB A;  2YZS A;  3LEV A;  4IJJ A;  1S05 A;  4JEB A;  2Q9A A;  4MTF A;  3R7C A;  2Y3D A;  3QVY A;  3BEH A;  2X51 A;  3ZIB A;  5KYY B;  2E87 A;  3VM6 A;  5EGY A;  2L6F A;  4WAB A;  1WN0 A;  2Y3B A;  1E84 A;  2R7U A;  4AE4 B;  2EIN C;  2R25 A;  2NPU A;  1MMA A;  4DRH B;  3DE8 A;  2XS1 A;  5L0D A;  2EPK X;  3R2P A;  4U5G A;  4M63 A;  1PCX A;  2D4U A;  2OU6 A;  1HY5 A;  3DM5 A;  1CGM E;  2HV7 A;  2NG1 A;  3B0V C;  4A4A A;  4CS8 C;  3M4B A;  4HFK B;  1WOL A;  3UGP A;  1LIH A;  1E2X A;  2VCC A;  2WVN A;  3PMR A;  3HJC A;  3CAX A;  4AK9 A;  1NZE A;  2XLW A;  2XLH A;  2VH3 A;  4XEF A;  2XSE A;  1M2V B;  3MBG A;  4J7Y A;  3U0C A;  4LDQ A;  2A69 F;  4PJN A;  3AG3 C;  1J8Y F;  2WL8 A;  3B9Q A;  2DB4 A;  5COG A;  1Q0G A;  3LS1 A;  3RQG A;  1YZA A;  4YN0 B;  2OOC A;  2C03 A;  1M6T A;  2JX0 A;  5JLI A;  2QLA A;  2UUH A;  4OD4 A;  3AOU A;  2X0C A;  1LE4 A;  2DYS C;  2KSF A;  2C04 A;  1OW6 A;  2EIM C;  2VC9 A;  3C8G D;  1G8X A;  3KH2 A;  3ZDL A;  3U2M A;  5JP7 A;  5CIV A;  2Q9C A;  4IRU A;  1ZU5 A;  4YT5 A;  3TJ6 A;  4ZLD A;  3PCV A;  1G5Z A;  5AC4 A;  3QW0 A;  4E17 A;  3V7O A;  3LES A;  5BQH A;  4AL0 A;  1I5N A;  3X1O A;  1O3U A;  4DRI B;  5JVE A;  3T4R A;  1ZW2 A;  1FMV A;  4JKV A;  2ZXO A;  4JC7 A;  3B71 A;  3M4C A;  5JSL A;  3UNG C;  3GAN A;  1OKK A;  1FNT c;  3M79 A;  4MVO A;  4CIP A;  2CW0 F;  4CSA C;  3TK0 A;  1QSP A;  4U9D A;  2DGJ A;  2LK4 A;  2EPO A;  1NU7 D;  1TWC A;  1UG7 A;  2YKZ A;  3JRT A;  4MVU A;  2J9U A;  1Q0K A;  1NFO A;  3G4X A;  1QPU A;  4U9E A;  1BDJ B;  3JTL O;  4WJ0 A;  4XQ1 A;  3SNH A;  4XLP F;  1AUE A;  5D91 A;  3GWL A;  3JSE O;  3LEO A;  1V54 C;  2KYH A;  2D5R B;  2P6V A;  3W2W A;  3JRM O;  3KYJ A;  3RFY A;  3V5Z A;  4Q4Z F;  4DBQ A;  4I3M A;  3SEO A;  3LJB A;  1RJ9 B;  1TQG A;  2CGE A;  2ASR A;  2KW3 C;  1RKE A;  2XLD A;  3EHN A;  3EFO B;  3O39 A;  3TD7 A;  1CGN A;  3EGD A;  3ASO C;  3FHD A;  1Y4C A;  5JT4 A;  4IWB A;  1RMV A;  4KNW A;  4W8P A;  2LFF A;  1M57 C;  3DJN B;  1EQ1 A;  2YLI A;  3PDM P;  3MYI A;  2OG2 A;  5JS5 A;  1HMD A;  1ORJ A;  5T3W A;  1JRA A;  2L9J A;  1VMA A;  1O87 A;  5T1D B;  2FFH A;  3HTK C;  4PR9 A;  4O79 A;  2R02 A;  3KYI A;  5GPG B;  3CZ6 A;  4MND A;  3K1I A;  1UFB A;  3M15 A;  5KYW B;  2R7S A;  1T6U A;  4KC9 A;  2B0J A;  4MS2 A;  2XRH A;  3SXY A;  2P0N A;  4E0I A;  4E7S A;  1BR1 A;  5DS4 A;  2Z15 A;  1HW2 A;  1A7V A;  1LVK A;  4ULV A;  4I1M A;  2LP4 A;  3RW0 A;  2QE9 A;  1HE9 A;  1U89 A;  1ZHT A;  4U5F E;  4XEV A;  3RIP A;  3ABL C;  3CEX A;  1MND A;  3EGX B;  3B0U X;  2GWW A;  1E85 A;  4I44 A;  3RQF A;  4EIY A;  3QMK A;  1EA8 A;  4DVY P;  1E86 A;  2QUP A;  4G7Z F;  3CQZ A;  4EKW A;  3GOD A;  3DAF A;  4I1O B;  1OCC C;  4BJ6 A;  3DE9 A;  2NUT A;  1TR2 A;  1ZZP A;  4MW3 A;  2W4M A;  3W8I A;  1XZP A;  3HNK A;  4FX5 A;  2OEV A;  3JT1 A;  1F1M A;  2WB7 A;  1DOV A;  5K0I A;  3WG7 C;  2LD6 A;  5A6K A;  3U8P A;  4LDK A;  4G78 A;  1SZI A;  4G7H F;  1T01 A;  3H2U A;  4ZLC A;  4UDV A;  2LIG A;  3A11 A;  1O5H A;  1A0B A;  1OR2 A;  3H2V A;  3ZC4 A;  2YEV A;  4JTC B;  1KU2 A;  2IOQ A;  3C8Z A;  1LI7 A;  1OCZ C;  4OD5 A;  3FDQ A;  1OKK D;  3Q7L A;  3AGT A; 
#chains in the Genus database with same CATH homology
 3DJU B;  3I4U A;  1FFT C;  3EPV A;  3K33 A;  2J9V A;  4KBL A;  2R7W A;  3EG9 A;  3UR3 C;  2ZPA A;  4J32 B;  2A68 F;  2R7O A;  2IXP A;  2Q9B A;  4BJ5 C;  5FCL A;  3Q6N A;  3AG1 C;  1MMD A;  4FWV A;  2L81 A;  4G7O F;  4DOZ A;  3QZC A;  1LKX A;  4CS9 C;  5L3V A;  4U5B E;  3NKE A;  3S0X A;  2XXA B;  1NU9 C;  3E70 C;  3JYH A;  4HEA J;  3FVY A;  3LNR A;  5F5H A;  4E7Z A;  2O9X A;  4U5H A;  3LAY A;  2HV6 A;  2G3K A;  4JW1 A;  3KMI A;  3ABK C;  4OIN F;  4YT4 A;  4W8K A;  5KYN A;  4KI2 A;  1J8M F;  2KGO A;  1JPN A;  4JJF A;  3ABM C;  2XL4 A;  2EIL C;  3E9V A;  4CS7 A;  4C3B A;  2R7V A;  4GEH A;  1Z3I X;  1MNE A;  1SMY F;  2J45 A;  5B3S C;  4IAO A;  5CI9 A;  4XLN F;  4PJJ A;  2NUP B;  5F5F A;  2WZG A;  3AQB A;  2J7P A;  2VB6 A;  3KKB A;  3RH3 A;  5L3Q A;  3DD7 A;  3MX3 A;  4Q7C A;  4PFO A;  1SF8 A;  1TWA A;  4LLE A;  3ZSU A;  3MLG A;  2LSE A;  3L34 A;  3S29 A;  2ZXP A;  4YWQ A;  3PHF 2;  5E2Q A;  4C3E A;  3F47 A;  2J46 A;  4C7O A;  4YJW A;  1Z5Z A;  3LLK A;  2A1D D;  3IEE A;  1ZHY A;  1VK5 A;  4N06 A;  1FMW A;  2V3C C;  5T3T A;  3VAY A;  1OCR C;  1M56 C;  3AG4 C;  3K66 A;  3EH1 A;  3JCU Q;  3JSZ A;  4HE8 D;  1N1C A;  5KYU A;  4CBE A;  1ZHX A;  2YHS A;  3DMD A;  1D0Z A;  3S27 A;  3OA1 A;  2WZL A;  5DVW A;  1JPJ A;  2MWQ A;  5DS5 A;  2KJG A;  1IW7 F;  2PF4 E;  4O7G A;  2J9W A;  1PD1 A;  3W2V A;  2IYL D;  3NRH A;  4LER A;  4OIP F;  3FAJ A;  5DS6 A;  2V26 A;  2G62 A;  4YT2 A;  2EIJ C;  3F46 A;  2OCC C;  1D1A A;  2CNW A;  4O6N A;  1MMG A;  3I5Q A;  1TWH A;  4X0R A;  4RBN A;  1MMN A;  3EHM A;  1ZYR F;  5KYY A;  3UMH A;  2PFD A;  2IXM A;  3EQL F;  2Y3H A;  2MYS A;  4AE4 A;  2GFH A;  2J7P D;  1TWG A;  3N0T A;  5KYX B;  4PK4 A;  1D0X A;  2WVO A;  3UGO A;  1LS1 A;  2A6E F;  2FGY A;  3LS0 A;  4CS8 A;  3EGD B;  3AG2 C;  3T6B A;  1M2V A;  1Z23 A;  2IXO A;  1D0Y A;  4QI0 A;  3VYW A;  2J0W A;  3K1I C;  4I44 A;  3OEO A;  3ASN C;  3RYL A;  4JUR I;  3NKD A;  3B0P A;  1M2O A;  1Z6A A;  4FES A;  4MQ9 F;  1BR2 A;  3Q7G A;  3EZI A;  3N24 A;  4DVZ A;  5B1B C;  2QTV A;  1WGW A;  1VYK A;  3ZVR A;  4EWC A;  3W8H A;  5D92 A;  5DLJ A;  5IY5 C;  4LLC A;  4BJ6 C;  1IZM A;  4JJG A;  2M4E A;  2H7V C;  2NUT B;  1NG1 A;  4CSA A;  3DAG A;  1ZU4 A;  1VOM A;  4ULW A;  1D1C A;  4OIQ F;  4O6Y A;  4BJT A;  1FFH A;  3HLZ A;  2CNW D;  3RKO F;  3ZG1 A;  3EH2 A;  4KNV A;  5DQZ A;  3OWT A;  5E33 A;  1RJ9 A;  3EFO A;  5DQT A;  1PD0 A;  3EG9 B;  3H65 A;  3SZR A;  2KNH A;  2H7O A;  2PP4 A;  5BUO A;  2Y39 A;  3NG1 A;  3N2Z B;  1BR4 A;  4GYT A;  5CI8 A;  4QI2 A;  2ZXR A;  5KYW A;  4F4B A;  4PJM A;  2R7X A;  3LLI A;  4YT8 A;  3X2Q C;  2J0X A;  3DZA A;  1W2W A;  1FTS A;  4J30 B;  2JD3 A;  4BJ1 A;  2R7R A;  4U5C E;  5EHH A;  3EGX A;  1QZX A;  3SP1 A;  2EIK C;  4OIO F;  4K0D A;  4OIR F;  1ZHW A;  1TKN A;  3ECS A;  2PX3 A;  3EJN A;  1V55 C;  4PJL A;  4RD9 A;  4C3D A;  3L0I A;  4P6I C;  2R7T A;  2VAS A;  4JVS A;  4H4K C;  2DYR C;  3M1C B;  4JCH A;  2R7Q A;  3NYL A;  3KL4 A;  3ITF A;  4LAC B;  1ST6 A;  2CDQ A;  2Q3T A;  2H7B A;  3I5P A;  4ANJ A;  4CIH A;  3DM9 B;  3AQC A;  1Z63 A;  1D1B A;  2G3V A;  5E3C A;  3UMI A;  4QDL A;  4K7B A;  3Q6M A;  2WVQ A;  3WOD F;  3K7D A;  1OCO C;  5E3A A;  3DXJ F;  3T6J A;  2ZXW C;  2I8B A;  3O6X A;  1QLE C;  2PX0 A;  4BJ5 A;  4EBB A;  3CSK A;  2BE5 F;  1VYI A;  2A6H F;  4C7O B;  4Q5S F;  2IXN A;  4AX2 A;  3UMK A;  4CS9 A;  2XXA A;  3NDB B;  4U5D E;  1ZHZ A;  4O6M A;  5KYU B;  2Y69 C;  3K1H A;  4PFP A;  4JZA A;  2W45 A;  4BG0 A;  2P7V A;  2WZF A;  2QY9 A;  2W4B A;  4XWJ A;  4B6I A;  3S28 A;  2KQ9 A;  3SYN A;  4XTK A;  2W9Y A;  4RDA A;  4NY3 A;  5B1A C;  4HFF B;  3NYM A;  3NYJ A;  4G0H A;  1S7Z A;  2Y3G A;  2NUP A;  5HSW A;  3K6B A;  3EZH A;  3POV A;  4U5E E;  4BEJ A;  2YZS A;  3LEV A;  4IJJ A;  2Q9A A;  2Y3D A;  2X51 A;  3ZIB A;  5KYY B;  2E87 A;  5EGY A;  2Y3B A;  2R7U A;  4AE4 B;  2EIN C;  1MMA A;  4U5G A;  4M63 A;  1PCX A;  3DM5 A;  2HV7 A;  2NG1 A;  3B0V C;  4CS8 C;  4HFK B;  3UGP A;  2WVN A;  3PMR A;  3HJC A;  4AK9 A;  1NZE A;  2VH3 A;  2XSE A;  1M2V B;  2A69 F;  4PJN A;  3AG3 C;  1J8Y F;  2WL8 A;  3B9Q A;  3LS1 A;  4YN0 B;  2C03 A;  4OD4 A;  2DYS C;  2C04 A;  2EIM C;  3KH2 A;  1G8X A;  2Q9C A;  4IRU A;  1ZU5 A;  4YT5 A;  4ZLD A;  3V7O A;  3LES A;  3X1O A;  3T4R A;  1FMV A;  2ZXO A;  3UNG C;  3GAN A;  1OKK A;  2CW0 F;  4CSA C;  2DGJ A;  1NU7 D;  1TWC A;  3JRT A;  2J9U A;  3SNH A;  4WJ0 A;  4XLP F;  5D91 A;  5KYX A;  1V54 C;  2P6V A;  2D5R B;  3W2W A;  4Q4Z F;  3RFY A;  4DBQ A;  4I3M A;  3SEO A;  3LJB A;  1RJ9 B;  2CGE A;  2KW3 C;  3EHN A;  3EFO B;  3O39 A;  3TD7 A;  3EGD A;  3ASO C;  3FHD A;  4IWB A;  4KNW A;  1M57 C;  3DJN B;  2OG2 A;  5T3W A;  2L9J A;  1VMA A;  1O87 A;  5T1D B;  2FFH A;  3HTK C;  4O79 A;  5KYW B;  3CZ6 A;  4MND A;  2R7S A;  4KC9 A;  2B0J A;  2XRH A;  4E7S A;  1BR1 A;  5DS4 A;  2Z15 A;  1LVK A;  4I1M A;  4DBR A;  1ZHT A;  4U5F E;  3RIP A;  3B0U X;  3ABL C;  3EGX B;  1MND A;  3QMK A;  4DVY P;  4G7Z F;  3CQZ A;  3GOD A;  3DAF A;  4I1O B;  1OCC C;  4BJ6 A;  2NUT A;  1TR2 A;  2W4M A;  3W8I A;  4FX5 A;  3JT1 A;  2WB7 A;  3WG7 C;  1SZI A;  4G7H F;  4ZLC A;  1O5H A;  3ZC4 A;  2YEV A;  1KU2 A;  2IOQ A;  1OCZ C;  4OD5 A;  3FDQ A;  1OKK D;  3Q7L A;  4A2N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...