2KW3C

Heterotrimeric interaction between rfx5 and rfxap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA-binding protein RFX5
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kw3C00
2KW3C
chains in the Genus database with same CATH superfamily
1NG1A 3JCUQ 4OIPF 3GM3A 4C3EA 1CGNA 1WWPA 1WN0A 4J7TA 3T6BA 3NYMA 4J7YA 2IBFA 3V7OA 2R03A 3G4XA 1KNYA 3AQBA 2KW3C 4DBRA 2IYLD 1JMWA 4KBLA 3GORA 4J32B 4OINF 4NCQA 2ZD9A 5DS4A 5L0FA 1F1MA 1HW2A 5DVWA 3C8GB 4PACA 1IW7F 1EQ1A 1D1AA 1NFNA 5BQGA 1Y6DA 1Z3IX 2EPNA 4U5BE 1WOLA 2VH3A 1T9KA 2XLMA 2YVKA 3JRTA 4U5EE 3S28A 5EHHA 4XLPF 3RF3A 3IQTA 2QLAA 1YLMA 1FFHA 2R05A 4HFKB 2J7PD 2CGEA 3EJNA 3GEIA 3L34A 4OIRF 2XXAA 1L3PA 1TWAA 2IXMA 2LSEA 1Z7Qc 3LNRA 1G4WR 2Q3TA 2HSQA 3B0VC 1I4ZA 5KYWA 4Q4ZF 3TK0A 1QZXA 2D5RB 2PFDA 2X0CA 2NUTA 3SXYA 1OCRC 2LIGA 4EIYA 3S9OA 1VYKA 5A6AA 4QI2A 3FOOA 4I1OB 1R5ID 2HUJA 2ZPAA 3QVYA 3MYFA 2QTVA 2PNOA 4GYTA 4YT2A 2F22A 2XSEA 2ZXOA 4Q7CA 1MMNA 1OKKD 1V55C 2YLGA 1YDIA 2B0JA 4JTAB 3RQFA 1H9GA 1M56C 3Q7GA 3TD7A 1GS9A 2FGYA 1M2VA 4O79A 3SXKA 1A7EA 2Q9AA 3NKDA 2XL4A 2XM0A 2Y3DA 2C03A 3EH1A 3M4CA 4CIPA 2DYSC 5DS5A 2JPUA 4O6NA 4UDVA 2XXAB 3K1IA 1G4US 1HY5A 1FTSA 1CPQA 3FVYA 1C17M 3RH3A 2PX0A 3NRHA 4XQ1A 2HMQA 2R7SA 5JUAA 3ABLC 5T3TA 4I1MA 3W2WA 2R7VA 4CJGA 1U6HA 2YL3A 3HTKC 3LAYA 4RD9A 2AU5A 1OXBA 2OG2A 5CI8A 4F4BA 1YA7O 1D0ZA 2P1AA 3DAGA 2YEVA 3ZTZA 1Q0GA 5IY5C 3DD7A 3DZAA 4MQ9F 3VF0A 4A2NB 1TFKB 3B29A 4P6IC 4PR9A 2WVQA 3K1IC 1YZAA 2KQ9A 4NTFA 4O7GA 4AL0A 5A6BA 2L9JA 2AP3A 3NYJA 2Q4FA 1MQVA 1E2XA 2A0BA 1QQ3A 1SYQA 4BJ5C 4KI2A 3F47A 3IEEA 3WAQA 1VLTA 2EIMC 3US6A 3BEHA 3DM5A 4LDRA 2HV6A 2XL6A 2OKUA 2OQMA 5JSLA 2HFIA 2J46A 1QSPA 4IGGA 3VRCA 4ZLDA 2VASA 4PFPA 3TOLA 2E87A 2KGOA 3BRJA 2J45A 4JCZA 3TQOA 2CYDA 4H54A 3IPMO 2NUPA 1LI5A 1E83A 1K40A 4IJJA 2H7VC 5HV9A 3J06A 4QI0A 1U89A 3U0CA 3RYLA 1QKRA 1OCCC 3MBGA 1JOGA 3M4BA 4XEFA 1OCOC 3DWWA 5L3VA 4C3DA 1H9TA 1HW1A 2NUTB 4U5HA 4EBBA 1ZW3A 3EPVA 1WGWA 1VYIA 1H7IA 2J8WA 1LVKA 1D1BA 5EK0A 4YL1A 2R7QA 3KKBA 3O10A 5B1AC 5JP7A 3U5SA 2YRFA 3W8HA 5B3SC 2W4BA 3AOUA 3S0XA 2J9WA 2LQGA 2Q9BA 2AWYA 3L0IA 4MVRA 4HFFB 1C02A 2YQYA 4XPXA 4MVMA 3C8GA 1MNDA 5COFA 1E84A 4JC7A 1G8XA 4D4XA 3ECSA 2HMZA 2R7RA 2A68F 2XLVA 3L8JA 4FWVA 1MMAA 4JEBA 4MTFA 3U3FA 3W2VA 1ZHTA 4WGZA 1QLEC 2NPUA 1YAUO 3OA1A 1E86A 3ZQYA 4G7OF 4JURI 4C7OB 4N6CA 1LKXA 1NU7D 5F5HA 4EUKB 5DS6A 3ABMC 3LNMB 1XZPA 4EHPA 1A41A 3DE8A 5L0CA 2A1DD 5L0IA 5B1BC 2CDQA 2UUIA 2EINC 2WVNA 3GM1A 3NDBB 2J0WA 3GM2A 1EA8A 2Q7RA 2A6EF 4CS7A 1BDJB 2LK4A 3UMKA 3C18A 1VB5A 2FAPB 3EGXB 3ITFA 4N4WA 3QVZA 1UFBA 5D92A 3FDQA 4RDAA 3GEEA 2BE5F 1J8MF 4E7ZA 1KTMA 3OWTA 3R2PA 3AG1C 3ZWIA 1MMDA 4Z9HA 3V5YA 1Y4CA 2CNWD 2OEXA 2YLIA 3EFOB 1TWHA 3MFNA 5L0JA 5KYYA 1I4YA 2BL2A 1R4TA 3AG4C 3RQGA 1Z63A 4OD4A 4MTGA 1RXQA 1LPEA 2D4UA 1VLSA 3CAXA 3JT1A 4CS9A 4GEHA 1ZHXA 3H2UA 1PV3A 3B0PA 3IHUA 2P0NA 4NC3A 2YL0A 1D0YA 1XWJA 1JRAA 4JEAA 3UNGC 1BR1A 1VMAA 4BPMA 1RKEA 256BA 5BQIA 5CIVA 1O3UA 1M57C 4JE9A 4ONSA 2X51A 1YJGA 3V5ZA 1U0BB 2A0UA 4YN0B 4E7SA 4N6HA 3EGDA 1T5OA 1Q0DA 4U5CE 3ABKC 4PJMA 3GANA 2GA0A 4KNVA 3UGOA 2EIJC 4P9TA 4MW3A 3CEXA 3NKEA 5AGFA 2H7OA 3N2ZB 1ORSC 3R7CA 1ZHWA 2HS5A 2J9BA 2QE9A 5GPGB 2CNWA 2AWCA 4KNWA 2OOCA 4MVQA 2G62A 2GAQA 3G4ZA 1ORJA 4NTBA 4U9DA 3U2MA 4BJ6A 1K05A 5JT4A 2DB4A 2LCHA 2ICWG 4E18A 1MNEA 3K6BA 1FMVA 3SXMA 4NY3A 3UMHA 3EZHA 3HNKA 2EPLX 3W8IA 4CBEA 2QNLA 2ASRA 4DRJB 1VOMA 3ATPA 4I3MA 4L6RA 3GWLA 3MLGA 4MVUA 3RKOF 3V5XA 4YL0A 1RMVA 5FCLA 2PBEA 3S27A 1WATA 4Z9IA 1Q0KA 3GODA 2HV7A 3U9JA 5EGYA 5JVEA 3TJ5A 5KYYB 2R7UA 1OW6A 2BC5A 2G3VA 3UMIA 1OR2A 1TFOB 3ZSUA 2GWWA 3O6XA 5AC4A 4J30B 4R32A 3S29A 3SZRA 1VTMP 2Y69C 2PF4E 3HNIA 2L7AA 2YL1A 2ZXPA 3QZCA 4WGYA 4CDYA 3N0TA 2J9UA 2W9YA 2W4MA 2VCBA 2PP4A 1TQGA 1HE1A 3JSZA 3KL4A 4XPYA 3VAYA 3ZVRA 5DQTA 4K1OA 1O5HA 1YZCA 2YZSA 3HKKA 4M63A 3LEOA 2LD6A 2KC3A 2XLDA 4FAPB 4OD5A 1ST6A 3U2LA 4C7OA 5KYUB 2CCYA 2ZXRA 2J0XA 3I5QA 2AVKA 4AE4B 3H65A 5JS5A 2MYSA 2MWQA 1GQAA 3AG2C 3PMRA 1OR3A 2YWAA 4I44A 3LS0A 2OCCC 1ORYA 3B0UX 4XPWA 1JPNA 4RBNA 5F28E 3I4UA 2JD3A 5D91A 4AL1A 2A69F 2DYRC 3HLZA 2R7OA 3KH2A 4P9FA 4EKWA 4IWBA 4O6MA 5KYXA 1QPUA 4CS9C 1JR8A 3ASNC 1S05A 3M1CB 3LLIA 1ZU5A 1WTYA 2L6HA 5KYUA 1O87A 5A6KA 4JJFA 4CX9A 3TULA 1V74B 1FR0A 3EHMA 1H6GA 3QW0A 3U8VA 3RQEA 5BUOA 1CGOA 1T6QA 3NG1A 3O39A 3LUTB 1M6TA 4BEMJ 3K7DA 5HSWA 2L6FA 1JAFA 3UR3C 1T6IA 2G3KA 4LACB 3ZG1A 2HSBA 3KYIA 2EPOA 2LFFA 3KMIA 4K7BA 1N1CA 1ZVZA 3RW0A 4MVZA 4NQFA 3LS1A 2CW0F 1EI7A 2A6HF 5DLJA 4D4NA 4WJ0A 4CSAA 2NUPB 2R25A 4XEVA 2YLDA 4DRHB 4YT8A 4IRUA 4G7ZF 2M4EA 4CSAC 4CIHA 1GGQA 4YT4A 1BR4A 2IXNA 2P61A 3X1OA 2WZGA 2V3CC 1S7ZA 4E0IA 3S84A 4N06A 1LE4A 2IXPA 2XLOA 3A9CA 1CGME 4YT5A 1JPJA 1NZEA 4ER9A 3OEOA 1Z5ZA 3ZIBA 4BJ5A 1TWGA 5L0HA 2TMVP 2OU6A 4FX5A 5A69A 1NBBA 4IARA 2FFHA 5A6BD 3FAPB 2WVOA 3DJNB 3E9VA 1OCZC 2HJ3A 4PK4A 3W4YA 2I15A 1SR2A 3C8ZA 1NFOA 2VB6A 3ZQVA 4CDVA 3UGPA 2XS1A 4H4KC 4B6IA 3DM9B 2H7BA 3CQZA 4MNDA 1LE2A 3AGUA 1CPRA 1K04A 1IZMA 2OJED 3Q7LA 2LFDA 4AK9A 3H2VA 1RCPA 4JKVA 1B68A 4PJLA 3ZC4A 3TOMA 5JRAA 3A11A 3K1HA 3X2QC 4OIOF 2EILC 5AC5A 2HJMA 3DJUB 2MHRA 3EQLF 1MMGA 1LI7A 2Y39A 3C8GD 1LIHA 1NU9C 4LLCA 1RJ9B 2Y3BA 2NSGA 3AQCA 3CSKA 3JSEO 1LS4A 3MYIA 3RFYA 3U3BA 4IAQA 1FAPB 1Q0FA 3IQ6A 3NYLA 4U9EA 1OW8A 3NMJA 3JRMO 1YA9A 2Y3GA 2NSFA 3FMSA 2J7PA 3GEHA 5E2QA 5BQHA 1TR2A 3HNJA 1BR2A 3IQCA 4MTOA 1HMOA 3T6GB 3U9MA 3AG3C 2WZFA 1T01A 3QW1A 2GFHA 4YL3A 2J9VA 4LERA 2O9XA 5T1DB 3RIPA 3ZDLA 2RD9A 3GWNA 4XWJA 2M64A 1Z23A 3PCVA 1EKYA 4XLNF 2R9RB 3DKAA 4ULWA 1OKKA 4AX2A 1TWCA 4YK5A 2ETSA 2QY9A 4DRIB 1D1CA 1AVOB 3HNLA 1V4AA 2XLWA 5CI9A 1M2OA 2P7VA 2DI3A 3NMIA 5KYWB 2VC9A 5L0DA 3NMKA 4LDQA 3ASOC 4QDLA 2B0HA 3JYYA 2XRHA 3M79A 1DOWA 1UG7A 4U5FE 2HZ8A 4IAOA 3EH2A 3FOPA 3B71A 1PD0A 2RSEB 4PFOA 4DVYP 2HKVA 3DXJF 3KYJA 4E0HA 3Q6NA 2KSFA 4JTCB 3WHNA 4CS8A 1OW7A 3SEOA 5A6JA 2JX0A 4K0DA 1AEPA 2KK1A 3TJ6A 5KYXB 1D0XA 3VYWA 2Z15A 2Q9CA 3WG7C 4PJJA 4XEKA 4JZAA 3HJCA 5E3CA 4YWQA 3F46A 4BEJA 1WASA 1L7CA 4AE4A 5JLIA 3U8PA 3E70C 2IM8A 2WZLA 3O55A 3POVA 1YYXA 3QTHA 2KYHA 2EPKX 1QVXA 3EZIA 3LEVA 3RVYA 3CZ6A 5F5FA 2GDCA 3EG9B 5DQZA 3B9QA 4MS2A 4PJNA 4GQHA 4W8KA 4BG0A 2XM4A 3SNHA 1NLXA 1SF8A 4LDKA 3C63A 2IXOA 3M15A 1DOVA 3QMKA 2H8AA 4G7HF 2KJGA 3IQ5A 3L1MA 2QUPA 3AJMA 4EBKA 2XS8A 4ULVA 3AGTA 1C03A 3EHNA 4BJ1A 4C3BA 1TKNA 2DGJA 4ANJA 4MVSA 4EBJA 3JTLO 3Q6MA 2Q00A 4HE8D 1ZU4A 4JVSA 4IB4A 3G50A 3LESA 2LP4A 4ZLCA 1A7VA 5TJ5E 3DMDA 3PDMP 4BJ6C 4OIQF 2UUHA 1LS1A 2OEVA 1T6UA 4Q5SF 1RJ9A 3MX3A 4JW1A 1I5NA 2OJQA 2EIKC 5FZTA 5COMA 3C7JA 3VM6A 3SYNA 4Z9JA 2I8BA 3KPHA 2C04A 1FFTC 1FMWA 4U5DE 2KNHA 1YYJA 5KYNA 3SP1A 1E85A 1OXKA 2R7XA 1HE9A 1VK5A 2R7TA 1A0BA 3L8IA 1V54C 5B3IA 4JJGA 2YL7A 4CS8C 4DVZA 1PCXA 4BJTA 1XZQA 2XLEA 4NTAA 3SXZA 4MVOA 3T6JA 4DBQA 1APCA 2IOQA 3FHDA 2L6GA 4JRZA 3EGDB 3DI5A 5T3WA 3LLKA 4KC9A 3ZTMA 1W2WA 1Z6AA 4YJWA 2XLHA 4WABA 1HMDA 4G78A 3DAFA 3JZ0A 3C62A 3JYHA 4X0RA 4O6YA 4HEAJ 3N24A 1RKEB 5COGA 4U5GA 2XL8A 5E33A 2VCAA 3FAJA 1BZ4A 4A4AA 2NG1A 2W45A 4CDAA 1ZYRF 3LJBA 4DXWA 1PD1A 1A7DA 1GM5A 2ZXWC 3WODF 1SMYF 2YKZA 2R7WA 3DE9A 1FNTc 3PHF2 1ZHZA 1KU2A 5L0GA 1M2VB 1SZIA 1YARO 2YHSA 3EFOA 4JTDB 3I5PA 1ZHYA 4EWCA 5L3QA 2L81A 1G5ZA 2WL8A 1BBHA 4XTKA 2V26A 5E3AA 3K66A 1RKCA 4MW8A 4CJOA 3S90A 2EPMX 1AUEA 4JCHA 2P6VA 3T4RA 3RVZA 4E17A 1Q0MA 1LM3B 2Y3HA 3EGXA 1J8YF 4G0HA 4W8PA 3FXHA 3T9OA 2WB7A 4DJ9A 5K0IA 1NSGB 1YVIA 2PX3A 2VCCA 3EG9A 2R02A 3K33A 4FESA 4DOZA 1ZW2A 4LLEA 1ZZPA 1OQCA 4JIOA
chains in the Genus database with same CATH topology
1NG1A 3JCUQ 4OIPF 4C3EA 3T6BA 3NYMA 3V7OA 3AQBA 2KW3C 4DBRA 2IYLD 4KBLA 4J32B 4OINF 5DS4A 5DVWA 1IW7F 1D1AA 1Z3IX 4U5BE 5EHHA 2VH3A 4U5EE 3S28A 3JRTA 4XLPF 1FFHA 4HFKB 2J7PD 2CGEA 3EJNA 3L34A 4OIRF 2XXAA 1TWAA 2IXMA 2LSEA 3LNRA 3B0VC 2Q3TA 5KYWA 4Q4ZF 1QZXA 2D5RB 2PFDA 2NUTA 4QI2A 1OCRC 1VYKA 4I1OB 4GYTA 2ZPAA 4YT2A 2QTVA 2XSEA 2ZXOA 4Q7CA 1MMNA 1OKKD 1V55C 2B0JA 1M56C 3Q7GA 3TD7A 2FGYA 1M2VA 4O79A 2Q9AA 3NKDA 2XL4A 2Y3DA 3EH1A 2C03A 2DYSC 5DS5A 4O6NA 1FTSA 3FVYA 3RH3A 2PX0A 3NRHA 2R7SA 3ABLC 5T3TA 4I1MA 3W2WA 2R7VA 3HTKC 3LAYA 4RD9A 2OG2A 5CI8A 4F4BA 1D0ZA 3DAGA 2YEVA 5IY5C 3DD7A 3DZAA 4MQ9F 4A2NB 4P6IC 2WVQA 3K1IC 2KQ9A 4O7GA 2L9JA 3NYJA 4BJ5C 4KI2A 3F47A 3IEEA 2EIMC 3DM5A 2HV6A 2J46A 4ZLDA 2VASA 4PFPA 2E87A 2KGOA 2J45A 2NUPA 4IJJA 2H7VC 4QI0A 3RYLA 1OCCC 1OCOC 5L3VA 4C3DA 2NUTB 4U5HA 4EBBA 3EPVA 1WGWA 1VYIA 1LVKA 1D1BA 2R7QA 3KKBA 5B1AC 3W8HA 5B3SC 2W4BA 3S0XA 2J9WA 2Q9BA 3L0IA 4HFFB 1MNDA 1G8XA 3ECSA 2R7RA 2A68F 4FWVA 3W2VA 1MMAA 1ZHTA 1QLEC 3OA1A 4G7OF 4JURI 4C7OB 5DS6A 1LKXA 1NU7D 5F5HA 3ABMC 2A1DD 5B1BC 2CDQA 2WVNA 2EINC 3NDBB 2J0WA 2A6EF 4CS7A 3UMKA 3ITFA 3EGXB 5D92A 3FDQA 4RDAA 2BE5F 1J8MF 4E7ZA 3OWTA 3AG1C 1MMDA 2CNWD 3EFOB 1TWHA 5KYYA 3AG4C 1Z63A 4OD4A 4CS9A 3JT1A 4GEHA 1ZHXA 3B0PA 1D0YA 3UNGC 1BR1A 1VMAA 1M57C 2X51A 4YN0B 4E7SA 3EGDA 4U5CE 3ABKC 4PJMA 3GANA 4KNVA 3UGOA 2EIJC 3NKEA 2H7OA 3N2ZB 1ZHWA 2CNWA 4KNWA 2G62A 4BJ6A 1MNEA 3K6BA 1FMVA 3W8IA 4NY3A 3UMHA 3EZHA 4CBEA 1VOMA 4I3MA 3MLGA 3RKOF 5FCLA 3S27A 3GODA 2HV7A 5EGYA 2R7UA 5KYYB 2G3VA 3UMIA 3ZSUA 3O6XA 4J30B 3S29A 3SZRA 2Y69C 2PF4E 2ZXPA 3QZCA 3N0TA 2J9UA 2W9YA 2W4MA 3KL4A 2PP4A 3JSZA 3VAYA 3ZVRA 5DQTA 1O5HA 2YZSA 4M63A 4OD5A 1ST6A 4C7OA 5KYUB 2ZXRA 2J0XA 3I5QA 4AE4B 3H65A 2MYSA 2MWQA 3PMRA 3AG2C 4I44A 3LS0A 2OCCC 3B0UX 1JPNA 4RBNA 3I4UA 2JD3A 5D91A 2A69F 2DYRC 3HLZA 2R7OA 3KH2A 4IWBA 4O6MA 5KYXA 4CS9C 3ASNC 3M1CB 3LLIA 1ZU5A 5KYUA 1O87A 4JJFA 3EHMA 5BUOA 3NG1A 3O39A 3K7DA 5HSWA 3UR3C 2G3KA 4LACB 3ZG1A 3KMIA 4K7BA 1N1CA 3LS1A 2CW0F 2A6HF 5DLJA 4WJ0A 4CSAA 2NUPB 4YT8A 4IRUA 4G7ZF 2M4EA 4CSAC 4CIHA 4YT4A 1BR4A 2IXNA 3X1OA 2V3CC 2WZGA 1S7ZA 4N06A 2IXPA 4YT5A 1JPJA 1NZEA 3OEOA 1Z5ZA 3ZIBA 4BJ5A 1TWGA 4FX5A 2FFHA 2WVOA 3DJNB 3E9VA 1OCZC 4PK4A 2VB6A 4H4KC 4B6IA 3DM9B 2H7BA 3CQZA 4MNDA 1IZMA 3Q7LA 4AK9A 4PJLA 3ZC4A 3X2QC 3K1HA 4OIOF 2EILC 3DJUB 3EQLF 1MMGA 2Y39A 1NU9C 4LLCA 1RJ9B 2Y3BA 3AQCA 3CSKA 3RFYA 3NYLA 2Y3GA 2J7PA 5E2QA 1TR2A 1BR2A 3AG3C 2WZFA 5T1DB 2GFHA 3RIPA 2J9VA 4LERA 2O9XA 4XWJA 1Z23A 4XLNF 4ULWA 4AX2A 1OKKA 1TWCA 2QY9A 1D1CA 5CI9A 1M2OA 2P7VA 5KYWB 3ASOC 4QDLA 2XRHA 4U5FE 4IAOA 3EH2A 4PFOA 1PD0A 4DVYP 3DXJF 3Q6NA 4CS8A 3SEOA 5KYXB 4K0DA 1D0XA 3VYWA 2Z15A 2Q9CA 3WG7C 4PJJA 4JZAA 3HJCA 5E3CA 4YWQA 3F46A 4BEJA 4AE4A 3E70C 2WZLA 3POVA 3EZIA 3LEVA 3CZ6A 5F5FA 3EG9B 5DQZA 3B9QA 4PJNA 4BG0A 4W8KA 3SNHA 1SF8A 2IXOA 3QMKA 4G7HF 2KJGA 3EHNA 4BJ1A 4C3BA 1TKNA 2DGJA 4ANJA 3Q6MA 4HE8D 1ZU4A 4JVSA 4ZLCA 3LESA 3DMDA 4BJ6C 4OIQF 1LS1A 4Q5SF 1RJ9A 3MX3A 4JW1A 2EIKC 3SYNA 2I8BA 2C04A 1FFTC 1FMWA 4U5DE 2KNHA 5KYNA 3SP1A 2R7XA 1VK5A 2R7TA 1V54C 4JJGA 4CS8C 4DVZA 1PCXA 4BJTA 4DBQA 3T6JA 2IOQA 3FHDA 5T3WA 3EGDB 3LLKA 4KC9A 1W2WA 1Z6AA 4YJWA 3DAFA 4X0RA 3JYHA 4O6YA 4HEAJ 3N24A 4U5GA 5E33A 3FAJA 2NG1A 2W45A 1ZYRF 3LJBA 1PD1A 2ZXWC 3WODF 1SMYF 2R7WA 3PHF2 1ZHZA 1KU2A 1M2VB 1SZIA 2YHSA 3EFOA 3I5PA 1ZHYA 4EWCA 5L3QA 2L81A 2WL8A 4XTKA 2V26A 5E3AA 3K66A 4JCHA 2P6VA 3T4RA 2Y3HA 3EGXA 4G0HA 3UGPA 1J8YF 2WB7A 2PX3A 3EG9A 3K33A 4FESA 4DOZA 4LLEA 2XXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW3 C; 
#chains in the Genus database with same CATH topology
 1NG1 A;  3JCU Q;  4OIP F;  3GM3 A;  4C3E A;  1CGN A;  1WWP A;  1WN0 A;  4J7T A;  3T6B A;  3NYM A;  4J7Y A;  2IBF A;  3V7O A;  2R03 A;  3G4X A;  1KNY A;  3AQB A;  2KW3 C;  4DBR A;  2IYL D;  1JMW A;  4KBL A;  3GOR A;  4J32 B;  4OIN F;  4NCQ A;  2ZD9 A;  5DS4 A;  5L0F A;  1F1M A;  1HW2 A;  5DVW A;  3C8G B;  4PAC A;  1IW7 F;  1EQ1 A;  1D1A A;  1NFN A;  5BQG A;  1Y6D A;  1Z3I X;  2EPN A;  4U5B E;  1WOL A;  2VH3 A;  1T9K A;  2XLM A;  2YVK A;  3JRT A;  4U5E E;  3S28 A;  5EHH A;  4XLP F;  3RF3 A;  3IQT A;  2QLA A;  1YLM A;  1FFH A;  2R05 A;  4HFK B;  2J7P D;  2CGE A;  3EJN A;  3GEI A;  3L34 A;  4OIR F;  2XXA A;  1L3P A;  1TWA A;  2IXM A;  2LSE A;  1Z7Q c;  3LNR A;  1G4W R;  2Q3T A;  2HSQ A;  3B0V C;  1I4Z A;  5KYW A;  4Q4Z F;  3TK0 A;  1QZX A;  2D5R B;  2PFD A;  2X0C A;  2NUT A;  3SXY A;  1OCR C;  2LIG A;  4EIY A;  3S9O A;  1VYK A;  5A6A A;  4QI2 A;  3FOO A;  4I1O B;  1R5I D;  2HUJ A;  2ZPA A;  3QVY A;  3MYF A;  2QTV A;  2PNO A;  4GYT A;  4YT2 A;  2F22 A;  2XSE A;  2ZXO A;  4Q7C A;  1MMN A;  1OKK D;  1V55 C;  2YLG A;  1YDI A;  2B0J A;  4JTA B;  3RQF A;  1H9G A;  1M56 C;  3Q7G A;  3TD7 A;  1GS9 A;  2FGY A;  1M2V A;  4O79 A;  3SXK A;  1A7E A;  2Q9A A;  3NKD A;  2XL4 A;  2XM0 A;  2Y3D A;  2C03 A;  3EH1 A;  3M4C A;  4CIP A;  2DYS C;  5DS5 A;  2JPU A;  4O6N A;  4UDV A;  2XXA B;  3K1I A;  1G4U S;  1HY5 A;  1FTS A;  1CPQ A;  3FVY A;  1C17 M;  3RH3 A;  2PX0 A;  3NRH A;  4XQ1 A;  2HMQ A;  2R7S A;  5JUA A;  3ABL C;  5T3T A;  4I1M A;  3W2W A;  2R7V A;  4CJG A;  1U6H A;  2YL3 A;  3HTK C;  3LAY A;  4RD9 A;  2AU5 A;  1OXB A;  2OG2 A;  5CI8 A;  4F4B A;  1YA7 O;  1D0Z A;  2P1A A;  3DAG A;  2YEV A;  3ZTZ A;  1Q0G A;  5IY5 C;  3DD7 A;  3DZA A;  4MQ9 F;  3VF0 A;  4A2N B;  1TFK B;  3B29 A;  4P6I C;  4PR9 A;  2WVQ A;  3K1I C;  1YZA A;  2KQ9 A;  4NTF A;  4O7G A;  4AL0 A;  5A6B A;  2L9J A;  2AP3 A;  3NYJ A;  2Q4F A;  1MQV A;  1E2X A;  2A0B A;  1QQ3 A;  1SYQ A;  4BJ5 C;  4KI2 A;  3F47 A;  3IEE A;  3WAQ A;  1VLT A;  2EIM C;  3US6 A;  3BEH A;  3DM5 A;  4LDR A;  2HV6 A;  2XL6 A;  2OKU A;  2OQM A;  5JSL A;  2HFI A;  2J46 A;  1QSP A;  4IGG A;  3VRC A;  4ZLD A;  2VAS A;  4PFP A;  3TOL A;  2E87 A;  2KGO A;  3BRJ A;  2J45 A;  4JCZ A;  3TQO A;  2CYD A;  4H54 A;  3IPM O;  2NUP A;  1LI5 A;  1E83 A;  1K40 A;  4IJJ A;  2H7V C;  5HV9 A;  3J06 A;  4QI0 A;  1U89 A;  3U0C A;  3RYL A;  1QKR A;  1OCC C;  3MBG A;  1JOG A;  3M4B A;  4XEF A;  1OCO C;  3DWW A;  5L3V A;  4C3D A;  1H9T A;  1HW1 A;  2NUT B;  4U5H A;  4EBB A;  1ZW3 A;  3EPV A;  1WGW A;  1VYI A;  1H7I A;  2J8W A;  1LVK A;  1D1B A;  5EK0 A;  4YL1 A;  2R7Q A;  3KKB A;  3O10 A;  5B1A C;  5JP7 A;  3U5S A;  2YRF A;  3W8H A;  5B3S C;  2W4B A;  3AOU A;  3S0X A;  2J9W A;  2LQG A;  2Q9B A;  2AWY A;  3L0I A;  4MVR A;  4HFF B;  1C02 A;  2YQY A;  4XPX A;  4MVM A;  3C8G A;  1MND A;  5COF A;  1E84 A;  4JC7 A;  1G8X A;  4D4X A;  3ECS A;  2HMZ A;  2R7R A;  2A68 F;  2XLV A;  3L8J A;  4FWV A;  1MMA A;  4JEB A;  4MTF A;  3U3F A;  3W2V A;  1ZHT A;  4WGZ A;  1QLE C;  2NPU A;  1YAU O;  3OA1 A;  1E86 A;  3ZQY A;  4G7O F;  4JUR I;  4C7O B;  4N6C A;  1LKX A;  1NU7 D;  5F5H A;  4EUK B;  5DS6 A;  3ABM C;  3LNM B;  1XZP A;  4EHP A;  1A41 A;  3DE8 A;  5L0C A;  2A1D D;  5L0I A;  5B1B C;  2CDQ A;  2UUI A;  2EIN C;  2WVN A;  3GM1 A;  3NDB B;  2J0W A;  3GM2 A;  1EA8 A;  2Q7R A;  2A6E F;  4CS7 A;  1BDJ B;  2LK4 A;  3UMK A;  3C18 A;  1VB5 A;  2FAP B;  3EGX B;  3ITF A;  4N4W A;  3QVZ A;  1UFB A;  5D92 A;  3FDQ A;  4RDA A;  3GEE A;  2BE5 F;  1J8M F;  4E7Z A;  1KTM A;  3OWT A;  3R2P A;  3AG1 C;  3ZWI A;  1MMD A;  4Z9H A;  3V5Y A;  1Y4C A;  2CNW D;  2OEX A;  2YLI A;  3EFO B;  1TWH A;  3MFN A;  5L0J A;  5KYY A;  1I4Y A;  2BL2 A;  1R4T A;  3AG4 C;  3RQG A;  1Z63 A;  4OD4 A;  4MTG A;  1RXQ A;  1LPE A;  2D4U A;  1VLS A;  3CAX A;  3JT1 A;  4CS9 A;  4GEH A;  1ZHX A;  3H2U A;  1PV3 A;  3B0P A;  3IHU A;  2P0N A;  4NC3 A;  2YL0 A;  1D0Y A;  1XWJ A;  1JRA A;  4JEA A;  3UNG C;  1BR1 A;  1VMA A;  4BPM A;  1RKE A;  256B A;  5BQI A;  5CIV A;  1O3U A;  1M57 C;  4JE9 A;  4ONS A;  2X51 A;  1YJG A;  3V5Z A;  1U0B B;  2A0U A;  4YN0 B;  4E7S A;  4N6H A;  3EGD A;  1T5O A;  1Q0D A;  4U5C E;  3ABK C;  4PJM A;  3GAN A;  2GA0 A;  4KNV A;  3UGO A;  2EIJ C;  4P9T A;  4MW3 A;  3CEX A;  3NKE A;  5AGF A;  2H7O A;  3N2Z B;  1ORS C;  3R7C A;  1ZHW A;  2HS5 A;  2J9B A;  2QE9 A;  5GPG B;  2CNW A;  2AWC A;  4KNW A;  2OOC A;  4MVQ A;  2G62 A;  2GAQ A;  3G4Z A;  1ORJ A;  4NTB A;  4U9D A;  3U2M A;  4BJ6 A;  1K05 A;  5JT4 A;  2DB4 A;  2LCH A;  2ICW G;  4E18 A;  1MNE A;  3K6B A;  1FMV A;  3SXM A;  4NY3 A;  3UMH A;  3EZH A;  3HNK A;  2EPL X;  3W8I A;  4CBE A;  2QNL A;  2ASR A;  4DRJ B;  1VOM A;  3ATP A;  4I3M A;  4L6R A;  3GWL A;  3MLG A;  4MVU A;  3RKO F;  3V5X A;  4YL0 A;  1RMV A;  5FCL A;  2PBE A;  3S27 A;  1WAT A;  4Z9I A;  1Q0K A;  3GOD A;  2HV7 A;  3U9J A;  5EGY A;  5JVE A;  3TJ5 A;  5KYY B;  2R7U A;  1OW6 A;  2BC5 A;  2G3V A;  3UMI A;  1OR2 A;  1TFO B;  3ZSU A;  2GWW A;  3O6X A;  5AC4 A;  4J30 B;  4R32 A;  3S29 A;  3SZR A;  1VTM P;  2Y69 C;  2PF4 E;  3HNI A;  2L7A A;  2YL1 A;  2ZXP A;  3QZC A;  4WGY A;  4CDY A;  3N0T A;  2J9U A;  2W9Y A;  2W4M A;  2VCB A;  2PP4 A;  1TQG A;  1HE1 A;  3JSZ A;  3KL4 A;  4XPY A;  3VAY A;  3ZVR A;  5DQT A;  4K1O A;  1O5H A;  1YZC A;  2YZS A;  3HKK A;  4M63 A;  3LEO A;  2LD6 A;  2KC3 A;  2XLD A;  4FAP B;  4OD5 A;  1ST6 A;  3U2L A;  4C7O A;  5KYU B;  2CCY A;  2ZXR A;  2J0X A;  3I5Q A;  2AVK A;  4AE4 B;  3H65 A;  5JS5 A;  2MYS A;  2MWQ A;  1GQA A;  3AG2 C;  3PMR A;  1OR3 A;  2YWA A;  4I44 A;  3LS0 A;  2OCC C;  1ORY A;  3B0U X;  4XPW A;  1JPN A;  4RBN A;  5F28 E;  3I4U A;  2JD3 A;  5D91 A;  4AL1 A;  2A69 F;  2DYR C;  3HLZ A;  2R7O A;  3KH2 A;  4P9F A;  4EKW A;  4IWB A;  4O6M A;  5KYX A;  1QPU A;  4CS9 C;  1JR8 A;  3ASN C;  1S05 A;  3M1C B;  3LLI A;  1ZU5 A;  1WTY A;  2L6H A;  5KYU A;  1O87 A;  5A6K A;  4JJF A;  4CX9 A;  3TUL A;  1V74 B;  1FR0 A;  3EHM A;  1H6G A;  3QW0 A;  3U8V A;  3RQE A;  5BUO A;  1CGO A;  1T6Q A;  3NG1 A;  3O39 A;  3LUT B;  1M6T A;  4BEM J;  3K7D A;  5HSW A;  2L6F A;  1JAF A;  3UR3 C;  1T6I A;  2G3K A;  4LAC B;  3ZG1 A;  2HSB A;  3KYI A;  2EPO A;  2LFF A;  3KMI A;  4K7B A;  1N1C A;  1ZVZ A;  3RW0 A;  4MVZ A;  4NQF A;  3LS1 A;  2CW0 F;  1EI7 A;  2A6H F;  5DLJ A;  4D4N A;  4WJ0 A;  4CSA A;  2NUP B;  2R25 A;  4XEV A;  2YLD A;  4DRH B;  4YT8 A;  4IRU A;  4G7Z F;  2M4E A;  4CSA C;  4CIH A;  1GGQ A;  4YT4 A;  1BR4 A;  2IXN A;  2P61 A;  3X1O A;  2WZG A;  2V3C C;  1S7Z A;  4E0I A;  3S84 A;  4N06 A;  1LE4 A;  2IXP A;  2XLO A;  3A9C A;  1CGM E;  4YT5 A;  1JPJ A;  1NZE A;  4ER9 A;  3OEO A;  1Z5Z A;  3ZIB A;  4BJ5 A;  1TWG A;  5L0H A;  2TMV P;  2OU6 A;  4FX5 A;  5A69 A;  1NBB A;  4IAR A;  2FFH A;  5A6B D;  3FAP B;  2WVO A;  3DJN B;  3E9V A;  1OCZ C;  2HJ3 A;  4PK4 A;  3W4Y A;  2I15 A;  1SR2 A;  3C8Z A;  1NFO A;  2VB6 A;  3ZQV A;  4CDV A;  3UGP A;  2XS1 A;  4H4K C;  4B6I A;  3DM9 B;  2H7B A;  3CQZ A;  4MND A;  1LE2 A;  3AGU A;  1CPR A;  1K04 A;  1IZM A;  2OJE D;  3Q7L A;  2LFD A;  4AK9 A;  3H2V A;  1RCP A;  4JKV A;  1B68 A;  4PJL A;  3ZC4 A;  3TOM A;  5JRA A;  3A11 A;  3K1H A;  3X2Q C;  4OIO F;  2EIL C;  5AC5 A;  2HJM A;  3DJU B;  2MHR A;  3EQL F;  1MMG A;  1LI7 A;  2Y39 A;  3C8G D;  1LIH A;  1NU9 C;  4LLC A;  1RJ9 B;  2Y3B A;  2NSG A;  3AQC A;  3CSK A;  3JSE O;  1LS4 A;  3MYI A;  3RFY A;  3U3B A;  4IAQ A;  1FAP B;  1Q0F A;  3IQ6 A;  3NYL A;  4U9E A;  1OW8 A;  3NMJ A;  3JRM O;  1YA9 A;  2Y3G A;  2NSF A;  3FMS A;  2J7P A;  3GEH A;  5E2Q A;  5BQH A;  1TR2 A;  3HNJ A;  1BR2 A;  3IQC A;  4MTO A;  1HMO A;  3T6G B;  3U9M A;  3AG3 C;  2WZF A;  1T01 A;  3QW1 A;  2GFH A;  4YL3 A;  2J9V A;  4LER A;  2O9X A;  5T1D B;  3RIP A;  3ZDL A;  2RD9 A;  3GWN A;  4XWJ A;  2M64 A;  1Z23 A;  3PCV A;  1EKY A;  4XLN F;  2R9R B;  3DKA A;  4ULW A;  1OKK A;  4AX2 A;  1TWC A;  4YK5 A;  2ETS A;  2QY9 A;  4DRI B;  1D1C A;  1AVO B;  3HNL A;  1V4A A;  2XLW A;  5CI9 A;  1M2O A;  2P7V A;  2DI3 A;  3NMI A;  5KYW B;  2VC9 A;  5L0D A;  3NMK A;  4LDQ A;  3ASO C;  4QDL A;  2B0H A;  3JYY A;  2XRH A;  3M79 A;  1DOW A;  1UG7 A;  4U5F E;  2HZ8 A;  4IAO A;  3EH2 A;  3FOP A;  3B71 A;  1PD0 A;  2RSE B;  4PFO A;  4DVY P;  2HKV A;  3DXJ F;  3KYJ A;  4E0H A;  3Q6N A;  2KSF A;  4JTC B;  3WHN A;  4CS8 A;  1OW7 A;  3SEO A;  5A6J A;  2JX0 A;  4K0D A;  1AEP A;  2KK1 A;  3TJ6 A;  5KYX B;  1D0X A;  3VYW A;  2Z15 A;  2Q9C A;  3WG7 C;  4PJJ A;  4XEK A;  4JZA A;  3HJC A;  5E3C A;  4YWQ A;  3F46 A;  4BEJ A;  1WAS A;  1L7C A;  4AE4 A;  5JLI A;  3U8P A;  3E70 C;  2IM8 A;  2WZL A;  3O55 A;  3POV A;  1YYX A;  3QTH A;  2KYH A;  2EPK X;  1QVX A;  3EZI A;  3LEV A;  3RVY A;  3CZ6 A;  5F5F A;  2GDC A;  3EG9 B;  5DQZ A;  3B9Q A;  4MS2 A;  4PJN A;  4GQH A;  4W8K A;  4BG0 A;  2XM4 A;  3SNH A;  1NLX A;  1SF8 A;  4LDK A;  3C63 A;  2IXO A;  3M15 A;  1DOV A;  3QMK A;  2H8A A;  4G7H F;  2KJG A;  3IQ5 A;  3L1M A;  2QUP A;  3AJM A;  4EBK A;  2XS8 A;  4ULV A;  3AGT A;  1C03 A;  3EHN A;  4BJ1 A;  4C3B A;  1TKN A;  2DGJ A;  4ANJ A;  4MVS A;  4EBJ A;  3JTL O;  3Q6M A;  2Q00 A;  4HE8 D;  1ZU4 A;  4JVS A;  4IB4 A;  3G50 A;  3LES A;  2LP4 A;  4ZLC A;  1A7V A;  5TJ5 E;  3DMD A;  3PDM P;  4BJ6 C;  4OIQ F;  2UUH A;  1LS1 A;  2OEV A;  1T6U A;  4Q5S F;  1RJ9 A;  3MX3 A;  4JW1 A;  1I5N A;  2OJQ A;  2EIK C;  5FZT A;  5COM A;  3C7J A;  3VM6 A;  3SYN A;  4Z9J A;  2I8B A;  3KPH A;  2C04 A;  1FFT C;  1FMW A;  4U5D E;  2KNH A;  1YYJ A;  5KYN A;  3SP1 A;  1E85 A;  1OXK A;  2R7X A;  1HE9 A;  1VK5 A;  2R7T A;  1A0B A;  3L8I A;  1V54 C;  5B3I A;  4JJG A;  2YL7 A;  4CS8 C;  4DVZ A;  1PCX A;  4BJT A;  1XZQ A;  2XLE A;  4NTA A;  3SXZ A;  4MVO A;  3T6J A;  4DBQ A;  1APC A;  2IOQ A;  3FHD A;  2L6G A;  4JRZ A;  3EGD B;  3DI5 A;  5T3W A;  3LLK A;  4KC9 A;  3ZTM A;  1W2W A;  1Z6A A;  4YJW A;  2XLH A;  4WAB A;  1HMD A;  4G78 A;  3DAF A;  3JZ0 A;  3C62 A;  3JYH A;  4X0R A;  4O6Y A;  4HEA J;  3N24 A;  1RKE B;  5COG A;  4U5G A;  2XL8 A;  5E33 A;  2VCA A;  3FAJ A;  1BZ4 A;  4A4A A;  2NG1 A;  2W45 A;  4CDA A;  1ZYR F;  3LJB A;  4DXW A;  1PD1 A;  1A7D A;  1GM5 A;  2ZXW C;  3WOD F;  1SMY F;  2YKZ A;  2R7W A;  3DE9 A;  1FNT c;  3PHF 2;  1ZHZ A;  1KU2 A;  5L0G A;  1M2V B;  1SZI A;  1YAR O;  2YHS A;  3EFO A;  4JTD B;  3I5P A;  1ZHY A;  4EWC A;  5L3Q A;  2L81 A;  1G5Z A;  2WL8 A;  1BBH A;  4XTK A;  2V26 A;  5E3A A;  3K66 A;  1RKC A;  4MW8 A;  4CJO A;  3S90 A;  2EPM X;  1AUE A;  4JCH A;  2P6V A;  3T4R A;  3RVZ A;  4E17 A;  1Q0M A;  1LM3 B;  2Y3H A;  3EGX A;  1J8Y F;  4G0H A;  4W8P A;  3FXH A;  3T9O A;  2WB7 A;  4DJ9 A;  5K0I A;  1NSG B;  1YVI A;  2PX3 A;  2VCC A;  3EG9 A;  2R02 A;  3K33 A;  4FES A;  4DOZ A;  1ZW2 A;  4LLE A;  1ZZP A;  1OQC A;  4JIO A; 
#chains in the Genus database with same CATH homology
 1NG1 A;  3JCU Q;  4OIP F;  4C3E A;  3T6B A;  3NYM A;  3V7O A;  3AQB A;  2KW3 C;  4DBR A;  2IYL D;  4KBL A;  4J32 B;  4OIN F;  5DS4 A;  5DVW A;  1IW7 F;  1D1A A;  1Z3I X;  4U5B E;  5EHH A;  2VH3 A;  4U5E E;  3S28 A;  3JRT A;  4XLP F;  1FFH A;  4HFK B;  2J7P D;  2CGE A;  3EJN A;  3L34 A;  4OIR F;  2XXA A;  1TWA A;  2IXM A;  2LSE A;  3LNR A;  3B0V C;  2Q3T A;  5KYW A;  4Q4Z F;  1QZX A;  2D5R B;  2PFD A;  2NUT A;  4QI2 A;  1OCR C;  1VYK A;  4I1O B;  4GYT A;  2ZPA A;  4YT2 A;  2QTV A;  2XSE A;  2ZXO A;  4Q7C A;  1MMN A;  1OKK D;  1V55 C;  2B0J A;  1M56 C;  3Q7G A;  3TD7 A;  2FGY A;  1M2V A;  4O79 A;  2Q9A A;  3NKD A;  2XL4 A;  2Y3D A;  3EH1 A;  2C03 A;  2DYS C;  5DS5 A;  4O6N A;  1FTS A;  3FVY A;  3RH3 A;  2PX0 A;  3NRH A;  2R7S A;  3ABL C;  5T3T A;  4I1M A;  3W2W A;  2R7V A;  3HTK C;  3LAY A;  4RD9 A;  2OG2 A;  5CI8 A;  4F4B A;  1D0Z A;  3DAG A;  2YEV A;  5IY5 C;  3DD7 A;  3DZA A;  4MQ9 F;  4A2N B;  4P6I C;  2WVQ A;  3K1I C;  2KQ9 A;  4O7G A;  2L9J A;  3NYJ A;  4BJ5 C;  4KI2 A;  3F47 A;  3IEE A;  2EIM C;  3DM5 A;  2HV6 A;  2J46 A;  4ZLD A;  2VAS A;  4PFP A;  2E87 A;  2KGO A;  2J45 A;  2NUP A;  4IJJ A;  2H7V C;  4QI0 A;  3RYL A;  1OCC C;  1OCO C;  5L3V A;  4C3D A;  2NUT B;  4U5H A;  4EBB A;  3EPV A;  1WGW A;  1VYI A;  1LVK A;  1D1B A;  2R7Q A;  3KKB A;  5B1A C;  3W8H A;  5B3S C;  2W4B A;  3S0X A;  2J9W A;  2Q9B A;  3L0I A;  4HFF B;  1MND A;  1G8X A;  3ECS A;  2R7R A;  2A68 F;  4FWV A;  3W2V A;  1MMA A;  1ZHT A;  1QLE C;  3OA1 A;  4G7O F;  4JUR I;  4C7O B;  5DS6 A;  1LKX A;  1NU7 D;  5F5H A;  3ABM C;  2A1D D;  5B1B C;  2CDQ A;  2WVN A;  2EIN C;  3NDB B;  2J0W A;  2A6E F;  4CS7 A;  3UMK A;  3ITF A;  3EGX B;  5D92 A;  3FDQ A;  4RDA A;  2BE5 F;  1J8M F;  4E7Z A;  3OWT A;  3AG1 C;  1MMD A;  2CNW D;  3EFO B;  1TWH A;  5KYY A;  3AG4 C;  1Z63 A;  4OD4 A;  4CS9 A;  3JT1 A;  4GEH A;  1ZHX A;  3B0P A;  1D0Y A;  3UNG C;  1BR1 A;  1VMA A;  1M57 C;  2X51 A;  4YN0 B;  4E7S A;  3EGD A;  4U5C E;  3ABK C;  4PJM A;  3GAN A;  4KNV A;  3UGO A;  2EIJ C;  3NKE A;  2H7O A;  3N2Z B;  1ZHW A;  2CNW A;  4KNW A;  2G62 A;  4BJ6 A;  1MNE A;  3K6B A;  1FMV A;  3W8I A;  4NY3 A;  3UMH A;  3EZH A;  4CBE A;  1VOM A;  4I3M A;  3MLG A;  3RKO F;  5FCL A;  3S27 A;  3GOD A;  2HV7 A;  5EGY A;  2R7U A;  5KYY B;  2G3V A;  3UMI A;  3ZSU A;  3O6X A;  4J30 B;  3S29 A;  3SZR A;  2Y69 C;  2PF4 E;  2ZXP A;  3QZC A;  3N0T A;  2J9U A;  2W9Y A;  2W4M A;  3KL4 A;  2PP4 A;  3JSZ A;  3VAY A;  3ZVR A;  5DQT A;  1O5H A;  2YZS A;  4M63 A;  4OD5 A;  1ST6 A;  4C7O A;  5KYU B;  2ZXR A;  2J0X A;  3I5Q A;  4AE4 B;  3H65 A;  2MYS A;  2MWQ A;  3PMR A;  3AG2 C;  4I44 A;  3LS0 A;  2OCC C;  3B0U X;  1JPN A;  4RBN A;  3I4U A;  2JD3 A;  5D91 A;  2A69 F;  2DYR C;  3HLZ A;  2R7O A;  3KH2 A;  4IWB A;  4O6M A;  5KYX A;  4CS9 C;  3ASN C;  3M1C B;  3LLI A;  1ZU5 A;  5KYU A;  1O87 A;  4JJF A;  3EHM A;  5BUO A;  3NG1 A;  3O39 A;  3K7D A;  5HSW A;  3UR3 C;  2G3K A;  4LAC B;  3ZG1 A;  3KMI A;  4K7B A;  1N1C A;  3LS1 A;  2CW0 F;  2A6H F;  5DLJ A;  4WJ0 A;  4CSA A;  2NUP B;  4YT8 A;  4IRU A;  4G7Z F;  2M4E A;  4CSA C;  4CIH A;  4YT4 A;  1BR4 A;  2IXN A;  3X1O A;  2V3C C;  2WZG A;  1S7Z A;  4N06 A;  2IXP A;  4YT5 A;  1JPJ A;  1NZE A;  3OEO A;  1Z5Z A;  3ZIB A;  4BJ5 A;  1TWG A;  4FX5 A;  2FFH A;  2WVO A;  3DJN B;  3E9V A;  1OCZ C;  4PK4 A;  2VB6 A;  4H4K C;  4B6I A;  3DM9 B;  2H7B A;  3CQZ A;  4MND A;  1IZM A;  3Q7L A;  4AK9 A;  4PJL A;  3ZC4 A;  3X2Q C;  3K1H A;  4OIO F;  2EIL C;  3DJU B;  3EQL F;  1MMG A;  2Y39 A;  1NU9 C;  4LLC A;  1RJ9 B;  2Y3B A;  3AQC A;  3CSK A;  3RFY A;  3NYL A;  2Y3G A;  2J7P A;  5E2Q A;  1TR2 A;  1BR2 A;  3AG3 C;  2WZF A;  5T1D B;  2GFH A;  3RIP A;  2J9V A;  4LER A;  2O9X A;  4XWJ A;  1Z23 A;  4XLN F;  4ULW A;  4AX2 A;  1OKK A;  1TWC A;  2QY9 A;  1D1C A;  5CI9 A;  1M2O A;  2P7V A;  5KYW B;  3ASO C;  4QDL A;  2XRH A;  4U5F E;  4IAO A;  3EH2 A;  4PFO A;  1PD0 A;  4DVY P;  3DXJ F;  3Q6N A;  4CS8 A;  3SEO A;  5KYX B;  4K0D A;  1D0X A;  3VYW A;  2Z15 A;  2Q9C A;  3WG7 C;  4PJJ A;  4JZA A;  3HJC A;  5E3C A;  4YWQ A;  3F46 A;  4BEJ A;  4AE4 A;  3E70 C;  2WZL A;  3POV A;  3EZI A;  3LEV A;  3CZ6 A;  5F5F A;  3EG9 B;  5DQZ A;  3B9Q A;  4PJN A;  4BG0 A;  4W8K A;  3SNH A;  1SF8 A;  2IXO A;  3QMK A;  4G7H F;  2KJG A;  3EHN A;  4BJ1 A;  4C3B A;  1TKN A;  2DGJ A;  4ANJ A;  3Q6M A;  4HE8 D;  1ZU4 A;  4JVS A;  4ZLC A;  3LES A;  3DMD A;  4BJ6 C;  4OIQ F;  1LS1 A;  4Q5S F;  1RJ9 A;  3MX3 A;  4JW1 A;  2EIK C;  3SYN A;  2I8B A;  2C04 A;  1FFT C;  1FMW A;  4U5D E;  2KNH A;  5KYN A;  3SP1 A;  2R7X A;  1VK5 A;  2R7T A;  1V54 C;  4JJG A;  4CS8 C;  4DVZ A;  1PCX A;  4BJT A;  4DBQ A;  3T6J A;  2IOQ A;  3FHD A;  5T3W A;  3EGD B;  3LLK A;  4KC9 A;  1W2W A;  1Z6A A;  4YJW A;  3DAF A;  4X0R A;  3JYH A;  4O6Y A;  4HEA J;  3N24 A;  4U5G A;  5E33 A;  3FAJ A;  2NG1 A;  2W45 A;  1ZYR F;  3LJB A;  1PD1 A;  2ZXW C;  3WOD F;  1SMY F;  2R7W A;  3PHF 2;  1ZHZ A;  1KU2 A;  1M2V B;  1SZI A;  2YHS A;  3EFO A;  3I5P A;  1ZHY A;  4EWC A;  5L3Q A;  2L81 A;  2WL8 A;  4XTK A;  2V26 A;  5E3A A;  3K66 A;  4JCH A;  2P6V A;  3T4R A;  2Y3H A;  3EGX A;  4G0H A;  3UGP A;  1J8Y F;  2WB7 A;  2PX3 A;  3EG9 A;  3K33 A;  4FES A;  4DOZ A;  4LLE A;  2XXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...