2KW3C

Heterotrimeric interaction between rfx5 and rfxap
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords DNA-binding protein RFX5
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 2010-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1340 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2kw3C00
2KW3C
chains in the Genus database with same CATH superfamily
2R05A 2R7UA 3Q7GA 2ZXWC 4XEKA 2C03A 2YWAA 1NU9C 1VOMA 3PCVA 2G62A 3QMKA 4XPYA 3DM9B 3VAYA 1M6TA 2LSEA 2YRFA 2XRHA 4DRJB 4CIPA 3ABMC 2M64A 4U5CE 4JKVA 3T9OA 1FR0A 4GQHA 3ZTZA 3ZSUA 5B1AC 1YJGA 1TQGA 2Q9BA 1Q0FA 2QUPA 2W9YA 4E0IA 3LEOA 4BEJA 2HV7A 5L0GA 3OEOA 1Q0MA 4Q7CA 1NZEA 5TJ5E 3EHNA 4CSAA 2H7BA 2HSBA 2PBEA 3DJUB 2NSGA 1FAPB 3QVZA 1EA8A 4C7OB 4EIYA 1WOLA 1YLMA 4JVSA 3T4RA 1IZMA 4I1MA 2RSEB 3H65A 5D91A 1RCPA 3C8GB 4JTAB 2Y3GA 4K7BA 2W4MA 3JTLO 2EPMX 3U3BA 4YN0B 5L0HA 4G7HF 2KJGA 4LDRA 1YA7O 3DZAA 3LUTB 3NMIA 3G4ZA 4MVSA 2EPLX 1D0YA 1S05A 3TD7A 3HTKC 5L0IA 2Y39A 2A69F 2XL4A 4JRZA 4MS2A 4P9TA 2X51A 2WB7A 3DJNB 2R7WA 1M57C 1EI7A 2XS1A 3GWNA 2Q9AA 2WL8A 4OD5A 4XWJA 2WZFA 3VM6A 4MTOA 3GM1A 2R7VA 2Q00A 3M79A 2CYDA 3TK0A 4JIOA 4IWBA 3B29A 1C03A 5L0FA 4MQ9F 4WABA 4LLEA 4N6HA 1E85A 3W4YA 2EINC 1QQ3A 2B0JA 2OG2A 4L6RA 2DGJA 1ORYA 3C8GD 3V5YA 4O7GA 2OKUA 3RF3A 2HSQA 3A11A 3NMJA 1E2XA 4JEBA 1EKYA 1FFHA 2HMZA 4O6MA 4EKWA 2MHRA 2CGEA 2J9VA 4PR9A 1YZCA 3FVYA 2KYHA 2R03A 3IHUA 2DYRC 3ECSA 1RKEB 3SXKA 5JVEA 3Q6NA 1FMWA 3PHF2 3LLKA 1MNEA 2LCHA 2QTVA 2YEVA 1QSPA 2BE5F 1V55C 2L6FA 1T6IA 2KNHA 4R32A 3GM3A 1Z63A 3SYNA 1NFNA 2A0BA 1J8MF 2Y69C 4MTFA 3WAQA 4A4AA 3JYHA 1VMAA 1FFTC 2Y3BA 1IW7F 1WGWA 3MYFA 1PCXA 1YARO 2F22A 1VLSA 4EHPA 3FOOA 4D4XA 2YLDA 4G78A 2Y3HA 5BQHA 5CI9A 3HNJA 3W8IA 3AGUA 1SR2A 3JRMO 3H2UA 1MNDA 4BG0A 1DOWA 2X0CA 3K1IC 1ZHWA 4WGYA 3KH2A 5FZTA 1NFOA 3SEOA 2Q4FA 2H7OA 1FMVA 1WASA 3ATPA 4HFKB 3TJ5A 4Q5SF 3NKDA 4PJMA 1KU2A 2YL1A 1JPJA 1ZYRF 1BBHA 2HV6A 4XLPF 1CGNA 2VCCA 1LVKA 2XLEA 1UFBA 2XLOA 4U9DA 3SP1A 2J8WA 5CIVA 1Q0GA 2M4EA 3KYIA 5E33A 5BQGA 1RXQA 4CX9A 4FX5A 2IXNA 1L7CA 3AG1C 1SYQA 3I4UA 4N4WA 3QW1A 5EK0A 4FESA 3U9MA 3NDBB 2KK1A 1JOGA 4AL0A 5T1DB 2L9JA 3ASNC 4IRUA 4LLCA 1LE2A 2WZLA 3K1HA 4KC9A 4YL3A 4CDVA 2LFFA 3FOPA 2O9XA 4U5BE 2FFHA 3C63A 4P9FA 2B0HA 2JPUA 4C3EA 3GODA 4U5GA 3FDQA 3UGPA 1QLEC 1L3PA 4IAOA 4CBEA 2BL2A 3VF0A 2QY9A 3IQ6A 2R7RA 3VRCA 2FGYA 1YDIA 1I5NA 3WODF 1R5ID 4ZLCA 2GDCA 5COGA 3EPVA 4Z9HA 3U8PA 1BZ4A 2XXAA 1ZW3A 4YL1A 4C3BA 2XL6A 1GM5A 2KSFA 2OCCC 4NTBA 1BR1A 5EHHA 3B0PA 2YKZA 2HJ3A 3EGXA 2CCYA 1I4YA 2PX0A 5AC5A 3NKEA 1BR2A 1U89A 2MYSA 1NBBA 3C18A 4N6CA 3N2ZB 4E7SA 4CIHA 5T3TA 2H8AA 2CNWD 3GORA 1OW7A 2CW0F 3HJCA 2ZPAA 3GEIA 4G0HA 5B3IA 5HV9A 3AG2C 2AVKA 1D1AA 3HKKA 1TKNA 3K1IA 5KYWB 4JTDB 1SF8A 3PDMP 4ULVA 3S84A 4CDAA 1HY5A 3JSEO 1C17M 1VK5A 3DAFA 4N06A 1WN0A 3CAXA 1QVXA 3W2VA 1TWHA 3R7CA 1Z23A 3KKBA 3K33A 2YZSA 1GGQA 3KPHA 1V74B 4M63A 4XPWA 4YK5A 2P61A 5F5HA 4AX2A 1HE9A 4XLNF 4CJGA 2YL7A 5A69A 2TMVP 5DQTA 1A7EA 5JRAA 2WVQA 1AVOB 2QNLA 4EBJA 1K40A 1HW1A 5E2QA 3QTHA 1G5ZA 3RH3A 3T6BA 1PD1A 4BJTA 4CJOA 3RQEA 3J06A 3LESA 2PX3A 4W8PA 2H7VC 1LIHA 2WVOA 3W2WA 3A9CA 3EGDA 1H9TA 4X0RA 4OIRF 1V54C 3OA1A 4MNDA 1V4AA 4BJ5A 2EIMC 3MBGA 4RD9A 2GAQA 3ZC4A 3S90A 1OQCA 2HUJA 5KYNA 3UMHA 1YVIA 3UGOA 3IEEA 5JUAA 4BJ6C 1W2WA 1T9KA 2AU5A 3EG9A 4LDKA 3CEXA 2LD6A 1NLXA 4XEFA 4DXWA 5BQIA 5KYXA 1F1MA 5D92A 2L7AA 1KNYA 3UR3C 1Y6DA 4U5DE 2QLAA 3AQBA 4GEHA 3X2QC 4CS9C 1ZVZA 1ORSC 2OEVA 2Q3TA 3JT1A 5JP7A 3HNLA 3SXMA 3GEEA 4IAQA 3UMIA 1U6HA 1XZPA 2RD9A 3BRJA 4EBBA 1LPEA 2NPUA 3EQLF 3IPMO 2AWCA 2OJQA 4QI0A 3ZVRA 3ZDLA 1A0BA 5DLJA 2V3CC 1MQVA 1I4ZA 1OCRC 2P7VA 2R7OA 2EPNA 1YA9A 2XM0A 3L34A 1Y4CA 3NYLA 4PACA 3SXZA 4U5HA 2R9RB 2J46A 1LI5A 2L6GA 2XM4A 2J9UA 1VYIA 3AG3C 1AEPA 3LNRA 4JJGA 4DBRA 1O5HA 3Q6MA 1LS1A 3C8ZA 1GQAA 2CDQA 2LQGA 1Q0KA 2OJED 3NRHA 3RVYA 1SZIA 2NUPA 3DI5A 4BPMA 4JJFA 3TULA 1TWCA 1HW2A 3KMIA 5JSLA 1TFOB 4DVYP 2Z15A 5DS4A 3DXJF 2CNWA 3RVZA 3S28A 2IXOA 5EGYA 5L0JA 2YVKA 4J32B 3QW0A 4PK4A 5DS5A 1LE4A 2VB6A 1NG1A 4MTGA 3NMKA 2PF4E 3ZIBA 1NU7D 2G3KA 2L81A 3V5XA 1JR8A 2VC9A 5CI8A 3HNKA 2NUTA 1A41A 4H54A 4XTKA 4EBKA 1XWJA 2XLDA 5T3WA 1ZHTA 4OINF 4NY3A 3ABLC 4GYTA 3GWLA 2A1DD 2NSFA 3GM2A 1BDJB 1D1BA 3U0CA 1TWGA 2NUPB 3AQCA 4O6YA 1WATA 1JPNA 4J30B 1H7IA 2R7QA 3S9OA 5DQZA 3LLIA 2IYLD 4DOZA 1G4US 2WVNA 3DE9A 4MVUA 1WTYA 1Z6AA 2UUIA 2YL0A 3X1OA 5L0CA 3MYIA 2D5RB 2IXPA 1CGOA 2NUTB 4K0DA 4XPXA 4NTFA 4JW1A 3M15A 4MVZA 1OCOC 4JZAA 4Q4ZF 2R02A 1N1CA 4O6NA 3H2VA 3ASOC 3HLZA 5A6BD 1OCCC 4HFFB 3FMSA 4YT4A 1HMOA 2DI3A 3U8VA 3U5SA 2EPKX 4PFPA 1KTMA 4DRHB 1ST6A 1ZHYA 3EH1A 3JYYA 1PV3A 4PFOA 2XLWA 4H4KC 2J9WA 1PD0A 2Q7RA 4RBNA 1E83A 2AWYA 4IGGA 1K04A 1HMDA 2LIGA 3RIPA 2I15A 4FAPB 2A68F 2P6VA 4CS7A 4Z9IA 1YZAA 2A6HF 3I5PA 4CS8A 3EHMA 1H9GA 2VCBA 3DD7A 3FXHA 3ZTMA 5B3SC 3B0VC 4KBLA 4I3MA 4ONSA 1Z7Qc 4U9EA 1R4TA 1RKEA 2ZD9A 3EH2A 4MVMA 2D4UA 1S7ZA 1Z5ZA 3UNGC 4I1OB 3QVYA 2YQYA 3BEHA 2VH3A 2IBFA 1OKKA 1RJ9B 4AE4B 3E70C 4W8KA 4U5FE 4EWCA 4ZLDA 3S0XA 3M4CA 3S27A 2P0NA 2IM8A 2XL8A 3EGDB 1OW6A 2G3VA 3DWWA 1Z3IX 3F46A 3ITFA 3JSZA 3K7DA 2GA0A 4D4NA 1QPUA 4C3DA 3C62A 4BEMJ 3F47A 2ICWG 3TQOA 4I44A 5AGFA 4YL0A 2A6EF 2IXMA 2ZXOA 1ZHXA 3RQGA 1MMNA 2VASA 3C7JA 3EG9B 3KYJA 5F5FA 1OR3A 4RDAA 2Q9CA 2EIJC 3M1CB 5DVWA 5KYXB 5GPGB 4DBQA 3V7OA 2OQMA 3IQTA 2WZGA 1D1CA 4ULWA 2R7SA 1A7VA 2P1AA 3RW0A 5HSWA 2UUHA 3K66A 5A6JA 2PFDA 3DM5A 4IJJA 2C04A 1RJ9A 2JD3A 4AE4A 5E3CA 3NG1A 4IARA 2LP4A 1Q0DA 4DJ9A 2AP3A 5A6AA 5KYYA 1ORJA 4PJJA 1LS4A 4NCQA 1OR2A 3JRTA 4Z9JA 2XS8A 4E18A 2HZ8A 1C02A 1VLTA 2DB4A 1BR4A 2KW3C 1T6UA 3LEVA 3MFNA 3O6XA 1OKKD 5JLIA 2J0XA 4PJNA 1VTMP 1G4WR 2OU6A 3FAPB 4JEAA 4MW8A 4NC3A 1LI7A 1JAFA 2XSEA 3L1MA 3N0TA 4K1OA 5AC4A 4MVQA 1ZW2A 3O55A 3LS1A 1TR2A 4JCHA 2IOQA 4XEVA 3RQFA 4BJ1A 2EILC 4JTCB 3N24A 3S29A 3U9JA 2PNOA 2YHSA 1VB5A 1JMWA 2A0UA 2YLIA 5A6BA 4IB4A 2J7PA 1FTSA 1ZU4A 3QZCA 4JCZA 3WHNA 4DVZA 5L3QA 1MMAA 1LKXA 1OW8A 3V5ZA 5DS6A 4P6IC 5KYWA 3L8IA 1SMYF 2ASRA 1ZZPA 2ETSA 2J7PD 2VCAA 3GEHA 3JCUQ 4CS8C 1YYXA 4G7ZF 2Y3DA 4DRIB 5K0IA 3B9QA 3RFYA 3SXYA 3G50A 1A7DA 2XXAB 1O87A 1UG7A 3PMRA 4LACB 5F28E 3SZRA 3EJNA 5L0DA 4OIQF 2XLHA 3FHDA 1E86A 1EQ1A 1CPRA 4HEAJ 2HJMA 1LM3B 3SNHA 3L8JA 3FAJA 1ZHZA 3POVA 1M2OA 1T5OA 1MMGA 1CGME 2HS5A 1ZU5A 2PP4A 2XLVA 3O10A 3EZHA 4PJLA 4AK9A 4JC7A 2J45A 4CDYA 3T6GB 4E0HA 2YLGA 4HE8D 3O39A 5IY5C 3WG7C 2KGOA 4NQFA 3B71A 2GWWA 2KQ9A 3M4BA 3EFOB 3IQCA 4YWQA 4MW3A 4MVOA 4OIPF 1TWAA 3RYLA 2E87A 4KNVA 4YT2A 2J0WA 3L0IA 3E9VA 2BC5A 1E84A 2QE9A 3MLGA 1U0BB 4WGZA 5BUOA 4OD4A 1D0XA 1FNTc 256BA 4A2NB 4XQ1A 1H6GA 2GFHA 3C8GA 4MVRA 3LJBA 3LS0A 1QZXA 2HKVA 2LK4A 4UDVA 1T6QA 3DAGA 1GS9A 1M2VA 3NYMA 4FWVA 4YT5A 3U2LA 2J9BA 1YYJA 5A6KA 4JURI 4J7YA 3LNMB 1DOVA 5KYUB 3B0UX 1RMVA 5JT4A 3TOLA 1OCZC 3HNIA 4YT8A 5JS5A 5KYYB 2R7TA 4KNWA 3U3FA 4B6IA 3AOUA 4F4BA 4CSAC 3EGXB 3RKOF 5KYUA 1XZQA 4WJ0A 1QKRA 2MWQA 2W4BA 3CQZA 3VYWA 3W8HA 3DMDA 2OOCA 5FCLA 2KC3A 1MMDA 1B68A 4EUKB 3I5QA 5E3AA 4J7TA 3MX3A 3T6JA 1M2VB 2HMQA 2FAPB 4BJ5C 3AJMA 4C7OA 4ER9A 2ZXPA 1AUEA 1RKCA 2EIKC 3CZ6A 3JZ0A 5L3VA 3U2MA 4AL1A 2NG1A 1TFKB 3LAYA 1VYKA 1WWPA 3ZWIA 3UMKA 5COFA 2R7XA 1K05A 3AG4C 3OWTA 4JE9A 3DE8A 2LFDA 4OIOF 3DKAA 1T01A 3KL4A 2I8BA 1G8XA 3TJ6A 1JRAA 1M56C 2OEXA 4NTAA 2EPOA 5B1BC 3CSKA 4O79A 1OXBA 4ANJA 3AGTA 1CPQA 1D0ZA 1HE1A 1O3UA 3EFOA 3IQ5A 4CS9A 4QI2A 3Q7LA 2YL3A 4G7OF 3G4XA 1J8YF 4E7ZA 3K6BA 1APCA 2R25A 4LERA 3R2PA 3ZQYA 2ZXRA 3ZG1A 4BJ6A 3TOMA 4U5EE 3US6A 3ZQVA 3ABKC 3GANA 2XLMA 2L6HA 3EZIA 4E17A 4KI2A 5COMA 4QDLA 4YJWA 1YAUO 2W45A 3NYJA 2JX0A 2HFIA 4LDQA 2DYSC 1OXKA 1NSGB 2V26A
chains in the Genus database with same CATH topology
2R7UA 3Q7GA 2ZXWC 2C03A 3QMKA 1NU9C 1VOMA 2G62A 3DM9B 3VAYA 2LSEA 2XRHA 3ABMC 4U5CE 3ZSUA 5B1AC 2Q9BA 2W9YA 4BEJA 2HV7A 3OEOA 4Q7CA 1NZEA 4CSAA 3EHNA 2H7BA 3DJUB 4C7OB 4JVSA 3T4RA 1IZMA 4I1MA 3H65A 5D91A 4K7BA 2Y3GA 2W4MA 4G7HF 4YN0B 2KJGA 3DZAA 1D0YA 3TD7A 3HTKC 2Y39A 2A69F 2XL4A 2X51A 2WB7A 3DJNB 2R7WA 1M57C 4OD5A 2Q9AA 2WL8A 4XWJA 2WZFA 2R7VA 4IWBA 4MQ9F 4LLEA 2EINC 2B0JA 2OG2A 2DGJA 4O7GA 1FFHA 4O6MA 2CGEA 2J9VA 3FVYA 2DYRC 3ECSA 3Q6NA 1FMWA 3PHF2 3LLKA 1MNEA 2QTVA 2YEVA 2BE5F 1V55C 2KNHA 1Z63A 3SYNA 1J8MF 2Y69C 3JYHA 1VMAA 1FFTC 2Y3BA 1IW7F 1WGWA 1PCXA 2Y3HA 5CI9A 3W8IA 1MNDA 4BG0A 3K1IC 1ZHWA 3KH2A 3SEOA 2H7OA 1FMVA 4HFKB 4Q5SF 3NKDA 4PJMA 1KU2A 1JPJA 1ZYRF 2HV6A 4XLPF 3SP1A 1LVKA 2M4EA 5E33A 4FX5A 2IXNA 3AG1C 3I4UA 4FESA 3NDBB 5T1DB 2L9JA 3ASNC 4IRUA 4LLCA 2WZLA 4KC9A 3K1HA 2O9XA 4U5BE 2FFHA 4C3EA 3GODA 4U5GA 3FDQA 3UGPA 1QLEC 4IAOA 4CBEA 2QY9A 2R7RA 2FGYA 3WODF 4ZLCA 3EPVA 2XXAA 4C3BA 2OCCC 1BR1A 5EHHA 3B0PA 3EGXA 2PX0A 3NKEA 1BR2A 2MYSA 3N2ZB 4E7SA 4CIHA 5T3TA 2CNWD 2CW0F 3HJCA 2ZPAA 4G0HA 3AG2C 1D1AA 1TKNA 5KYWB 1SF8A 1VK5A 3DAFA 4N06A 3W2VA 1TWHA 1Z23A 3KKBA 3K33A 2YZSA 4M63A 5F5HA 4AX2A 4XLNF 5DQTA 2WVQA 5E2QA 3T6BA 4BJTA 3RH3A 1PD1A 3LESA 2PX3A 2H7VC 2WVOA 3W2WA 3EGDA 4X0RA 4OIRF 1V54C 3OA1A 4MNDA 4BJ5A 2EIMC 4RD9A 3ZC4A 5KYNA 3UMHA 3UGOA 3IEEA 4BJ6C 1W2WA 3EG9A 5KYXA 5D92A 3UR3C 4U5DE 3AQBA 4GEHA 3X2QC 4CS9C 2Q3TA 3JT1A 3UMIA 4EBBA 3EQLF 4QI0A 3ZVRA 5DLJA 2V3CC 1OCRC 2P7VA 2R7OA 3L34A 3NYLA 4U5HA 2J46A 2J9UA 1VYIA 3AG3C 3LNRA 4JJGA 4DBRA 1O5HA 3Q6MA 1LS1A 2CDQA 3NRHA 1SZIA 2NUPA 4JJFA 1TWCA 3KMIA 4DVYP 2Z15A 5DS4A 3DXJF 2CNWA 3S28A 2IXOA 5EGYA 4J32B 4PK4A 5DS5A 2VB6A 1NG1A 3ZIBA 3S0XA 2PF4E 1NU7D 2G3KA 2L81A 5CI8A 2NUTA 4XTKA 5T3WA 1ZHTA 4OINF 4NY3A 3ABLC 4GYTA 2A1DD 1D1BA 1TWGA 2NUPB 3AQCA 4O6YA 4J30B 1JPNA 4DOZA 2R7QA 5DQZA 3LLIA 2IYLD 2WVNA 1Z6AA 3X1OA 2D5RB 2IXPA 4K0DA 2NUTB 4JW1A 1OCOC 4JZAA 4Q4ZF 1N1CA 4O6NA 3ASOC 3HLZA 1OCCC 4HFFB 4YT4A 4PFPA 1ST6A 1ZHYA 3EH1A 4PFOA 4H4KC 2J9WA 1PD0A 4RBNA 3RIPA 2A68F 2P6VA 4CS7A 2A6HF 3I5PA 4CS8A 3EHMA 3B0VC 3DD7A 5B3SC 4KBLA 4I3MA 3EH2A 1S7ZA 1Z5ZA 3UNGC 4I1OB 2VH3A 4EWCA 1OKKA 1RJ9B 4AE4B 3E70C 4W8KA 4U5FE 4ZLDA 3S27A 3EGDB 2G3VA 3F46A 3JSZA 1Z3IX 3ITFA 3K7DA 4C3DA 3F47A 4I44A 2A6EF 2IXMA 2ZXOA 1ZHXA 1MMNA 2VASA 3EG9B 5F5FA 4RDAA 2Q9CA 2EIJC 3M1CB 5DVWA 5KYXB 4DBQA 3V7OA 2WZGA 1D1CA 4ULWA 2R7SA 5HSWA 3K66A 2PFDA 3DM5A 4IJJA 2C04A 1RJ9A 2JD3A 4AE4A 5E3CA 3NG1A 5KYYA 4PJJA 3JRTA 3LEVA 2KW3C 3O6XA 1BR4A 1OKKD 2J0XA 4PJNA 2XSEA 3N0TA 4BJ1A 3LS1A 1TR2A 4JCHA 2IOQA 2EILC 3S29A 3N24A 2YHSA 2J7PA 1FTSA 1ZU4A 3QZCA 5L3QA 4DVZA 1MMAA 1LKXA 5DS6A 5KYWA 4P6IC 1SMYF 3JCUQ 2J7PD 4CS8C 4G7ZF 2Y3DA 3B9QA 3RFYA 2XXAB 1O87A 3PMRA 4LACB 3SZRA 4OIQF 3EJNA 3FHDA 4HEAJ 3SNHA 3FAJA 1ZHZA 3POVA 1M2OA 1MMGA 1ZU5A 2PP4A 3EZHA 4PJLA 4AK9A 2J45A 4HE8D 3O39A 5IY5C 3WG7C 2KGOA 2KQ9A 4YWQA 3EFOB 4OIPF 1TWAA 3RYLA 2E87A 4KNVA 4YT2A 2J0WA 3L0IA 3E9VA 3MLGA 5BUOA 4OD4A 1D0XA 4A2NB 2GFHA 3LJBA 3LS0A 1QZXA 3DAGA 4FWVA 1M2VA 3NYMA 4YT5A 5KYUB 4JURI 3B0UX 5KYYB 1OCZC 4YT8A 2R7TA 4KNWA 4B6IA 4F4BA 4CSAC 3EGXB 3RKOF 5KYUA 4WJ0A 2W4BA 2MWQA 3CQZA 3VYWA 3W8HA 3DMDA 5FCLA 1MMDA 3I5QA 5E3AA 3MX3A 3T6JA 1M2VB 4BJ5C 4C7OA 2ZXPA 2EIKC 3CZ6A 5L3VA 3LAYA 2NG1A 1VYKA 3UMKA 2R7XA 3AG4C 3OWTA 4OIOF 3KL4A 2I8BA 1G8XA 1M56C 5B1BC 3CSKA 4O79A 4CS9A 4ANJA 3EFOA 1D0ZA 4QI2A 3Q7LA 4G7OF 1J8YF 4E7ZA 3K6BA 4LERA 2ZXRA 3ZG1A 4BJ6A 4U5EE 3ABKC 3GANA 3EZIA 4KI2A 4QDLA 4YJWA 2W45A 3NYJA 2DYSC 2V26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW3 C; 
#chains in the Genus database with same CATH topology
 2R05 A;  2R7U A;  3Q7G A;  2ZXW C;  4XEK A;  2C03 A;  2YWA A;  1NU9 C;  1VOM A;  3PCV A;  2G62 A;  3QMK A;  4XPY A;  3DM9 B;  3VAY A;  1M6T A;  2LSE A;  2YRF A;  2XRH A;  4DRJ B;  4CIP A;  3ABM C;  2M64 A;  4U5C E;  4JKV A;  3T9O A;  1FR0 A;  4GQH A;  3ZTZ A;  3ZSU A;  5B1A C;  1YJG A;  1TQG A;  2Q9B A;  1Q0F A;  2QUP A;  2W9Y A;  4E0I A;  3LEO A;  4BEJ A;  2HV7 A;  5L0G A;  3OEO A;  1Q0M A;  4Q7C A;  1NZE A;  5TJ5 E;  3EHN A;  4CSA A;  2H7B A;  2HSB A;  2PBE A;  3DJU B;  2NSG A;  1FAP B;  3QVZ A;  1EA8 A;  4C7O B;  4EIY A;  1WOL A;  1YLM A;  4JVS A;  3T4R A;  1IZM A;  4I1M A;  2RSE B;  3H65 A;  5D91 A;  1RCP A;  3C8G B;  4JTA B;  2Y3G A;  4K7B A;  2W4M A;  3JTL O;  2EPM X;  3U3B A;  4YN0 B;  5L0H A;  4G7H F;  2KJG A;  4LDR A;  1YA7 O;  3DZA A;  3LUT B;  3NMI A;  3G4Z A;  4MVS A;  2EPL X;  1D0Y A;  1S05 A;  3TD7 A;  3HTK C;  5L0I A;  2Y39 A;  2A69 F;  2XL4 A;  4JRZ A;  4MS2 A;  4P9T A;  2X51 A;  2WB7 A;  3DJN B;  2R7W A;  1M57 C;  1EI7 A;  2XS1 A;  3GWN A;  2Q9A A;  2WL8 A;  4OD5 A;  4XWJ A;  2WZF A;  3VM6 A;  4MTO A;  3GM1 A;  2R7V A;  2Q00 A;  3M79 A;  2CYD A;  3TK0 A;  4JIO A;  4IWB A;  3B29 A;  1C03 A;  5L0F A;  4MQ9 F;  4WAB A;  4LLE A;  4N6H A;  1E85 A;  3W4Y A;  2EIN C;  1QQ3 A;  2B0J A;  2OG2 A;  4L6R A;  2DGJ A;  1ORY A;  3C8G D;  3V5Y A;  4O7G A;  2OKU A;  3RF3 A;  2HSQ A;  3A11 A;  3NMJ A;  1E2X A;  4JEB A;  1EKY A;  1FFH A;  2HMZ A;  4O6M A;  4EKW A;  2MHR A;  2CGE A;  2J9V A;  4PR9 A;  1YZC A;  3FVY A;  2KYH A;  2R03 A;  3IHU A;  2DYR C;  3ECS A;  1RKE B;  3SXK A;  5JVE A;  3Q6N A;  1FMW A;  3PHF 2;  3LLK A;  1MNE A;  2LCH A;  2QTV A;  2YEV A;  1QSP A;  2BE5 F;  1V55 C;  2L6F A;  1T6I A;  2KNH A;  4R32 A;  3GM3 A;  1Z63 A;  3SYN A;  1NFN A;  2A0B A;  1J8M F;  2Y69 C;  4MTF A;  3WAQ A;  4A4A A;  3JYH A;  1VMA A;  1FFT C;  2Y3B A;  1IW7 F;  1WGW A;  3MYF A;  1PCX A;  1YAR O;  2F22 A;  1VLS A;  4EHP A;  3FOO A;  4D4X A;  2YLD A;  4G78 A;  2Y3H A;  5BQH A;  5CI9 A;  3HNJ A;  3W8I A;  3AGU A;  1SR2 A;  3JRM O;  3H2U A;  1MND A;  4BG0 A;  1DOW A;  2X0C A;  3K1I C;  1ZHW A;  4WGY A;  3KH2 A;  5FZT A;  1NFO A;  3SEO A;  2Q4F A;  2H7O A;  1FMV A;  1WAS A;  3ATP A;  4HFK B;  3TJ5 A;  4Q5S F;  3NKD A;  4PJM A;  1KU2 A;  2YL1 A;  1JPJ A;  1ZYR F;  1BBH A;  2HV6 A;  4XLP F;  1CGN A;  2VCC A;  1LVK A;  2XLE A;  1UFB A;  2XLO A;  4U9D A;  3SP1 A;  2J8W A;  5CIV A;  1Q0G A;  2M4E A;  3KYI A;  5E33 A;  5BQG A;  1RXQ A;  4CX9 A;  4FX5 A;  2IXN A;  1L7C A;  3AG1 C;  1SYQ A;  3I4U A;  4N4W A;  3QW1 A;  5EK0 A;  4FES A;  3U9M A;  3NDB B;  2KK1 A;  1JOG A;  4AL0 A;  5T1D B;  2L9J A;  3ASN C;  4IRU A;  4LLC A;  1LE2 A;  2WZL A;  3K1H A;  4KC9 A;  4YL3 A;  4CDV A;  2LFF A;  3FOP A;  2O9X A;  4U5B E;  2FFH A;  3C63 A;  4P9F A;  2B0H A;  2JPU A;  4C3E A;  3GOD A;  4U5G A;  3FDQ A;  3UGP A;  1QLE C;  1L3P A;  4IAO A;  4CBE A;  2BL2 A;  3VF0 A;  2QY9 A;  3IQ6 A;  2R7R A;  3VRC A;  2FGY A;  1YDI A;  1I5N A;  3WOD F;  1R5I D;  4ZLC A;  2GDC A;  5COG A;  3EPV A;  4Z9H A;  3U8P A;  1BZ4 A;  2XXA A;  1ZW3 A;  4YL1 A;  4C3B A;  2XL6 A;  1GM5 A;  2KSF A;  2OCC C;  4NTB A;  1BR1 A;  5EHH A;  3B0P A;  2YKZ A;  2HJ3 A;  3EGX A;  2CCY A;  1I4Y A;  2PX0 A;  5AC5 A;  3NKE A;  1BR2 A;  1U89 A;  2MYS A;  1NBB A;  3C18 A;  4N6C A;  3N2Z B;  4E7S A;  4CIH A;  5T3T A;  2H8A A;  2CNW D;  3GOR A;  1OW7 A;  2CW0 F;  3HJC A;  2ZPA A;  3GEI A;  4G0H A;  5B3I A;  5HV9 A;  3AG2 C;  2AVK A;  1D1A A;  3HKK A;  1TKN A;  3K1I A;  5KYW B;  4JTD B;  1SF8 A;  3PDM P;  4ULV A;  3S84 A;  4CDA A;  1HY5 A;  3JSE O;  1C17 M;  1VK5 A;  3DAF A;  4N06 A;  1WN0 A;  3CAX A;  1QVX A;  3W2V A;  1TWH A;  3R7C A;  1Z23 A;  3KKB A;  3K33 A;  2YZS A;  1GGQ A;  3KPH A;  1V74 B;  4M63 A;  4XPW A;  4YK5 A;  2P61 A;  5F5H A;  4AX2 A;  1HE9 A;  4XLN F;  4CJG A;  2YL7 A;  5A69 A;  2TMV P;  5DQT A;  1A7E A;  5JRA A;  2WVQ A;  1AVO B;  2QNL A;  4EBJ A;  1K40 A;  1HW1 A;  5E2Q A;  3QTH A;  1G5Z A;  3RH3 A;  3T6B A;  1PD1 A;  4BJT A;  4CJO A;  3RQE A;  3J06 A;  3LES A;  2PX3 A;  4W8P A;  2H7V C;  1LIH A;  2WVO A;  3W2W A;  3A9C A;  3EGD A;  1H9T A;  4X0R A;  4OIR F;  1V54 C;  3OA1 A;  4MND A;  1V4A A;  4BJ5 A;  2EIM C;  3MBG A;  4RD9 A;  2GAQ A;  3ZC4 A;  3S90 A;  1OQC A;  2HUJ A;  5KYN A;  3UMH A;  1YVI A;  3UGO A;  3IEE A;  5JUA A;  4BJ6 C;  1W2W A;  1T9K A;  2AU5 A;  3EG9 A;  4LDK A;  3CEX A;  2LD6 A;  1NLX A;  4XEF A;  4DXW A;  5BQI A;  5KYX A;  1F1M A;  5D92 A;  2L7A A;  1KNY A;  3UR3 C;  1Y6D A;  4U5D E;  2QLA A;  3AQB A;  4GEH A;  3X2Q C;  4CS9 C;  1ZVZ A;  1ORS C;  2OEV A;  2Q3T A;  3JT1 A;  5JP7 A;  3HNL A;  3SXM A;  3GEE A;  4IAQ A;  3UMI A;  1U6H A;  1XZP A;  2RD9 A;  3BRJ A;  4EBB A;  1LPE A;  2NPU A;  3EQL F;  3IPM O;  2AWC A;  2OJQ A;  4QI0 A;  3ZVR A;  3ZDL A;  1A0B A;  5DLJ A;  2V3C C;  1MQV A;  1I4Z A;  1OCR C;  2P7V A;  2R7O A;  2EPN A;  1YA9 A;  2XM0 A;  3L34 A;  1Y4C A;  3NYL A;  4PAC A;  3SXZ A;  4U5H A;  2R9R B;  2J46 A;  1LI5 A;  2L6G A;  2XM4 A;  2J9U A;  1VYI A;  3AG3 C;  1AEP A;  3LNR A;  4JJG A;  4DBR A;  1O5H A;  3Q6M A;  1LS1 A;  3C8Z A;  1GQA A;  2CDQ A;  2LQG A;  1Q0K A;  2OJE D;  3NRH A;  3RVY A;  1SZI A;  2NUP A;  3DI5 A;  4BPM A;  4JJF A;  3TUL A;  1TWC A;  1HW2 A;  3KMI A;  5JSL A;  1TFO B;  4DVY P;  2Z15 A;  5DS4 A;  3DXJ F;  2CNW A;  3RVZ A;  3S28 A;  2IXO A;  5EGY A;  5L0J A;  2YVK A;  4J32 B;  3QW0 A;  4PK4 A;  5DS5 A;  1LE4 A;  2VB6 A;  1NG1 A;  4MTG A;  3NMK A;  2PF4 E;  3ZIB A;  1NU7 D;  2G3K A;  2L81 A;  3V5X A;  1JR8 A;  2VC9 A;  5CI8 A;  3HNK A;  2NUT A;  1A41 A;  4H54 A;  4XTK A;  4EBK A;  1XWJ A;  2XLD A;  5T3W A;  1ZHT A;  4OIN F;  4NY3 A;  3ABL C;  4GYT A;  3GWL A;  2A1D D;  2NSF A;  3GM2 A;  1BDJ B;  1D1B A;  3U0C A;  1TWG A;  2NUP B;  3AQC A;  4O6Y A;  1WAT A;  1JPN A;  4J30 B;  1H7I A;  2R7Q A;  3S9O A;  5DQZ A;  3LLI A;  2IYL D;  4DOZ A;  1G4U S;  2WVN A;  3DE9 A;  4MVU A;  1WTY A;  1Z6A A;  2UUI A;  2YL0 A;  3X1O A;  5L0C A;  3MYI A;  2D5R B;  2IXP A;  1CGO A;  2NUT B;  4K0D A;  4XPX A;  4NTF A;  4JW1 A;  3M15 A;  4MVZ A;  1OCO C;  4JZA A;  4Q4Z F;  2R02 A;  1N1C A;  4O6N A;  3H2V A;  3ASO C;  3HLZ A;  5A6B D;  1OCC C;  4HFF B;  3FMS A;  4YT4 A;  1HMO A;  2DI3 A;  3U8V A;  3U5S A;  2EPK X;  4PFP A;  1KTM A;  4DRH B;  1ST6 A;  1ZHY A;  3EH1 A;  3JYY A;  1PV3 A;  4PFO A;  2XLW A;  4H4K C;  2J9W A;  1PD0 A;  2Q7R A;  4RBN A;  1E83 A;  2AWY A;  4IGG A;  1K04 A;  1HMD A;  2LIG A;  3RIP A;  2I15 A;  4FAP B;  2A68 F;  2P6V A;  4CS7 A;  4Z9I A;  1YZA A;  2A6H F;  3I5P A;  4CS8 A;  3EHM A;  1H9G A;  2VCB A;  3DD7 A;  3FXH A;  3ZTM A;  5B3S C;  3B0V C;  4KBL A;  4I3M A;  4ONS A;  1Z7Q c;  4U9E A;  1R4T A;  1RKE A;  2ZD9 A;  3EH2 A;  4MVM A;  2D4U A;  1S7Z A;  1Z5Z A;  3UNG C;  4I1O B;  3QVY A;  2YQY A;  3BEH A;  2VH3 A;  2IBF A;  1OKK A;  1RJ9 B;  4AE4 B;  3E70 C;  4W8K A;  4U5F E;  4EWC A;  4ZLD A;  3S0X A;  3M4C A;  3S27 A;  2P0N A;  2IM8 A;  2XL8 A;  3EGD B;  1OW6 A;  2G3V A;  3DWW A;  1Z3I X;  3F46 A;  3ITF A;  3JSZ A;  3K7D A;  2GA0 A;  4D4N A;  1QPU A;  4C3D A;  3C62 A;  4BEM J;  3F47 A;  2ICW G;  3TQO A;  4I44 A;  5AGF A;  4YL0 A;  2A6E F;  2IXM A;  2ZXO A;  1ZHX A;  3RQG A;  1MMN A;  2VAS A;  3C7J A;  3EG9 B;  3KYJ A;  5F5F A;  1OR3 A;  4RDA A;  2Q9C A;  2EIJ C;  3M1C B;  5DVW A;  5KYX B;  5GPG B;  4DBQ A;  3V7O A;  2OQM A;  3IQT A;  2WZG A;  1D1C A;  4ULW A;  2R7S A;  1A7V A;  2P1A A;  3RW0 A;  5HSW A;  2UUH A;  3K66 A;  5A6J A;  2PFD A;  3DM5 A;  4IJJ A;  2C04 A;  1RJ9 A;  2JD3 A;  4AE4 A;  5E3C A;  3NG1 A;  4IAR A;  2LP4 A;  1Q0D A;  4DJ9 A;  2AP3 A;  5A6A A;  5KYY A;  1ORJ A;  4PJJ A;  1LS4 A;  4NCQ A;  1OR2 A;  3JRT A;  4Z9J A;  2XS8 A;  4E18 A;  2HZ8 A;  1C02 A;  1VLT A;  2DB4 A;  1BR4 A;  2KW3 C;  1T6U A;  3LEV A;  3MFN A;  3O6X A;  1OKK D;  5JLI A;  2J0X A;  4PJN A;  1VTM P;  1G4W R;  2OU6 A;  3FAP B;  4JEA A;  4MW8 A;  4NC3 A;  1LI7 A;  1JAF A;  2XSE A;  3L1M A;  3N0T A;  4K1O A;  5AC4 A;  4MVQ A;  1ZW2 A;  3O55 A;  3LS1 A;  1TR2 A;  4JCH A;  2IOQ A;  4XEV A;  3RQF A;  4BJ1 A;  2EIL C;  4JTC B;  3N24 A;  3S29 A;  3U9J A;  2PNO A;  2YHS A;  1VB5 A;  1JMW A;  2A0U A;  2YLI A;  5A6B A;  4IB4 A;  2J7P A;  1FTS A;  1ZU4 A;  3QZC A;  4JCZ A;  3WHN A;  4DVZ A;  5L3Q A;  1MMA A;  1LKX A;  1OW8 A;  3V5Z A;  5DS6 A;  4P6I C;  5KYW A;  3L8I A;  1SMY F;  2ASR A;  1ZZP A;  2ETS A;  2J7P D;  2VCA A;  3GEH A;  3JCU Q;  4CS8 C;  1YYX A;  4G7Z F;  2Y3D A;  4DRI B;  5K0I A;  3B9Q A;  3RFY A;  3SXY A;  3G50 A;  1A7D A;  2XXA B;  1O87 A;  1UG7 A;  3PMR A;  4LAC B;  5F28 E;  3SZR A;  3EJN A;  5L0D A;  4OIQ F;  2XLH A;  3FHD A;  1E86 A;  1EQ1 A;  1CPR A;  4HEA J;  2HJM A;  1LM3 B;  3SNH A;  3L8J A;  3FAJ A;  1ZHZ A;  3POV A;  1M2O A;  1T5O A;  1MMG A;  1CGM E;  2HS5 A;  1ZU5 A;  2PP4 A;  2XLV A;  3O10 A;  3EZH A;  4PJL A;  4AK9 A;  4JC7 A;  2J45 A;  4CDY A;  3T6G B;  4E0H A;  2YLG A;  4HE8 D;  3O39 A;  5IY5 C;  3WG7 C;  2KGO A;  4NQF A;  3B71 A;  2GWW A;  2KQ9 A;  3M4B A;  3EFO B;  3IQC A;  4YWQ A;  4MW3 A;  4MVO A;  4OIP F;  1TWA A;  3RYL A;  2E87 A;  4KNV A;  4YT2 A;  2J0W A;  3L0I A;  3E9V A;  2BC5 A;  1E84 A;  2QE9 A;  3MLG A;  1U0B B;  4WGZ A;  5BUO A;  4OD4 A;  1D0X A;  1FNT c;  256B A;  4A2N B;  4XQ1 A;  1H6G A;  2GFH A;  3C8G A;  4MVR A;  3LJB A;  3LS0 A;  1QZX A;  2HKV A;  2LK4 A;  4UDV A;  1T6Q A;  3DAG A;  1GS9 A;  1M2V A;  3NYM A;  4FWV A;  4YT5 A;  3U2L A;  2J9B A;  1YYJ A;  5A6K A;  4JUR I;  4J7Y A;  3LNM B;  1DOV A;  5KYU B;  3B0U X;  1RMV A;  5JT4 A;  3TOL A;  1OCZ C;  3HNI A;  4YT8 A;  5JS5 A;  5KYY B;  2R7T A;  4KNW A;  3U3F A;  4B6I A;  3AOU A;  4F4B A;  4CSA C;  3EGX B;  3RKO F;  5KYU A;  1XZQ A;  4WJ0 A;  1QKR A;  2MWQ A;  2W4B A;  3CQZ A;  3VYW A;  3W8H A;  3DMD A;  2OOC A;  5FCL A;  2KC3 A;  1MMD A;  1B68 A;  4EUK B;  3I5Q A;  5E3A A;  4J7T A;  3MX3 A;  3T6J A;  1M2V B;  2HMQ A;  2FAP B;  4BJ5 C;  3AJM A;  4C7O A;  4ER9 A;  2ZXP A;  1AUE A;  1RKC A;  2EIK C;  3CZ6 A;  3JZ0 A;  5L3V A;  3U2M A;  4AL1 A;  2NG1 A;  1TFK B;  3LAY A;  1VYK A;  1WWP A;  3ZWI A;  3UMK A;  5COF A;  2R7X A;  1K05 A;  3AG4 C;  3OWT A;  4JE9 A;  3DE8 A;  2LFD A;  4OIO F;  3DKA A;  1T01 A;  3KL4 A;  2I8B A;  1G8X A;  3TJ6 A;  1JRA A;  1M56 C;  2OEX A;  4NTA A;  2EPO A;  5B1B C;  3CSK A;  4O79 A;  1OXB A;  4ANJ A;  3AGT A;  1CPQ A;  1D0Z A;  1HE1 A;  1O3U A;  3EFO A;  3IQ5 A;  4CS9 A;  4QI2 A;  3Q7L A;  2YL3 A;  4G7O F;  3G4X A;  1J8Y F;  4E7Z A;  3K6B A;  1APC A;  2R25 A;  4LER A;  3R2P A;  3ZQY A;  2ZXR A;  3ZG1 A;  4BJ6 A;  3TOM A;  4U5E E;  3US6 A;  3ZQV A;  3ABK C;  3GAN A;  2XLM A;  2L6H A;  3EZI A;  4E17 A;  4KI2 A;  5COM A;  4QDL A;  4YJW A;  1YAU O;  2W45 A;  3NYJ A;  2JX0 A;  2HFI A;  4LDQ A;  2DYS C;  1OXK A;  1NSG B;  2V26 A; 
#chains in the Genus database with same CATH homology
 2R7U A;  3Q7G A;  2ZXW C;  2C03 A;  3QMK A;  1NU9 C;  1VOM A;  2G62 A;  3DM9 B;  3VAY A;  2LSE A;  2XRH A;  3ABM C;  4U5C E;  3ZSU A;  5B1A C;  2Q9B A;  2W9Y A;  4BEJ A;  2HV7 A;  3OEO A;  4Q7C A;  1NZE A;  4CSA A;  3EHN A;  2H7B A;  3DJU B;  4C7O B;  4JVS A;  3T4R A;  1IZM A;  4I1M A;  3H65 A;  5D91 A;  4K7B A;  2Y3G A;  2W4M A;  4G7H F;  4YN0 B;  2KJG A;  3DZA A;  1D0Y A;  3TD7 A;  3HTK C;  2Y39 A;  2A69 F;  2XL4 A;  2X51 A;  2WB7 A;  3DJN B;  2R7W A;  1M57 C;  4OD5 A;  2Q9A A;  2WL8 A;  4XWJ A;  2WZF A;  2R7V A;  4IWB A;  4MQ9 F;  4LLE A;  2EIN C;  2B0J A;  2OG2 A;  2DGJ A;  4O7G A;  1FFH A;  4O6M A;  2CGE A;  2J9V A;  3FVY A;  2DYR C;  3ECS A;  3Q6N A;  1FMW A;  3PHF 2;  3LLK A;  1MNE A;  2QTV A;  2YEV A;  2BE5 F;  1V55 C;  2KNH A;  1Z63 A;  3SYN A;  1J8M F;  2Y69 C;  3JYH A;  1VMA A;  1FFT C;  2Y3B A;  1IW7 F;  1WGW A;  1PCX A;  2Y3H A;  5CI9 A;  3W8I A;  1MND A;  4BG0 A;  3K1I C;  1ZHW A;  3KH2 A;  3SEO A;  2H7O A;  1FMV A;  4HFK B;  4Q5S F;  3NKD A;  4PJM A;  1KU2 A;  1JPJ A;  1ZYR F;  2HV6 A;  4XLP F;  3SP1 A;  1LVK A;  2M4E A;  5E33 A;  4FX5 A;  2IXN A;  3AG1 C;  3I4U A;  4FES A;  3NDB B;  5T1D B;  2L9J A;  3ASN C;  4IRU A;  4LLC A;  2WZL A;  4KC9 A;  3K1H A;  2O9X A;  4U5B E;  2FFH A;  4C3E A;  3GOD A;  4U5G A;  3FDQ A;  3UGP A;  1QLE C;  4IAO A;  4CBE A;  2QY9 A;  2R7R A;  2FGY A;  3WOD F;  4ZLC A;  3EPV A;  2XXA A;  4C3B A;  2OCC C;  1BR1 A;  5EHH A;  3B0P A;  3EGX A;  2PX0 A;  3NKE A;  1BR2 A;  2MYS A;  3N2Z B;  4E7S A;  4CIH A;  5T3T A;  2CNW D;  2CW0 F;  3HJC A;  2ZPA A;  4G0H A;  3AG2 C;  1D1A A;  1TKN A;  5KYW B;  1SF8 A;  1VK5 A;  3DAF A;  4N06 A;  3W2V A;  1TWH A;  1Z23 A;  3KKB A;  3K33 A;  2YZS A;  4M63 A;  5F5H A;  4AX2 A;  4XLN F;  5DQT A;  2WVQ A;  5E2Q A;  3T6B A;  4BJT A;  3RH3 A;  1PD1 A;  3LES A;  2PX3 A;  2H7V C;  2WVO A;  3W2W A;  3EGD A;  4X0R A;  4OIR F;  1V54 C;  3OA1 A;  4MND A;  4BJ5 A;  2EIM C;  4RD9 A;  3ZC4 A;  5KYN A;  3UMH A;  3UGO A;  3IEE A;  4BJ6 C;  1W2W A;  3EG9 A;  5KYX A;  5D92 A;  3UR3 C;  4U5D E;  3AQB A;  4GEH A;  3X2Q C;  4CS9 C;  2Q3T A;  3JT1 A;  3UMI A;  4EBB A;  3EQL F;  4QI0 A;  3ZVR A;  5DLJ A;  2V3C C;  1OCR C;  2P7V A;  2R7O A;  3L34 A;  3NYL A;  4U5H A;  2J46 A;  2J9U A;  1VYI A;  3AG3 C;  3LNR A;  4JJG A;  4DBR A;  1O5H A;  3Q6M A;  1LS1 A;  2CDQ A;  3NRH A;  1SZI A;  2NUP A;  4JJF A;  1TWC A;  3KMI A;  4DVY P;  2Z15 A;  5DS4 A;  3DXJ F;  2CNW A;  3S28 A;  2IXO A;  5EGY A;  4J32 B;  4PK4 A;  5DS5 A;  2VB6 A;  1NG1 A;  3ZIB A;  3S0X A;  2PF4 E;  1NU7 D;  2G3K A;  2L81 A;  5CI8 A;  2NUT A;  4XTK A;  5T3W A;  1ZHT A;  4OIN F;  4NY3 A;  3ABL C;  4GYT A;  2A1D D;  1D1B A;  1TWG A;  2NUP B;  3AQC A;  4O6Y A;  4J30 B;  1JPN A;  4DOZ A;  2R7Q A;  5DQZ A;  3LLI A;  2IYL D;  2WVN A;  1Z6A A;  3X1O A;  2D5R B;  2IXP A;  4K0D A;  2NUT B;  4JW1 A;  1OCO C;  4JZA A;  4Q4Z F;  1N1C A;  4O6N A;  3ASO C;  3HLZ A;  1OCC C;  4HFF B;  4YT4 A;  4PFP A;  1ST6 A;  1ZHY A;  3EH1 A;  4PFO A;  4H4K C;  2J9W A;  1PD0 A;  4RBN A;  3RIP A;  2A68 F;  2P6V A;  4CS7 A;  2A6H F;  3I5P A;  4CS8 A;  3EHM A;  3B0V C;  3DD7 A;  5B3S C;  4KBL A;  4I3M A;  3EH2 A;  1S7Z A;  1Z5Z A;  3UNG C;  4I1O B;  2VH3 A;  4EWC A;  1OKK A;  1RJ9 B;  4AE4 B;  3E70 C;  4W8K A;  4U5F E;  4ZLD A;  3S27 A;  3EGD B;  2G3V A;  3F46 A;  3JSZ A;  1Z3I X;  3ITF A;  3K7D A;  4C3D A;  3F47 A;  4I44 A;  2A6E F;  2IXM A;  2ZXO A;  1ZHX A;  1MMN A;  2VAS A;  3EG9 B;  5F5F A;  4RDA A;  2Q9C A;  2EIJ C;  3M1C B;  5DVW A;  5KYX B;  4DBQ A;  3V7O A;  2WZG A;  1D1C A;  4ULW A;  2R7S A;  5HSW A;  3K66 A;  2PFD A;  3DM5 A;  4IJJ A;  2C04 A;  1RJ9 A;  2JD3 A;  4AE4 A;  5E3C A;  3NG1 A;  5KYY A;  4PJJ A;  3JRT A;  3LEV A;  2KW3 C;  3O6X A;  1BR4 A;  1OKK D;  2J0X A;  4PJN A;  2XSE A;  3N0T A;  4BJ1 A;  3LS1 A;  1TR2 A;  4JCH A;  2IOQ A;  2EIL C;  3S29 A;  3N24 A;  2YHS A;  2J7P A;  1FTS A;  1ZU4 A;  3QZC A;  5L3Q A;  4DVZ A;  1MMA A;  1LKX A;  5DS6 A;  5KYW A;  4P6I C;  1SMY F;  3JCU Q;  2J7P D;  4CS8 C;  4G7Z F;  2Y3D A;  3B9Q A;  3RFY A;  2XXA B;  1O87 A;  3PMR A;  4LAC B;  3SZR A;  4OIQ F;  3EJN A;  3FHD A;  4HEA J;  3SNH A;  3FAJ A;  1ZHZ A;  3POV A;  1M2O A;  1MMG A;  1ZU5 A;  2PP4 A;  3EZH A;  4PJL A;  4AK9 A;  2J45 A;  4HE8 D;  3O39 A;  5IY5 C;  3WG7 C;  2KGO A;  2KQ9 A;  4YWQ A;  3EFO B;  4OIP F;  1TWA A;  3RYL A;  2E87 A;  4KNV A;  4YT2 A;  2J0W A;  3L0I A;  3E9V A;  3MLG A;  5BUO A;  4OD4 A;  1D0X A;  4A2N B;  2GFH A;  3LJB A;  3LS0 A;  1QZX A;  3DAG A;  4FWV A;  1M2V A;  3NYM A;  4YT5 A;  5KYU B;  4JUR I;  3B0U X;  5KYY B;  1OCZ C;  4YT8 A;  2R7T A;  4KNW A;  4B6I A;  4F4B A;  4CSA C;  3EGX B;  3RKO F;  5KYU A;  4WJ0 A;  2W4B A;  2MWQ A;  3CQZ A;  3VYW A;  3W8H A;  3DMD A;  5FCL A;  1MMD A;  3I5Q A;  5E3A A;  3MX3 A;  3T6J A;  1M2V B;  4BJ5 C;  4C7O A;  2ZXP A;  2EIK C;  3CZ6 A;  5L3V A;  3LAY A;  2NG1 A;  1VYK A;  3UMK A;  2R7X A;  3AG4 C;  3OWT A;  4OIO F;  3KL4 A;  2I8B A;  1G8X A;  1M56 C;  5B1B C;  3CSK A;  4O79 A;  4CS9 A;  4ANJ A;  3EFO A;  1D0Z A;  4QI2 A;  3Q7L A;  4G7O F;  1J8Y F;  4E7Z A;  3K6B A;  4LER A;  2ZXR A;  3ZG1 A;  4BJ6 A;  4U5E E;  3ABK C;  3GAN A;  3EZI A;  4KI2 A;  4QDL A;  4YJW A;  2W45 A;  3NYJ A;  2DYS C;  2V26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...