2KW4A

Solution nmr structure of the holo form of a ribonuclease h domain from d.hafniense, northeast structural genomics consortium target dhr1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target DhR1A
rcsb
molecule keywords Uncharacterized protein
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2kw4A00
1BCMA 3TABA 1B9DA 4DMNA 5KTQA 2BDPA 1LWCA 4BWMA 3L3UA 3V9WA 3K58A 3QESA 3SQ0A 4N41A 4RW8A 4W5TA 3OS0A 1NK0A 1A5WA 2FBXA 4EZ9A 3ZSZA 1BHLA 3T19A 4HHTA 3V9ZA 4FJGA 3NCIA 1QHTA 4O5BA 4H8KA 1BQNA 4FLTA 3RTVA 1IKVA 5C25A 2XY7A 4EP4A 2Y1JA 3RR8A 4KI6A 3MEDA 2EHGA 3P83D 2D0BA 5KI6A 4FLVA 3KD5E 4DFJA 1RT5A 2D0CA 5EU7A 2HHXA 2BE2A 1XHZA 1CZ9A 4NCAA 4G1QA 3IS9A 3DLGA 2E6LA 2BANA 3I8DA 4KHWA 3KLFA 5CZ2A 4DTRA 3OY9A 3TANA 4M3WA 1DTTA 4F8RA 4I7FA 4O0IA 2OPSA 4DU4A 1C6VA 4AHCA 5HRNA 2QXFA 5HROA 3E01A 3HYFA 4OJRA 3VA3A 3QEVA 1X9WA 4ELUA 2RF2A 3CFOA 1QSLA 3VQCA 4M45A 1ZBIA 5J2QA 4OGEA 1RT7A 1SV5A 4RG8A 3I0SA 3O3GA 3SYZA 5J2NA 4K8ZA 4CHYA 1DTQA 4ZTFA 3FFIA 3SCXA 3PO4A 2YNGA 1VSHA 4FCYA 1NK9A 2QKBA 5HRSA 2P5OA 2X74A 3DLBA 2VG5A 3HSTB 1W9HA 3WNGA 4CGFA 1KVAA 4CFDA 3L2UA 2VG7A 1JLQA 3ZSRA 3TI0A 1JXBA 1RTDA 4M42A 4FLWA 4CIEA 3ZT2A 4BE2A 4CJUA 1UAXA 3NGYA 4DU1A 4NYNA 4CJRA 2WOMA 1HYZA 1RNHA 1HNVA 1RT3A 3CG7A 2ZE2A 3OYGA 4BDYA 1O1WA 1F21A 1CZBA 3KK1A 4HVJA 1JLFA 1VSIA 3NBPA 4AH9A 5JS1A 3U3GA 3D45A 1C1BA 1VSFA 4CJWA 4DQSA 4QAGA 4FW2A 4OKKA 4E19A 1C1CA 1EP4A 3MAQA 1S5JA 4GW6A 1ASWA 3K5OA 4LY7A 4CERA 2GBZA 4DSKA 4KI4A 3QETA 3KD1E 2IDOA 4IFVA 4DG1A 4OKJA 4O0JA 4CJEA 4KREA 1KFSA 3AVFA 4BACA 1T03A 3CM5A 4IBNA 3M8PA 4WE1A 4CGJA 3U3YA 3RR7A 4LH4A 4FJHA 3VQDA 1TK5A 4CHOA 3NFAA 3O4NA 3S9HA 1TVRA 1NK7A 1L3SA 1TK0A 3CM6A 3VQPA 4DTUA 2BGGA 4KHNA 1FK9A 1U49A 1HMVA 4IFYA 3ZT0A 4FJNA 4KAZA 4FJMA 3OS1A 2DTUA 4B9LA 1HRHA 3DLKA 3RMDA 3RMBA 3NF7A 1WAJA 4W5OA 4I9LA 1XHXA 4LD0A 3DMJA 4B9NA 1RTJA 4DSEA 4E1NA 4M3UA 1MU2A 4DS5A 2ETJA 1BL3A 4DTNA 3LAMA 3RRHA 1RCHA 4CF8A 4N5SA 1SUQA 4CHNA 3F9KA 2P1JA 3EY1A 1YVUA 1IKXA 5J2MA 3ZSQA 3SV4A 2X78A 3T3FA 2HHUA 4CEEA 4CEZA 5SWMA 2B4JA 3V1OA 2JLEA 4DU3A 4R5PA 1WSIA 3IG1A 4O44A 3OYMA 2X6NA 3G0ZA 4KTWA 5FRNA 2JGUA 2QKKA 3DLEA 4FXDA 1ZYQA 1YTAA 2IAJA 4Z4HA 4FJJA 3NAEA 3NGZA 5CZ1A 3MEEA 1RT2A 1ITGA 3QIPA 1SKSA 1KSPA 4K8XA 3TWHA 4DSLA 1GOBA 3LANA 2E6MA 4HUFA 3VQAA 4CJ5A 4DFKA 1N5YA 3QEXA 3VQBA 1SL1A 4KTZA 1JL2A 3AA2A 4J2DA 1L3TA 4Z0UA 4B8AB 4JLHA 3AVIA 3AVCA 4B3OA 4DQQA 3ZCMA 3LWLA 4AHSA 1R0AA 2YKMA 3DI6A 1VSLA 3ZT3A 2GUIA 1JLBA 2OPPA 2Z1JA 1D9DA 4ELVA 1WSGA 4CJKA 1D9FA 1A5XA 4CJ3A 1NKEA 5KRSA 3OYHA 3LAKA 4FM0A 1Z26A 4FYDA 4KHSA 4LH5A 4CJSA 3BGRA 3NF8A 1X9SA 1KFDA 1TGOA 1RTIA 3F73A 3SNNA 2FBYA 1D8YA 3LWMA 5HLFA 4DS4A 2P51A 1IG9A 2G8WA 3AVHA 2HB5A 2VWJA 4DQRA 3OYKA 3OYBA 4JS5A 1QTMA 3V9XA 3HP6A 4OPJA 3SJJA 3K5LA 1X1PA 2GV9A 3LP0A 3NH0A 2AJQA 4DTMA 4F2RA 4CCHA 4RW4A 3C6TA 3DRPA 3HT3A 1NKBA 1LWFA 1NOYA 3C95A 1KRPA 1BIZA 4ELTA 4QCLA 3DRSA 1WAFA 3QIOA 4CF2A 4CJFA 3TAFA 3P1GA 4RW6A 3JSMA 5FRMA 2KW4A 4RW9A 1LW0A 4FK0A 4ZHRA 1B9FA 1VSDA 4C8MA 4PQUA 3HPGA 4AILC 2QK9A 3VN5A 3D0PA 3KIOA 4YNQA 3MXIA 4CHZA 3H08A 1I3AA 3DOKA 4IG0A 4Z4IA 4CGGA 1EXQA 4N47A 1YT3A 2EX3A 1QQCA 1BCOA 1XI1A 4NCGA 3ITHA 4CJLA 3AA3A 3AO1A 1CXUA 3TAPA 3M8SA 4DLEA 3SPZA 3EYZA 3V1QA 4XIUA 2R7YA 3QNNA 2XY5A 4Q0BA 3RMCA 5KGWA 4CK3A 1KVBA 3HO1A 4OKEA 1LAVA 2HMIA 1RDBA 2PYJA 2HNDA 1TAUA 2VWKA 3OYAA 3RMAA 4OVLA 2A1RA 1KTQA 4GMJB 4EP5A 3LALA 1CXQA 3IAYA 3VQ6A 1BISA 5JS2A 4FJKA 1QSSA 2KTQA 1VRTA 3OVNA 4PY5A 4KV8A 4ICLA 4M3RA 4YFUA 4ID5A 3UIQA 2WONA 1S6QA 3PX4A 1WSEA 4DF8A 4DTSA 1J54A 1REVA 3MXMA 4ID1A 2IC3A 3KKRA 1KVCA 4CK2A 3AO2A 4BDPA 4CFCA 4JRQA 1Y97A 3ZT4A 3K57A 4OPKA 1UA0A 4C8NA 4ZTJA 1RT1A 3OS2A 1BQMA 3JYTA 2D0AA 2XY8A 3C94A 4EZ6A 4F3OA 4KHUA 4C8KA 3QLHA 1RT6A 3DM2A 1BGXT 4E7LA 3SQ2A 5HP1A 3S3OA 2OYQA 1S1WA 3L2RA 2E4LA 3VA0A 4M3XA 4UQGA 4DF4A 3QO9A 1LV5A 2DFEA 4FJLA 4CGHA 4I9QA 4AHRA 1C0TA 1KLMA 1JLAA 3ZSVA 1NK6A 3HJFA 5CYQA 2D5RA 2HHQA 3LP3A 3EZ5A 3TAEA 4KRFA 1TKTA 5KRTA 4N76A 1DLOA 4FK2A 3V9SA 4B9SA 2DFFA 1Q8IA 4KB0A 1HYSA 5I42A 1UA1A 2Z1HA 4KTQA 3C6UA 1JXEA 2Z1IA 4BDZA 4KHYA 5J2PA 3PX0A 2HHVA 2Q3SA 3AVBA 1ASVA 4BE1A 3L8BA 4F4KA 4KHQA 4IDKA 1VK0A 1U47A 3WNHA 1VSKA 3SPYA 3PY8A 2HVIA 4FVMA 1WNSA 3HPHA 2G8KA 2DY4A 1WSJA 3LZIA 1TL1A 3AVGA 1TKXA 1EKEA 4IG3A 4DTJA 3ZSOA 4B9MA 2HW3A 3QERA 4NCBA 4E0DA 1JL1A 1NOZA 3OYFA 4CE9A 1B92A 1WSFA 4CF9A 4HTUA 1K6YA 1S1TA 1LWEA 3AA4A 1T8EA 2OPQA 1VRUA 4CJ4A 2Z1GA 4F3TA 1A5VA 3P5JA 3VQQA 4CIFA 3K59A 3L2QA 4Q5VA 3RRGA 4LSLA 4CJPA 1RT4A 2YV0X 1WSHA 3K5MA 3LPTA 4B9VA 3B6OA 4E7IA 3ASMA 3AVNA 2ZQBA 1N6QA 3TAQA 4CF0A 4KO0A 4M3TA 3PV8A 4J2BA 1I39A 1NJWA 1SL2A 1SKRA 3AVJA 3S3MA 2O4IA 1IKWA 4FM2A 1WN7A 4BWJA 3VQ9A 4HCBA 2HNZA 5HBMA 3A2FA 3O4QA 2ITGA 3KK2A 1XWLA 1J9AA 3QNOA 1IKYA 4E7JA 4FJIA 3DOLA 2YHAA 4JS4A 2F96A 1VSMA 4CEFA 2Y1IA 2KZZA 1XC9A 4CEAA 3LDSA 3NH2A 4H4OA 1C1AA 1Q9YA 1RBSA 1S6PA 3MECA 3NE6A 3KLIA 2YKNA 4CECA 1BI4A 2X6SA 4DTPA 4CJVA 3AO3A 5FROA 1RDDA 5T7BA 4QOZB 1JKHA 4FJ7A 1NJYA 2G8VA 1NK4A 1Q9XA 4TSXA 2OZSA 2DFHA 1QS4A 3AO4A 3G10A 5CY4A 4M41A 4CK1A 3OYJA 4Z4EA 3DLHA 1HQUA 4MFBA 4KKOA 3CQ8A 3B6PA 3CYMA 3WNEA 4CEQA 3SUPA 4DSIA 1S1VA 3SUNA 4B9TA 3LP1A 3T1AA 4GVMA 4FJ8A 4PA1A 3NF6A 3CFRA 2P5GA 1RBVA 2KZMA 3L2WA 3V4IA 5C24A 3QEPA 3ULDA 4Z4CA 1W0HA 4J2AA 1RBUA 1L3UA 3LZJA 1HYVA 4M3YA 2RPIA 3LP2A 1UOCA 1NK5A 2XHBA 3VQ5A 3ZSWA 2G8FA 3TAGA 4HUGA 1CLQA 3K2PA 4B08A 4DLGA 3K5NA 3THVA 1TK8A 3MEGA 3OJUA 3NGIA 3OYNA 3U6FA 1FKOA 1RILA 1VSEA 2FBVA 3NH1A 2XRIA 4CFBA 1G15A 3HVTA 2KFZA 3LPUA 3SI6A 4AHVA 1KLNA 4CEOA 3AV9A 2KQ2A 2XO7A 4J2EA 5I3UA 2VG6A 5HRPA 2PY5A 1L5UA 2F8TA 2NUBA 3AVKA 1U48A 3PX6A 3KK3A 1U45A 3IRXA 3M8RA 2HHSA 3HP9A 4B9UA 2G8IA 4OLAA 1BIUA 4RW7A 4JRPA 3V81A 2OA8A 3OYIA 1FKPA 4M3ZA 4CGIA 3S3NA 1L3VA 3NDKA 1TL3A 2I5JA 1HQEA 2LSNA 3SQ1A 1IO2A 3SUOA 3VQ4A 3KJVA 4CHQA 4E7KA 4FM1A 4W5NA 3O3HA 4F2SA 4FZXC 3AA5X 2XY6A 4DQIA 1ZBFA 4FLZA 1BI4B 5FDLA 1LAWA 1ZBLA 4FJXA 4DQPA 3OYEA 4NYFA 4Y1CA 1NJXA 1GOAA 3KLEA 2ZD1A 3ZSYA 1SKWA 2A1SA 4C8LA 2HHWA 1EX4A 2IOCA 4CJQA 4DTXA 2IS3A 1HNIA 1IH7A 3TAMA 4IKFA 5CYMA 1JLGA 1NKCA 4E1MA 1HPZA 4KPYA 5DK5A 3QEIA 4CFAA 4FLXA 3PO5A 2HHTA 1GOCA 3AVMA 3HVRA 3SV3A 4W5QA 1T7PA 1T05A 4C8OA 1U04A 2IGIA 1C0UA 2G8HA 2ATQA 2PZSA 3VQ7A 3MXJA 3V1RA 3CFPA 4Y1DA 4FJ9A 4CGDA 2HVHA 4AHUA 4N56A 1Z25A 3HL8A 3QINA 1YTUA 3AVAA 1TKZA 4MQ3A 3SQ4A 1ZBUA 4O4GA 5SZTA 1ZBHA 3AVLA 3ZSXA 3OYCA 1NJZA 1HJRA 2HNYA 5K14A 1J53A 3M8QA 2O4GA 4FLYA 3DYAA 2RN2A 3I0RA 3KLGA 2G8UA 3L3VA 4E3SA 4CEBA 5E41A 4FZYA 1RDAA 1S9EA 3TR8A 2YNFA 4DFMA 4PUOA 5HRRA 2W42A 4HCCA 1S1UA 3DLRA 2F8SA 2B5JA 3PUFA 4FW1A 1S9GA 4CEDA 1UWBA 5J1EA 3OYLA 4CF1A 3KLHA 4CESA 3SZ2A 3TARA 4FZZA 1KCFA 1FXXA 1LW2A 4FLUA 1TKDA 3OJSA 4CIGA 3L2VA 4OLBA 4I2PA 1ASUA 2PYLA 2YHBA 1QE1A 2YNIA 3KKSA 1X9MA 4DWIA 4Z4FA 2KFNA 2FBTA 4LSNA 3RWUA 4L8RB 3HXMA 4CHPA 4PWDA 3VQ8A 4AHTA 1TV6A 1WLJA 1J5OA 3HK2A 2OPRA 4DSJA 4KFBA 1C0MA 4DSFA 3DRRA 4E7HA 1TAQA 3WNFA 3VQEA 4E89A 2YNHA 3HM9A 3V6DA 4DFPA 3SUQA 4I2QA 1EETA 3KTQA 1JLCA 2OZMA 4O55A 3O3FA 1JLEA 2FC0A 2B6AA 1U4BA 4FK4A 4KB1A 3NHGA 4FJ5A 4CJTA 1RDCA 3ISNC 4B8CA 4H4MA 1QSYA 3ALYA 4W5RA 1RBRA 4BE0A 1SL0A 1VSJA 5DMRA 4OGCA 1NK8A 3HPOA 3V9UA 4HUEA 3OYDA 5KGXA 5C42A 3AO5A 1RTHA 1S1XA 4DTOA 1RBTA 3QEWA 3BDPA 3ZT1A 5D3GA 4Z4GA 1D5AA 3NF9A 2RKIA
chains in the Genus database with same CATH superfamily
1B9DA 1ESVA 4DMNA 2BDPA 1LWCA 3SQ0A 4RW8A 1NK0A 2QI2A 4BC4A 3ZSZA 1BHLA 3ZETB 3NCIA 1QHTA 4O5BA 1BQNA 1VQMN 4JI4K 3OTOK 3L4IA 4BR7A 1QVFM 2EHGA 2D0BA 3KD5E 4YOYA 2QWQA 1XHZA 1HKBA 3I8DA 3T1YK 5CZ2A 3TANA 3DWLA 4QS9A 5TKWA 3E01A 3CJ7A 3VQCA 4M45A 3TU5A 5J2QA 3O3GA 3MCPA 5J2NA 3HOTA 1DTQA 1E4FT 3FFIA 5HRSA 3WNGA 1W9HA 4IOAL 3L2UA 1KVAA 2VG7A 2ZGZA 3SAGA 1QHAA 1JXBA 1RTDA 4DR3K 4CJUA 3NGYA 4DU1A 4CJRA 2WOMA 1HNVA 4DB3A 2ZE2A 3A5NC 1QVGM 3SMSA 1NJIO 5GIOA 1VSIA 5C2DA 5AQXA 2Q36A 4YDUC 3QICA 4QAGA 4FW2A 4OKKA 3O1WA 1S5JA 3K5OA 4CERA 3KD1E 4HWIA 4OKJA 1YUWA 4BACA 3THWA 3CM5A 5AQOA 4CGJA 3U3YA 4FWNA 5BRDA 5CR4A 1HUXA 1NK7A 4GKJK 3VQPA 1QZ6A 2Q0UA 2VGMA 2ASPA 2CGJA 3OA9A 3ZT0A 1T3VA 3CC4N 4FJMA 3OS1A 4H0OA 3G6EN 3NF7A 1WAJA 4I9LA 4B1ZA 5AZIB 2Q1NA 4NLBA 5AZJA 3KWGA 3AY9A 3ID8A 3ZEUA 4WFNL 1D4XA 4CF8A 1SUQA 3FE1A 3W0LA 4A59A 3WT0A 1IKXA 5J2MA 3DXKA 3TSPA 1N33K 4BGBA 2B4JA 3V1OA 4NB4A 4DU3A 1WSIA 2HMPA 2NZTA 4YY3K 3L6QA 3CJCA 1YHQN 1VQ9N 1ZYQA 2IAJA 1DT9A 4K25A 4FJJA 1VQON 3A8YA 5CZ1A 3MEEA 1ITGA 3O5BA 3J80O 4DUYK 1GOBA 3LANA 3VENA 1N5YA 3VQAA 4DFKA 4FOEA 1SL1A 1JL2A 4Z0UA 3BP8A 2YKMA 1R0AA 3DI6A 1VSLA 2Z1JA 4F9OA 3J7YP 1WSGA 3FGUA 3M6GA 1D9FA 3ATUA 3E1YA 4BRMA 5KRSA 4B1VA 3OYHA 3LAKA 4EHTA 4CJSA 2O8CA 1X9SA 3CF5L 4OPAA 1KFDA 1TGOA 5JVHL 1XNQK 3CI5A 4YDUA 3OBWA 4DS4A 4BROA 2P51A 4BRDA 3VGMA 1Z6RA 3DXMA 4JS5A 4A61A 3K5LA 1X1PA 2GV9A 4BRKA 3NH0A 3I55N 5AQMA 3UKRA 2OCEA 1BIZA 1RDWX 3TAFA 4CJFA 2KW4A 1B9FA 4YOTA 4DQ8A 4PQUA 1K8AO 3VN5A 3MXIA 4IG0A 4JKFA 2O8BA 1EXQA 1EWRA 3GBTA 1QQCA 1NGFA 1RGIA 1YF5L 2VCPA 3BZKA 3L4QA 4XIUA 3BY5A 1BO5O 3RMCA 4Q0BA 5KGWA 1OH8A 3HOSA 4OKEA 1IBKK 2HMIA 1OH6A 4GMJB 3IAYA 3LALA 1CXQA 3MX2A 4JK9A 2KTQA 2P9PA 3OVNA 4YFUA 4ID5A 1VQNN 1J54A 3KKRA 2I7NA 4PKGA 3AO2A 4BDPA 3T7ZA 2E1YA 4C8NA 1UA0A 1BQMA 3JYTA 2D0AA 4FOIA 1BGXT 1IV0A 3MWTA 3VA0A 4M3XA 4CGHA 4I9QA 1C0TA 1KLMA 3ZSVA 3VTHA 3WQTA 2D5RA 3EZ5A 4KRFA 4N76A 4FK2A 1DLOA 1HYSA 1Q8IA 1TYQB 1W2BM 4KTQA 4NLCA 4KHYA 2Z1IA 4BDZA 4BVPA 3LDQA 3PX0A 1YIJN 2HHVA 1ASVA 2D0PA 4KHQA 3CIPA 3PY8A 2KKZA 4FVMA 3BF3A 3LZIA 1TKXA 4DTJA 2HW3A 1GLBG 4NCBA 4JKDA 3MDQA 3VQQA 3K59A 3FZFA 4Q5VA 1CZAN 4LSLA 1RT4A 3LPTA 4B9VA 5BREA 4CF0A 3PV8A 2YCHA 1IBLK 2O4IA 4FM2A 1WN7A 3VQ9A 4BRNA 2ITGA 4OPHA 1ILYA 3BEXA 4BRFA 3DOLA 3EZWA 2IVPA 4CZJA 2O8EA 4CEAA 5FPNA 3P38A 4YORA 3QFPA 3VEVA 5IT9O 3MWPA 5E26A 3KLIA 3HZ6A 3K9KA 1BI4A 1SZ2A 2A42A 3WXLA 1RDDA 3SMPA 2ZJRL 4QOZB 1MDUB 3CJ9A 4FJ7A 3DAWA 4H0XB 1HJOA 2BTFA 1NGDA 4PL8A 4KKOA 4DV3K 4FJ8A 3C0BA 2KZMA 4CZGA 3E9PA 1VQ4N 3MN9A 4J2AA 3UE5A 4M3YA 1L3UA 3T69A 5ADXA 2RPIA 2FF6A 5AQJA 3WXMB 3ENOA 2G8FA 1CLQA 3UKUB 3VEWA 3D2FA 3AAQA 4CFBA 3F9MA 3CCRN 1KLNA 3U9ZA 2KQ2A 3KZBA 3PIPL 2PY5A 1L5UA 2F8TA 3AVKA 4LFAK 5AQGA 4NO7A 5AQVA 3HP9A 4DR6K 3I8BA 2G8IA 4OLAA 2OA8A 2OTJN 1FKPA 4BRPA 4CGIA 3S3NA 3VQ4A 4CHQA 4E7KA 4FPAA 2XY6A 3TTFA 3EE9A 3MMVA 2QWLA 4ILGB 1HPMA 4CVNE 4C8LA 3ZSYA 3CCLN 1YVNA 2NRHA 3O08A 1JLGA 1HPZA 3AAPA 3EEQA 3K9JA 5DK5A 4CFAA 1GOCA 3HVRA 4W5QA 2UXDK 2IGIA 2G8HA 2ATQA 3MCAB 3VQ7A 2D1KA 5AQPA 1Q81O 4JHDA 2HVHA 3EN9A 1Z25A 3HL8A 3HRGA 3SQ4A 2HNYA 5K14A 3M8QA 3I0RA 3KLGA 3L3VA 4JKBA 4CEBA 5E41A 1RDAA 2QA4N 4PUOA 1VHXA 2F8SA 2B5JA 3CCSN 3OYLA 3KLHA 3TARA 1KCFA 1FXXA 1K8KA 4FLUA 3L2VA 4OLBA 2P9SB 1ASUA 3R6MA 2E2OA 2YHBA 4GNIA 3CHWA 3WEEA 1NU0A 3HXMA 3PLAA 1TV6A 1J5OA 3HK2A 4DSJA 1C0MA 2ASOA 4E7HA 2GTDA 3N4PA 4DFPA 3O3FA 2WTUA 4FK4A 3AARA 3ZX2A 4W5RA 1RBRA 3OYDA 4U67L 1RTHA 4JI7K 4A2BA 2CH6A 1NJWA 1ATNA 1D5AA 1MA9B 2RKIA 4CF2A 4M7XA 4RCHA 4KH4A 1T6CA 2QW9A 5FPEA 2CH5A 4EIAA 2GWKA 4EZ9A 4X64K 3T19A 3LM9A 3V9ZA 4FJGA 4WFBL 4H8KA 4CBWA 2JWLA 1QQMA 1IKVA 5C25A 2Y1JA 4EP4A 2W40A 2UYTA 4RTFD 1GLAG 2D0CA 5EU7A 2BE2A 3IS9A 4KHWA 4BR2A 4DTRA 3ULEA 1VQ8N 1DTTA 4BR0A 2VGNA 2OPSA 1C6VA 3H45C 3HSCA 4AHCA 4BG8A 5HRNA 4OJRA 3QEVA 4ELTA 4ELUA 2ZM6K 3FFKB 4BRGA 3THXA 3QFUA 4CHYA 3SCXA 4NXMK 2YNGA 2QKBA 1NK9A 3DLBA 1HKCA 5AQRA 3HSTB 4CFDA 3CCEN 3CJBA 4BE2A 1WBBA 1CZBA 3KK1A 4JV5K 1VAZA 1NGCA 4AH9A 3VF2A 4E19A 3MX5A 1EP4A 4LY7A 2GBZA 3HTVA 4OO1J 2PAVA 2F9WA 5M1PA 1TUUA 3QETA 2UXCK 4CJEA 4KREA 3RR7A 5F0XA 4H0PA 3NVKA 3LDLA 3O4NA 3EE8A 3CM6A 4DTUA 2BGGA 1HMVA 4IFYA 1GLJO 4IWVA 4B9LA 1Q82O 5AQKA 4WFAL 1HRHA 3DLKA 3RMBA 4IO8A 2W6KA 3Q7BA 1XHXA 4B9NA 5JLHA 2A5XA 4M3UA 4CZFA 2ETJA 5KQDA 4WQ5C 4DV7K 3SJHA 1I94K 3D7EO 3H1VX 3EY1A 4LF7K 2IVNA 5FPDA 3ZSQA 1HNWK 2P9LB 3A5LC 4CEZA 2JLEA 4FWRA 3OYMA 2X6NA 3G0ZA 3GG4A 4KTWA 2QKKA 1NM1A 4WYBA 4H5NA 3VQBA 3R1XA 4B8AB 3AVCA 4DQQA 3ZCMA 3LWLA 4AHSA 2P9NA 1H1VA 1JLBA 1D9DA 1V4SA 2ZJPL 5LL6Z 2UXBK 4FWLA 5AQZA 1C0FA 1XUPO 4FM0A 3EO3A 4IFEA 3GOIA 2ZJQL 3F73A 1D8YA 2RE2A 2F7TA 2UUAK 3O4WA 5HLFA 5AZJB 3LDPA 4I6MA 2BH1A 2VWJA 4DQRA 3OYKA 1XC3A 3HP6A 4OPJA 2O8DA 2YHXA 3SJJA 3LP0A 2E2QA 2AJQA 4CCHA 4DUZK 1VQLN 3DXKB 3HT3A 3FZHA 1LWFA 1YJ9N 1KRPA 3JSMA 2YJFA 5FRMA 4RW9A 1LW0A 4WCEL 1VSDA 3HPGA 3O9RA 2QK9A 3CCJN 4EFHA 4YNQA 3H08A 1I3AA 1ZBSA 1YT3A 3ENBA 4WQ5A 1BU6O 3AGRA 4H5RA 1BCOA 5KPZA 1XI1A 2HBLA 2V51B 5AQIA 4DLEA 3EYZA 4FPBA 2XY5A 4CK3A 1SQKA 3HO1A 4BG9A 1LAVA 3P39A 3OYAA 4IOCL 4GV3A 3RMAA 1NNEA 4DR4K 1KTQA 4EP5A 1BISA 3CPWM 4FSVA 5JS2A 2O8CB 1QSSA 1VRTA 3NVMA 4KV8A 4M3RA 3TTDA 3UIQA 1WSEA 4DF8A 1REVA 3MXMA 4ID1A 4JRQA 5JS1A 3E66A 4CZIA 4KHUA 4C8KA 5HP1A 3S3OA 4IJAA 3L2RA 5DM6L 4FJLA 2DFEA 5LJVA 3HJFA 4JK7A 3TPQA 2OTLN 5CYQA 3M5RA 3LP3A 3TAEA 3PSFA 5KRTA 3CPEA 2PBDA 3VOVA 1UA1A 2Z1HA 5C15A 4JI0K 3EL2A 4B1YB 3FZKA 1ATSA 3C6UA 2FLOA 4O8KA 3ZETA 3ZYYX 4XH5A 4B1UB 3AVBA 1U47A 3WNHA 1VSKA 4H0YB 4MLHA 4XH1A 1TL1A 3WXIA 3AVGA 1EKEA 4IG3A 3ZSOA 3ATVA 2Q2RA 4E0DA 3M1FA 1B92A 1WSFA 4CE9A 4KHPK 2H3GX 1T8EA 3AA4A 2OPQA 1IG8A 3A5MC 5AQSA 3L2QA 2YV0X 1WSHA 3B6OA 4E7IA 3AVNA 3I33A 2ZQBA 3TAQA 5IWAK 3CMEN 3AVJA 4HCBA 3GE1A 1NGBA 3O4QA 4YHHK 1XWLA 4YOWA 4FJIA 1JJ2M 4CEFA 2Y1IA 3J7ZO 2KZZA 4L3QA 4LC9B 1XC9A 1C1AA 4Y0WA 2HF4A 4DTPA 4CJVA 3RSEA 3AO3A 5FROA 5T7BA 1YAGA 3H46O 3WXJA 4PL7A 4B3MK 2G8VA 1NK4A 4BREA 4TSXA 4JKGA 2DFHA 5CY4A 4CK1A 4Z4EA 1HQUA 4JKCA 3CQ8A 3SUPA 4DSIA 4B9TA 3LP1A 4CZLA 4GVMA 2P5GA 4DR1K 3L2WA 3V4IA 3SBTA 3QEPA 3ULDA 4Z4CA 5BR9A 1RBUA 2UUCK 3OHRA 1NK5A 4GVEA 2XHBA 3ZSWA 3BF1A 4A2AA 3THVA 1TK8A 1OVQA 3OYNA 3U6FA 2FBVA 5AZIA 4C1NI 3HVTA 3LPUA 4AHVA 2XO7A 5I3UA 3IUCA 3G4SN 2NUBA 3IRXA 1HNZK 5EOYA 3ENHA 4JRPA 3GDQA 1S3XA 4KH6A 3CCQN 4B1WB 3SQ1A 1IO2A 3KJVA 3O3HA 1HR0K 4DQIA 1ZBFA 4FLZA 1BI4B 1ZBLA 1LAWA 4FJXA 4DQPA 4FWQA 1X9JA 4IKFA 3TAMA 1W7AA 3KVGA 4CZHA 3QEIA 3PO5A 4IO9L 4FWMA 3R3LA 1T05A 4BRAA 4C8OA 1C0UA 3KWIA 4H0TB 2E2PA 3CFPA 2P9UB 1YTUA 4MQ3A 5KQ8A 2P9IB 1HJRA 4FLYA 1J53A 3DYAA 4E3SA 2AP1A 3O1BA 1Q86O 3TR8A 5HRRA 1S72N 2F9TA 4FW1A 3CCVN 1S9GA 1WBDA 4FZZA 4CF1A 4JI8K 1LW2A 4L8RB 4LSNA 3QB0A 4AM6A 5M1KA 4PWDA 3SBGA 4BRIA 2OPRA 4DSFA 3VGKA 3WNFA 2NRVA 4JD2B 4FWKA 5GAGP 3HM9A 3KTQA 3C65A 1JLCA 4O55A 1JLEA 3HM8A 2B6AA 2E1ZA 4KB1A 1C0GA 1XQSC 2V7YA 4H4MA 4B8CA 1QSYA 1NGJA 1SL0A 1VSJA 2P9KB 1NGHA 3HPOA 2PFUA 5GADP 1RBTA 3U9DA 1OVYA 1BCMA 3TABA 4BWMA 3L3UA 3VMFB 3K58A 3V9WA 2E2NA 4N41A 3PSIA 2FF3B 4FWPA 4M63C 2HSTA 2XY7A 1JCEA 3MEDA 4FLVA 2UU9K 1RT5A 2HHXA 1CZ9A 3DLGA 2BANA 3KLFA 3CCUN 1T6DA 5AJ3K 4O0IA 4DU4A 1X9WA 3HYFA 3ID6A 2RF2A 3CFOA 3FLCO 3O9SA 4JKAA 1JCGA 4DV2K 1RT7A 1SV5A 3MN6A 4RG8A 3CD6N 3SYZA 3PO4A 4ZTFA 4FCYA 1VSHA 1M90O 1TYQA 2WFBA 2P5OA 5I9EB 1JCFA 2BUPA 3VF4A 3ZSRA 3TI0A 4M42A 4CIEA 5JLFA 4A57A 3ZT2A 5AQQA 4A62A 1RNHA 5C0YA 3N4QA 1F21A 4HVJA 3VERA 3U3GA 1VSFA 4JI2K 4CJWA 4GW6A 3SLCA 1ASWA 5GAEP 4DSKA 4KI4A 2IDOA 5LY3A 4CD3A 3S41A 1KFSA 4G9ZA 3M8PA 4WE1A 4LH4A 1TK5A 3S9HA 1TVRA 5AR0A 1DEJA 5AQFA 1U49A 4LF4K 2YX6A 1IBMK 3C7NA 2O8FB 1RFQA 4JKEA 3DMJA 5FPMA 4CZEA 1RTJA 4DSEA 4E1NA 1MU2A 1SAZA 4DS5A 3LDNA 3C6HA 5M1QA 1BL3A 1XMOK 3FZLA 3RRHA 1RCHA 3F9KA 1DGKN 2P1JA 1BG3A 4CD1A 2X78A 2HOEA 4XH4A 3ZX3A 4R5PA 3CQYA 3IG1A 1FW6A 3OBYA 4YOXA 5FRNA 2JGUA 3D2EB 3DLEA 4FXDA 5M1NA 3NAEA 1RT2A 1VQ5N 1SKSA 4DR5K 4C1NK 4HUFA 4CJ5A 3QEXA 4KTZA 3AA2A 4J2DA 4LF6K 1L3TA 3TSUA 1GLCG 3AVIA 4B3OA 3ZT3A 1KAXA 3LDOA 2GUIA 4GY2B 4ELVA 2NRWA 3D6RA 4CJKA 4PHTX 1KC8O 2HBMA 4CZKA 4FYDA 4KHSA 2VQFK 1N36K 3BGRA 4JN4A 2FBYA 3LWMA 2W41A 4DCHA 4PKIA 2VYPA 2G8WA 2HB5A 4LFCK 3V9XA 3THYA 2VWBA 5BR8K 4DTMA 4F2RA 4RW4A 5M1FA 1NKBA 5EVZA 3C95A 3LM2A 3DRSA 5GINA 3QIOA 1KD1O 3O9TA 1HKGA 3J7AP 4AILC 5BRFA 1HLUA 1NGAA 4Z4IA 3DOKA 4CGGA 4N47A 3J8AA 4CJLA 3AA3A 4JI5K 1CXUA 2P9NB 3M8SA 3SPZA 1ZXOA 3V1QA 2R7YA 3QNNA 4DKWA 2P9SA 4JAXA 3CCMN 4HTLA 5BPMA 5FLXO 1TAUA 5M1OA 2A1RA 4OVLA 2AA4A 5AQUA 3U8XA 1KAYA 4FJKA 1OH5A 4PY5A 1E3MA 4ICLA 5AQWA 3QDKA 2WONA 3PX4A 3HBTA 4I6MB 4WQ4A 2ITMA 4CK2A 4CFCA 3ZT4A 4B9SA 4ZTJA 1RT1A 3OS2A 4EZ6A 4DV4K 4F3OA 3QLHA 3QBWA 3DM2A 3SQ2A 2OYQA 1S1WA 3M3ZA 1N34K 5AQNA 4UQGA 3QO9A 5HOOA 1JLAA 5C2FA 2HHQA 1TKTA 4CI6A 5C10A 2FSKA 2KLAA 1NWKA 1JXEA 2DPNA 4YOVA 2Q3SA 2E20A 4BE1A 3Q7CA 4MO5A 1VK0A 3SPYA 4H5TA 2A6AA 3HPHA 2ZF5O 2G8KA 1WSJA 5BN8A 4M7YA 1JL1A 3OYFA 1BA1A 4HTUA 4CF9A 1K6YA 1VRUA 4JI3K 2Z1GA 4F3TA 4ILJA 1A5VA 4LF8K 3RRGA 4CJPA 1KAZA 2YHYA 3K5MA 3THWB 3ASMA 2CGKA 1N6QA 4M3TA 4KO0A 1M1KO 1OKJA 1I39A 1SL2A 1SKRA 1K73O 1J5EK 4B3RK 5AFUH 1IKWA 5HBMA 3A2FA 3JAMO 1U2VA 1J9AA 1IKYA 2YHAA 4JS4A 3R9PA 2FSJA 5AFUA 1YJNN 4H4OA 2QWNA 3MECA 1KXPA 2WBNA 2X6SA 1T44A 3ZEUB 3BUZB 3VPZA 3VEXA 1Q9XA 2OZSA 1QS4A 3AO4A 3G10A 4M41A 2E5LK 3DLHA 4MFBA 5BRHA 3B6PA 3CYMA 4EHUA 3SUNA 3TSQA 2ZGYA 3T1AA 4PA1A 3NF6A 3CFRA 4O8UA 4U7BA 3O9UA 5C24A 1W0HA 1HYVA 3CXCM 3LP2A 1UOCA 3TAGA 4HUGA 3K2PA 4C23A 3VESA 3NGIA 4JEPA 1FKOA 1WUAA 1VSEA 3NH1A 2HF3A 2ZWHA 2HHHK 1G15A 3H1QA 3SI6A 4AQYK 3AV9A 2VG6A 1BA0A 1U48A 1NBWA 2P9LA 1FJGK 4PKHA 3OYIA 4B3TK 4M3ZA 1Y64A 1TL3A 2LSNA 3SUOA 4W5NA 4JKHA 3AA5X 4JYAK 1Q7YO 5FDLA 4Y1CA 3RSEB 1NJXA 3DXMB 2HBKA 2ZD1A 2A1SA 1EX4A 2IOCA 1IH7A 3J81O 5CYMA 4DR7K 4QS8A 4KH5A 4E1MA 1RDUA 2WC9A 3VEYA 4V19S 1HNXK 4DV0K 3O8MA 2HHTA 3F5TA 3NMUA 4JKGB 3AVMA 1U04A 3UKRB 2PZSA 4QS7A 5BPLA 4FJ9A 4CGDA 4YOUA 4AHUA 3QINA 5BN9A 3AVAA 1ZBUA 4A5BA 3AVLA 1NJZA 2RN2A 4K43A 2O8BB 2G8UA 1S9EA 3A0IX 2YNFA 4DFMA 1WOQA 2W42A 4HCCA 3DLRA 3PUFA 1ZC6A 2QWOA 4CEDA 4CESA 3EKSA 3JS6A 4DHYA 1XNRK 3KKSA 4DWIA 3RWUA 3LL3A 3PIOL 4ISFA 4NXNK 3VQ8A 4AHTA 4E1JA 1OH7A 3DRRA 2IVOA 2YNHA 2P9PB 3QBXA 3V6DA 3SUQA 5JICA 4I2QA 1EETA 2A40A 2OANA 3VF6A 3NHGA 1X3NA 4CJTA 3ALYA 4EAHD 4BE0A 5DMRA 1NK8A 4OGCA 2GUPA 3V9UA 1Z05A 3BDPA 5C42A 4Z4GA 1S1XA 4CJ3A 3NF9A 1P8ZA 5KTQA 3E9LA 4CJ7A 3QESA 3DJCA 4W5TA 3OS0A 2VQEK 1VQ6N 1A5WA 2FBXA 4IZ9A 4HHTA 4JNEA 3RTVA 4FLTA 5C12A 3W3DA 4FL9A 3RR8A 4KI6A 3TTCA 4LFBK 5KI6A 3P83D 2KHOA 3DLLL 3QMLA 4DFJA 4NCAA 4G1QA 2E6LA 3OY9A 4M3WA 3B8AX 4F8RA 4I7FA 4BR5A 2QXFA 2W6LA 3VA3A 1G99A 5HROA 1QSLA 4WF9L 1ZBIA 4OGEA 2E8AA 3I0SA 4K8ZA 1N32K 3WQUA 4GKKK 2X74A 5TKYA 2VG5A 4CGFA 1JLQA 3I56N 4FLWA 2O8EB 4IEEA 4IEIA 1UAXA 5AQLA 1EWQA 4BC3A 4NYNA 1HYZA 1VQKN 1MWKA 1RT3A 3CG7A 3OYGA 4BGAA 4H0VB 1O1WA 4BDYA 4OX9K 4BRCA 2E88A 1NGEA 1JLFA 3NBPA 2UUBK 3D45A 1C1BA 4DQSA 1P90A 1C1CA 3MAQA 1QZ5A 4IFVA 4DG1A 4O0JA 1J6ZA 3IKMA 3AVFA 1T03A 5F1XA 4IBNA 4X65K 4FJHA 3VQDA 4CHOA 3O6WA 3NFAA 1L3SA 1TK0A 2QWPA 4KHNA 1FK9A 1NGIA 3CERA 4KAZA 4FJNA 1LCUA 2DTUA 2V52B 4CZMA 3VEOA 3RMDA 1BDGA 5LMUK 4W5OA 2I7PA 3CJ1A 4LD0A 3E9OA 3D2FB 4O5FA 1TUYA 4BRHA 3H3OB 4DTNA 3LAMA 2YHWA 4N5SA 4CHNA 1W97L 1YVUA 4FVUA 3SV4A 2JWKA 4K0KK 1NGGA 3T3FA 2HHUA 4CEEA 5SWMA 3MN5A 4O44A 3VTIA 2FXUA 4IDHA 4ILHA 1YJWN 1YTAA 4CBUA 4Z4HA 5AQHA 3NGZA 3QIPA 1KSPA 4K8XA 3TWHA 3GL1A 4DSLA 2E6MA 3ZLJA 3SAHA 2Q0RA 3KHYA 2YI1A 4JLHA 4KBOA 4IXCA 2NRXA 3WUHA 5AQYA 5H1SQ 2OPPA 5HL7L 3P4IA 4JHDB 2HBJA 2QEXN 2NLXA 1A5XA 4FWOA 1NKEA 1EO1A 5A2QO 1Z26A 2ASMA 3IFRA 4LH5A 2NRRA 3P31A 3C7NB 3FZMA 3NF8A 1DKGD 1VQPN 3BZCA 3L0QA 1RTIA 3SNNA 1EQYA 5B8HA 1BWFO 1NLVA 2QWMA 1IG9A 3AVHA 1YXQA 4ISEA 4B1XB 1K8KB 3OYBA 1QTMA 1IJJA 3WEEB 4H5WA 4B9QA 3MK6A 5ELZA 3C6TA 3DRPA 3SK3A 1NOYA 5ADXH 1WAFA 3CMAN 3F2KA 1NG9A 3A5OC 3P1GA 4RW6A 2P9UA 2IIRA 5JVGL 4FK0A 4ZHRA 4C8MA 5CE3A 2A3ZA 2QTDA 1WB9A 2P9IA 3D0PA 1ATRA 2QWRA 3KIOA 4CHZA 1QQNA 4FO0A 3AGKA 2EX3A 3CETA 4NCGA 3ITHA 3AO1A 2GELA 3TAPA 2Q97A 1YI2N 4ISGA 2EWSA 1KVBA 4BQLA 4AF1A 3IDHA 1RDBA 2PYJA 2HNDA 1NMNA 2VWKA 1YITN 3VQ6A 5DM7L 4J8FA 4JD2A 1BUPA 4GV6A 1S6QA 4DTSA 5MLCQ 2IC3A 1KVCA 1S22A 1Y97A 2FSNA 4UY8O 3THYB 3K57A 4OPKA 3ULEB 4KPYA 3C94A 2XY8A 4XEIA 2P9KA 1RT6A 4E7LA 5EY4A 2E4LA 4DF4A 1LV5A 4AHRA 1NK6A 4DV1K 2J4RA 1X3MA 3THXB 3CC2N 3V9SA 2DFFA 4KB0A 3G25A 5I42A 1E4GT 5J2PA 1V4TA 4F4KA 4BQZA 3L8BA 4IDKA 3O9QA 4MDAA 2HVIA 1WNSA 2GEMA 3VGLA 2DY4A 4R79A 4B9MA 3QERA 1NOZA 3T1HK 1S1TA 1LWEA 1VQ7N 4JI6K 4CJ4A 4X66K 3P5JA 3UKUA 4WQ4C 4CIFA 1GLEG 4X62K 3K0SA 1MWMA 4J2BA 3S3MA 4BWJA 2HNZA 3KK2A 2GWJA 3QNOA 4B3SK 4E7JA 5AQTA 4JK8A 2F96A 1VSMA 4LF9K 5F2RA 3LDSA 3NH2A 1Q9YA 3OW2M 1RBSA 1S6PA 3NE6A 2YKNA 4MO4A 5CHIA 4CECA 3UB5A 4DR2K 1KQSM 4BRLA 2YJEA 4AM7A 1JKHA 1NJYA 4K41A 2GX9A 4CBXA 5EXWA 3OYJA 3WNEA 4CEQA 1S1VA 3ZX0A 1XMQK 1RBVA 3H6EA 2RHKA 4CW7B 4BC5A 5BPNA 4MLEA 3LZJA 5GAHP 4BY9C 4RWTA 3VQ5A 2O8FA 4B08A 4DLGA 1LOTB 3K5NA 3MEGA 3OJUA 4FWSA 3EKUA 1RILA 2CGLA 2XRIA 2KFZA 4CEOA 4IJNA 4GV9A 4H03B 3MN7A 4H5VA 4J2EA 5HRPA 2D0OA 3PX6A 3KK3A 1U45A 3M8RA 3CQXA 1U2VB 4IOXA 2HHSA 4MDBA 4Z94A 3VETA 4B9UA 1BIUA 4RW7A 3V81A 1QQOA 2V7ZA 1L3VA 1HX1A 3NDKA 2I5JA 1HQEA 3FR0A 4FM1A 4FZXC 4JI1K 4F2SA 3D2EA 3IMXA 4BC2A 5JMVA 2A41A 3O80A 1GLLO 3OYEA 4NYFA 1GOAA 4A5AA 3KLEA 2NRZA 1SKWA 2HHWA 2NNWA 4BR4A 4CJQA 5LJWA 1U6ZA 2IS3A 1HNIA 4DTXA 2O8DB 1NKCA 4BVOA 4FLXA 3H3NO 3SV3A 1T7PA 4LF5K 4K42A 3G71N 3MXJA 2NRTA 3V1RA 3U4LA 4Y1DA 2QXLA 5LMNK 4DV5K 4N56A 5EX5A 1TKZA 1BOTO 3VEZA 4O4GA 5SZTA 1ZBHA 1N8RO 3ZSXA 3OYCA 4QCLA 3HI0A 2O4GA 4FZYA 5E84A 1S1UA 2WUSA 5KPTA 3CJAA 1UWBA 5J1EA 3SZ2A 1R59O 1TKDA 3CC7N 3OJSA 4CIGA 4I2PA 2PYLA 1QE1A 2YNIA 1X9MA 4Z4FA 5GIPA 2FBTA 2KFNA 4CHPA 2F4VK 1Q18A 1WLJA 3C6AA 4KFBA 1TAQA 3SAFA 1K9MO 1O13A 3VQEA 4E89A 1SS6A 3KK7A 5KPRA 2OZMA 4BR9A 2FC0A 3RVCA 1U4BA 2D4WA 1GLFO 1GLDG 4FJ5A 1RDCA 2Q31A 3ISNC 2QM1A 3WXKA 3R8EA 4BRQA 3JXUA 4HUEA 1NMDA 5KGXA 4DTOA 3AO5A 5D3GA 4DV6K 3QEWA 3ZT1A
chains in the Genus database with same CATH topology
1BCMA 3TABA 1B9DA 4DMNA 5KTQA 2BDPA 1LWCA 4BWMA 3L3UA 3V9WA 3K58A 3QESA 3SQ0A 4N41A 4RW8A 4W5TA 3OS0A 1NK0A 1A5WA 2FBXA 4EZ9A 3ZSZA 1BHLA 3T19A 4HHTA 3V9ZA 4FJGA 3NCIA 1QHTA 4O5BA 4H8KA 1BQNA 4FLTA 3RTVA 1IKVA 5C25A 2XY7A 4EP4A 2Y1JA 3RR8A 4KI6A 3MEDA 2EHGA 3P83D 2D0BA 5KI6A 4FLVA 3KD5E 4DFJA 1RT5A 2D0CA 5EU7A 2HHXA 2BE2A 1XHZA 1CZ9A 4NCAA 4G1QA 3IS9A 3DLGA 2E6LA 2BANA 3I8DA 4KHWA 3KLFA 5CZ2A 4DTRA 3OY9A 3TANA 4M3WA 1DTTA 4F8RA 4I7FA 4O0IA 2OPSA 4DU4A 1C6VA 4AHCA 5HRNA 2QXFA 5HROA 3E01A 3HYFA 4OJRA 3VA3A 3QEVA 1X9WA 4ELUA 2RF2A 3CFOA 1QSLA 3VQCA 4M45A 1ZBIA 5J2QA 4OGEA 1RT7A 1SV5A 4RG8A 3I0SA 3O3GA 3SYZA 5J2NA 4K8ZA 4CHYA 1DTQA 4ZTFA 3FFIA 3SCXA 3PO4A 2YNGA 1VSHA 4FCYA 1NK9A 2QKBA 5HRSA 2P5OA 2X74A 3DLBA 2VG5A 3HSTB 1W9HA 3WNGA 4CGFA 1KVAA 4CFDA 3L2UA 2VG7A 1JLQA 3ZSRA 3TI0A 1JXBA 1RTDA 4M42A 4FLWA 4CIEA 3ZT2A 4BE2A 4CJUA 1UAXA 3NGYA 4DU1A 4NYNA 4CJRA 2WOMA 1HYZA 1RNHA 1HNVA 1RT3A 3CG7A 2ZE2A 3OYGA 4BDYA 1O1WA 1F21A 1CZBA 3KK1A 4HVJA 1JLFA 1VSIA 3NBPA 4AH9A 5JS1A 3U3GA 3D45A 1C1BA 1VSFA 4CJWA 4DQSA 4QAGA 4FW2A 4OKKA 4E19A 1C1CA 1EP4A 3MAQA 1S5JA 4GW6A 1ASWA 3K5OA 4LY7A 4CERA 2GBZA 4DSKA 4KI4A 3QETA 3KD1E 2IDOA 4IFVA 4DG1A 4OKJA 4O0JA 4CJEA 4KREA 1KFSA 3AVFA 4BACA 1T03A 3CM5A 4IBNA 3M8PA 4WE1A 4CGJA 3U3YA 3RR7A 4LH4A 4FJHA 3VQDA 1TK5A 4CHOA 3NFAA 3O4NA 3S9HA 1TVRA 1NK7A 1L3SA 1TK0A 3CM6A 3VQPA 4DTUA 2BGGA 4KHNA 1FK9A 1U49A 1HMVA 4IFYA 3ZT0A 4FJNA 4KAZA 4FJMA 3OS1A 2DTUA 4B9LA 1HRHA 3DLKA 3RMDA 3RMBA 3NF7A 1WAJA 4W5OA 4I9LA 1XHXA 4LD0A 3DMJA 4B9NA 1RTJA 4DSEA 4E1NA 4M3UA 1MU2A 4DS5A 2ETJA 1BL3A 4DTNA 3LAMA 3RRHA 1RCHA 4CF8A 4N5SA 1SUQA 4CHNA 3F9KA 2P1JA 3EY1A 1YVUA 1IKXA 5J2MA 3ZSQA 3SV4A 2X78A 3T3FA 2HHUA 4CEEA 4CEZA 5SWMA 2B4JA 3V1OA 2JLEA 4DU3A 4R5PA 1WSIA 3IG1A 4O44A 3OYMA 2X6NA 3G0ZA 4KTWA 5FRNA 2JGUA 2QKKA 3DLEA 4FXDA 1ZYQA 1YTAA 2IAJA 4Z4HA 4FJJA 3NAEA 3NGZA 5CZ1A 3MEEA 1RT2A 1ITGA 3QIPA 1SKSA 1KSPA 4K8XA 3TWHA 4DSLA 1GOBA 3LANA 2E6MA 4HUFA 3VQAA 4CJ5A 4DFKA 1N5YA 3QEXA 3VQBA 1SL1A 4KTZA 1JL2A 3AA2A 4J2DA 1L3TA 4Z0UA 4B8AB 4JLHA 3AVIA 3AVCA 4B3OA 4DQQA 3ZCMA 3LWLA 4AHSA 1R0AA 2YKMA 3DI6A 1VSLA 3ZT3A 2GUIA 1JLBA 2OPPA 2Z1JA 1D9DA 4ELVA 1WSGA 4CJKA 1D9FA 1A5XA 4CJ3A 1NKEA 5KRSA 3OYHA 3LAKA 4FM0A 1Z26A 4FYDA 4KHSA 4LH5A 4CJSA 3BGRA 3NF8A 1X9SA 1KFDA 1TGOA 1RTIA 3F73A 3SNNA 2FBYA 1D8YA 3LWMA 5HLFA 4DS4A 2P51A 1IG9A 2G8WA 3AVHA 2HB5A 2VWJA 4DQRA 3OYKA 3OYBA 4JS5A 1QTMA 3V9XA 3HP6A 4OPJA 3SJJA 3K5LA 1X1PA 2GV9A 3LP0A 3NH0A 2AJQA 4DTMA 4F2RA 4CCHA 4RW4A 3C6TA 3DRPA 3HT3A 1NKBA 1LWFA 1NOYA 3C95A 1KRPA 1BIZA 4ELTA 4QCLA 3DRSA 1WAFA 3QIOA 4CF2A 4CJFA 3TAFA 3P1GA 4RW6A 3JSMA 5FRMA 2KW4A 4RW9A 1LW0A 4FK0A 4ZHRA 1B9FA 1VSDA 4C8MA 4PQUA 3HPGA 4AILC 2QK9A 3VN5A 3D0PA 3KIOA 4YNQA 3MXIA 4CHZA 3H08A 1I3AA 3DOKA 4IG0A 4Z4IA 4CGGA 1EXQA 4N47A 1YT3A 2EX3A 1QQCA 1BCOA 1XI1A 4NCGA 3ITHA 4CJLA 3AA3A 3AO1A 1CXUA 3TAPA 3M8SA 4DLEA 3SPZA 3EYZA 3V1QA 4XIUA 2R7YA 3QNNA 2XY5A 4Q0BA 3RMCA 5KGWA 4CK3A 1KVBA 3HO1A 4OKEA 1LAVA 2HMIA 1RDBA 2PYJA 2HNDA 1TAUA 2VWKA 3OYAA 3RMAA 4OVLA 2A1RA 1KTQA 4GMJB 4EP5A 3LALA 1CXQA 3IAYA 3VQ6A 1BISA 5JS2A 4FJKA 1QSSA 2KTQA 1VRTA 3OVNA 4PY5A 4KV8A 4ICLA 4M3RA 4YFUA 4ID5A 3UIQA 2WONA 1S6QA 3PX4A 1WSEA 4DF8A 4DTSA 1J54A 1REVA 3MXMA 4ID1A 2IC3A 3KKRA 1KVCA 4CK2A 3AO2A 4BDPA 4CFCA 4JRQA 1Y97A 3ZT4A 3K57A 4OPKA 1UA0A 4C8NA 4ZTJA 1RT1A 3OS2A 1BQMA 3JYTA 2D0AA 2XY8A 3C94A 4EZ6A 4F3OA 4KHUA 4C8KA 3QLHA 1RT6A 3DM2A 1BGXT 4E7LA 3SQ2A 5HP1A 3S3OA 2OYQA 1S1WA 3L2RA 2E4LA 3VA0A 4M3XA 4UQGA 4DF4A 3QO9A 1LV5A 2DFEA 4FJLA 4CGHA 4I9QA 4AHRA 1C0TA 1KLMA 1JLAA 3ZSVA 1NK6A 3HJFA 5CYQA 2D5RA 2HHQA 3LP3A 3EZ5A 3TAEA 4KRFA 1TKTA 5KRTA 4N76A 1DLOA 4FK2A 3V9SA 4B9SA 2DFFA 1Q8IA 4KB0A 1HYSA 5I42A 1UA1A 2Z1HA 4KTQA 3C6UA 1JXEA 2Z1IA 4BDZA 4KHYA 5J2PA 3PX0A 2HHVA 2Q3SA 3AVBA 1ASVA 4BE1A 3L8BA 4F4KA 4KHQA 4IDKA 1VK0A 1U47A 3WNHA 1VSKA 3SPYA 3PY8A 2HVIA 4FVMA 1WNSA 3HPHA 2G8KA 2DY4A 1WSJA 3LZIA 1TL1A 3AVGA 1TKXA 1EKEA 4IG3A 4DTJA 3ZSOA 4B9MA 2HW3A 3QERA 4NCBA 4E0DA 1JL1A 1NOZA 3OYFA 4CE9A 1B92A 1WSFA 4CF9A 4HTUA 1K6YA 1S1TA 1LWEA 3AA4A 1T8EA 2OPQA 1VRUA 4CJ4A 2Z1GA 4F3TA 1A5VA 3P5JA 3VQQA 4CIFA 3K59A 3L2QA 4Q5VA 3RRGA 4LSLA 4CJPA 1RT4A 2YV0X 1WSHA 3K5MA 3LPTA 4B9VA 3B6OA 4E7IA 3ASMA 3AVNA 2ZQBA 1N6QA 3TAQA 4CF0A 4KO0A 4M3TA 3PV8A 4J2BA 1I39A 1NJWA 1SL2A 1SKRA 3AVJA 3S3MA 2O4IA 1IKWA 4FM2A 1WN7A 4BWJA 3VQ9A 4HCBA 2HNZA 5HBMA 3A2FA 3O4QA 2ITGA 3KK2A 1XWLA 1J9AA 3QNOA 1IKYA 4E7JA 4FJIA 3DOLA 2YHAA 4JS4A 2F96A 1VSMA 4CEFA 2Y1IA 2KZZA 1XC9A 4CEAA 3LDSA 3NH2A 4H4OA 1C1AA 1Q9YA 1RBSA 1S6PA 3MECA 3NE6A 3KLIA 2YKNA 4CECA 1BI4A 2X6SA 4DTPA 4CJVA 3AO3A 5FROA 1RDDA 5T7BA 4QOZB 1JKHA 4FJ7A 1NJYA 2G8VA 1NK4A 1Q9XA 4TSXA 2OZSA 2DFHA 1QS4A 3AO4A 3G10A 5CY4A 4M41A 4CK1A 3OYJA 4Z4EA 3DLHA 1HQUA 4MFBA 4KKOA 3CQ8A 3B6PA 3CYMA 3WNEA 4CEQA 3SUPA 4DSIA 1S1VA 3SUNA 4B9TA 3LP1A 3T1AA 4GVMA 4FJ8A 4PA1A 3NF6A 3CFRA 2P5GA 1RBVA 2KZMA 3L2WA 3V4IA 5C24A 3QEPA 3ULDA 4Z4CA 1W0HA 4J2AA 1RBUA 1L3UA 3LZJA 1HYVA 4M3YA 2RPIA 3LP2A 1UOCA 1NK5A 2XHBA 3VQ5A 3ZSWA 2G8FA 3TAGA 4HUGA 1CLQA 3K2PA 4B08A 4DLGA 3K5NA 3THVA 1TK8A 3MEGA 3OJUA 3NGIA 3OYNA 3U6FA 1FKOA 1RILA 1VSEA 2FBVA 3NH1A 2XRIA 4CFBA 1G15A 3HVTA 2KFZA 3LPUA 3SI6A 4AHVA 1KLNA 4CEOA 3AV9A 2KQ2A 2XO7A 4J2EA 5I3UA 2VG6A 5HRPA 2PY5A 1L5UA 2F8TA 2NUBA 3AVKA 1U48A 3PX6A 3KK3A 1U45A 3IRXA 3M8RA 2HHSA 3HP9A 4B9UA 2G8IA 4OLAA 1BIUA 4RW7A 4JRPA 3V81A 2OA8A 3OYIA 1FKPA 4M3ZA 4CGIA 3S3NA 1L3VA 3NDKA 1TL3A 2I5JA 1HQEA 2LSNA 3SQ1A 1IO2A 3SUOA 3VQ4A 3KJVA 4CHQA 4E7KA 4FM1A 4W5NA 3O3HA 4F2SA 4FZXC 3AA5X 2XY6A 4DQIA 1ZBFA 4FLZA 1BI4B 5FDLA 1LAWA 1ZBLA 4FJXA 4DQPA 3OYEA 4NYFA 4Y1CA 1NJXA 1GOAA 3KLEA 2ZD1A 3ZSYA 1SKWA 2A1SA 4C8LA 2HHWA 1EX4A 2IOCA 4CJQA 4DTXA 2IS3A 1HNIA 1IH7A 3TAMA 4IKFA 5CYMA 1JLGA 1NKCA 4E1MA 1HPZA 4KPYA 5DK5A 3QEIA 4CFAA 4FLXA 3PO5A 2HHTA 1GOCA 3AVMA 3HVRA 3SV3A 4W5QA 1T7PA 1T05A 4C8OA 1U04A 2IGIA 1C0UA 2G8HA 2ATQA 2PZSA 3VQ7A 3MXJA 3V1RA 3CFPA 4Y1DA 4FJ9A 4CGDA 2HVHA 4AHUA 4N56A 1Z25A 3HL8A 3QINA 1YTUA 3AVAA 1TKZA 4MQ3A 3SQ4A 1ZBUA 4O4GA 5SZTA 1ZBHA 3AVLA 3ZSXA 3OYCA 1NJZA 1HJRA 2HNYA 5K14A 1J53A 3M8QA 2O4GA 4FLYA 3DYAA 2RN2A 3I0RA 3KLGA 2G8UA 3L3VA 4E3SA 4CEBA 5E41A 4FZYA 1RDAA 1S9EA 3TR8A 2YNFA 4DFMA 4PUOA 5HRRA 2W42A 4HCCA 1S1UA 3DLRA 2F8SA 2B5JA 3PUFA 4FW1A 1S9GA 4CEDA 1UWBA 5J1EA 3OYLA 4CF1A 3KLHA 4CESA 3SZ2A 3TARA 4FZZA 1KCFA 1FXXA 1LW2A 4FLUA 1TKDA 3OJSA 4CIGA 3L2VA 4OLBA 4I2PA 1ASUA 2PYLA 2YHBA 1QE1A 2YNIA 3KKSA 1X9MA 4DWIA 4Z4FA 2KFNA 2FBTA 4LSNA 3RWUA 4L8RB 3HXMA 4CHPA 4PWDA 3VQ8A 4AHTA 1TV6A 1WLJA 1J5OA 3HK2A 2OPRA 4DSJA 4KFBA 1C0MA 4DSFA 3DRRA 4E7HA 1TAQA 3WNFA 3VQEA 4E89A 2YNHA 3HM9A 3V6DA 4DFPA 3SUQA 4I2QA 1EETA 3KTQA 1JLCA 2OZMA 4O55A 3O3FA 1JLEA 2FC0A 2B6AA 1U4BA 4FK4A 4KB1A 3NHGA 4FJ5A 4CJTA 1RDCA 3ISNC 4B8CA 4H4MA 1QSYA 3ALYA 4W5RA 1RBRA 4BE0A 1SL0A 1VSJA 5DMRA 4OGCA 1NK8A 3HPOA 3V9UA 4HUEA 3OYDA 5KGXA 5C42A 3AO5A 1RTHA 1S1XA 4DTOA 1RBTA 3QEWA 3BDPA 3ZT1A 5D3GA 4Z4GA 1D5AA 3NF9A 2RKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BCM A;  3TAB A;  1B9D A;  4DMN A;  5KTQ A;  2BDP A;  1LWC A;  4BWM A;  3L3U A;  3V9W A;  3K58 A;  3QES A;  3SQ0 A;  4N41 A;  4RW8 A;  4W5T A;  3OS0 A;  1NK0 A;  1A5W A;  2FBX A;  4EZ9 A;  3ZSZ A;  1BHL A;  3T19 A;  4HHT A;  3V9Z A;  4FJG A;  3NCI A;  1QHT A;  4O5B A;  4H8K A;  1BQN A;  4FLT A;  3RTV A;  1IKV A;  5C25 A;  2XY7 A;  4EP4 A;  2Y1J A;  3RR8 A;  4KI6 A;  3MED A;  2EHG A;  3P83 D;  2D0B A;  5KI6 A;  4FLV A;  3KD5 E;  4DFJ A;  1RT5 A;  2D0C A;  5EU7 A;  2HHX A;  2BE2 A;  1XHZ A;  1CZ9 A;  4NCA A;  4G1Q A;  3IS9 A;  3DLG A;  2E6L A;  2BAN A;  3I8D A;  4KHW A;  3KLF A;  5CZ2 A;  4DTR A;  3OY9 A;  3TAN A;  4M3W A;  1DTT A;  4F8R A;  4I7F A;  4O0I A;  2OPS A;  4DU4 A;  1C6V A;  4AHC A;  5HRN A;  2QXF A;  5HRO A;  3E01 A;  3HYF A;  4OJR A;  3VA3 A;  3QEV A;  1X9W A;  4ELU A;  2RF2 A;  3CFO A;  1QSL A;  3VQC A;  4M45 A;  1ZBI A;  5J2Q A;  4OGE A;  1RT7 A;  1SV5 A;  4RG8 A;  3I0S A;  3O3G A;  3SYZ A;  5J2N A;  4K8Z A;  4CHY A;  1DTQ A;  4ZTF A;  3FFI A;  3SCX A;  3PO4 A;  2YNG A;  1VSH A;  4FCY A;  1NK9 A;  2QKB A;  5HRS A;  2P5O A;  2X74 A;  3DLB A;  2VG5 A;  3HST B;  1W9H A;  3WNG A;  4CGF A;  1KVA A;  4CFD A;  3L2U A;  2VG7 A;  1JLQ A;  3ZSR A;  3TI0 A;  1JXB A;  1RTD A;  4M42 A;  4FLW A;  4CIE A;  3ZT2 A;  4BE2 A;  4CJU A;  1UAX A;  3NGY A;  4DU1 A;  4NYN A;  4CJR A;  2WOM A;  1HYZ A;  1RNH A;  1HNV A;  1RT3 A;  3CG7 A;  2ZE2 A;  3OYG A;  4BDY A;  1O1W A;  1F21 A;  1CZB A;  3KK1 A;  4HVJ A;  1JLF A;  1VSI A;  3NBP A;  4AH9 A;  5JS1 A;  3U3G A;  3D45 A;  1C1B A;  1VSF A;  4CJW A;  4DQS A;  4QAG A;  4FW2 A;  4OKK A;  4E19 A;  1C1C A;  1EP4 A;  3MAQ A;  1S5J A;  4GW6 A;  1ASW A;  3K5O A;  4LY7 A;  4CER A;  2GBZ A;  4DSK A;  4KI4 A;  3QET A;  3KD1 E;  2IDO A;  4IFV A;  4DG1 A;  4OKJ A;  4O0J A;  4CJE A;  4KRE A;  1KFS A;  3AVF A;  4BAC A;  1T03 A;  3CM5 A;  4IBN A;  3M8P A;  4WE1 A;  4CGJ A;  3U3Y A;  3RR7 A;  4LH4 A;  4FJH A;  3VQD A;  1TK5 A;  4CHO A;  3NFA A;  3O4N A;  3S9H A;  1TVR A;  1NK7 A;  1L3S A;  1TK0 A;  3CM6 A;  3VQP A;  4DTU A;  2BGG A;  4KHN A;  1FK9 A;  1U49 A;  1HMV A;  4IFY A;  3ZT0 A;  4FJN A;  4KAZ A;  4FJM A;  3OS1 A;  2DTU A;  4B9L A;  1HRH A;  3DLK A;  3RMD A;  3RMB A;  3NF7 A;  1WAJ A;  4W5O A;  4I9L A;  1XHX A;  4LD0 A;  3DMJ A;  4B9N A;  1RTJ A;  4DSE A;  4E1N A;  4M3U A;  1MU2 A;  4DS5 A;  2ETJ A;  1BL3 A;  4DTN A;  3LAM A;  3RRH A;  1RCH A;  4CF8 A;  4N5S A;  1SUQ A;  4CHN A;  3F9K A;  2P1J A;  3EY1 A;  1YVU A;  1IKX A;  5J2M A;  3ZSQ A;  3SV4 A;  2X78 A;  3T3F A;  2HHU A;  4CEE A;  4CEZ A;  5SWM A;  2B4J A;  3V1O A;  2JLE A;  4DU3 A;  4R5P A;  1WSI A;  3IG1 A;  4O44 A;  3OYM A;  2X6N A;  3G0Z A;  4KTW A;  5FRN A;  2JGU A;  2QKK A;  3DLE A;  4FXD A;  1ZYQ A;  1YTA A;  2IAJ A;  4Z4H A;  4FJJ A;  3NAE A;  3NGZ A;  5CZ1 A;  3MEE A;  1RT2 A;  1ITG A;  3QIP A;  1SKS A;  1KSP A;  4K8X A;  3TWH A;  4DSL A;  1GOB A;  3LAN A;  2E6M A;  4HUF A;  3VQA A;  4CJ5 A;  4DFK A;  1N5Y A;  3QEX A;  3VQB A;  1SL1 A;  4KTZ A;  1JL2 A;  3AA2 A;  4J2D A;  1L3T A;  4Z0U A;  4B8A B;  4JLH A;  3AVI A;  3AVC A;  4B3O A;  4DQQ A;  3ZCM A;  3LWL A;  4AHS A;  1R0A A;  2YKM A;  3DI6 A;  1VSL A;  3ZT3 A;  2GUI A;  1JLB A;  2OPP A;  2Z1J A;  1D9D A;  4ELV A;  1WSG A;  4CJK A;  1D9F A;  1A5X A;  4CJ3 A;  1NKE A;  5KRS A;  3OYH A;  3LAK A;  4FM0 A;  1Z26 A;  4FYD A;  4KHS A;  4LH5 A;  4CJS A;  3BGR A;  3NF8 A;  1X9S A;  1KFD A;  1TGO A;  1RTI A;  3F73 A;  3SNN A;  2FBY A;  1D8Y A;  3LWM A;  5HLF A;  4DS4 A;  2P51 A;  1IG9 A;  2G8W A;  3AVH A;  2HB5 A;  2VWJ A;  4DQR A;  3OYK A;  3OYB A;  4JS5 A;  1QTM A;  3V9X A;  3HP6 A;  4OPJ A;  3SJJ A;  3K5L A;  1X1P A;  2GV9 A;  3LP0 A;  3NH0 A;  2AJQ A;  4DTM A;  4F2R A;  4CCH A;  4RW4 A;  3C6T A;  3DRP A;  3HT3 A;  1NKB A;  1LWF A;  1NOY A;  3C95 A;  1KRP A;  1BIZ A;  4ELT A;  4QCL A;  3DRS A;  1WAF A;  3QIO A;  4CF2 A;  4CJF A;  3TAF A;  3P1G A;  4RW6 A;  3JSM A;  5FRM A;  2KW4 A;  4RW9 A;  1LW0 A;  4FK0 A;  4ZHR A;  1B9F A;  1VSD A;  4C8M A;  4PQU A;  3HPG A;  4AIL C;  2QK9 A;  3VN5 A;  3D0P A;  3KIO A;  4YNQ A;  3MXI A;  4CHZ A;  3H08 A;  1I3A A;  3DOK A;  4IG0 A;  4Z4I A;  4CGG A;  1EXQ A;  4N47 A;  1YT3 A;  2EX3 A;  1QQC A;  1BCO A;  1XI1 A;  4NCG A;  3ITH A;  4CJL A;  3AA3 A;  3AO1 A;  1CXU A;  3TAP A;  3M8S A;  4DLE A;  3SPZ A;  3EYZ A;  3V1Q A;  4XIU A;  2R7Y A;  3QNN A;  2XY5 A;  4Q0B A;  3RMC A;  5KGW A;  4CK3 A;  1KVB A;  3HO1 A;  4OKE A;  1LAV A;  2HMI A;  1RDB A;  2PYJ A;  2HND A;  1TAU A;  2VWK A;  3OYA A;  3RMA A;  4OVL A;  2A1R A;  1KTQ A;  4GMJ B;  4EP5 A;  3LAL A;  1CXQ A;  3IAY A;  3VQ6 A;  1BIS A;  5JS2 A;  4FJK A;  1QSS A;  2KTQ A;  1VRT A;  3OVN A;  4PY5 A;  4KV8 A;  4ICL A;  4M3R A;  4YFU A;  4ID5 A;  3UIQ A;  2WON A;  1S6Q A;  3PX4 A;  1WSE A;  4DF8 A;  4DTS A;  1J54 A;  1REV A;  3MXM A;  4ID1 A;  2IC3 A;  3KKR A;  1KVC A;  4CK2 A;  3AO2 A;  4BDP A;  4CFC A;  4JRQ A;  1Y97 A;  3ZT4 A;  3K57 A;  4OPK A;  1UA0 A;  4C8N A;  4ZTJ A;  1RT1 A;  3OS2 A;  1BQM A;  3JYT A;  2D0A A;  2XY8 A;  3C94 A;  4EZ6 A;  4F3O A;  4KHU A;  4C8K A;  3QLH A;  1RT6 A;  3DM2 A;  1BGX T;  4E7L A;  3SQ2 A;  5HP1 A;  3S3O A;  2OYQ A;  1S1W A;  3L2R A;  2E4L A;  3VA0 A;  4M3X A;  4UQG A;  4DF4 A;  3QO9 A;  1LV5 A;  2DFE A;  4FJL A;  4CGH A;  4I9Q A;  4AHR A;  1C0T A;  1KLM A;  1JLA A;  3ZSV A;  1NK6 A;  3HJF A;  5CYQ A;  2D5R A;  2HHQ A;  3LP3 A;  3EZ5 A;  3TAE A;  4KRF A;  1TKT A;  5KRT A;  4N76 A;  1DLO A;  4FK2 A;  3V9S A;  4B9S A;  2DFF A;  1Q8I A;  4KB0 A;  1HYS A;  5I42 A;  1UA1 A;  2Z1H A;  4KTQ A;  3C6U A;  1JXE A;  2Z1I A;  4BDZ A;  4KHY A;  5J2P A;  3PX0 A;  2HHV A;  2Q3S A;  3AVB A;  1ASV A;  4BE1 A;  3L8B A;  4F4K A;  4KHQ A;  4IDK A;  1VK0 A;  1U47 A;  3WNH A;  1VSK A;  3SPY A;  3PY8 A;  2HVI A;  4FVM A;  1WNS A;  3HPH A;  2G8K A;  2DY4 A;  1WSJ A;  3LZI A;  1TL1 A;  3AVG A;  1TKX A;  1EKE A;  4IG3 A;  4DTJ A;  3ZSO A;  4B9M A;  2HW3 A;  3QER A;  4NCB A;  4E0D A;  1JL1 A;  1NOZ A;  3OYF A;  4CE9 A;  1B92 A;  1WSF A;  4CF9 A;  4HTU A;  1K6Y A;  1S1T A;  1LWE A;  3AA4 A;  1T8E A;  2OPQ A;  1VRU A;  4CJ4 A;  2Z1G A;  4F3T A;  1A5V A;  3P5J A;  3VQQ A;  4CIF A;  3K59 A;  3L2Q A;  4Q5V A;  3RRG A;  4LSL A;  4CJP A;  1RT4 A;  2YV0 X;  1WSH A;  3K5M A;  3LPT A;  4B9V A;  3B6O A;  4E7I A;  3ASM A;  3AVN A;  2ZQB A;  1N6Q A;  3TAQ A;  4CF0 A;  4KO0 A;  4M3T A;  3PV8 A;  4J2B A;  1I39 A;  1NJW A;  1SL2 A;  1SKR A;  3AVJ A;  3S3M A;  2O4I A;  1IKW A;  4FM2 A;  1WN7 A;  4BWJ A;  3VQ9 A;  4HCB A;  2HNZ A;  5HBM A;  3A2F A;  3O4Q A;  2ITG A;  3KK2 A;  1XWL A;  1J9A A;  3QNO A;  1IKY A;  4E7J A;  4FJI A;  3DOL A;  2YHA A;  4JS4 A;  2F96 A;  1VSM A;  4CEF A;  2Y1I A;  2KZZ A;  1XC9 A;  4CEA A;  3LDS A;  3NH2 A;  4H4O A;  1C1A A;  1Q9Y A;  1RBS A;  1S6P A;  3MEC A;  3NE6 A;  3KLI A;  2YKN A;  4CEC A;  1BI4 A;  2X6S A;  4DTP A;  4CJV A;  3AO3 A;  5FRO A;  1RDD A;  5T7B A;  4QOZ B;  1JKH A;  4FJ7 A;  1NJY A;  2G8V A;  1NK4 A;  1Q9X A;  4TSX A;  2OZS A;  2DFH A;  1QS4 A;  3AO4 A;  3G10 A;  5CY4 A;  4M41 A;  4CK1 A;  3OYJ A;  4Z4E A;  3DLH A;  1HQU A;  4MFB A;  4KKO A;  3CQ8 A;  3B6P A;  3CYM A;  3WNE A;  4CEQ A;  3SUP A;  4DSI A;  1S1V A;  3SUN A;  4B9T A;  3LP1 A;  3T1A A;  4GVM A;  4FJ8 A;  4PA1 A;  3NF6 A;  3CFR A;  2P5G A;  1RBV A;  2KZM A;  3L2W A;  3V4I A;  5C24 A;  3QEP A;  3ULD A;  4Z4C A;  1W0H A;  4J2A A;  1RBU A;  1L3U A;  3LZJ A;  1HYV A;  4M3Y A;  2RPI A;  3LP2 A;  1UOC A;  1NK5 A;  2XHB A;  3VQ5 A;  3ZSW A;  2G8F A;  3TAG A;  4HUG A;  1CLQ A;  3K2P A;  4B08 A;  4DLG A;  3K5N A;  3THV A;  1TK8 A;  3MEG A;  3OJU A;  3NGI A;  3OYN A;  3U6F A;  1FKO A;  1RIL A;  1VSE A;  2FBV A;  3NH1 A;  2XRI A;  4CFB A;  1G15 A;  3HVT A;  2KFZ A;  3LPU A;  3SI6 A;  4AHV A;  1KLN A;  4CEO A;  3AV9 A;  2KQ2 A;  2XO7 A;  4J2E A;  5I3U A;  2VG6 A;  5HRP A;  2PY5 A;  1L5U A;  2F8T A;  2NUB A;  3AVK A;  1U48 A;  3PX6 A;  3KK3 A;  1U45 A;  3IRX A;  3M8R A;  2HHS A;  3HP9 A;  4B9U A;  2G8I A;  4OLA A;  1BIU A;  4RW7 A;  4JRP A;  3V81 A;  2OA8 A;  3OYI A;  1FKP A;  4M3Z A;  4CGI A;  3S3N A;  1L3V A;  3NDK A;  1TL3 A;  2I5J A;  1HQE A;  2LSN A;  3SQ1 A;  1IO2 A;  3SUO A;  3VQ4 A;  3KJV A;  4CHQ A;  4E7K A;  4FM1 A;  4W5N A;  3O3H A;  4F2S A;  4FZX C;  3AA5 X;  2XY6 A;  4DQI A;  1ZBF A;  4FLZ A;  1BI4 B;  5FDL A;  1LAW A;  1ZBL A;  4FJX A;  4DQP A;  3OYE A;  4NYF A;  4Y1C A;  1NJX A;  1GOA A;  3KLE A;  2ZD1 A;  3ZSY A;  1SKW A;  2A1S A;  4C8L A;  2HHW A;  1EX4 A;  2IOC A;  4CJQ A;  4DTX A;  2IS3 A;  1HNI A;  1IH7 A;  3TAM A;  4IKF A;  5CYM A;  1JLG A;  1NKC A;  4E1M A;  1HPZ A;  4KPY A;  5DK5 A;  3QEI A;  4CFA A;  4FLX A;  3PO5 A;  2HHT A;  1GOC A;  3AVM A;  3HVR A;  3SV3 A;  4W5Q A;  1T7P A;  1T05 A;  4C8O A;  1U04 A;  2IGI A;  1C0U A;  2G8H A;  2ATQ A;  2PZS A;  3VQ7 A;  3MXJ A;  3V1R A;  3CFP A;  4Y1D A;  4FJ9 A;  4CGD A;  2HVH A;  4AHU A;  4N56 A;  1Z25 A;  3HL8 A;  3QIN A;  1YTU A;  3AVA A;  1TKZ A;  4MQ3 A;  3SQ4 A;  1ZBU A;  4O4G A;  5SZT A;  1ZBH A;  3AVL A;  3ZSX A;  3OYC A;  1NJZ A;  1HJR A;  2HNY A;  5K14 A;  1J53 A;  3M8Q A;  2O4G A;  4FLY A;  3DYA A;  2RN2 A;  3I0R A;  3KLG A;  2G8U A;  3L3V A;  4E3S A;  4CEB A;  5E41 A;  4FZY A;  1RDA A;  1S9E A;  3TR8 A;  2YNF A;  4DFM A;  4PUO A;  5HRR A;  2W42 A;  4HCC A;  1S1U A;  3DLR A;  2F8S A;  2B5J A;  3PUF A;  4FW1 A;  1S9G A;  4CED A;  1UWB A;  5J1E A;  3OYL A;  4CF1 A;  3KLH A;  4CES A;  3SZ2 A;  3TAR A;  4FZZ A;  1KCF A;  1FXX A;  1LW2 A;  4FLU A;  1TKD A;  3OJS A;  4CIG A;  3L2V A;  4OLB A;  4I2P A;  1ASU A;  2PYL A;  2YHB A;  1QE1 A;  2YNI A;  3KKS A;  1X9M A;  4DWI A;  4Z4F A;  2KFN A;  2FBT A;  4LSN A;  3RWU A;  4L8R B;  3HXM A;  4CHP A;  4PWD A;  3VQ8 A;  4AHT A;  1TV6 A;  1WLJ A;  1J5O A;  3HK2 A;  2OPR A;  4DSJ A;  4KFB A;  1C0M A;  4DSF A;  3DRR A;  4E7H A;  1TAQ A;  3WNF A;  3VQE A;  4E89 A;  2YNH A;  3HM9 A;  3V6D A;  4DFP A;  3SUQ A;  4I2Q A;  1EET A;  3KTQ A;  1JLC A;  2OZM A;  4O55 A;  3O3F A;  1JLE A;  2FC0 A;  2B6A A;  1U4B A;  4FK4 A;  4KB1 A;  3NHG A;  4FJ5 A;  4CJT A;  1RDC A;  3ISN C;  4B8C A;  4H4M A;  1QSY A;  3ALY A;  4W5R A;  1RBR A;  4BE0 A;  1SL0 A;  1VSJ A;  5DMR A;  4OGC A;  1NK8 A;  3HPO A;  3V9U A;  4HUE A;  3OYD A;  5KGX A;  5C42 A;  3AO5 A;  1RTH A;  1S1X A;  4DTO A;  1RBT A;  3QEW A;  3BDP A;  3ZT1 A;  5D3G A;  4Z4G A;  1D5A A;  3NF9 A;  2RKI A; 
#chains in the Genus database with same CATH topology
 1B9D A;  1ESV A;  4DMN A;  2BDP A;  1LWC A;  3SQ0 A;  4RW8 A;  1NK0 A;  2QI2 A;  4BC4 A;  3ZSZ A;  1BHL A;  3ZET B;  3NCI A;  1QHT A;  4O5B A;  1BQN A;  1VQM N;  4JI4 K;  3OTO K;  3L4I A;  4BR7 A;  1QVF M;  2EHG A;  2D0B A;  3KD5 E;  4YOY A;  2QWQ A;  1XHZ A;  1HKB A;  3I8D A;  3T1Y K;  5CZ2 A;  3TAN A;  3DWL A;  4QS9 A;  5TKW A;  3E01 A;  3CJ7 A;  3VQC A;  4M45 A;  3TU5 A;  5J2Q A;  3O3G A;  3MCP A;  5J2N A;  3HOT A;  1DTQ A;  1E4F T;  3FFI A;  5HRS A;  3WNG A;  1W9H A;  4IOA L;  3L2U A;  1KVA A;  2VG7 A;  2ZGZ A;  3SAG A;  1QHA A;  1JXB A;  1RTD A;  4DR3 K;  4CJU A;  3NGY A;  4DU1 A;  4CJR A;  2WOM A;  1HNV A;  4DB3 A;  2ZE2 A;  3A5N C;  1QVG M;  3SMS A;  1NJI O;  5GIO A;  1VSI A;  5C2D A;  5AQX A;  2Q36 A;  4YDU C;  3QIC A;  4QAG A;  4FW2 A;  4OKK A;  3O1W A;  1S5J A;  3K5O A;  4CER A;  3KD1 E;  4HWI A;  4OKJ A;  1YUW A;  4BAC A;  3THW A;  3CM5 A;  5AQO A;  4CGJ A;  3U3Y A;  4FWN A;  5BRD A;  5CR4 A;  1HUX A;  1NK7 A;  4GKJ K;  3VQP A;  1QZ6 A;  2Q0U A;  2VGM A;  2ASP A;  2CGJ A;  3OA9 A;  3ZT0 A;  1T3V A;  3CC4 N;  4FJM A;  3OS1 A;  4H0O A;  3G6E N;  3NF7 A;  1WAJ A;  4I9L A;  4B1Z A;  5AZI B;  2Q1N A;  4NLB A;  5AZJ A;  3KWG A;  3AY9 A;  3ID8 A;  3ZEU A;  4WFN L;  1D4X A;  4CF8 A;  1SUQ A;  3FE1 A;  3W0L A;  4A59 A;  3WT0 A;  1IKX A;  5J2M A;  3DXK A;  3TSP A;  1N33 K;  4BGB A;  2B4J A;  3V1O A;  4NB4 A;  4DU3 A;  1WSI A;  2HMP A;  2NZT A;  4YY3 K;  3L6Q A;  3CJC A;  1YHQ N;  1VQ9 N;  1ZYQ A;  2IAJ A;  1DT9 A;  4K25 A;  4FJJ A;  1VQO N;  3A8Y A;  5CZ1 A;  3MEE A;  1ITG A;  3O5B A;  3J80 O;  4DUY K;  1GOB A;  3LAN A;  3VEN A;  1N5Y A;  3VQA A;  4DFK A;  4FOE A;  1SL1 A;  1JL2 A;  4Z0U A;  3BP8 A;  2YKM A;  1R0A A;  3DI6 A;  1VSL A;  2Z1J A;  4F9O A;  3J7Y P;  1WSG A;  3FGU A;  3M6G A;  1D9F A;  3ATU A;  3E1Y A;  4BRM A;  5KRS A;  4B1V A;  3OYH A;  3LAK A;  4EHT A;  4CJS A;  2O8C A;  1X9S A;  3CF5 L;  4OPA A;  1KFD A;  1TGO A;  5JVH L;  1XNQ K;  3CI5 A;  4YDU A;  3OBW A;  4DS4 A;  4BRO A;  2P51 A;  4BRD A;  3VGM A;  1Z6R A;  3DXM A;  4JS5 A;  4A61 A;  3K5L A;  1X1P A;  2GV9 A;  4BRK A;  3NH0 A;  3I55 N;  5AQM A;  3UKR A;  2OCE A;  1BIZ A;  1RDW X;  3TAF A;  4CJF A;  2KW4 A;  1B9F A;  4YOT A;  4DQ8 A;  4PQU A;  1K8A O;  3VN5 A;  3MXI A;  4IG0 A;  4JKF A;  2O8B A;  1EXQ A;  1EWR A;  3GBT A;  1QQC A;  1NGF A;  1RGI A;  1YF5 L;  2VCP A;  3BZK A;  3L4Q A;  4XIU A;  3BY5 A;  1BO5 O;  3RMC A;  4Q0B A;  5KGW A;  1OH8 A;  3HOS A;  4OKE A;  1IBK K;  2HMI A;  1OH6 A;  4GMJ B;  3IAY A;  3LAL A;  1CXQ A;  3MX2 A;  4JK9 A;  2KTQ A;  2P9P A;  3OVN A;  4YFU A;  4ID5 A;  1VQN N;  1J54 A;  3KKR A;  2I7N A;  4PKG A;  3AO2 A;  4BDP A;  3T7Z A;  2E1Y A;  4C8N A;  1UA0 A;  1BQM A;  3JYT A;  2D0A A;  4FOI A;  1BGX T;  1IV0 A;  3MWT A;  3VA0 A;  4M3X A;  4CGH A;  4I9Q A;  1C0T A;  1KLM A;  3ZSV A;  3VTH A;  3WQT A;  2D5R A;  3EZ5 A;  4KRF A;  4N76 A;  4FK2 A;  1DLO A;  1HYS A;  1Q8I A;  1TYQ B;  1W2B M;  4KTQ A;  4NLC A;  4KHY A;  2Z1I A;  4BDZ A;  4BVP A;  3LDQ A;  3PX0 A;  1YIJ N;  2HHV A;  1ASV A;  2D0P A;  4KHQ A;  3CIP A;  3PY8 A;  2KKZ A;  4FVM A;  3BF3 A;  3LZI A;  1TKX A;  4DTJ A;  2HW3 A;  1GLB G;  4NCB A;  4JKD A;  3MDQ A;  3VQQ A;  3K59 A;  3FZF A;  4Q5V A;  1CZA N;  4LSL A;  1RT4 A;  3LPT A;  4B9V A;  5BRE A;  4CF0 A;  3PV8 A;  2YCH A;  1IBL K;  2O4I A;  4FM2 A;  1WN7 A;  3VQ9 A;  4BRN A;  2ITG A;  4OPH A;  1ILY A;  3BEX A;  4BRF A;  3DOL A;  3EZW A;  2IVP A;  4CZJ A;  2O8E A;  4CEA A;  5FPN A;  3P38 A;  4YOR A;  3QFP A;  3VEV A;  5IT9 O;  3MWP A;  5E26 A;  3KLI A;  3HZ6 A;  3K9K A;  1BI4 A;  1SZ2 A;  2A42 A;  3WXL A;  1RDD A;  3SMP A;  2ZJR L;  4QOZ B;  1MDU B;  3CJ9 A;  4FJ7 A;  3DAW A;  4H0X B;  1HJO A;  2BTF A;  1NGD A;  4PL8 A;  4KKO A;  4DV3 K;  4FJ8 A;  3C0B A;  2KZM A;  4CZG A;  3E9P A;  1VQ4 N;  3MN9 A;  4J2A A;  3UE5 A;  4M3Y A;  1L3U A;  3T69 A;  5ADX A;  2RPI A;  2FF6 A;  5AQJ A;  3WXM B;  3ENO A;  2G8F A;  1CLQ A;  3UKU B;  3VEW A;  3D2F A;  3AAQ A;  4CFB A;  3F9M A;  3CCR N;  1KLN A;  3U9Z A;  2KQ2 A;  3KZB A;  3PIP L;  2PY5 A;  1L5U A;  2F8T A;  3AVK A;  4LFA K;  5AQG A;  4NO7 A;  5AQV A;  3HP9 A;  4DR6 K;  3I8B A;  2G8I A;  4OLA A;  2OA8 A;  2OTJ N;  1FKP A;  4BRP A;  4CGI A;  3S3N A;  3VQ4 A;  4CHQ A;  4E7K A;  4FPA A;  2XY6 A;  3TTF A;  3EE9 A;  3MMV A;  2QWL A;  4ILG B;  1HPM A;  4CVN E;  4C8L A;  3ZSY A;  3CCL N;  1YVN A;  2NRH A;  3O08 A;  1JLG A;  1HPZ A;  3AAP A;  3EEQ A;  3K9J A;  5DK5 A;  4CFA A;  1GOC A;  3HVR A;  4W5Q A;  2UXD K;  2IGI A;  2G8H A;  2ATQ A;  3MCA B;  3VQ7 A;  2D1K A;  5AQP A;  1Q81 O;  4JHD A;  2HVH A;  3EN9 A;  1Z25 A;  3HL8 A;  3HRG A;  3SQ4 A;  2HNY A;  5K14 A;  3M8Q A;  3I0R A;  3KLG A;  3L3V A;  4JKB A;  4CEB A;  5E41 A;  1RDA A;  2QA4 N;  4PUO A;  1VHX A;  2F8S A;  2B5J A;  3CCS N;  3OYL A;  3KLH A;  3TAR A;  1KCF A;  1FXX A;  1K8K A;  4FLU A;  3L2V A;  4OLB A;  2P9S B;  1ASU A;  3R6M A;  2E2O A;  2YHB A;  4GNI A;  3CHW A;  3WEE A;  1NU0 A;  3HXM A;  3PLA A;  1TV6 A;  1J5O A;  3HK2 A;  4DSJ A;  1C0M A;  2ASO A;  4E7H A;  2GTD A;  3N4P A;  4DFP A;  3O3F A;  2WTU A;  4FK4 A;  3AAR A;  3ZX2 A;  4W5R A;  1RBR A;  3OYD A;  4U67 L;  1RTH A;  4JI7 K;  4A2B A;  2CH6 A;  1NJW A;  1ATN A;  1D5A A;  1MA9 B;  2RKI A;  4CF2 A;  4M7X A;  4RCH A;  4KH4 A;  1T6C A;  2QW9 A;  5FPE A;  2CH5 A;  4EIA A;  2GWK A;  4EZ9 A;  4X64 K;  3T19 A;  3LM9 A;  3V9Z A;  4FJG A;  4WFB L;  4H8K A;  4CBW A;  2JWL A;  1QQM A;  1IKV A;  5C25 A;  2Y1J A;  4EP4 A;  2W40 A;  2UYT A;  4RTF D;  1GLA G;  2D0C A;  5EU7 A;  2BE2 A;  3IS9 A;  4KHW A;  4BR2 A;  4DTR A;  3ULE A;  1VQ8 N;  1DTT A;  4BR0 A;  2VGN A;  2OPS A;  1C6V A;  3H45 C;  3HSC A;  4AHC A;  4BG8 A;  5HRN A;  4OJR A;  3QEV A;  4ELT A;  4ELU A;  2ZM6 K;  3FFK B;  4BRG A;  3THX A;  3QFU A;  4CHY A;  3SCX A;  4NXM K;  2YNG A;  2QKB A;  1NK9 A;  3DLB A;  1HKC A;  5AQR A;  3HST B;  4CFD A;  3CCE N;  3CJB A;  4BE2 A;  1WBB A;  1CZB A;  3KK1 A;  4JV5 K;  1VAZ A;  1NGC A;  4AH9 A;  3VF2 A;  4E19 A;  3MX5 A;  1EP4 A;  4LY7 A;  2GBZ A;  3HTV A;  4OO1 J;  2PAV A;  2F9W A;  5M1P A;  1TUU A;  3QET A;  2UXC K;  4CJE A;  4KRE A;  3RR7 A;  5F0X A;  4H0P A;  3NVK A;  3LDL A;  3O4N A;  3EE8 A;  3CM6 A;  4DTU A;  2BGG A;  1HMV A;  4IFY A;  1GLJ O;  4IWV A;  4B9L A;  1Q82 O;  5AQK A;  4WFA L;  1HRH A;  3DLK A;  3RMB A;  4IO8 A;  2W6K A;  3Q7B A;  1XHX A;  4B9N A;  5JLH A;  2A5X A;  4M3U A;  4CZF A;  2ETJ A;  5KQD A;  4WQ5 C;  4DV7 K;  3SJH A;  1I94 K;  3D7E O;  3H1V X;  3EY1 A;  4LF7 K;  2IVN A;  5FPD A;  3ZSQ A;  1HNW K;  2P9L B;  3A5L C;  4CEZ A;  2JLE A;  4FWR A;  3OYM A;  2X6N A;  3G0Z A;  3GG4 A;  4KTW A;  2QKK A;  1NM1 A;  4WYB A;  4H5N A;  3VQB A;  3R1X A;  4B8A B;  3AVC A;  4DQQ A;  3ZCM A;  3LWL A;  4AHS A;  2P9N A;  1H1V A;  1JLB A;  1D9D A;  1V4S A;  2ZJP L;  5LL6 Z;  2UXB K;  4FWL A;  5AQZ A;  1C0F A;  1XUP O;  4FM0 A;  3EO3 A;  4IFE A;  3GOI A;  2ZJQ L;  3F73 A;  1D8Y A;  2RE2 A;  2F7T A;  2UUA K;  3O4W A;  5HLF A;  5AZJ B;  3LDP A;  4I6M A;  2BH1 A;  2VWJ A;  4DQR A;  3OYK A;  1XC3 A;  3HP6 A;  4OPJ A;  2O8D A;  2YHX A;  3SJJ A;  3LP0 A;  2E2Q A;  2AJQ A;  4CCH A;  4DUZ K;  1VQL N;  3DXK B;  3HT3 A;  3FZH A;  1LWF A;  1YJ9 N;  1KRP A;  3JSM A;  2YJF A;  5FRM A;  4RW9 A;  1LW0 A;  4WCE L;  1VSD A;  3HPG A;  3O9R A;  2QK9 A;  3CCJ N;  4EFH A;  4YNQ A;  3H08 A;  1I3A A;  1ZBS A;  1YT3 A;  3ENB A;  4WQ5 A;  1BU6 O;  3AGR A;  4H5R A;  1BCO A;  5KPZ A;  1XI1 A;  2HBL A;  2V51 B;  5AQI A;  4DLE A;  3EYZ A;  4FPB A;  2XY5 A;  4CK3 A;  1SQK A;  3HO1 A;  4BG9 A;  1LAV A;  3P39 A;  3OYA A;  4IOC L;  4GV3 A;  3RMA A;  1NNE A;  4DR4 K;  1KTQ A;  4EP5 A;  1BIS A;  3CPW M;  4FSV A;  5JS2 A;  2O8C B;  1QSS A;  1VRT A;  3NVM A;  4KV8 A;  4M3R A;  3TTD A;  3UIQ A;  1WSE A;  4DF8 A;  1REV A;  3MXM A;  4ID1 A;  4JRQ A;  5JS1 A;  3E66 A;  4CZI A;  4KHU A;  4C8K A;  5HP1 A;  3S3O A;  4IJA A;  3L2R A;  5DM6 L;  4FJL A;  2DFE A;  5LJV A;  3HJF A;  4JK7 A;  3TPQ A;  2OTL N;  5CYQ A;  3M5R A;  3LP3 A;  3TAE A;  3PSF A;  5KRT A;  3CPE A;  2PBD A;  3VOV A;  1UA1 A;  2Z1H A;  5C15 A;  4JI0 K;  3EL2 A;  4B1Y B;  3FZK A;  1ATS A;  3C6U A;  2FLO A;  4O8K A;  3ZET A;  3ZYY X;  4XH5 A;  4B1U B;  3AVB A;  1U47 A;  3WNH A;  1VSK A;  4H0Y B;  4MLH A;  4XH1 A;  1TL1 A;  3WXI A;  3AVG A;  1EKE A;  4IG3 A;  3ZSO A;  3ATV A;  2Q2R A;  4E0D A;  3M1F A;  1B92 A;  1WSF A;  4CE9 A;  4KHP K;  2H3G X;  1T8E A;  3AA4 A;  2OPQ A;  1IG8 A;  3A5M C;  5AQS A;  3L2Q A;  2YV0 X;  1WSH A;  3B6O A;  4E7I A;  3AVN A;  3I33 A;  2ZQB A;  3TAQ A;  5IWA K;  3CME N;  3AVJ A;  4HCB A;  3GE1 A;  1NGB A;  3O4Q A;  4YHH K;  1XWL A;  4YOW A;  4FJI A;  1JJ2 M;  4CEF A;  2Y1I A;  3J7Z O;  2KZZ A;  4L3Q A;  4LC9 B;  1XC9 A;  1C1A A;  4Y0W A;  2HF4 A;  4DTP A;  4CJV A;  3RSE A;  3AO3 A;  5FRO A;  5T7B A;  1YAG A;  3H46 O;  3WXJ A;  4PL7 A;  4B3M K;  2G8V A;  1NK4 A;  4BRE A;  4TSX A;  4JKG A;  2DFH A;  5CY4 A;  4CK1 A;  4Z4E A;  1HQU A;  4JKC A;  3CQ8 A;  3SUP A;  4DSI A;  4B9T A;  3LP1 A;  4CZL A;  4GVM A;  2P5G A;  4DR1 K;  3L2W A;  3V4I A;  3SBT A;  3QEP A;  3ULD A;  4Z4C A;  5BR9 A;  1RBU A;  2UUC K;  3OHR A;  1NK5 A;  4GVE A;  2XHB A;  3ZSW A;  3BF1 A;  4A2A A;  3THV A;  1TK8 A;  1OVQ A;  3OYN A;  3U6F A;  2FBV A;  5AZI A;  4C1N I;  3HVT A;  3LPU A;  4AHV A;  2XO7 A;  5I3U A;  3IUC A;  3G4S N;  2NUB A;  3IRX A;  1HNZ K;  5EOY A;  3ENH A;  4JRP A;  3GDQ A;  1S3X A;  4KH6 A;  3CCQ N;  4B1W B;  3SQ1 A;  1IO2 A;  3KJV A;  3O3H A;  1HR0 K;  4DQI A;  1ZBF A;  4FLZ A;  1BI4 B;  1ZBL A;  1LAW A;  4FJX A;  4DQP A;  4FWQ A;  1X9J A;  4IKF A;  3TAM A;  1W7A A;  3KVG A;  4CZH A;  3QEI A;  3PO5 A;  4IO9 L;  4FWM A;  3R3L A;  1T05 A;  4BRA A;  4C8O A;  1C0U A;  3KWI A;  4H0T B;  2E2P A;  3CFP A;  2P9U B;  1YTU A;  4MQ3 A;  5KQ8 A;  2P9I B;  1HJR A;  4FLY A;  1J53 A;  3DYA A;  4E3S A;  2AP1 A;  3O1B A;  1Q86 O;  3TR8 A;  5HRR A;  1S72 N;  2F9T A;  4FW1 A;  3CCV N;  1S9G A;  1WBD A;  4FZZ A;  4CF1 A;  4JI8 K;  1LW2 A;  4L8R B;  4LSN A;  3QB0 A;  4AM6 A;  5M1K A;  4PWD A;  3SBG A;  4BRI A;  2OPR A;  4DSF A;  3VGK A;  3WNF A;  2NRV A;  4JD2 B;  4FWK A;  5GAG P;  3HM9 A;  3KTQ A;  3C65 A;  1JLC A;  4O55 A;  1JLE A;  3HM8 A;  2B6A A;  2E1Z A;  4KB1 A;  1C0G A;  1XQS C;  2V7Y A;  4H4M A;  4B8C A;  1QSY A;  1NGJ A;  1SL0 A;  1VSJ A;  2P9K B;  1NGH A;  3HPO A;  2PFU A;  5GAD P;  1RBT A;  3U9D A;  1OVY A;  1BCM A;  3TAB A;  4BWM A;  3L3U A;  3VMF B;  3K58 A;  3V9W A;  2E2N A;  4N41 A;  3PSI A;  2FF3 B;  4FWP A;  4M63 C;  2HST A;  2XY7 A;  1JCE A;  3MED A;  4FLV A;  2UU9 K;  1RT5 A;  2HHX A;  1CZ9 A;  3DLG A;  2BAN A;  3KLF A;  3CCU N;  1T6D A;  5AJ3 K;  4O0I A;  4DU4 A;  1X9W A;  3HYF A;  3ID6 A;  2RF2 A;  3CFO A;  3FLC O;  3O9S A;  4JKA A;  1JCG A;  4DV2 K;  1RT7 A;  1SV5 A;  3MN6 A;  4RG8 A;  3CD6 N;  3SYZ A;  3PO4 A;  4ZTF A;  4FCY A;  1VSH A;  1M90 O;  1TYQ A;  2WFB A;  2P5O A;  5I9E B;  1JCF A;  2BUP A;  3VF4 A;  3ZSR A;  3TI0 A;  4M42 A;  4CIE A;  5JLF A;  4A57 A;  3ZT2 A;  5AQQ A;  4A62 A;  1RNH A;  5C0Y A;  3N4Q A;  1F21 A;  4HVJ A;  3VER A;  3U3G A;  1VSF A;  4JI2 K;  4CJW A;  4GW6 A;  3SLC A;  1ASW A;  5GAE P;  4DSK A;  4KI4 A;  2IDO A;  5LY3 A;  4CD3 A;  3S41 A;  1KFS A;  4G9Z A;  3M8P A;  4WE1 A;  4LH4 A;  1TK5 A;  3S9H A;  1TVR A;  5AR0 A;  1DEJ A;  5AQF A;  1U49 A;  4LF4 K;  2YX6 A;  1IBM K;  3C7N A;  2O8F B;  1RFQ A;  4JKE A;  3DMJ A;  5FPM A;  4CZE A;  1RTJ A;  4DSE A;  4E1N A;  1MU2 A;  1SAZ A;  4DS5 A;  3LDN A;  3C6H A;  5M1Q A;  1BL3 A;  1XMO K;  3FZL A;  3RRH A;  1RCH A;  3F9K A;  1DGK N;  2P1J A;  1BG3 A;  4CD1 A;  2X78 A;  2HOE A;  4XH4 A;  3ZX3 A;  4R5P A;  3CQY A;  3IG1 A;  1FW6 A;  3OBY A;  4YOX A;  5FRN A;  2JGU A;  3D2E B;  3DLE A;  4FXD A;  5M1N A;  3NAE A;  1RT2 A;  1VQ5 N;  1SKS A;  4DR5 K;  4C1N K;  4HUF A;  4CJ5 A;  3QEX A;  4KTZ A;  3AA2 A;  4J2D A;  4LF6 K;  1L3T A;  3TSU A;  1GLC G;  3AVI A;  4B3O A;  3ZT3 A;  1KAX A;  3LDO A;  2GUI A;  4GY2 B;  4ELV A;  2NRW A;  3D6R A;  4CJK A;  4PHT X;  1KC8 O;  2HBM A;  4CZK A;  4FYD A;  4KHS A;  2VQF K;  1N36 K;  3BGR A;  4JN4 A;  2FBY A;  3LWM A;  2W41 A;  4DCH A;  4PKI A;  2VYP A;  2G8W A;  2HB5 A;  4LFC K;  3V9X A;  3THY A;  2VWB A;  5BR8 K;  4DTM A;  4F2R A;  4RW4 A;  5M1F A;  1NKB A;  5EVZ A;  3C95 A;  3LM2 A;  3DRS A;  5GIN A;  3QIO A;  1KD1 O;  3O9T A;  1HKG A;  3J7A P;  4AIL C;  5BRF A;  1HLU A;  1NGA A;  4Z4I A;  3DOK A;  4CGG A;  4N47 A;  3J8A A;  4CJL A;  3AA3 A;  4JI5 K;  1CXU A;  2P9N B;  3M8S A;  3SPZ A;  1ZXO A;  3V1Q A;  2R7Y A;  3QNN A;  4DKW A;  2P9S A;  4JAX A;  3CCM N;  4HTL A;  5BPM A;  5FLX O;  1TAU A;  5M1O A;  2A1R A;  4OVL A;  2AA4 A;  5AQU A;  3U8X A;  1KAY A;  4FJK A;  1OH5 A;  4PY5 A;  1E3M A;  4ICL A;  5AQW A;  3QDK A;  2WON A;  3PX4 A;  3HBT A;  4I6M B;  4WQ4 A;  2ITM A;  4CK2 A;  4CFC A;  3ZT4 A;  4B9S A;  4ZTJ A;  1RT1 A;  3OS2 A;  4EZ6 A;  4DV4 K;  4F3O A;  3QLH A;  3QBW A;  3DM2 A;  3SQ2 A;  2OYQ A;  1S1W A;  3M3Z A;  1N34 K;  5AQN A;  4UQG A;  3QO9 A;  5HOO A;  1JLA A;  5C2F A;  2HHQ A;  1TKT A;  4CI6 A;  5C10 A;  2FSK A;  2KLA A;  1NWK A;  1JXE A;  2DPN A;  4YOV A;  2Q3S A;  2E20 A;  4BE1 A;  3Q7C A;  4MO5 A;  1VK0 A;  3SPY A;  4H5T A;  2A6A A;  3HPH A;  2ZF5 O;  2G8K A;  1WSJ A;  5BN8 A;  4M7Y A;  1JL1 A;  3OYF A;  1BA1 A;  4HTU A;  4CF9 A;  1K6Y A;  1VRU A;  4JI3 K;  2Z1G A;  4F3T A;  4ILJ A;  1A5V A;  4LF8 K;  3RRG A;  4CJP A;  1KAZ A;  2YHY A;  3K5M A;  3THW B;  3ASM A;  2CGK A;  1N6Q A;  4M3T A;  4KO0 A;  1M1K O;  1OKJ A;  1I39 A;  1SL2 A;  1SKR A;  1K73 O;  1J5E K;  4B3R K;  5AFU H;  1IKW A;  5HBM A;  3A2F A;  3JAM O;  1U2V A;  1J9A A;  1IKY A;  2YHA A;  4JS4 A;  3R9P A;  2FSJ A;  5AFU A;  1YJN N;  4H4O A;  2QWN A;  3MEC A;  1KXP A;  2WBN A;  2X6S A;  1T44 A;  3ZEU B;  3BUZ B;  3VPZ A;  3VEX A;  1Q9X A;  2OZS A;  1QS4 A;  3AO4 A;  3G10 A;  4M41 A;  2E5L K;  3DLH A;  4MFB A;  5BRH A;  3B6P A;  3CYM A;  4EHU A;  3SUN A;  3TSQ A;  2ZGY A;  3T1A A;  4PA1 A;  3NF6 A;  3CFR A;  4O8U A;  4U7B A;  3O9U A;  5C24 A;  1W0H A;  1HYV A;  3CXC M;  3LP2 A;  1UOC A;  3TAG A;  4HUG A;  3K2P A;  4C23 A;  3VES A;  3NGI A;  4JEP A;  1FKO A;  1WUA A;  1VSE A;  3NH1 A;  2HF3 A;  2ZWH A;  2HHH K;  1G15 A;  3H1Q A;  3SI6 A;  4AQY K;  3AV9 A;  2VG6 A;  1BA0 A;  1U48 A;  1NBW A;  2P9L A;  1FJG K;  4PKH A;  3OYI A;  4B3T K;  4M3Z A;  1Y64 A;  1TL3 A;  2LSN A;  3SUO A;  4W5N A;  4JKH A;  3AA5 X;  4JYA K;  1Q7Y O;  5FDL A;  4Y1C A;  3RSE B;  1NJX A;  3DXM B;  2HBK A;  2ZD1 A;  2A1S A;  1EX4 A;  2IOC A;  1IH7 A;  3J81 O;  5CYM A;  4DR7 K;  4QS8 A;  4KH5 A;  4E1M A;  1RDU A;  2WC9 A;  3VEY A;  4V19 S;  1HNX K;  4DV0 K;  3O8M A;  2HHT A;  3F5T A;  3NMU A;  4JKG B;  3AVM A;  1U04 A;  3UKR B;  2PZS A;  4QS7 A;  5BPL A;  4FJ9 A;  4CGD A;  4YOU A;  4AHU A;  3QIN A;  5BN9 A;  3AVA A;  1ZBU A;  4A5B A;  3AVL A;  1NJZ A;  2RN2 A;  4K43 A;  2O8B B;  2G8U A;  1S9E A;  3A0I X;  2YNF A;  4DFM A;  1WOQ A;  2W42 A;  4HCC A;  3DLR A;  3PUF A;  1ZC6 A;  2QWO A;  4CED A;  4CES A;  3EKS A;  3JS6 A;  4DHY A;  1XNR K;  3KKS A;  4DWI A;  3RWU A;  3LL3 A;  3PIO L;  4ISF A;  4NXN K;  3VQ8 A;  4AHT A;  4E1J A;  1OH7 A;  3DRR A;  2IVO A;  2YNH A;  2P9P B;  3QBX A;  3V6D A;  3SUQ A;  5JIC A;  4I2Q A;  1EET A;  2A40 A;  2OAN A;  3VF6 A;  3NHG A;  1X3N A;  4CJT A;  3ALY A;  4EAH D;  4BE0 A;  5DMR A;  1NK8 A;  4OGC A;  2GUP A;  3V9U A;  1Z05 A;  3BDP A;  5C42 A;  4Z4G A;  1S1X A;  4CJ3 A;  3NF9 A;  1P8Z A;  5KTQ A;  3E9L A;  4CJ7 A;  3QES A;  3DJC A;  4W5T A;  3OS0 A;  2VQE K;  1VQ6 N;  1A5W A;  2FBX A;  4IZ9 A;  4HHT A;  4JNE A;  3RTV A;  4FLT A;  5C12 A;  3W3D A;  4FL9 A;  3RR8 A;  4KI6 A;  3TTC A;  4LFB K;  5KI6 A;  3P83 D;  2KHO A;  3DLL L;  3QML A;  4DFJ A;  4NCA A;  4G1Q A;  2E6L A;  3OY9 A;  4M3W A;  3B8A X;  4F8R A;  4I7F A;  4BR5 A;  2QXF A;  2W6L A;  3VA3 A;  1G99 A;  5HRO A;  1QSL A;  4WF9 L;  1ZBI A;  4OGE A;  2E8A A;  3I0S A;  4K8Z A;  1N32 K;  3WQU A;  4GKK K;  2X74 A;  5TKY A;  2VG5 A;  4CGF A;  1JLQ A;  3I56 N;  4FLW A;  2O8E B;  4IEE A;  4IEI A;  1UAX A;  5AQL A;  1EWQ A;  4BC3 A;  4NYN A;  1HYZ A;  1VQK N;  1MWK A;  1RT3 A;  3CG7 A;  3OYG A;  4BGA A;  4H0V B;  1O1W A;  4BDY A;  4OX9 K;  4BRC A;  2E88 A;  1NGE A;  1JLF A;  3NBP A;  2UUB K;  3D45 A;  1C1B A;  4DQS A;  1P90 A;  1C1C A;  3MAQ A;  1QZ5 A;  4IFV A;  4DG1 A;  4O0J A;  1J6Z A;  3IKM A;  3AVF A;  1T03 A;  5F1X A;  4IBN A;  4X65 K;  4FJH A;  3VQD A;  4CHO A;  3O6W A;  3NFA A;  1L3S A;  1TK0 A;  2QWP A;  4KHN A;  1FK9 A;  1NGI A;  3CER A;  4KAZ A;  4FJN A;  1LCU A;  2DTU A;  2V52 B;  4CZM A;  3VEO A;  3RMD A;  1BDG A;  5LMU K;  4W5O A;  2I7P A;  3CJ1 A;  4LD0 A;  3E9O A;  3D2F B;  4O5F A;  1TUY A;  4BRH A;  3H3O B;  4DTN A;  3LAM A;  2YHW A;  4N5S A;  4CHN A;  1W97 L;  1YVU A;  4FVU A;  3SV4 A;  2JWK A;  4K0K K;  1NGG A;  3T3F A;  2HHU A;  4CEE A;  5SWM A;  3MN5 A;  4O44 A;  3VTI A;  2FXU A;  4IDH A;  4ILH A;  1YJW N;  1YTA A;  4CBU A;  4Z4H A;  5AQH A;  3NGZ A;  3QIP A;  1KSP A;  4K8X A;  3TWH A;  3GL1 A;  4DSL A;  2E6M A;  3ZLJ A;  3SAH A;  2Q0R A;  3KHY A;  2YI1 A;  4JLH A;  4KBO A;  4IXC A;  2NRX A;  3WUH A;  5AQY A;  5H1S Q;  2OPP A;  5HL7 L;  3P4I A;  4JHD B;  2HBJ A;  2QEX N;  2NLX A;  1A5X A;  4FWO A;  1NKE A;  1EO1 A;  5A2Q O;  1Z26 A;  2ASM A;  3IFR A;  4LH5 A;  2NRR A;  3P31 A;  3C7N B;  3FZM A;  3NF8 A;  1DKG D;  1VQP N;  3BZC A;  3L0Q A;  1RTI A;  3SNN A;  1EQY A;  5B8H A;  1BWF O;  1NLV A;  2QWM A;  1IG9 A;  3AVH A;  1YXQ A;  4ISE A;  4B1X B;  1K8K B;  3OYB A;  1QTM A;  1IJJ A;  3WEE B;  4H5W A;  4B9Q A;  3MK6 A;  5ELZ A;  3C6T A;  3DRP A;  3SK3 A;  1NOY A;  5ADX H;  1WAF A;  3CMA N;  3F2K A;  1NG9 A;  3A5O C;  3P1G A;  4RW6 A;  2P9U A;  2IIR A;  5JVG L;  4FK0 A;  4ZHR A;  4C8M A;  5CE3 A;  2A3Z A;  2QTD A;  1WB9 A;  2P9I A;  3D0P A;  1ATR A;  2QWR A;  3KIO A;  4CHZ A;  1QQN A;  4FO0 A;  3AGK A;  2EX3 A;  3CET A;  4NCG A;  3ITH A;  3AO1 A;  2GEL A;  3TAP A;  2Q97 A;  1YI2 N;  4ISG A;  2EWS A;  1KVB A;  4BQL A;  4AF1 A;  3IDH A;  1RDB A;  2PYJ A;  2HND A;  1NMN A;  2VWK A;  1YIT N;  3VQ6 A;  5DM7 L;  4J8F A;  4JD2 A;  1BUP A;  4GV6 A;  1S6Q A;  4DTS A;  5MLC Q;  2IC3 A;  1KVC A;  1S22 A;  1Y97 A;  2FSN A;  4UY8 O;  3THY B;  3K57 A;  4OPK A;  3ULE B;  4KPY A;  3C94 A;  2XY8 A;  4XEI A;  2P9K A;  1RT6 A;  4E7L A;  5EY4 A;  2E4L A;  4DF4 A;  1LV5 A;  4AHR A;  1NK6 A;  4DV1 K;  2J4R A;  1X3M A;  3THX B;  3CC2 N;  3V9S A;  2DFF A;  4KB0 A;  3G25 A;  5I42 A;  1E4G T;  5J2P A;  1V4T A;  4F4K A;  4BQZ A;  3L8B A;  4IDK A;  3O9Q A;  4MDA A;  2HVI A;  1WNS A;  2GEM A;  3VGL A;  2DY4 A;  4R79 A;  4B9M A;  3QER A;  1NOZ A;  3T1H K;  1S1T A;  1LWE A;  1VQ7 N;  4JI6 K;  4CJ4 A;  4X66 K;  3P5J A;  3UKU A;  4WQ4 C;  4CIF A;  1GLE G;  4X62 K;  3K0S A;  1MWM A;  4J2B A;  3S3M A;  4BWJ A;  2HNZ A;  3KK2 A;  2GWJ A;  3QNO A;  4B3S K;  4E7J A;  5AQT A;  4JK8 A;  2F96 A;  1VSM A;  4LF9 K;  5F2R A;  3LDS A;  3NH2 A;  1Q9Y A;  3OW2 M;  1RBS A;  1S6P A;  3NE6 A;  2YKN A;  4MO4 A;  5CHI A;  4CEC A;  3UB5 A;  4DR2 K;  1KQS M;  4BRL A;  2YJE A;  4AM7 A;  1JKH A;  1NJY A;  4K41 A;  2GX9 A;  4CBX A;  5EXW A;  3OYJ A;  3WNE A;  4CEQ A;  1S1V A;  3ZX0 A;  1XMQ K;  1RBV A;  3H6E A;  2RHK A;  4CW7 B;  4BC5 A;  5BPN A;  4MLE A;  3LZJ A;  5GAH P;  4BY9 C;  4RWT A;  3VQ5 A;  2O8F A;  4B08 A;  4DLG A;  1LOT B;  3K5N A;  3MEG A;  3OJU A;  4FWS A;  3EKU A;  1RIL A;  2CGL A;  2XRI A;  2KFZ A;  4CEO A;  4IJN A;  4GV9 A;  4H03 B;  3MN7 A;  4H5V A;  4J2E A;  5HRP A;  2D0O A;  3PX6 A;  3KK3 A;  1U45 A;  3M8R A;  3CQX A;  1U2V B;  4IOX A;  2HHS A;  4MDB A;  4Z94 A;  3VET A;  4B9U A;  1BIU A;  4RW7 A;  3V81 A;  1QQO A;  2V7Z A;  1L3V A;  1HX1 A;  3NDK A;  2I5J A;  1HQE A;  3FR0 A;  4FM1 A;  4FZX C;  4JI1 K;  4F2S A;  3D2E A;  3IMX A;  4BC2 A;  5JMV A;  2A41 A;  3O80 A;  1GLL O;  3OYE A;  4NYF A;  1GOA A;  4A5A A;  3KLE A;  2NRZ A;  1SKW A;  2HHW A;  2NNW A;  4BR4 A;  4CJQ A;  5LJW A;  1U6Z A;  2IS3 A;  1HNI A;  4DTX A;  2O8D B;  1NKC A;  4BVO A;  4FLX A;  3H3N O;  3SV3 A;  1T7P A;  4LF5 K;  4K42 A;  3G71 N;  3MXJ A;  2NRT A;  3V1R A;  3U4L A;  4Y1D A;  2QXL A;  5LMN K;  4DV5 K;  4N56 A;  5EX5 A;  1TKZ A;  1BOT O;  3VEZ A;  4O4G A;  5SZT A;  1ZBH A;  1N8R O;  3ZSX A;  3OYC A;  4QCL A;  3HI0 A;  2O4G A;  4FZY A;  5E84 A;  1S1U A;  2WUS A;  5KPT A;  3CJA A;  1UWB A;  5J1E A;  3SZ2 A;  1R59 O;  1TKD A;  3CC7 N;  3OJS A;  4CIG A;  4I2P A;  2PYL A;  1QE1 A;  2YNI A;  1X9M A;  4Z4F A;  5GIP A;  2FBT A;  2KFN A;  4CHP A;  2F4V K;  1Q18 A;  1WLJ A;  3C6A A;  4KFB A;  1TAQ A;  3SAF A;  1K9M O;  1O13 A;  3VQE A;  4E89 A;  1SS6 A;  3KK7 A;  5KPR A;  2OZM A;  4BR9 A;  2FC0 A;  3RVC A;  1U4B A;  2D4W A;  1GLF O;  1GLD G;  4FJ5 A;  1RDC A;  2Q31 A;  3ISN C;  2QM1 A;  3WXK A;  3R8E A;  4BRQ A;  3JXU A;  4HUE A;  1NMD A;  5KGX A;  4DTO A;  3AO5 A;  5D3G A;  4DV6 K;  3QEW A;  3ZT1 A; 
#chains in the Genus database with same CATH homology
 1BCM A;  3TAB A;  1B9D A;  4DMN A;  5KTQ A;  2BDP A;  1LWC A;  4BWM A;  3L3U A;  3V9W A;  3K58 A;  3QES A;  3SQ0 A;  4N41 A;  4RW8 A;  4W5T A;  3OS0 A;  1NK0 A;  1A5W A;  2FBX A;  4EZ9 A;  3ZSZ A;  1BHL A;  3T19 A;  4HHT A;  3V9Z A;  4FJG A;  3NCI A;  1QHT A;  4O5B A;  4H8K A;  1BQN A;  4FLT A;  3RTV A;  1IKV A;  5C25 A;  2XY7 A;  4EP4 A;  2Y1J A;  3RR8 A;  4KI6 A;  3MED A;  2EHG A;  3P83 D;  2D0B A;  5KI6 A;  4FLV A;  3KD5 E;  4DFJ A;  1RT5 A;  2D0C A;  5EU7 A;  2HHX A;  2BE2 A;  1XHZ A;  1CZ9 A;  4NCA A;  4G1Q A;  3IS9 A;  3DLG A;  2E6L A;  2BAN A;  3I8D A;  4KHW A;  3KLF A;  5CZ2 A;  4DTR A;  3OY9 A;  3TAN A;  4M3W A;  1DTT A;  4F8R A;  4I7F A;  4O0I A;  2OPS A;  4DU4 A;  1C6V A;  4AHC A;  5HRN A;  2QXF A;  5HRO A;  3E01 A;  3HYF A;  4OJR A;  3VA3 A;  3QEV A;  1X9W A;  4ELU A;  2RF2 A;  3CFO A;  1QSL A;  3VQC A;  4M45 A;  1ZBI A;  5J2Q A;  4OGE A;  1RT7 A;  1SV5 A;  4RG8 A;  3I0S A;  3O3G A;  3SYZ A;  5J2N A;  4K8Z A;  4CHY A;  1DTQ A;  4ZTF A;  3FFI A;  3SCX A;  3PO4 A;  2YNG A;  1VSH A;  4FCY A;  1NK9 A;  2QKB A;  5HRS A;  2P5O A;  2X74 A;  3DLB A;  2VG5 A;  3HST B;  1W9H A;  3WNG A;  4CGF A;  1KVA A;  4CFD A;  3L2U A;  2VG7 A;  1JLQ A;  3ZSR A;  3TI0 A;  1JXB A;  1RTD A;  4M42 A;  4FLW A;  4CIE A;  3ZT2 A;  4BE2 A;  4CJU A;  1UAX A;  3NGY A;  4DU1 A;  4NYN A;  4CJR A;  2WOM A;  1HYZ A;  1RNH A;  1HNV A;  1RT3 A;  3CG7 A;  2ZE2 A;  3OYG A;  4BDY A;  1O1W A;  1F21 A;  1CZB A;  3KK1 A;  4HVJ A;  1JLF A;  1VSI A;  3NBP A;  4AH9 A;  5JS1 A;  3U3G A;  3D45 A;  1C1B A;  1VSF A;  4CJW A;  4DQS A;  4QAG A;  4FW2 A;  4OKK A;  4E19 A;  1C1C A;  1EP4 A;  3MAQ A;  1S5J A;  4GW6 A;  1ASW A;  3K5O A;  4LY7 A;  4CER A;  2GBZ A;  4DSK A;  4KI4 A;  3QET A;  3KD1 E;  2IDO A;  4IFV A;  4DG1 A;  4OKJ A;  4O0J A;  4CJE A;  4KRE A;  1KFS A;  3AVF A;  4BAC A;  1T03 A;  3CM5 A;  4IBN A;  3M8P A;  4WE1 A;  4CGJ A;  3U3Y A;  3RR7 A;  4LH4 A;  4FJH A;  3VQD A;  1TK5 A;  4CHO A;  3NFA A;  3O4N A;  3S9H A;  1TVR A;  1NK7 A;  1L3S A;  1TK0 A;  3CM6 A;  3VQP A;  4DTU A;  2BGG A;  4KHN A;  1FK9 A;  1U49 A;  1HMV A;  4IFY A;  3ZT0 A;  4FJN A;  4KAZ A;  4FJM A;  3OS1 A;  2DTU A;  4B9L A;  1HRH A;  3DLK A;  3RMD A;  3RMB A;  3NF7 A;  1WAJ A;  4W5O A;  4I9L A;  1XHX A;  4LD0 A;  3DMJ A;  4B9N A;  1RTJ A;  4DSE A;  4E1N A;  4M3U A;  1MU2 A;  4DS5 A;  2ETJ A;  1BL3 A;  4DTN A;  3LAM A;  3RRH A;  1RCH A;  4CF8 A;  4N5S A;  1SUQ A;  4CHN A;  3F9K A;  2P1J A;  3EY1 A;  1YVU A;  1IKX A;  5J2M A;  3ZSQ A;  3SV4 A;  2X78 A;  3T3F A;  2HHU A;  4CEE A;  4CEZ A;  5SWM A;  2B4J A;  3V1O A;  2JLE A;  4DU3 A;  4R5P A;  1WSI A;  3IG1 A;  4O44 A;  3OYM A;  2X6N A;  3G0Z A;  4KTW A;  5FRN A;  2JGU A;  2QKK A;  3DLE A;  4FXD A;  1ZYQ A;  1YTA A;  2IAJ A;  4Z4H A;  4FJJ A;  3NAE A;  3NGZ A;  5CZ1 A;  3MEE A;  1RT2 A;  1ITG A;  3QIP A;  1SKS A;  1KSP A;  4K8X A;  3TWH A;  4DSL A;  1GOB A;  3LAN A;  2E6M A;  4HUF A;  3VQA A;  4CJ5 A;  4DFK A;  1N5Y A;  3QEX A;  3VQB A;  1SL1 A;  4KTZ A;  1JL2 A;  3AA2 A;  4J2D A;  1L3T A;  4Z0U A;  4B8A B;  4JLH A;  3AVI A;  3AVC A;  4B3O A;  4DQQ A;  3ZCM A;  3LWL A;  4AHS A;  1R0A A;  2YKM A;  3DI6 A;  1VSL A;  3ZT3 A;  2GUI A;  1JLB A;  2OPP A;  2Z1J A;  1D9D A;  4ELV A;  1WSG A;  4CJK A;  1D9F A;  1A5X A;  4CJ3 A;  1NKE A;  5KRS A;  3OYH A;  3LAK A;  4FM0 A;  1Z26 A;  4FYD A;  4KHS A;  4LH5 A;  4CJS A;  3BGR A;  3NF8 A;  1X9S A;  1KFD A;  1TGO A;  1RTI A;  3F73 A;  3SNN A;  2FBY A;  1D8Y A;  3LWM A;  5HLF A;  4DS4 A;  2P51 A;  1IG9 A;  2G8W A;  3AVH A;  2HB5 A;  2VWJ A;  4DQR A;  3OYK A;  3OYB A;  4JS5 A;  1QTM A;  3V9X A;  3HP6 A;  4OPJ A;  3SJJ A;  3K5L A;  1X1P A;  2GV9 A;  3LP0 A;  3NH0 A;  2AJQ A;  4DTM A;  4F2R A;  4CCH A;  4RW4 A;  3C6T A;  3DRP A;  3HT3 A;  1NKB A;  1LWF A;  1NOY A;  3C95 A;  1KRP A;  1BIZ A;  4ELT A;  4QCL A;  3DRS A;  1WAF A;  3QIO A;  4CF2 A;  4CJF A;  3TAF A;  3P1G A;  4RW6 A;  3JSM A;  5FRM A;  2KW4 A;  4RW9 A;  1LW0 A;  4FK0 A;  4ZHR A;  1B9F A;  1VSD A;  4C8M A;  4PQU A;  3HPG A;  4AIL C;  2QK9 A;  3VN5 A;  3D0P A;  3KIO A;  4YNQ A;  3MXI A;  4CHZ A;  3H08 A;  1I3A A;  3DOK A;  4IG0 A;  4Z4I A;  4CGG A;  1EXQ A;  4N47 A;  1YT3 A;  2EX3 A;  1QQC A;  1BCO A;  1XI1 A;  4NCG A;  3ITH A;  4CJL A;  3AA3 A;  3AO1 A;  1CXU A;  3TAP A;  3M8S A;  4DLE A;  3SPZ A;  3EYZ A;  3V1Q A;  4XIU A;  2R7Y A;  3QNN A;  2XY5 A;  4Q0B A;  3RMC A;  5KGW A;  4CK3 A;  1KVB A;  3HO1 A;  4OKE A;  1LAV A;  2HMI A;  1RDB A;  2PYJ A;  2HND A;  1TAU A;  2VWK A;  3OYA A;  3RMA A;  4OVL A;  2A1R A;  1KTQ A;  4GMJ B;  4EP5 A;  3LAL A;  1CXQ A;  3IAY A;  3VQ6 A;  1BIS A;  5JS2 A;  4FJK A;  1QSS A;  2KTQ A;  1VRT A;  3OVN A;  4PY5 A;  4KV8 A;  4ICL A;  4M3R A;  4YFU A;  4ID5 A;  3UIQ A;  2WON A;  1S6Q A;  3PX4 A;  1WSE A;  4DF8 A;  4DTS A;  1J54 A;  1REV A;  3MXM A;  4ID1 A;  2IC3 A;  3KKR A;  1KVC A;  4CK2 A;  3AO2 A;  4BDP A;  4CFC A;  4JRQ A;  1Y97 A;  3ZT4 A;  3K57 A;  4OPK A;  1UA0 A;  4C8N A;  4ZTJ A;  1RT1 A;  3OS2 A;  1BQM A;  3JYT A;  2D0A A;  2XY8 A;  3C94 A;  4EZ6 A;  4F3O A;  4KHU A;  4C8K A;  3QLH A;  1RT6 A;  3DM2 A;  1BGX T;  4E7L A;  3SQ2 A;  5HP1 A;  3S3O A;  2OYQ A;  1S1W A;  3L2R A;  2E4L A;  3VA0 A;  4M3X A;  4UQG A;  4DF4 A;  3QO9 A;  1LV5 A;  2DFE A;  4FJL A;  4CGH A;  4I9Q A;  4AHR A;  1C0T A;  1KLM A;  1JLA A;  3ZSV A;  1NK6 A;  3HJF A;  5CYQ A;  2D5R A;  2HHQ A;  3LP3 A;  3EZ5 A;  3TAE A;  4KRF A;  1TKT A;  5KRT A;  4N76 A;  1DLO A;  4FK2 A;  3V9S A;  4B9S A;  2DFF A;  1Q8I A;  4KB0 A;  1HYS A;  5I42 A;  1UA1 A;  2Z1H A;  4KTQ A;  3C6U A;  1JXE A;  2Z1I A;  4BDZ A;  4KHY A;  5J2P A;  3PX0 A;  2HHV A;  2Q3S A;  3AVB A;  1ASV A;  4BE1 A;  3L8B A;  4F4K A;  4KHQ A;  4IDK A;  1VK0 A;  1U47 A;  3WNH A;  1VSK A;  3SPY A;  3PY8 A;  2HVI A;  4FVM A;  1WNS A;  3HPH A;  2G8K A;  2DY4 A;  1WSJ A;  3LZI A;  1TL1 A;  3AVG A;  1TKX A;  1EKE A;  4IG3 A;  4DTJ A;  3ZSO A;  4B9M A;  2HW3 A;  3QER A;  4NCB A;  4E0D A;  1JL1 A;  1NOZ A;  3OYF A;  4CE9 A;  1B92 A;  1WSF A;  4CF9 A;  4HTU A;  1K6Y A;  1S1T A;  1LWE A;  3AA4 A;  1T8E A;  2OPQ A;  1VRU A;  4CJ4 A;  2Z1G A;  4F3T A;  1A5V A;  3P5J A;  3VQQ A;  4CIF A;  3K59 A;  3L2Q A;  4Q5V A;  3RRG A;  4LSL A;  4CJP A;  1RT4 A;  2YV0 X;  1WSH A;  3K5M A;  3LPT A;  4B9V A;  3B6O A;  4E7I A;  3ASM A;  3AVN A;  2ZQB A;  1N6Q A;  3TAQ A;  4CF0 A;  4KO0 A;  4M3T A;  3PV8 A;  4J2B A;  1I39 A;  1NJW A;  1SL2 A;  1SKR A;  3AVJ A;  3S3M A;  2O4I A;  1IKW A;  4FM2 A;  1WN7 A;  4BWJ A;  3VQ9 A;  4HCB A;  2HNZ A;  5HBM A;  3A2F A;  3O4Q A;  2ITG A;  3KK2 A;  1XWL A;  1J9A A;  3QNO A;  1IKY A;  4E7J A;  4FJI A;  3DOL A;  2YHA A;  4JS4 A;  2F96 A;  1VSM A;  4CEF A;  2Y1I A;  2KZZ A;  1XC9 A;  4CEA A;  3LDS A;  3NH2 A;  4H4O A;  1C1A A;  1Q9Y A;  1RBS A;  1S6P A;  3MEC A;  3NE6 A;  3KLI A;  2YKN A;  4CEC A;  1BI4 A;  2X6S A;  4DTP A;  4CJV A;  3AO3 A;  5FRO A;  1RDD A;  5T7B A;  4QOZ B;  1JKH A;  4FJ7 A;  1NJY A;  2G8V A;  1NK4 A;  1Q9X A;  4TSX A;  2OZS A;  2DFH A;  1QS4 A;  3AO4 A;  3G10 A;  5CY4 A;  4M41 A;  4CK1 A;  3OYJ A;  4Z4E A;  3DLH A;  1HQU A;  4MFB A;  4KKO A;  3CQ8 A;  3B6P A;  3CYM A;  3WNE A;  4CEQ A;  3SUP A;  4DSI A;  1S1V A;  3SUN A;  4B9T A;  3LP1 A;  3T1A A;  4GVM A;  4FJ8 A;  4PA1 A;  3NF6 A;  3CFR A;  2P5G A;  1RBV A;  2KZM A;  3L2W A;  3V4I A;  5C24 A;  3QEP A;  3ULD A;  4Z4C A;  1W0H A;  4J2A A;  1RBU A;  1L3U A;  3LZJ A;  1HYV A;  4M3Y A;  2RPI A;  3LP2 A;  1UOC A;  1NK5 A;  2XHB A;  3VQ5 A;  3ZSW A;  2G8F A;  3TAG A;  4HUG A;  1CLQ A;  3K2P A;  4B08 A;  4DLG A;  3K5N A;  3THV A;  1TK8 A;  3MEG A;  3OJU A;  3NGI A;  3OYN A;  3U6F A;  1FKO A;  1RIL A;  1VSE A;  2FBV A;  3NH1 A;  2XRI A;  4CFB A;  1G15 A;  3HVT A;  2KFZ A;  3LPU A;  3SI6 A;  4AHV A;  1KLN A;  4CEO A;  3AV9 A;  2KQ2 A;  2XO7 A;  4J2E A;  5I3U A;  2VG6 A;  5HRP A;  2PY5 A;  1L5U A;  2F8T A;  2NUB A;  3AVK A;  1U48 A;  3PX6 A;  3KK3 A;  1U45 A;  3IRX A;  3M8R A;  2HHS A;  3HP9 A;  4B9U A;  2G8I A;  4OLA A;  1BIU A;  4RW7 A;  4JRP A;  3V81 A;  2OA8 A;  3OYI A;  1FKP A;  4M3Z A;  4CGI A;  3S3N A;  1L3V A;  3NDK A;  1TL3 A;  2I5J A;  1HQE A;  2LSN A;  3SQ1 A;  1IO2 A;  3SUO A;  3VQ4 A;  3KJV A;  4CHQ A;  4E7K A;  4FM1 A;  4W5N A;  3O3H A;  4F2S A;  4FZX C;  3AA5 X;  2XY6 A;  4DQI A;  1ZBF A;  4FLZ A;  1BI4 B;  5FDL A;  1LAW A;  1ZBL A;  4FJX A;  4DQP A;  3OYE A;  4NYF A;  4Y1C A;  1NJX A;  1GOA A;  3KLE A;  2ZD1 A;  3ZSY A;  1SKW A;  2A1S A;  4C8L A;  2HHW A;  1EX4 A;  2IOC A;  4CJQ A;  4DTX A;  2IS3 A;  1HNI A;  1IH7 A;  3TAM A;  4IKF A;  5CYM A;  1JLG A;  1NKC A;  4E1M A;  1HPZ A;  4KPY A;  5DK5 A;  3QEI A;  4CFA A;  4FLX A;  3PO5 A;  2HHT A;  1GOC A;  3AVM A;  3HVR A;  3SV3 A;  4W5Q A;  1T7P A;  1T05 A;  4C8O A;  1U04 A;  2IGI A;  1C0U A;  2G8H A;  2ATQ A;  2PZS A;  3VQ7 A;  3MXJ A;  3V1R A;  3CFP A;  4Y1D A;  4FJ9 A;  4CGD A;  2HVH A;  4AHU A;  4N56 A;  1Z25 A;  3HL8 A;  3QIN A;  1YTU A;  3AVA A;  1TKZ A;  4MQ3 A;  3SQ4 A;  1ZBU A;  4O4G A;  5SZT A;  1ZBH A;  3AVL A;  3ZSX A;  3OYC A;  1NJZ A;  1HJR A;  2HNY A;  5K14 A;  1J53 A;  3M8Q A;  2O4G A;  4FLY A;  3DYA A;  2RN2 A;  3I0R A;  3KLG A;  2G8U A;  3L3V A;  4E3S A;  4CEB A;  5E41 A;  4FZY A;  1RDA A;  1S9E A;  3TR8 A;  2YNF A;  4DFM A;  4PUO A;  5HRR A;  2W42 A;  4HCC A;  1S1U A;  3DLR A;  2F8S A;  2B5J A;  3PUF A;  4FW1 A;  1S9G A;  4CED A;  1UWB A;  5J1E A;  3OYL A;  4CF1 A;  3KLH A;  4CES A;  3SZ2 A;  3TAR A;  4FZZ A;  1KCF A;  1FXX A;  1LW2 A;  4FLU A;  1TKD A;  3OJS A;  4CIG A;  3L2V A;  4OLB A;  4I2P A;  1ASU A;  2PYL A;  2YHB A;  1QE1 A;  2YNI A;  3KKS A;  1X9M A;  4DWI A;  4Z4F A;  2KFN A;  2FBT A;  4LSN A;  3RWU A;  4L8R B;  3HXM A;  4CHP A;  4PWD A;  3VQ8 A;  4AHT A;  1TV6 A;  1WLJ A;  1J5O A;  3HK2 A;  2OPR A;  4DSJ A;  4KFB A;  1C0M A;  4DSF A;  3DRR A;  4E7H A;  1TAQ A;  3WNF A;  3VQE A;  4E89 A;  2YNH A;  3HM9 A;  3V6D A;  4DFP A;  3SUQ A;  4I2Q A;  1EET A;  3KTQ A;  1JLC A;  2OZM A;  4O55 A;  3O3F A;  1JLE A;  2FC0 A;  2B6A A;  1U4B A;  4FK4 A;  4KB1 A;  3NHG A;  4FJ5 A;  4CJT A;  1RDC A;  3ISN C;  4B8C A;  4H4M A;  1QSY A;  3ALY A;  4W5R A;  1RBR A;  4BE0 A;  1SL0 A;  1VSJ A;  5DMR A;  4OGC A;  1NK8 A;  3HPO A;  3V9U A;  4HUE A;  3OYD A;  5KGX A;  5C42 A;  3AO5 A;  1RTH A;  1S1X A;  4DTO A;  1RBT A;  3QEW A;  3BDP A;  3ZT1 A;  5D3G A;  4Z4G A;  1D5A A;  3NF9 A;  2RKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...