2KW4A

Solution nmr structure of the holo form of a ribonuclease h domain from d.hafniense, northeast structural genomics consortium target dhr1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target DhR1A
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2kw4A00
2YHAA 4RW4A 2Q3SA 4NCGA 4W5TA 4WE1A 3O3FA 1C1AA 2GV9A 1WNSA 4O0IA 3V9ZA 1UA0A 3OYBA 2FC0A 1KFDA 2YHBA 3OYDA 4FK4A 3ZSWA 1L3UA 2OPSA 1JL2A 5HLFA 4CGDA 1U48A 1TKDA 4CEQA 2HW3A 4CHNA 5D3GA 5KGXA 4C8OA 3LANA 5J2PA 3HP6A 4BDZA 2Y1JA 1WLJA 1NK5A 3CFPA 4DTSA 4CF0A 2A1RA 4FJ9A 2G8VA 1SKSA 4BWJA 1LWCA 4ZHRA 3U3GA 1QSLA 4EZ9A 3LWMA 4GVMA 4AHSA 4N56A 3RR7A 3ZSVA 5KTQA 2DTUA 2XY7A 4UQGA 3FFIA 3VQCA 3SV4A 2ITGA 2P5OA 1QHTA 4E89A 1VSFA 4JS4A 2OYQA 4E19A 4KHUA 1W9HA 4QAGA 2DFHA 2HHUA 1JLBA 1VSLA 2Z1HA 3HK2A 2XY5A 1DTTA 3F9KA 2F96A 2RF2A 4CIEA 1TKZA 4W5QA 3SQ1A 1NKBA 4C8LA 4IKFA 4J2AA 3NGZA 4CJEA 3VQBA 3NF6A 4E1NA 5E41A 3C6TA 3OYNA 3OYMA 2PZSA 1LAWA 4IDKA 1RTHA 3EYZA 3LAKA 4R5PA 2XY8A 4CF8A 4CGGA 4B3OA 1Z25A 4FW1A 1BISA 2I5JA 4DFJA 1QSYA 3PX6A 4PY5A 4FJKA 1MU2A 3O3GA 1IKVA 2Z1IA 3K5LA 4FLYA 2HHVA 3MXMA 3LPTA 4DQIA 1S1VA 3S3MA 2F8SA 3NBPA 1D9DA 3QLHA 3ISNC 3SQ4A 1VSHA 2DFFA 3NH2A 3AVFA 1IKYA 1U04A 3DLKA 4EZ6A 4DF8A 4H4OA 4N5SA 4Q5VA 1S1UA 2OZSA 1NK9A 4J2EA 3LZIA 2DY4A 1JL1A 1NJZA 4CFAA 1VRTA 1FKOA 3HVRA 3SPZA 4MFBA 5CZ2A 1YT3A 4J2BA 4LSNA 1RBVA 4DSEA 2JGUA 1Y97A 2EX3A 3QO9A 3VQDA 4DSKA 4FJNA 4FXDA 1VSDA 1TGOA 1RT7A 4BWMA 4FM2A 1WSGA 1ASUA 4H8KA 4CHZA 4JLHA 1DTQA 1UWBA 3DRRA 4AHTA 3V4IA 4E0DA 3T1AA 1D5AA 4I7FA 3PO4A 4M42A 1NKEA 1C1BA 1FXXA 3KLIA 1N6QA 3VQ8A 3OYLA 3ZSRA 3U3YA 1ZBHA 4KRFA 3KIOA 1IKWA 4KV8A 3V9WA 1SV5A 1VRUA 4NCAA 1HQUA 2ZQBA 3LZJA 2QK9A 3LP0A 1HQEA 3LP2A 3TAMA 3ZT3A 4B9UA 3KJVA 4DF4A 4CEBA 1B9DA 3VQQA 5KI6A 2KZZA 4M3XA 1ZBUA 1T05A 2Z1JA 3L8BA 3TABA 2VG5A 3QEIA 3QESA 5T7BA 4CJ3A 3SZ2A 1UAXA 3RMBA 1J9AA 1NK0A 3LP3A 3AVIA 4RW8A 3AVNA 3OYGA 1BCOA 3EZ5A 2IGIA 3ITHA 4JRQA 1J5OA 4K8XA 1GOBA 4CIGA 1U47A 2AJQA 4GMJB 3OYJA 3HM9A 3VA3A 1SL1A 2F8TA 2G8KA 5CYQA 4H4MA 4F4KA 3AVKA 2HVIA 3O4NA 2XHBA 1BQMA 3P1GA 3MXJA 5KRTA 3ZSQA 2D0AA 1HMVA 3B6PA 2ZE2A 4DTUA 1HRHA 4DFKA 2ATQA 3SCXA 3RRGA 2HHXA 1RDAA 3TI0A 1TL1A 1ASWA 4E3SA 4BDPA 5I42A 1ZBLA 4DU3A 1KVAA 4CHOA 4DTJA 1KVBA 4DSIA 5HRPA 3RMCA 4IG3A 4FZYA 4CESA 1RT2A 4FLWA 3SUPA 4O4GA 4B8CA 3ASMA 3NF8A 3NF9A 2P1JA 4N47A 1VK0A 3AA4A 3OYIA 1WSEA 1U45A 1FK9A 1S1WA 3AVHA 1HYVA 2OPQA 3IRXA 3IS9A 3CFRA 3DLHA 3QEWA 3V1RA 2IOCA 3HJFA 2BGGA 1RBUA 1S9EA 3A2FA 3AVJA 2IDOA 4KHSA 1L3SA 1CZ9A 2NUBA 2IS3A 5CZ1A 5SWMA 3LALA 4E7KA 1WAJA 3HPHA 3VQAA 3D45A 3V1OA 3OYCA 4BE0A 4FM0A 3ZSYA 5J2NA 2XY6A 1TKXA 3S9HA 1VSKA 4B9MA 3LAMA 5HRRA 1S1TA 4Z0UA 4CK1A 1BIUA 3THVA 4FJ8A 4DLGA 3TAEA 2FBXA 3AVGA 1TV6A 4OKJA 2ETJA 4RW7A 4YNQA 3DRSA 4DFMA 2X74A 3DLEA 3NCIA 3TAFA 3SPYA 2LSNA 1ZYQA 4KTQA 4Z4CA 2BDPA 3P5JA 4CEOA 4DU1A 1VSJA 4M45A 4DSLA 1XWLA 4QCLA 3L3UA 4Y1CA 4M3WA 3SUNA 1BCMA 2KFZA 4HUEA 1L5UA 4DFPA 3TAGA 4FVMA 3AVBA 4F3TA 3QIOA 3OS2A 1JXEA 4DTPA 4FJLA 3O4QA 3VQ4A 1X1PA 4G1QA 3V6DA 4KO0A 1QSSA 5FDLA 3AA2A 1ZBIA 3RRHA 5HROA 4I2PA 4O55A 4W5RA 1WSFA 4ZTFA 3KD5E 4CJKA 1LV5A 4ELUA 1T8EA 3V9XA 3AO4A 3TR8A 1I3AA 2JLEA 3TAQA 1XHZA 4CHQA 4QOZB 4BE1A 4CJ5A 4OGEA 3DMJA 1W0HA 4ID1A 1C0UA 3VQPA 4EP5A 4CJSA 3SQ2A 2VG6A 2R7YA 4DU4A 2HMIA 4CFBA 4KI6A 3SUOA 5J2QA 3L3VA 1IG9A 2G8UA 3K5NA 3JYTA 4FW2A 3LP1A 4C8NA 3M8QA 3M8RA 4Z4IA 3KKRA 4FCYA 2BANA 2O4GA 3MEGA 5HRNA 4KFBA 4CJ4A 3L2RA 1NKCA 4KPYA 4PUOA 1RTDA 1KLMA 1RDDA 4PA1A 1S9GA 4CGHA 4KREA 3RTVA 4C8KA 4E7JA 2KFNA 3AO3A 4CJQA 3SJJA 3C94A 4Z4FA 2VWJA 4HHTA 1Z26A 3KK1A 4ELVA 1JLGA 1BQNA 1X9SA 2G8IA 1A5WA 1KCFA 2FBYA 3MECA 3G0ZA 3WNGA 3ZT1A 4DSFA 1TK5A 4PWDA 4AHUA 3I0RA 1K6YA 4DMNA 2OPPA 1JLEA 2HHWA 2X78A 1SL0A 3L2UA 2PY5A 4IFVA 1C0TA 1A5VA 4CK3A 3K59A 4L8RB 5DMRA 4CGFA 3QEVA 3M8SA 2RN2A 4M41A 1J53A 2WONA 3MEDA 4FLTA 1GOCA 4NYNA 1RT1A 1WSIA 3LWLA 4DTNA 2OPRA 2KQ2A 3QEPA 4CEZA 4FJHA 2YNHA 3TWHA 3CM6A 3T19A 5C25A 1CLQA 2PYJA 5CY4A 3HYFA 4M3YA 1RT5A 4OPJA 3MEEA 1WSHA 1SKWA 2G8FA 1U4BA 4E7LA 1F21A 4DQSA 2B5JA 3ZSOA 3BDPA 3DM2A 4IG0A 3KK2A 4KI4A 2KZMA 4CFCA 3VQ9A 3VQ6A 4BE2A 3S3NA 1QS4A 4CGIA 1RT3A 1O1WA 1L3VA 1EETA 2QXFA 5SZTA 5KRSA 3NFAA 1KVCA 3HXMA 1JXBA 1N5YA 2HNYA 1WN7A 4KB1A 4W5OA 4DQQA 2YNFA 3NGYA 3ZSZA 2BE2A 3S3OA 4CCHA 1TKTA 3CM5A 4JRPA 2G8HA 1VSIA 4W5NA 1KRPA 1VSEA 4DTOA 1T03A 3DLGA 4FLUA 4FJIA 4AH9A 3OYHA 1HJRA 4LSLA 4OLAA 1YVUA 1RT6A 4FM1A 4RW9A 4M3ZA 2KW4A 3OJUA 4E7HA 4E7IA 5J1EA 4FJ5A 3NF7A 3O3HA 3CG7A 1LAVA 2D0CA 3VQEA 1VSMA 3DOKA 3QNOA 1RT4A 3QETA 4CJUA 2KTQA 5HBMA 4M3RA 4CHPA 4XIUA 1A5XA 3NH0A 3NHGA 1Q9XA 5J2MA 3V9SA 2OZMA 2HHTA 3CFOA 4RW6A 3PO5A 4FJMA 4DTXA 2G8WA 4CE9A 3M8PA 4OVLA 1EX4A 4AHRA 4AHVA 2E6MA 3K5MA 4F3OA 3K57A 1RDBA 3AO1A 1CZBA 5C24A 3OYFA 1HYSA 1XC9A 1S1XA 2HB5A 3HO1A 2RPIA 3AA5X 3OS1A 3SNNA 4CJLA 4HCCA 4BACA 4FLZA 4B9NA 4KB0A 2VWKA 4FK2A 3DLBA 1JLQA 1C6VA 3DYAA 2D5RA 5JS2A 3KKSA 3PY8A 4DTMA 3SQ0A 4HUGA 4OKKA 3V81A 2HVHA 4FYDA 5FROA 1REVA 4OLBA 1G15A 1ITGA 3HVTA 4LH4A 3QEXA 4B9SA 3NE6A 3H08A 3OJSA 3BGRA 4FZZA 4YFUA 3TANA 4ZTJA 4B9LA 3AV9A 3NAEA 2YNIA 3VA0A 4B9TA 2HHSA 4ID5A 1LWEA 4FK0A 3AO5A 1KLNA 4O5BA 1RDCA 3OYEA 1BHLA 1EP4A 4ICLA 3LPUA 4GW6A 5HP1A 3OY9A 5KGWA 1SKRA 4I9QA 4Z4GA 4FLXA 3RR8A 4KAZA 2GBZA 3F73A 4IBNA 3RMAA 1JLAA 4DLEA 3AVCA 3DRPA 4CEFA 3P83D 1EKEA 4F2SA 3OYKA 2B6AA 2IAJA 4NCBA 4E1MA 1RTIA 1WAFA 2X6NA 4CF1A 1DLOA 2HNZA 3KLHA 1C0MA 3DOLA 4HCBA 4IFYA 4CF2A 3VQ5A 4N76A 3MXIA 3AVMA 1Q8IA 1TAQA 1S5JA 3PUFA 1TK8A 3SYZA 3MAQA 3NH1A 3OVNA 1YTAA 3HPOA 1ASVA 4EP4A 1X9MA 3NDKA 1S6PA 1LW0A 3K2PA 4AILC 3KLEA 3RMDA 1NK7A 3HSTB 1B9FA 4CERA 4KTZA 4HVJA 4LY7A 2DFEA 2QKKA 4FJ7A 1JLFA 4J2DA 2E4LA 4DSJA 3PX4A 4CJRA 1TL3A 4OKEA 4Z4HA 3B6OA 4OJRA 1NJWA 4M3TA 4B8AB 3AVAA 3NGIA 4I2QA 3ZT0A 4M3UA 4DQPA 4F8RA 1YTUA 3WNFA 4HTUA 1I39A 2A1SA 3V1QA 3PX0A 3ZT4A 1SUQA 2P51A 4CGJA 3UIQA 4LD0A 3K58A 3EY1A 1FKPA 3C95A 3TAPA 4CJTA 2FBVA 2YKMA 3DI6A 3E01A 4KTWA 4AHCA 3CQ8A 3QIPA 2PYLA 3G10A 1X9WA 2P5GA 5EU7A 4CIFA 1IKXA 1R0AA 1BL3A 1LWFA 3SUQA 4C8MA 4KKOA 2HNDA 4O0JA 3WNEA 1S6QA 4CJPA 3KLFA 3SV3A 1KSPA 1BI4A 4B9VA 4FJXA 5C42A 4O44A 1RNHA 3K5OA 4MQ3A 3L2VA 4CJFA 4HUFA 1KFSA 2OA8A 2YV0X 1TVRA 2X6SA 1IO2A 2RKIA 2VG7A 4OGCA 1RTJA 3HP9A 4Y1DA 2XO7A 3HT3A 3QERA 5I3UA 1CXQA 1L3TA 4K8ZA 3KLGA 3HL8A 3T3FA 3ZCMA 1U49A 1HNIA 4DQRA 4Q0BA 3OYAA 4ELTA 1IH7A 2GUIA 3KD1E 1TK0A 4Z4EA 3AVLA 3WNHA 1C1CA 3AA3A 2O4IA 3ZT2A 2E6LA 4CFDA 4BDYA 1ZBFA 2QKBA 2HHQA 1BGXT 1LW2A 1B92A 1CXUA 4LH5A 1UOCA 3ULDA 2W42A 4NYFA 1EXQA 3L2QA 3D0PA 2EHGA 3I8DA 3KK3A 1RBSA 1QQCA 4CK2A 1NK6A 3PV8A 4CEDA 1T7PA 4KHNA 3AO2A 4CECA 1GOAA 4KHWA 1D9FA 1XHXA 1Q9YA 1NOZA 4CHYA 4DS5A 4OPKA 1QE1A 2ZD1A 1WSJA 1NK4A 3RWUA 1UA1A 4CF9A 1NOYA 1QTMA 1D8YA 4FZXC 2D0BA 1BI4B 3C6UA 2YNGA 3VQ7A 4I9LA 3VN5A 4B08A 4DTRA 4F2RA 2XRIA 4DG1A 1XI1A 2FBTA 3OS0A 4PQUA 5JS1A 3QNNA 4TSXA 4DS4A 4FJJA 4CJWA 1KTQA 1RCHA 5HRSA 1SL2A 1NJXA 1HYZA 3ZSXA 3CYMA 4N41A 1TAUA 3TARA 3ALYA 4FLVA 3V9UA 1NJYA 1JKHA 5CYMA 3LDSA 4FJGA 4JS5A 5FRMA 3JSMA 1JLCA 4KHYA 1RBRA 4RG8A 1HNVA 3U6FA 3IG1A 1BIZA 4CJVA 2B4JA 1RILA 5DK5A 5K14A 4CEEA 2Z1GA 4DWIA 2YKNA 3L2WA 3I0SA 5FRNA 1RBTA 3SI6A 2WOMA 3DLRA 4CEAA 2IC3A 1HPZA 3IAYA 1J54A 1NK8A 3HPGA 4KHQA 2Y1IA 3KTQA 3QINA
chains in the Genus database with same CATH superfamily
4A5AA 1OH7A 3V9ZA 3OYDA 4FK4A 1L3UA 1WB9A 4FO0A 4CEQA 4CHNA 5ADXH 1NGCA 4U7BA 3U8XA 5J2PA 4BDZA 4FWQA 3CFPA 5GADP 2G8VA 5KPRA 4EZ9A 4N56A 3KWGA 5KTQA 4C1NI 1RDWX 3B8AX 3THYB 2HF4A 4JS4A 1VSFA 3J8AA 4BRAA 3SK3A 1JLBA 1T3VA 3HK2A 4B1ZA 5BPLA 2F96A 3WEEA 3K0SA 1TKZA 3SQ1A 2ZJQL 3AAQA 4A57A 3VQBA 1VQPN 2PZSA 2VGMA 2XY8A 1Z25A 2I5JA 3E9PA 3PX6A 3BF3A 4FJKA 1MU2A 3O3GA 1Q86O 3ID6A 1XC3A 3MXMA 3K9KA 2F8SA 1D9DA 4X66K 3M1FA 3SQ4A 5AQYA 1U04A 4EZ6A 3LZIA 1VRTA 3WQUA 5CZ2A 3O9UA 4CBUA 4DSEA 3QO9A 2EX3A 3FZLA 1WSGA 1ASUA 5M1NA 2IIRA 3M5RA 1C1BA 1RDUA 4B1YB 3OYLA 3V9WA 1VRUA 2ZQBA 3VGMA 3QEIA 4LF7K 3QESA 5CHIA 3MMVA 5T7BA 4KBOA 3RMBA 4JYAK 5AQGA 1NK0A 4JI1K 2IGIA 3HI0A 1U47A 1QZ5A 4H4MA 2HVIA 2XHBA 1BQMA 3MXJA 3TTDA 2D0AA 2Q31A 3B6PA 4B1UB 4FOEA 4DTUA 5M1FA 4L3QA 3TI0A 1TL1A 3CCLN 4BDPA 1KVAA 1KVBA 1DT9A 5M1OA 1WBBA 3THXA 1C0GA 1RT2A 4CESA 4FLWA 4O4GA 5FPEA 3NF9A 4JI5K 3AA4A 1FK9A 1HYVA 3IS9A 3QEWA 3V1RA 1ATRA 3HJFA 3AVJA 3J7YP 4JD2A 2A41A 2D4WA 2UU9K 5CZ1A 5AQQA 3HPHA 3VEXA 1V4SA 4IXCA 3V1OA 3S9HA 3UKUB 3LAMA 3THVA 2Q0RA 4NLBA 3TAEA 3AVGA 4OKJA 2ETJA 4RW7A 4YNQA 3I56N 3DRSA 3DLEA 3SPYA 3I55N 4JKCA 4BVPA 4DU1A 1XWLA 4Y1CA 2D0OA 3SUNA 1BCMA 4HUEA 4JKGB 2FLOA 2V51B 3QIOA 3NVMA 1JXEA 3C6HA 4DTPA 3VQ4A 4KO0A 1OH8A 3EEQA 2F9TA 5FDLA 5HROA 3J80O 1T8EA 1S22A 3TR8A 3MN9A 3O80A 1GLFO 3TAQA 2AP1A 4CHQA 4RWTA 4OGEA 3SQ2A 4CZEA 3L3VA 2G8UA 4FWOA 4WF9L 3MEGA 1G99A 4DB3A 3VPZA 4GKKK 1KLMA 1S9GA 2KFNA 3RTVA 4C8KA 4CVNE 4E7JA 1NWKA 1JLGA 1X9SA 2O8BA 1KCFA 2FBYA 3G0ZA 4IO8A 1JLEA 3IDHA 3L2UA 3J81O 4BR5A 4L8RB 4CGFA 3UE5A 2NRWA 1J53A 3MN5A 4DHYA 3L4IA 1GOCA 4CZMA 1RT1A 4KHPK 4JKEA 3SLCA 1CLQA 2E1ZA 5CY4A 1HNWK 3HYFA 4M3YA 5BRFA 4BC3A 2G8FA 4E7LA 2B5JA 4BG8A 3SAFA 4CFCA 4JI6K 3M3ZA 4FWPA 2VQEK 4WCEL 2UXBK 5KRSA 2HNYA 4W5OA 4CCHA 4JI4K 3CM5A 2G8HA 1VSIA 4DR7K 3O8MA 4FWLA 1XMQK 1YVUA 5KQDA 1RT6A 3ULEB 3OTOK 2KW4A 4K25A 2HSTA 4E7IA 4FJ5A 5BR9A 3CIPA 1QQOA 3QETA 4CHPA 3NHGA 1A5XA 4CD1A 4YOYA 1QZ6A 3CFOA 4RW6A 4DTXA 4Y0WA 1U2VB 1EX4A 2E2QA 2E6MA 1Z6RA 2QM1A 3K9JA 3AO1A 3OYFA 4B1WB 5AQSA 4WFAL 4AF1A 2RPIA 1N33K 3QICA 5F1XA 4HCCA 4BACA 4B9NA 4FK2A 1C6VA 1KD1O 3GBTA 3ZETA 3T69A 4FYDA 3CF5L 1ITGA 3MCAB 3H08A 4YFUA 2UUCK 4F9OA 3H3OB 3AV9A 3NAEA 3AO5A 4JNEA 5C0YA 3OY9A 1SKRA 4I9QA 4Z4GA 4FLXA 4GKJK 4QS9A 1JLAA 4DLEA 3AVCA 4YHHK 4CEFA 1Z05A 1EKEA 3CJ7A 1Q81O 4DR3K 3KLHA 3DOLA 4IFYA 4N76A 4K43A 3SMPA 3MWTA 4NLCA 5BRHA 1P90A 4EP4A 3VOVA 1VQ4N 3Q7BA 5AQLA 4KTZA 4HVJA 2QKKA 4B3MK 2ASOA 4JK7A 2E4LA 4XH5A 4Z4HA 3BEXA 4B8AB 3AVAA 5ELZA 4M3UA 1I39A 2NRTA 3CC4N 1Q7YO 3UIQA 3VTIA 4JHDA 4LD0A 3EY1A 2FBVA 4KTWA 3CQ8A 2PYLA 5AJ3K 5GIOA 1X9WA 2P5GA 4BRCA 1K8AO 4CIFA 1LWFA 4C8MA 4O0JA 3VMFB 3SV3A 1KSPA 1BI4A 4FJXA 1NM1A 4IOAL 2YV0X 1NGAA 3CJCA 1IO2A 4OGCA 3QERA 1K9MO 2HBKA 1L3TA 1U49A 2WTUA 4DR4K 3ZCMA 3D2FB 5EVZA 1OKJA 3VGKA 3TSPA 1E4GT 4BRNA 2O4IA 2A5XA 3T1HK 2E6LA 2QKBA 1ZBFA 2HHQA 1BGXT 1B92A 1XUPO 4LH5A 1UOCA 3N4QA 3AY9A 3I8DA 2GWKA 1NGEA 2E8AA 4EAHD 1J6ZA 3LDOA 2V7YA 1LCUA 1T7PA 3O1BA 1Q9YA 4CHYA 5F0XA 4DS5A 1MWKA 2ZD1A 1NK4A 4CBWA 4FWKA 1NOYA 4BQLA 1BI4B 3C6UA 2YNGA 3GE1A 4B08A 5JS1A 1XI1A 2FBTA 4DS4A 4CJWA 1NJXA 3U9DA 1TAUA 3ALYA 4FVUA 4RG8A 3U6FA 1NGJA 4KH6A 5ADXA 3IG1A 4CJVA 1EO1A 2B4JA 5DK5A 5AZJA 1HKCA 5C2DA 2YKNA 1JCFA 1VQKN 4DWIA 1RFQA 3DLRA 4NB4A 4CEAA 4FWNA 1HPZA 4WQ5C 4FPAA 3HPGA 4KHQA 2NRXA 3SBTA 3KTQA 4FLZA 2Q3SA 4XH1A 1C1AA 1WNSA 1UA0A 1VQ9N 2FC0A 1KFDA 2P9NA 3CQXA 3ZSWA 4BGBA 4EHUA 3CXCM 4CGDA 1TYQB 1TKDA 4XH4A 4LF8K 5D3GA 3OA9A 4C8OA 3HP6A 1WLJA 5KPTA 1NK5A 1TYQA 4CF0A 1KQSM 4V19S 4BWJA 4ZHRA 3LDLA 1QSLA 4AHSA 2XY7A 1ATSA 3FFIA 3VQCA 3THWB 2O8EA 4E89A 4MLHA 3P4IA 2NNWA 5M1PA 4KHUA 1S3XA 1W9HA 4QAGA 2DFHA 4BREA 1DTTA 3D6RA 3F9KA 4CIEA 4J2AA 4W5QA 1RGIA 4DV7K 1WUAA 1U6ZA 3NF6A 3OYNA 3C6TA 3C6AA 4O5FA 1LAWA 3DWLA 4R5PA 4CF8A 4CGGA 2NRVA 4DFJA 1QSYA 4PY5A 3TPQA 2Z1IA 1M1KO 2QWNA 5C10A 3AVFA 4O8KA 4FL9A 3CJAA 3VEOA 4EHTA 4H4OA 4Q5VA 2DY4A 4J2EA 4WQ4A 4CFAA 1BOTO 1NGHA 3SPZA 1YT3A 5GAHP 1YXQA 3PIOL 3KZBA 1RBVA 2ZF5O 3VQDA 2QWQA 4IJAA 4RCHA 4YDUC 4BWMA 5BRDA 4FM2A 1LOTB 3LL3A 1DTQA 4AHTA 3T1AA 1D5AA 4I7FA 2A6AA 1GLCG 3GL1A 4BRPA 1NKEA 1N6QA 1ZBHA 4KV8A 1SV5A 1HQUA 1HQEA 3LP2A 4B9UA 1Q18A 3E9LA 1KC8O 1B9DA 2KZZA 4JD2B 4JK9A 4BG9A 1VQ7N 2HOEA 3L8BA 3KWIA 2F4VK 3H1QA 3OYGA 4CZHA 3AVNA 4JRQA 3MDQA 2AJQA 4BRKA 3VA3A 3CCEN 5CYQA 3O4NA 5AQHA 3RVCA 4B3RK 4B1XB 1HMVA 4DFKA 2ZE2A 4I6MB 1HRHA 3R1XA 3RRGA 2HHXA 1SAZA 3ZETB 4BRDA 1RDAA 3BY5A 4FPBA 3UKRA 3VF6A 3D2EA 4B8CA 4BC4A 3ASMA 3OYIA 3ZEUB 1S1WA 3AVHA 3DLHA 2P9PB 3IRXA 3CFRA 2IOCA 4A62A 2YI1A 4X64K 3WXMB 3H46O 1BDGA 4KHSA 1CZ9A 1N32K 3LALA 2NLXA 4BE0A 3ZSYA 3T1YK 4JEPA 2A3ZA 3CERA 5H1SQ 2IVOA 5AQXA 4DFMA 3TAFA 2X74A 4KTQA 4Z4CA 4M45A 4M3WA 1L5UA 1Y64A 4DFPA 3TAGA 3AVBA 1BA0A 3VEVA 3OS2A 1HKBA 4JKHA 3V6DA 3AA2A 1ZBIA 4CJKA 1MDUB 3TTFA 4DKWA 4OPHA 3V9XA 1XHZA 2W40A 5AQFA 4BE1A 4CJ5A 3FE1A 2FF6A 1HNXK 4ILJA 1C0UA 3VQPA 4CJSA 2R7YA 3MK6A 5J2QA 2P9SA 1IG9A 2WC9A 3K5NA 3JYTA 2DPNA 4YDUA 3M8QA 3M8RA 3KKRA 2BANA 4H5RA 4K0KK 3L2RA 5C12A 3HRGA 2O8BB 4PA1A 3AO3A 1K8KB 3C94A 5AQWA 3PIPL 1BQNA 3LM2A 1A5WA 3MECA 4DSFA 3G71N 2OTLN 4FWSA 3I0RA 2OPPA 1N8RO 1SL0A 2VYPA 4WFNL 3K59A 3QEVA 3M8SA 3PLAA 4M41A 3O6WA 2FSKA 3SJHA 3CM6A 3WXJA 3T19A 2HHHK 4K42A 1QHAA 2P9UB 3OBWA 3CC7N 3MEEA 4IOXA 1SKWA 1F21A 4DQSA 3BDPA 5BR8K 3VQ9A 4CGIA 3DXMA 1NGBA 2HBLA 4BGAA 3NFAA 1JXBA 3HOTA 1N5YA 1JJ2M 4KB1A 4DQQA 2YNFA 2BE2A 4DUZK 3H1VX 5CE3A 4W5NA 1VSEA 3A5MC 5BN9A 4BR7A 2NRZA 1BO5O 2QWLA 4RW9A 3OJUA 5GAGP 1NG9A 4BRGA 1BUPA 1SQKA 2YX6A 2E2PA 3CG7A 2D1KA 4M7XA 2D0CA 1VSMA 1NU0A 3A0IX 3VEZA 3EN9A 3NH0A 1SZ2A 3HM8A 2HHTA 1HPMA 2G8WA 4GY2B 1BWFO 4DUYK 4DR5K 4AHVA 1RDBA 1VQ5N 5C24A 3T7ZA 2P9SB 1HYSA 1XC9A 3HTVA 1IBKK 2VWKA 4B1VA 2KLAA 3TTCA 1XQSC 2D5RA 5JS2A 4OKKA 5AQZA 3OW2M 3QEXA 4DV2K 3OJSA 3BGRA 1W2BM 4IJNA 4BC2A 4B9LA 2HBJA 3VA0A 1YJNN 4FK0A 4PL8A 4CZGA 1JCEA 4H5VA 2UYTA 4KAZA 1ATNA 3AAPA 3QBWA 4NCBA 3QB0A 1RTIA 1WAFA 3P31A 1DLOA 2HNZA 1C0MA 4FOIA 1YTAA 4CZJA 1X9MA 4DR6K 3W0LA 1WOQA 3KLEA 3JXUA 2OANA 2P9LA 4CERA 3JAMO 4LY7A 2DFEA 4JI3K 4FJ7A 1JLFA 4CJRA 4OKEA 3O9QA 1NJWA 3PSIA 4JKGA 3ZT0A 4F8RA 3WNFA 4JI2K 2P51A 2J4RA 4CD3A 4AQYK 3CCQN 2YKMA 3E01A 1P8ZA 2P9NB 3QIPA 3VESA 4JI7K 4JKAA 5EU7A 4FSVA 1IKXA 1R0AA 3EKSA 1YAGA 4H0PA 4CJPA 5E84A 3O5BA 1QQMA 5C42A 3K5OA 4CJFA 2OA8A 1KFSA 2O8EB 2ZJPL 4E7KA 2VG7A 2RKIA 3EE9A 1BA1A 1RTJA 2XO7A 1CXQA 3SAGA 4A59A 4JHDB 4Q0BA 1D4XA 4DV3K 3KD1E 3AVLA 3WNHA 1M90O 1YI2N 3CC2N 3ULDA 4HTLA 3VF4A 3C65A 3L2QA 1EXQA 2W42A 4IZ9A 5BREA 1QQCA 4CK2A 3PV8A 1EWRA 4KHNA 2BH1A 1NOZA 3BZCA 4OPKA 1QE1A 4CW7B 1QTMA 2D0BA 4DTRA 2W6LA 3ZSXA 4N41A 4BVOA 4FJGA 1JKHA 4JS5A 3JSMA 1TUYA 1QQNA 1BIZA 1RILA 5K14A 4DV1K 2Z1GA 3L2WA 5FRNA 3SI6A 2WOMA 2P9IA 3WXIA 3IAYA 1VQ8N 1VQNN 3IMXA 1J54A 1YJ9N 2OTJN 3VN5A 4W5TA 4NCGA 2GV9A 4O0IA 1NGDA 2YHBA 1IJJA 5AQKA 5HLFA 2HMPA 3EKUA 4H0XB 4WQ4C 2HW3A 4YOTA 3O9TA 1KAYA 5LY3A 1T44A 4DTSA 3VTHA 3A5OC 4C23A 4FJ9A 1SKSA 4RTFD 3U3GA 3LWMA 4GVMA 4A2AA 3ZSVA 2Q36A 2KKZA 2KHOA 3N4PA 3SV4A 2P5OA 2CGKA 1ZBSA 4E19A 1NGFA 2Z1HA 2RE2A 4LF9K 2RF2A 1O13A 1NKBA 4CJEA 2ZJRL 4E1NA 3ENBA 5AZJB 5A2QO 4IDKA 3LAKA 4B3OA 4JN4A 1YF5L 5AFUH 3K5LA 4ILGB 3LPTA 3R3LA 3ZLJA 1DKGD 2WFBA 2DFFA 3NH2A 4GV3A 3DLKA 1SS6A 1NK9A 3UKRB 3L4QA 4BRQA 1FKOA 3HVRA 3AGKA 4EFHA 4LSNA 1Y97A 4DSKA 2BTFA 1XNRK 3J7AP 1GLJO 4I6MA 1VSDA 1W7AA 4DV4K 1HJOA 4CHZA 2GEMA 3DRRA 3CI5A 2AA4A 3PO4A 3P39A 1FXXA 3KLIA 1WBDA 2HHWA 1IV0A 3U3YA 3ZSRA 4H5NA 4CJ7A 3CMAN 4KH5A 5EXWA 2VGNA 3LZJA 1NMDA 3LP0A 3THWA 5KI6A 4M3XA 1ZBUA 2Q2RA 3TABA 2VG5A 2ASMA 4G9ZA 3ZX2A 4CJ3A 5FPNA 4MDBA 1J9AA 3HZ6A 3LP3A 1J5OA 4GMJB 3HM9A 1YUWA 2F8TA 5JVGL 3LM9A 4F4KA 3DLLL 3SCXA 2ATQA 1GLEG 1NLVA 1ASWA 4E3SA 5I42A 1ZBLA 4DU3A 4CHOA 2CGLA 4DSIA 3RMCA 4IG3A 2E5LK 4JI0K 4N47A 2P1JA 1VK0A 2NZTA 1WSEA 1U45A 1S72N 1RBUA 1S9EA 3BUZB 3A2FA 2IDOA 2YJFA 1L3SA 2IS3A 5IWAK 5SWMA 3VQAA 3CJ9A 4JK8A 5J2NA 1NMNA 2XY6A 1DGKN 1TKXA 1VSKA 4Z0UA 4FJ8A 4DLGA 3C0BA 3R6MA 2FBXA 4X62K 5LJWA 2LSNA 2D0PA 2BDPA 2ZGZA 1I94K 4DR1K 1VSJA 1VQMN 4DSLA 3L3UA 5FPMA 3CPWM 4MLEA 4F3TA 4FVMA 3UB5A 3D2EB 4FJLA 4G1QA 2H3GX 1QSSA 1ZC6A 2PAVA 3RRHA 3VERA 4W5RA 1WSFA 3NVKA 4FWRA 1OH6A 5AZIA 3AO4A 4DV6K 3KK7A 2JLEA 3EL2A 4Z94A 3J7ZO 3DMJA 1W0HA 2ASPA 4CFBA 2QWRA 3SUOA 2YCHA 2PBDA 3ZYYX 4FCYA 4Z4IA 1YJWN 4KFBA 4KPYA 3LDQA 4PUOA 1RTDA 1OVQA 4CGHA 3FFKB 2UUBK 3SJJA 4Z4FA 4BR2A 3DXMB 2VWJA 3KK1A 4ELVA 5HL7L 2KFZA 3VENA 4JKFA 3ZT1A 3WNGA 1YITN 4PWDA 4AHUA 4DQ8A 4DMNA 2PY5A 2P9KA 4IFVA 5AQTA 1A5VA 4CK3A 1OVYA 5DMRA 2RN2A 5JICA 4WYBA 4NYNA 3LWLA 4DTNA 2KQ2A 3QEPA 4CEZA 4FJHA 2E2NA 5C25A 1IG8A 5DM7L 3Q7CA 1Q82O 1RT5A 4OPJA 3MN7A 2QW9A 3GOIA 1WSHA 1U4BA 3MWPA 3ZSOA 5AQMA 2KZMA 3VQ6A 4BE2A 3S3NA 1QS4A 1RT3A 3RSEA 1O1WA 5SZTA 1IBLK 1ESVA 1KVCA 1WN7A 3O4WA 3ENHA 3S3OA 4UY8O 3ULEA 3BZKA 4JRPA 1KRPA 4DTOA 3H6EA 1T03A 2QTDA 2ITMA 5FPDA 3DLGA 3G25A 2V7ZA 5LMNK 4FLUA 3ENOA 4AH9A 3AARA 3OYHA 2P9IB 4OLAA 4LSLA 4OX9K 4B3SK 4M3ZA 1X3NA 5LL6Z 5J1EA 4O8UA 1EQYA 3DOKA 1RT4A 4CJUA 4MO4A 5HBMA 4M3RA 3TSQA 2KTQA 5TKYA 1QVGM 2FSNA 2ZM6K 3PO5A 4H0TB 3M8PA 4AHRA 4F3OA 3K57A 4IEIA 3AA5X 3OS1A 3SNNA 2P9UA 2WBNA 4KB0A 3DLBA 4M63C 3O9SA 4DTMA 4HUGA 3V81A 5DM6L 1W97L 2HVHA 5FROA 1VQON 3HVTA 5JLFA 4B9SA 4FZZA 5C2FA 4ZTJA 4AM6A 2YHYA 3G6EN 4DV5K 4B9TA 1LWEA 1KLNA 4O5BA 3OYEA 3LPUA 5HP1A 5KGWA 3RR8A 4F2SA 2B6AA 2E1YA 3PSFA 2X6NA 4HCBA 5AQPA 4GV6A 4CF2A 3VQ5A 3MXIA 3CQYA 1S5JA 3PUFA 1TK8A 3SYZA 3MAQA 3NH1A 3MX2A 3HPOA 5JLHA 3RMDA 4H03B 4BC5A 4LF6K 1XMOK 5EY4A 4BRHA 4DSJA 1TL3A 3CCVN 3B6OA 1HR0K 4CZKA 3FZMA 3NGIA 4I2QA 1YTUA 4DQPA 4JKBA 3V1QA 3PX0A 3C7NB 2GTDA 3C95A 3TAPA 3G10A 3AGRA 2VWBA 1BL3A 3CETA 3VF2A 1HNZK 4KKOA 2HNDA 3WNEA 3WQTA 1VQ6N 3MN6A 4B9VA 1HLUA 3SAHA 1V4TA 2QEXN 1BG3A 1C0FA 3O9RA 4MQ3A 5AQVA 4DR2K 4H5TA 1TVRA 4IDHA 2X6SA 3HT3A 1FJGK 3HP9A 4K8ZA 3HL8A 1HNIA 3OYAA 1IH7A 2GUIA 4KH4A 1TK0A 2P9PA 3H3NO 2VQFK 4BDYA 4YORA 1CXUA 5AR0A 4BR9A 3KK3A 1RBSA 4CEDA 3KHYA 5LMUK 5AQUA 5JVHL 4KHWA 3F9MA 5KPZA 4JKDA 2YJEA 1WSJA 4PL7A 1UA1A 4JV5K 3CCSN 1D8YA 4FZXC 4F2RA 4GV9A 4I9LA 1JCGA 3VGLA 4DG1A 4PQUA 1NBWA 3DAWA 3QNNA 4FJJA 5HRSA 3A5NC 3CYMA 3SBGA 3QMLA 1TUUA 5CYMA 4H5WA 5I9EB 1JLCA 3LDPA 1YVNA 3ZX3A 3CHWA 4KHYA 2RHKA 1HNVA 1T6CA 3IUCA 1XNQK 4XEIA 3I0SA 4H0VB 3WXKA 1NK8A 4BQZA 2Y1IA 1K73O 1HUXA 2Q97A 4LF4K 2YHAA 4RW4A 3O3FA 4WE1A 5CR4A 4YOXA 3FZFA 3OYBA 2OPSA 1JL2A 5GAEP 3GG4A 3VEWA 1U48A 4CZLA 2E88A 3ZEUA 5KGXA 2FXUA 2GUPA 2EWSA 3LANA 4U67L 2UXCK 2Y1JA 4QS8A 1QVFM 3HBTA 2A1RA 1EWQA 4GVEA 3WXLA 1LWCA 1YHQN 3R8EA 2DTUA 3RR7A 2O8FB 4UQGA 2ITGA 1N36K 1QHTA 2OYQA 2HHUA 1VSLA 3UKUA 2XY5A 3MX5A 5EOYA 3R9PA 3ID8A 4C8LA 4IKFA 3NGZA 1VQLN 2O8DB 3FZKA 5E41A 4IEEA 3OYMA 3ATVA 3EYZA 1RTHA 4X65K 4FW1A 1BISA 2WUSA 5AQIA 1IKVA 2HHVA 4FLYA 4DQIA 1S1VA 2NRRA 3S3MA 3NBPA 4DV0K 3QLHA 5BN8A 1GLDG 3ISNC 1VSHA 1IKYA 4B3TK 4DF8A 4N5SA 2OZSA 1S1UA 5B8HA 4DCHA 3THXB 1JL1A 3TSUA 4MFBA 4J2BA 1CZAN 3LDNA 2CH6A 2JGUA 4FJNA 4FXDA 1TGOA 1RT7A 4H8KA 4JLHA 3V4IA 1UWBA 4E0DA 4M42A 4OO1J 3FZHA 3VQ8A 4KRFA 3KIOA 1IKWA 4NCAA 2QK9A 3TAMA 4K41A 3ZT3A 3KJVA 4DF4A 2O8FA 4CEBA 3VQQA 2QWOA 1T05A 2Z1JA 1FW6A 2E20A 1J5EK 1GLLO 4MDAA 3SZ2A 1UAXA 3P38A 3HOSA 3O08A 3O1WA 4RW8A 3AVIA 3EZ5A 1BCOA 3ITHA 4K8XA 1GOBA 4FWMA 4CIGA 4R79A 3OYJA 1SL1A 2HF3A 2G8KA 1BU6O 3AVKA 3P1GA 5KRTA 3ZSQA 2QXLA 4PKHA 2JWKA 1DEJA 2Q1NA 3ZX0A 2YHXA 4DTJA 2FF3B 2F7TA 3E1YA 4J8FA 3VEYA 5HRPA 4FZYA 1IBMK 3A5LC 3SUPA 3NF8A 3QBXA 2OPQA 2QI2A 5BPMA 3M6GA 2BGGA 5FLXO 3VETA 2IVPA 3D2FA 1KAXA 2NUBA 3EE8A 3JS6A 4YOUA 1R59O 1WAJA 3CCMN 4AM7A 3MCPA 4BR0A 3D45A 3OYCA 4FM0A 1MA9B 4B9MA 5HRRA 1S1TA 4CK1A 1BIUA 1VAZA 3BP8A 1TV6A 3DJCA 3TU5A 5GINA 5LJVA 2PFUA 3NCIA 1ZYQA 3P5JA 4CEOA 3DXKB 3FGUA 3C7NA 4QCLA 3RSEB 3SMSA 4HWIA 4BRFA 4BRIA 4YY3K 4LFCK 1ILYA 3O4QA 1X1PA 4BRMA 3L0QA 1N34K 2ZWHA 1GLAG 3KD5E 4I2PA 4O55A 4ZTFA 2GWJA 1LV5A 4ELUA 1NGIA 1I3AA 4QOZB 1KAZA 4ID1A 4EP5A 2VG6A 4DU4A 2HMIA 4KI6A 2BUPA 4CZIA 4FW2A 3LP1A 3D7EO 4C8NA 4OPAA 2O4GA 5HRNA 1NKCA 4CJ4A 4QS7A 2V52B 5MLCQ 5JMVA 1RDDA 1T6DA 2ZGYA 5EX5A 4KREA 4CJQA 4YOWA 3L6QA 3I8BA 4HHTA 1Z26A 2G8IA 1TK5A 3CD6N 2CH5A 1K6YA 4ISEA 1ZXOA 2X78A 1C0TA 4H0OA 3KVGA 5AQJA 2WONA 3MEDA 4FLTA 3W3DA 3THYA 1WSIA 2OPRA 2VCPA 2I7NA 5AZIB 2YNHA 3TWHA 1HKGA 4MO5A 2PYJA 4LC9B 4NXMK 3FR0A 3E9OA 3DM2A 4IG0A 1X3MA 3KK2A 4KI4A 1U2VA 3CCUN 3QFUA 2O8CB 1L3VA 1EETA 2QXFA 1NGGA 4NO7A 3GDQA 3HXMA 4WQ5A 4EIAA 3NGYA 3ZSZA 1TKTA 4A61A 4PHTX 5AFUA 2A42A 4FJIA 2A40A 2P9KB 1HJRA 4FM1A 4PKIA 1E3MA 3ATUA 2GELA 4E7HA 2QWMA 3NF7A 3O3HA 4C1NK 1LAVA 1HX1A 4H0YB 3VQEA 3QNOA 3CCRN 4XIUA 1Q9XA 2OZMA 3A8YA 3V9SA 5J2MA 5BPNA 4FJMA 4CE9A 3I33A 4OVLA 3K5MA 4ISGA 1CZBA 1S1XA 2HB5A 3HO1A 3E66A 4CJLA 3IFRA 1X9JA 5AQRA 2JWLA 1JLQA 3DYAA 3KKSA 2QWPA 3PY8A 3SQ0A 2YHWA 1REVA 2IVNA 4OLBA 1G15A 4LH4A 3NE6A 5GIPA 3TANA 4CI6A 2YNIA 2HHSA 4ID5A 1RDCA 1BHLA 1EP4A 4ICLA 3OHRA 4GW6A 2OCEA 4LFBK 4BY9C 3QFPA 1MWMA 2GBZA 3F73A 4IBNA 3RMAA 4LFAK 2O8CA 3DRPA 3P83D 3OYKA 2IAJA 3CJBA 4M7YA 4E1MA 2I7PA 4CF1A 3WEEB 3AVMA 1Q8IA 1TAQA 3QDKA 4BR4A 3OVNA 3FLCO 5M1KA 4BROA 5C15A 1ASVA 2QA4N 3NDKA 1S6PA 1LW0A 3K2PA 4AILC 1NK7A 3HSTB 5KQ8A 1B9FA 3BF1A 1KXPA 4BRLA 2FSJA 4J2DA 2CGJA 3PX4A 3NMUA 4OJRA 5AQOA 4YOVA 4M3TA 3CCJN 4IFEA 5F2RA 4HTUA 1H1VA 4GNIA 2A1SA 5IT9O 3ZT4A 3CJ1A 4IO9L 4IOCL 1SUQA 4CGJA 3G4SN 4JAXA 3K58A 1FKPA 1NJZA 4CJTA 3DI6A 3DXKA 4AHCA 5E26A 5AQNA 2O8DA 3SUQA 2Q0UA 4ISFA 1S6QA 3H45C 3KLFA 4ILHA 5M1QA 4O44A 2W41A 5TKWA 1RNHA 3L2VA 4HUFA 2F9WA 4LF5K 4Y1DA 3IKMA 5I3UA 1E4FT 3KLGA 3T3FA 3WUHA 3CMEN 3U9ZA 1K8KA 4DQRA 5HOOA 4ELTA 3HSCA 2GX9A 3OBYA 4Z4EA 3WT0A 1C1CA 4WFBL 3EZWA 3AA3A 2E2OA 3ZT2A 4CFDA 4PKGA 1LW2A 2UUAK 4NYFA 1OH5A 3D0PA 2EHGA 3EO3A 1NK6A 2P9LB 2HBMA 3AO2A 4B9QA 4CECA 1GOAA 4CZFA 1D9FA 3F5TA 1XHXA 1NJIO 3CPEA 4CBXA 3RWUA 4CF9A 1VHXA 3S41A 3VQ7A 2W6KA 2XRIA 3U4LA 3OS0A 4JI8K 1GLBG 4TSXA 1KTQA 1RCHA 1SL2A 1HYZA 2NRHA 1NNEA 1YIJN 3TARA 4FLVA 3V9UA 1NJYA 3LDSA 5FRMA 1RBRA 4IWVA 4E1JA 4CEEA 4A2BA 4NXNK 2UXDK 3F2KA 1RBTA 2IC3A 4A5BA 3QINA
chains in the Genus database with same CATH topology
2YHAA 4RW4A 2Q3SA 4NCGA 4W5TA 4WE1A 3O3FA 1C1AA 2GV9A 1WNSA 4O0IA 3V9ZA 1UA0A 3OYBA 2FC0A 1KFDA 2YHBA 3OYDA 4FK4A 3ZSWA 1L3UA 2OPSA 1JL2A 5HLFA 4CGDA 1U48A 1TKDA 4CEQA 2HW3A 4CHNA 5D3GA 5KGXA 4C8OA 3LANA 5J2PA 3HP6A 4BDZA 2Y1JA 1WLJA 1NK5A 3CFPA 4DTSA 4CF0A 2A1RA 4FJ9A 2G8VA 1SKSA 4BWJA 1LWCA 4ZHRA 3U3GA 1QSLA 4EZ9A 3LWMA 4GVMA 4AHSA 4N56A 3RR7A 3ZSVA 5KTQA 2DTUA 2XY7A 4UQGA 3FFIA 3VQCA 3SV4A 2ITGA 2P5OA 1QHTA 4E89A 1VSFA 4JS4A 2OYQA 4E19A 4KHUA 1W9HA 4QAGA 2DFHA 2HHUA 1JLBA 1VSLA 2Z1HA 3HK2A 2XY5A 1DTTA 3F9KA 2F96A 2RF2A 4CIEA 1TKZA 4W5QA 3SQ1A 1NKBA 4C8LA 4IKFA 4J2AA 3NGZA 4CJEA 3VQBA 3NF6A 4E1NA 5E41A 3C6TA 3OYNA 3OYMA 2PZSA 1LAWA 4IDKA 1RTHA 3EYZA 3LAKA 4R5PA 2XY8A 4CF8A 4CGGA 4B3OA 1Z25A 4FW1A 1BISA 2I5JA 4DFJA 1QSYA 3PX6A 4PY5A 4FJKA 1MU2A 3O3GA 1IKVA 2Z1IA 3K5LA 4FLYA 2HHVA 3MXMA 3LPTA 4DQIA 1S1VA 3S3MA 2F8SA 3NBPA 1D9DA 3QLHA 3ISNC 3SQ4A 1VSHA 2DFFA 3NH2A 3AVFA 1IKYA 1U04A 3DLKA 4EZ6A 4DF8A 4H4OA 4N5SA 4Q5VA 1S1UA 2OZSA 1NK9A 4J2EA 3LZIA 2DY4A 1JL1A 1NJZA 4CFAA 1VRTA 1FKOA 3HVRA 3SPZA 4MFBA 5CZ2A 1YT3A 4J2BA 4LSNA 1RBVA 4DSEA 2JGUA 1Y97A 2EX3A 3QO9A 3VQDA 4DSKA 4FJNA 4FXDA 1VSDA 1TGOA 1RT7A 4BWMA 4FM2A 1WSGA 1ASUA 4H8KA 4CHZA 4JLHA 1DTQA 1UWBA 3DRRA 4AHTA 3V4IA 4E0DA 3T1AA 1D5AA 4I7FA 3PO4A 4M42A 1NKEA 1C1BA 1FXXA 3KLIA 1N6QA 3VQ8A 3OYLA 3ZSRA 3U3YA 1ZBHA 4KRFA 3KIOA 1IKWA 4KV8A 3V9WA 1SV5A 1VRUA 4NCAA 1HQUA 2ZQBA 3LZJA 2QK9A 3LP0A 1HQEA 3LP2A 3TAMA 3ZT3A 4B9UA 3KJVA 4DF4A 4CEBA 1B9DA 3VQQA 5KI6A 2KZZA 4M3XA 1ZBUA 1T05A 2Z1JA 3L8BA 3TABA 2VG5A 3QEIA 3QESA 5T7BA 4CJ3A 3SZ2A 1UAXA 3RMBA 1J9AA 1NK0A 3LP3A 3AVIA 4RW8A 3AVNA 3OYGA 1BCOA 3EZ5A 2IGIA 3ITHA 4JRQA 1J5OA 4K8XA 1GOBA 4CIGA 1U47A 2AJQA 4GMJB 3OYJA 3HM9A 3VA3A 1SL1A 2F8TA 2G8KA 5CYQA 4H4MA 4F4KA 3AVKA 2HVIA 3O4NA 2XHBA 1BQMA 3P1GA 3MXJA 5KRTA 3ZSQA 2D0AA 1HMVA 3B6PA 2ZE2A 4DTUA 1HRHA 4DFKA 2ATQA 3SCXA 3RRGA 2HHXA 1RDAA 3TI0A 1TL1A 1ASWA 4E3SA 4BDPA 5I42A 1ZBLA 4DU3A 1KVAA 4CHOA 4DTJA 1KVBA 4DSIA 5HRPA 3RMCA 4IG3A 4FZYA 4CESA 1RT2A 4FLWA 3SUPA 4O4GA 4B8CA 3ASMA 3NF8A 3NF9A 2P1JA 4N47A 1VK0A 3AA4A 3OYIA 1WSEA 1U45A 1FK9A 1S1WA 3AVHA 1HYVA 2OPQA 3IRXA 3IS9A 3CFRA 3DLHA 3QEWA 3V1RA 2IOCA 3HJFA 2BGGA 1RBUA 1S9EA 3A2FA 3AVJA 2IDOA 4KHSA 1L3SA 1CZ9A 2NUBA 2IS3A 5CZ1A 5SWMA 3LALA 4E7KA 1WAJA 3HPHA 3VQAA 3D45A 3V1OA 3OYCA 4BE0A 4FM0A 3ZSYA 5J2NA 2XY6A 1TKXA 3S9HA 1VSKA 4B9MA 3LAMA 5HRRA 1S1TA 4Z0UA 4CK1A 1BIUA 3THVA 4FJ8A 4DLGA 3TAEA 2FBXA 3AVGA 1TV6A 4OKJA 2ETJA 4RW7A 4YNQA 3DRSA 4DFMA 2X74A 3DLEA 3NCIA 3TAFA 3SPYA 2LSNA 1ZYQA 4KTQA 4Z4CA 2BDPA 3P5JA 4CEOA 4DU1A 1VSJA 4M45A 4DSLA 1XWLA 4QCLA 3L3UA 4Y1CA 4M3WA 3SUNA 1BCMA 2KFZA 4HUEA 1L5UA 4DFPA 3TAGA 4FVMA 3AVBA 4F3TA 3QIOA 3OS2A 1JXEA 4DTPA 4FJLA 3O4QA 3VQ4A 1X1PA 4G1QA 3V6DA 4KO0A 1QSSA 5FDLA 3AA2A 1ZBIA 3RRHA 5HROA 4I2PA 4O55A 4W5RA 1WSFA 4ZTFA 3KD5E 4CJKA 1LV5A 4ELUA 1T8EA 3V9XA 3AO4A 3TR8A 1I3AA 2JLEA 3TAQA 1XHZA 4CHQA 4QOZB 4BE1A 4CJ5A 4OGEA 3DMJA 1W0HA 4ID1A 1C0UA 3VQPA 4EP5A 4CJSA 3SQ2A 2VG6A 2R7YA 4DU4A 2HMIA 4CFBA 4KI6A 3SUOA 5J2QA 3L3VA 1IG9A 2G8UA 3K5NA 3JYTA 4FW2A 3LP1A 4C8NA 3M8QA 3M8RA 4Z4IA 3KKRA 4FCYA 2BANA 2O4GA 3MEGA 5HRNA 4KFBA 4CJ4A 3L2RA 1NKCA 4KPYA 4PUOA 1RTDA 1KLMA 1RDDA 4PA1A 1S9GA 4CGHA 4KREA 3RTVA 4C8KA 4E7JA 2KFNA 3AO3A 4CJQA 3SJJA 3C94A 4Z4FA 2VWJA 4HHTA 1Z26A 3KK1A 4ELVA 1JLGA 1BQNA 1X9SA 2G8IA 1A5WA 1KCFA 2FBYA 3MECA 3G0ZA 3WNGA 3ZT1A 4DSFA 1TK5A 4PWDA 4AHUA 3I0RA 1K6YA 4DMNA 2OPPA 1JLEA 2HHWA 2X78A 1SL0A 3L2UA 2PY5A 4IFVA 1C0TA 1A5VA 4CK3A 3K59A 4L8RB 5DMRA 4CGFA 3QEVA 3M8SA 2RN2A 4M41A 1J53A 2WONA 3MEDA 4FLTA 1GOCA 4NYNA 1RT1A 1WSIA 3LWLA 4DTNA 2OPRA 2KQ2A 3QEPA 4CEZA 4FJHA 2YNHA 3TWHA 3CM6A 3T19A 5C25A 1CLQA 2PYJA 5CY4A 3HYFA 4M3YA 1RT5A 4OPJA 3MEEA 1WSHA 1SKWA 2G8FA 1U4BA 4E7LA 1F21A 4DQSA 2B5JA 3ZSOA 3BDPA 3DM2A 4IG0A 3KK2A 4KI4A 2KZMA 4CFCA 3VQ9A 3VQ6A 4BE2A 3S3NA 1QS4A 4CGIA 1RT3A 1O1WA 1L3VA 1EETA 2QXFA 5SZTA 5KRSA 3NFAA 1KVCA 3HXMA 1JXBA 1N5YA 2HNYA 1WN7A 4KB1A 4W5OA 4DQQA 2YNFA 3NGYA 3ZSZA 2BE2A 3S3OA 4CCHA 1TKTA 3CM5A 4JRPA 2G8HA 1VSIA 4W5NA 1KRPA 1VSEA 4DTOA 1T03A 3DLGA 4FLUA 4FJIA 4AH9A 3OYHA 1HJRA 4LSLA 4OLAA 1YVUA 1RT6A 4FM1A 4RW9A 4M3ZA 2KW4A 3OJUA 4E7HA 4E7IA 5J1EA 4FJ5A 3NF7A 3O3HA 3CG7A 1LAVA 2D0CA 3VQEA 1VSMA 3DOKA 3QNOA 1RT4A 3QETA 4CJUA 2KTQA 5HBMA 4M3RA 4CHPA 4XIUA 1A5XA 3NH0A 3NHGA 1Q9XA 5J2MA 3V9SA 2OZMA 2HHTA 3CFOA 4RW6A 3PO5A 4FJMA 4DTXA 2G8WA 4CE9A 3M8PA 4OVLA 1EX4A 4AHRA 4AHVA 2E6MA 3K5MA 4F3OA 3K57A 1RDBA 3AO1A 1CZBA 5C24A 3OYFA 1HYSA 1XC9A 1S1XA 2HB5A 3HO1A 2RPIA 3AA5X 3OS1A 3SNNA 4CJLA 4HCCA 4BACA 4FLZA 4B9NA 4KB0A 2VWKA 4FK2A 3DLBA 1JLQA 1C6VA 3DYAA 2D5RA 5JS2A 3KKSA 3PY8A 4DTMA 3SQ0A 4HUGA 4OKKA 3V81A 2HVHA 4FYDA 5FROA 1REVA 4OLBA 1G15A 1ITGA 3HVTA 4LH4A 3QEXA 4B9SA 3NE6A 3H08A 3OJSA 3BGRA 4FZZA 4YFUA 3TANA 4ZTJA 4B9LA 3AV9A 3NAEA 2YNIA 3VA0A 4B9TA 2HHSA 4ID5A 1LWEA 4FK0A 3AO5A 1KLNA 4O5BA 1RDCA 3OYEA 1BHLA 1EP4A 4ICLA 3LPUA 4GW6A 5HP1A 3OY9A 5KGWA 1SKRA 4I9QA 4Z4GA 4FLXA 3RR8A 4KAZA 2GBZA 3F73A 4IBNA 3RMAA 1JLAA 4DLEA 3AVCA 3DRPA 4CEFA 3P83D 1EKEA 4F2SA 3OYKA 2B6AA 2IAJA 4NCBA 4E1MA 1RTIA 1WAFA 2X6NA 4CF1A 1DLOA 2HNZA 3KLHA 1C0MA 3DOLA 4HCBA 4IFYA 4CF2A 3VQ5A 4N76A 3MXIA 3AVMA 1Q8IA 1TAQA 1S5JA 3PUFA 1TK8A 3SYZA 3MAQA 3NH1A 3OVNA 1YTAA 3HPOA 1ASVA 4EP4A 1X9MA 3NDKA 1S6PA 1LW0A 3K2PA 4AILC 3KLEA 3RMDA 1NK7A 3HSTB 1B9FA 4CERA 4KTZA 4HVJA 4LY7A 2DFEA 2QKKA 4FJ7A 1JLFA 4J2DA 2E4LA 4DSJA 3PX4A 4CJRA 1TL3A 4OKEA 4Z4HA 3B6OA 4OJRA 1NJWA 4M3TA 4B8AB 3AVAA 3NGIA 4I2QA 3ZT0A 4M3UA 4DQPA 4F8RA 1YTUA 3WNFA 4HTUA 1I39A 2A1SA 3V1QA 3PX0A 3ZT4A 1SUQA 2P51A 4CGJA 3UIQA 4LD0A 3K58A 3EY1A 1FKPA 3C95A 3TAPA 4CJTA 2FBVA 2YKMA 3DI6A 3E01A 4KTWA 4AHCA 3CQ8A 3QIPA 2PYLA 3G10A 1X9WA 2P5GA 5EU7A 4CIFA 1IKXA 1R0AA 1BL3A 1LWFA 3SUQA 4C8MA 4KKOA 2HNDA 4O0JA 3WNEA 1S6QA 4CJPA 3KLFA 3SV3A 1KSPA 1BI4A 4B9VA 4FJXA 5C42A 4O44A 1RNHA 3K5OA 4MQ3A 3L2VA 4CJFA 4HUFA 1KFSA 2OA8A 2YV0X 1TVRA 2X6SA 1IO2A 2RKIA 2VG7A 4OGCA 1RTJA 3HP9A 4Y1DA 2XO7A 3HT3A 3QERA 5I3UA 1CXQA 1L3TA 4K8ZA 3KLGA 3HL8A 3T3FA 3ZCMA 1U49A 1HNIA 4DQRA 4Q0BA 3OYAA 4ELTA 1IH7A 2GUIA 3KD1E 1TK0A 4Z4EA 3AVLA 3WNHA 1C1CA 3AA3A 2O4IA 3ZT2A 2E6LA 4CFDA 4BDYA 1ZBFA 2QKBA 2HHQA 1BGXT 1LW2A 1B92A 1CXUA 4LH5A 1UOCA 3ULDA 2W42A 4NYFA 1EXQA 3L2QA 3D0PA 2EHGA 3I8DA 3KK3A 1RBSA 1QQCA 4CK2A 1NK6A 3PV8A 4CEDA 1T7PA 4KHNA 3AO2A 4CECA 1GOAA 4KHWA 1D9FA 1XHXA 1Q9YA 1NOZA 4CHYA 4DS5A 4OPKA 1QE1A 2ZD1A 1WSJA 1NK4A 3RWUA 1UA1A 4CF9A 1NOYA 1QTMA 1D8YA 4FZXC 2D0BA 1BI4B 3C6UA 2YNGA 3VQ7A 4I9LA 3VN5A 4B08A 4DTRA 4F2RA 2XRIA 4DG1A 1XI1A 2FBTA 3OS0A 4PQUA 5JS1A 3QNNA 4TSXA 4DS4A 4FJJA 4CJWA 1KTQA 1RCHA 5HRSA 1SL2A 1NJXA 1HYZA 3ZSXA 3CYMA 4N41A 1TAUA 3TARA 3ALYA 4FLVA 3V9UA 1NJYA 1JKHA 5CYMA 3LDSA 4FJGA 4JS5A 5FRMA 3JSMA 1JLCA 4KHYA 1RBRA 4RG8A 1HNVA 3U6FA 3IG1A 1BIZA 4CJVA 2B4JA 1RILA 5DK5A 5K14A 4CEEA 2Z1GA 4DWIA 2YKNA 3L2WA 3I0SA 5FRNA 1RBTA 3SI6A 2WOMA 3DLRA 4CEAA 2IC3A 1HPZA 3IAYA 1J54A 1NK8A 3HPGA 4KHQA 2Y1IA 3KTQA 3QINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YHA A;  4RW4 A;  2Q3S A;  4NCG A;  4W5T A;  4WE1 A;  3O3F A;  1C1A A;  2GV9 A;  1WNS A;  4O0I A;  3V9Z A;  1UA0 A;  3OYB A;  2FC0 A;  1KFD A;  2YHB A;  3OYD A;  4FK4 A;  3ZSW A;  1L3U A;  2OPS A;  1JL2 A;  5HLF A;  4CGD A;  1U48 A;  1TKD A;  4CEQ A;  2HW3 A;  4CHN A;  5D3G A;  5KGX A;  4C8O A;  3LAN A;  5J2P A;  3HP6 A;  4BDZ A;  2Y1J A;  1WLJ A;  1NK5 A;  3CFP A;  4DTS A;  4CF0 A;  2A1R A;  4FJ9 A;  2G8V A;  1SKS A;  4BWJ A;  1LWC A;  4ZHR A;  3U3G A;  1QSL A;  4EZ9 A;  3LWM A;  4GVM A;  4AHS A;  4N56 A;  3RR7 A;  3ZSV A;  5KTQ A;  2DTU A;  2XY7 A;  4UQG A;  3FFI A;  3VQC A;  3SV4 A;  2ITG A;  2P5O A;  1QHT A;  4E89 A;  1VSF A;  4JS4 A;  2OYQ A;  4E19 A;  4KHU A;  1W9H A;  4QAG A;  2DFH A;  2HHU A;  1JLB A;  1VSL A;  2Z1H A;  3HK2 A;  2XY5 A;  1DTT A;  3F9K A;  2F96 A;  2RF2 A;  4CIE A;  1TKZ A;  4W5Q A;  3SQ1 A;  1NKB A;  4C8L A;  4IKF A;  4J2A A;  3NGZ A;  4CJE A;  3VQB A;  3NF6 A;  4E1N A;  5E41 A;  3C6T A;  3OYN A;  3OYM A;  2PZS A;  1LAW A;  4IDK A;  1RTH A;  3EYZ A;  3LAK A;  4R5P A;  2XY8 A;  4CF8 A;  4CGG A;  4B3O A;  1Z25 A;  4FW1 A;  1BIS A;  2I5J A;  4DFJ A;  1QSY A;  3PX6 A;  4PY5 A;  4FJK A;  1MU2 A;  3O3G A;  1IKV A;  2Z1I A;  3K5L A;  4FLY A;  2HHV A;  3MXM A;  3LPT A;  4DQI A;  1S1V A;  3S3M A;  2F8S A;  3NBP A;  1D9D A;  3QLH A;  3ISN C;  3SQ4 A;  1VSH A;  2DFF A;  3NH2 A;  3AVF A;  1IKY A;  1U04 A;  3DLK A;  4EZ6 A;  4DF8 A;  4H4O A;  4N5S A;  4Q5V A;  1S1U A;  2OZS A;  1NK9 A;  4J2E A;  3LZI A;  2DY4 A;  1JL1 A;  1NJZ A;  4CFA A;  1VRT A;  1FKO A;  3HVR A;  3SPZ A;  4MFB A;  5CZ2 A;  1YT3 A;  4J2B A;  4LSN A;  1RBV A;  4DSE A;  2JGU A;  1Y97 A;  2EX3 A;  3QO9 A;  3VQD A;  4DSK A;  4FJN A;  4FXD A;  1VSD A;  1TGO A;  1RT7 A;  4BWM A;  4FM2 A;  1WSG A;  1ASU A;  4H8K A;  4CHZ A;  4JLH A;  1DTQ A;  1UWB A;  3DRR A;  4AHT A;  3V4I A;  4E0D A;  3T1A A;  1D5A A;  4I7F A;  3PO4 A;  4M42 A;  1NKE A;  1C1B A;  1FXX A;  3KLI A;  1N6Q A;  3VQ8 A;  3OYL A;  3ZSR A;  3U3Y A;  1ZBH A;  4KRF A;  3KIO A;  1IKW A;  4KV8 A;  3V9W A;  1SV5 A;  1VRU A;  4NCA A;  1HQU A;  2ZQB A;  3LZJ A;  2QK9 A;  3LP0 A;  1HQE A;  3LP2 A;  3TAM A;  3ZT3 A;  4B9U A;  3KJV A;  4DF4 A;  4CEB A;  1B9D A;  3VQQ A;  5KI6 A;  2KZZ A;  4M3X A;  1ZBU A;  1T05 A;  2Z1J A;  3L8B A;  3TAB A;  2VG5 A;  3QEI A;  3QES A;  5T7B A;  4CJ3 A;  3SZ2 A;  1UAX A;  3RMB A;  1J9A A;  1NK0 A;  3LP3 A;  3AVI A;  4RW8 A;  3AVN A;  3OYG A;  1BCO A;  3EZ5 A;  2IGI A;  3ITH A;  4JRQ A;  1J5O A;  4K8X A;  1GOB A;  4CIG A;  1U47 A;  2AJQ A;  4GMJ B;  3OYJ A;  3HM9 A;  3VA3 A;  1SL1 A;  2F8T A;  2G8K A;  5CYQ A;  4H4M A;  4F4K A;  3AVK A;  2HVI A;  3O4N A;  2XHB A;  1BQM A;  3P1G A;  3MXJ A;  5KRT A;  3ZSQ A;  2D0A A;  1HMV A;  3B6P A;  2ZE2 A;  4DTU A;  1HRH A;  4DFK A;  2ATQ A;  3SCX A;  3RRG A;  2HHX A;  1RDA A;  3TI0 A;  1TL1 A;  1ASW A;  4E3S A;  4BDP A;  5I42 A;  1ZBL A;  4DU3 A;  1KVA A;  4CHO A;  4DTJ A;  1KVB A;  4DSI A;  5HRP A;  3RMC A;  4IG3 A;  4FZY A;  4CES A;  1RT2 A;  4FLW A;  3SUP A;  4O4G A;  4B8C A;  3ASM A;  3NF8 A;  3NF9 A;  2P1J A;  4N47 A;  1VK0 A;  3AA4 A;  3OYI A;  1WSE A;  1U45 A;  1FK9 A;  1S1W A;  3AVH A;  1HYV A;  2OPQ A;  3IRX A;  3IS9 A;  3CFR A;  3DLH A;  3QEW A;  3V1R A;  2IOC A;  3HJF A;  2BGG A;  1RBU A;  1S9E A;  3A2F A;  3AVJ A;  2IDO A;  4KHS A;  1L3S A;  1CZ9 A;  2NUB A;  2IS3 A;  5CZ1 A;  5SWM A;  3LAL A;  4E7K A;  1WAJ A;  3HPH A;  3VQA A;  3D45 A;  3V1O A;  3OYC A;  4BE0 A;  4FM0 A;  3ZSY A;  5J2N A;  2XY6 A;  1TKX A;  3S9H A;  1VSK A;  4B9M A;  3LAM A;  5HRR A;  1S1T A;  4Z0U A;  4CK1 A;  1BIU A;  3THV A;  4FJ8 A;  4DLG A;  3TAE A;  2FBX A;  3AVG A;  1TV6 A;  4OKJ A;  2ETJ A;  4RW7 A;  4YNQ A;  3DRS A;  4DFM A;  2X74 A;  3DLE A;  3NCI A;  3TAF A;  3SPY A;  2LSN A;  1ZYQ A;  4KTQ A;  4Z4C A;  2BDP A;  3P5J A;  4CEO A;  4DU1 A;  1VSJ A;  4M45 A;  4DSL A;  1XWL A;  4QCL A;  3L3U A;  4Y1C A;  4M3W A;  3SUN A;  1BCM A;  2KFZ A;  4HUE A;  1L5U A;  4DFP A;  3TAG A;  4FVM A;  3AVB A;  4F3T A;  3QIO A;  3OS2 A;  1JXE A;  4DTP A;  4FJL A;  3O4Q A;  3VQ4 A;  1X1P A;  4G1Q A;  3V6D A;  4KO0 A;  1QSS A;  5FDL A;  3AA2 A;  1ZBI A;  3RRH A;  5HRO A;  4I2P A;  4O55 A;  4W5R A;  1WSF A;  4ZTF A;  3KD5 E;  4CJK A;  1LV5 A;  4ELU A;  1T8E A;  3V9X A;  3AO4 A;  3TR8 A;  1I3A A;  2JLE A;  3TAQ A;  1XHZ A;  4CHQ A;  4QOZ B;  4BE1 A;  4CJ5 A;  4OGE A;  3DMJ A;  1W0H A;  4ID1 A;  1C0U A;  3VQP A;  4EP5 A;  4CJS A;  3SQ2 A;  2VG6 A;  2R7Y A;  4DU4 A;  2HMI A;  4CFB A;  4KI6 A;  3SUO A;  5J2Q A;  3L3V A;  1IG9 A;  2G8U A;  3K5N A;  3JYT A;  4FW2 A;  3LP1 A;  4C8N A;  3M8Q A;  3M8R A;  4Z4I A;  3KKR A;  4FCY A;  2BAN A;  2O4G A;  3MEG A;  5HRN A;  4KFB A;  4CJ4 A;  3L2R A;  1NKC A;  4KPY A;  4PUO A;  1RTD A;  1KLM A;  1RDD A;  4PA1 A;  1S9G A;  4CGH A;  4KRE A;  3RTV A;  4C8K A;  4E7J A;  2KFN A;  3AO3 A;  4CJQ A;  3SJJ A;  3C94 A;  4Z4F A;  2VWJ A;  4HHT A;  1Z26 A;  3KK1 A;  4ELV A;  1JLG A;  1BQN A;  1X9S A;  2G8I A;  1A5W A;  1KCF A;  2FBY A;  3MEC A;  3G0Z A;  3WNG A;  3ZT1 A;  4DSF A;  1TK5 A;  4PWD A;  4AHU A;  3I0R A;  1K6Y A;  4DMN A;  2OPP A;  1JLE A;  2HHW A;  2X78 A;  1SL0 A;  3L2U A;  2PY5 A;  4IFV A;  1C0T A;  1A5V A;  4CK3 A;  3K59 A;  4L8R B;  5DMR A;  4CGF A;  3QEV A;  3M8S A;  2RN2 A;  4M41 A;  1J53 A;  2WON A;  3MED A;  4FLT A;  1GOC A;  4NYN A;  1RT1 A;  1WSI A;  3LWL A;  4DTN A;  2OPR A;  2KQ2 A;  3QEP A;  4CEZ A;  4FJH A;  2YNH A;  3TWH A;  3CM6 A;  3T19 A;  5C25 A;  1CLQ A;  2PYJ A;  5CY4 A;  3HYF A;  4M3Y A;  1RT5 A;  4OPJ A;  3MEE A;  1WSH A;  1SKW A;  2G8F A;  1U4B A;  4E7L A;  1F21 A;  4DQS A;  2B5J A;  3ZSO A;  3BDP A;  3DM2 A;  4IG0 A;  3KK2 A;  4KI4 A;  2KZM A;  4CFC A;  3VQ9 A;  3VQ6 A;  4BE2 A;  3S3N A;  1QS4 A;  4CGI A;  1RT3 A;  1O1W A;  1L3V A;  1EET A;  2QXF A;  5SZT A;  5KRS A;  3NFA A;  1KVC A;  3HXM A;  1JXB A;  1N5Y A;  2HNY A;  1WN7 A;  4KB1 A;  4W5O A;  4DQQ A;  2YNF A;  3NGY A;  3ZSZ A;  2BE2 A;  3S3O A;  4CCH A;  1TKT A;  3CM5 A;  4JRP A;  2G8H A;  1VSI A;  4W5N A;  1KRP A;  1VSE A;  4DTO A;  1T03 A;  3DLG A;  4FLU A;  4FJI A;  4AH9 A;  3OYH A;  1HJR A;  4LSL A;  4OLA A;  1YVU A;  1RT6 A;  4FM1 A;  4RW9 A;  4M3Z A;  2KW4 A;  3OJU A;  4E7H A;  4E7I A;  5J1E A;  4FJ5 A;  3NF7 A;  3O3H A;  3CG7 A;  1LAV A;  2D0C A;  3VQE A;  1VSM A;  3DOK A;  3QNO A;  1RT4 A;  3QET A;  4CJU A;  2KTQ A;  5HBM A;  4M3R A;  4CHP A;  4XIU A;  1A5X A;  3NH0 A;  3NHG A;  1Q9X A;  5J2M A;  3V9S A;  2OZM A;  2HHT A;  3CFO A;  4RW6 A;  3PO5 A;  4FJM A;  4DTX A;  2G8W A;  4CE9 A;  3M8P A;  4OVL A;  1EX4 A;  4AHR A;  4AHV A;  2E6M A;  3K5M A;  4F3O A;  3K57 A;  1RDB A;  3AO1 A;  1CZB A;  5C24 A;  3OYF A;  1HYS A;  1XC9 A;  1S1X A;  2HB5 A;  3HO1 A;  2RPI A;  3AA5 X;  3OS1 A;  3SNN A;  4CJL A;  4HCC A;  4BAC A;  4FLZ A;  4B9N A;  4KB0 A;  2VWK A;  4FK2 A;  3DLB A;  1JLQ A;  1C6V A;  3DYA A;  2D5R A;  5JS2 A;  3KKS A;  3PY8 A;  4DTM A;  3SQ0 A;  4HUG A;  4OKK A;  3V81 A;  2HVH A;  4FYD A;  5FRO A;  1REV A;  4OLB A;  1G15 A;  1ITG A;  3HVT A;  4LH4 A;  3QEX A;  4B9S A;  3NE6 A;  3H08 A;  3OJS A;  3BGR A;  4FZZ A;  4YFU A;  3TAN A;  4ZTJ A;  4B9L A;  3AV9 A;  3NAE A;  2YNI A;  3VA0 A;  4B9T A;  2HHS A;  4ID5 A;  1LWE A;  4FK0 A;  3AO5 A;  1KLN A;  4O5B A;  1RDC A;  3OYE A;  1BHL A;  1EP4 A;  4ICL A;  3LPU A;  4GW6 A;  5HP1 A;  3OY9 A;  5KGW A;  1SKR A;  4I9Q A;  4Z4G A;  4FLX A;  3RR8 A;  4KAZ A;  2GBZ A;  3F73 A;  4IBN A;  3RMA A;  1JLA A;  4DLE A;  3AVC A;  3DRP A;  4CEF A;  3P83 D;  1EKE A;  4F2S A;  3OYK A;  2B6A A;  2IAJ A;  4NCB A;  4E1M A;  1RTI A;  1WAF A;  2X6N A;  4CF1 A;  1DLO A;  2HNZ A;  3KLH A;  1C0M A;  3DOL A;  4HCB A;  4IFY A;  4CF2 A;  3VQ5 A;  4N76 A;  3MXI A;  3AVM A;  1Q8I A;  1TAQ A;  1S5J A;  3PUF A;  1TK8 A;  3SYZ A;  3MAQ A;  3NH1 A;  3OVN A;  1YTA A;  3HPO A;  1ASV A;  4EP4 A;  1X9M A;  3NDK A;  1S6P A;  1LW0 A;  3K2P A;  4AIL C;  3KLE A;  3RMD A;  1NK7 A;  3HST B;  1B9F A;  4CER A;  4KTZ A;  4HVJ A;  4LY7 A;  2DFE A;  2QKK A;  4FJ7 A;  1JLF A;  4J2D A;  2E4L A;  4DSJ A;  3PX4 A;  4CJR A;  1TL3 A;  4OKE A;  4Z4H A;  3B6O A;  4OJR A;  1NJW A;  4M3T A;  4B8A B;  3AVA A;  3NGI A;  4I2Q A;  3ZT0 A;  4M3U A;  4DQP A;  4F8R A;  1YTU A;  3WNF A;  4HTU A;  1I39 A;  2A1S A;  3V1Q A;  3PX0 A;  3ZT4 A;  1SUQ A;  2P51 A;  4CGJ A;  3UIQ A;  4LD0 A;  3K58 A;  3EY1 A;  1FKP A;  3C95 A;  3TAP A;  4CJT A;  2FBV A;  2YKM A;  3DI6 A;  3E01 A;  4KTW A;  4AHC A;  3CQ8 A;  3QIP A;  2PYL A;  3G10 A;  1X9W A;  2P5G A;  5EU7 A;  4CIF A;  1IKX A;  1R0A A;  1BL3 A;  1LWF A;  3SUQ A;  4C8M A;  4KKO A;  2HND A;  4O0J A;  3WNE A;  1S6Q A;  4CJP A;  3KLF A;  3SV3 A;  1KSP A;  1BI4 A;  4B9V A;  4FJX A;  5C42 A;  4O44 A;  1RNH A;  3K5O A;  4MQ3 A;  3L2V A;  4CJF A;  4HUF A;  1KFS A;  2OA8 A;  2YV0 X;  1TVR A;  2X6S A;  1IO2 A;  2RKI A;  2VG7 A;  4OGC A;  1RTJ A;  3HP9 A;  4Y1D A;  2XO7 A;  3HT3 A;  3QER A;  5I3U A;  1CXQ A;  1L3T A;  4K8Z A;  3KLG A;  3HL8 A;  3T3F A;  3ZCM A;  1U49 A;  1HNI A;  4DQR A;  4Q0B A;  3OYA A;  4ELT A;  1IH7 A;  2GUI A;  3KD1 E;  1TK0 A;  4Z4E A;  3AVL A;  3WNH A;  1C1C A;  3AA3 A;  2O4I A;  3ZT2 A;  2E6L A;  4CFD A;  4BDY A;  1ZBF A;  2QKB A;  2HHQ A;  1BGX T;  1LW2 A;  1B92 A;  1CXU A;  4LH5 A;  1UOC A;  3ULD A;  2W42 A;  4NYF A;  1EXQ A;  3L2Q A;  3D0P A;  2EHG A;  3I8D A;  3KK3 A;  1RBS A;  1QQC A;  4CK2 A;  1NK6 A;  3PV8 A;  4CED A;  1T7P A;  4KHN A;  3AO2 A;  4CEC A;  1GOA A;  4KHW A;  1D9F A;  1XHX A;  1Q9Y A;  1NOZ A;  4CHY A;  4DS5 A;  4OPK A;  1QE1 A;  2ZD1 A;  1WSJ A;  1NK4 A;  3RWU A;  1UA1 A;  4CF9 A;  1NOY A;  1QTM A;  1D8Y A;  4FZX C;  2D0B A;  1BI4 B;  3C6U A;  2YNG A;  3VQ7 A;  4I9L A;  3VN5 A;  4B08 A;  4DTR A;  4F2R A;  2XRI A;  4DG1 A;  1XI1 A;  2FBT A;  3OS0 A;  4PQU A;  5JS1 A;  3QNN A;  4TSX A;  4DS4 A;  4FJJ A;  4CJW A;  1KTQ A;  1RCH A;  5HRS A;  1SL2 A;  1NJX A;  1HYZ A;  3ZSX A;  3CYM A;  4N41 A;  1TAU A;  3TAR A;  3ALY A;  4FLV A;  3V9U A;  1NJY A;  1JKH A;  5CYM A;  3LDS A;  4FJG A;  4JS5 A;  5FRM A;  3JSM A;  1JLC A;  4KHY A;  1RBR A;  4RG8 A;  1HNV A;  3U6F A;  3IG1 A;  1BIZ A;  4CJV A;  2B4J A;  1RIL A;  5DK5 A;  5K14 A;  4CEE A;  2Z1G A;  4DWI A;  2YKN A;  3L2W A;  3I0S A;  5FRN A;  1RBT A;  3SI6 A;  2WOM A;  3DLR A;  4CEA A;  2IC3 A;  1HPZ A;  3IAY A;  1J54 A;  1NK8 A;  3HPG A;  4KHQ A;  2Y1I A;  3KTQ A;  3QIN A; 
#chains in the Genus database with same CATH topology
 4A5A A;  1OH7 A;  3V9Z A;  3OYD A;  4FK4 A;  1L3U A;  1WB9 A;  4FO0 A;  4CEQ A;  4CHN A;  5ADX H;  1NGC A;  4U7B A;  3U8X A;  5J2P A;  4BDZ A;  4FWQ A;  3CFP A;  5GAD P;  2G8V A;  5KPR A;  4EZ9 A;  4N56 A;  3KWG A;  5KTQ A;  4C1N I;  1RDW X;  3B8A X;  3THY B;  2HF4 A;  4JS4 A;  1VSF A;  3J8A A;  4BRA A;  3SK3 A;  1JLB A;  1T3V A;  3HK2 A;  4B1Z A;  5BPL A;  2F96 A;  3WEE A;  3K0S A;  1TKZ A;  3SQ1 A;  2ZJQ L;  3AAQ A;  4A57 A;  3VQB A;  1VQP N;  2PZS A;  2VGM A;  2XY8 A;  1Z25 A;  2I5J A;  3E9P A;  3PX6 A;  3BF3 A;  4FJK A;  1MU2 A;  3O3G A;  1Q86 O;  3ID6 A;  1XC3 A;  3MXM A;  3K9K A;  2F8S A;  1D9D A;  4X66 K;  3M1F A;  3SQ4 A;  5AQY A;  1U04 A;  4EZ6 A;  3LZI A;  1VRT A;  3WQU A;  5CZ2 A;  3O9U A;  4CBU A;  4DSE A;  3QO9 A;  2EX3 A;  3FZL A;  1WSG A;  1ASU A;  5M1N A;  2IIR A;  3M5R A;  1C1B A;  1RDU A;  4B1Y B;  3OYL A;  3V9W A;  1VRU A;  2ZQB A;  3VGM A;  3QEI A;  4LF7 K;  3QES A;  5CHI A;  3MMV A;  5T7B A;  4KBO A;  3RMB A;  4JYA K;  5AQG A;  1NK0 A;  4JI1 K;  2IGI A;  3HI0 A;  1U47 A;  1QZ5 A;  4H4M A;  2HVI A;  2XHB A;  1BQM A;  3MXJ A;  3TTD A;  2D0A A;  2Q31 A;  3B6P A;  4B1U B;  4FOE A;  4DTU A;  5M1F A;  4L3Q A;  3TI0 A;  1TL1 A;  3CCL N;  4BDP A;  1KVA A;  1KVB A;  1DT9 A;  5M1O A;  1WBB A;  3THX A;  1C0G A;  1RT2 A;  4CES A;  4FLW A;  4O4G A;  5FPE A;  3NF9 A;  4JI5 K;  3AA4 A;  1FK9 A;  1HYV A;  3IS9 A;  3QEW A;  3V1R A;  1ATR A;  3HJF A;  3AVJ A;  3J7Y P;  4JD2 A;  2A41 A;  2D4W A;  2UU9 K;  5CZ1 A;  5AQQ A;  3HPH A;  3VEX A;  1V4S A;  4IXC A;  3V1O A;  3S9H A;  3UKU B;  3LAM A;  3THV A;  2Q0R A;  4NLB A;  3TAE A;  3AVG A;  4OKJ A;  2ETJ A;  4RW7 A;  4YNQ A;  3I56 N;  3DRS A;  3DLE A;  3SPY A;  3I55 N;  4JKC A;  4BVP A;  4DU1 A;  1XWL A;  4Y1C A;  2D0O A;  3SUN A;  1BCM A;  4HUE A;  4JKG B;  2FLO A;  2V51 B;  3QIO A;  3NVM A;  1JXE A;  3C6H A;  4DTP A;  3VQ4 A;  4KO0 A;  1OH8 A;  3EEQ A;  2F9T A;  5FDL A;  5HRO A;  3J80 O;  1T8E A;  1S22 A;  3TR8 A;  3MN9 A;  3O80 A;  1GLF O;  3TAQ A;  2AP1 A;  4CHQ A;  4RWT A;  4OGE A;  3SQ2 A;  4CZE A;  3L3V A;  2G8U A;  4FWO A;  4WF9 L;  3MEG A;  1G99 A;  4DB3 A;  3VPZ A;  4GKK K;  1KLM A;  1S9G A;  2KFN A;  3RTV A;  4C8K A;  4CVN E;  4E7J A;  1NWK A;  1JLG A;  1X9S A;  2O8B A;  1KCF A;  2FBY A;  3G0Z A;  4IO8 A;  1JLE A;  3IDH A;  3L2U A;  3J81 O;  4BR5 A;  4L8R B;  4CGF A;  3UE5 A;  2NRW A;  1J53 A;  3MN5 A;  4DHY A;  3L4I A;  1GOC A;  4CZM A;  1RT1 A;  4KHP K;  4JKE A;  3SLC A;  1CLQ A;  2E1Z A;  5CY4 A;  1HNW K;  3HYF A;  4M3Y A;  5BRF A;  4BC3 A;  2G8F A;  4E7L A;  2B5J A;  4BG8 A;  3SAF A;  4CFC A;  4JI6 K;  3M3Z A;  4FWP A;  2VQE K;  4WCE L;  2UXB K;  5KRS A;  2HNY A;  4W5O A;  4CCH A;  4JI4 K;  3CM5 A;  2G8H A;  1VSI A;  4DR7 K;  3O8M A;  4FWL A;  1XMQ K;  1YVU A;  5KQD A;  1RT6 A;  3ULE B;  3OTO K;  2KW4 A;  4K25 A;  2HST A;  4E7I A;  4FJ5 A;  5BR9 A;  3CIP A;  1QQO A;  3QET A;  4CHP A;  3NHG A;  1A5X A;  4CD1 A;  4YOY A;  1QZ6 A;  3CFO A;  4RW6 A;  4DTX A;  4Y0W A;  1U2V B;  1EX4 A;  2E2Q A;  2E6M A;  1Z6R A;  2QM1 A;  3K9J A;  3AO1 A;  3OYF A;  4B1W B;  5AQS A;  4WFA L;  4AF1 A;  2RPI A;  1N33 K;  3QIC A;  5F1X A;  4HCC A;  4BAC A;  4B9N A;  4FK2 A;  1C6V A;  1KD1 O;  3GBT A;  3ZET A;  3T69 A;  4FYD A;  3CF5 L;  1ITG A;  3MCA B;  3H08 A;  4YFU A;  2UUC K;  4F9O A;  3H3O B;  3AV9 A;  3NAE A;  3AO5 A;  4JNE A;  5C0Y A;  3OY9 A;  1SKR A;  4I9Q A;  4Z4G A;  4FLX A;  4GKJ K;  4QS9 A;  1JLA A;  4DLE A;  3AVC A;  4YHH K;  4CEF A;  1Z05 A;  1EKE A;  3CJ7 A;  1Q81 O;  4DR3 K;  3KLH A;  3DOL A;  4IFY A;  4N76 A;  4K43 A;  3SMP A;  3MWT A;  4NLC A;  5BRH A;  1P90 A;  4EP4 A;  3VOV A;  1VQ4 N;  3Q7B A;  5AQL A;  4KTZ A;  4HVJ A;  2QKK A;  4B3M K;  2ASO A;  4JK7 A;  2E4L A;  4XH5 A;  4Z4H A;  3BEX A;  4B8A B;  3AVA A;  5ELZ A;  4M3U A;  1I39 A;  2NRT A;  3CC4 N;  1Q7Y O;  3UIQ A;  3VTI A;  4JHD A;  4LD0 A;  3EY1 A;  2FBV A;  4KTW A;  3CQ8 A;  2PYL A;  5AJ3 K;  5GIO A;  1X9W A;  2P5G A;  4BRC A;  1K8A O;  4CIF A;  1LWF A;  4C8M A;  4O0J A;  3VMF B;  3SV3 A;  1KSP A;  1BI4 A;  4FJX A;  1NM1 A;  4IOA L;  2YV0 X;  1NGA A;  3CJC A;  1IO2 A;  4OGC A;  3QER A;  1K9M O;  2HBK A;  1L3T A;  1U49 A;  2WTU A;  4DR4 K;  3ZCM A;  3D2F B;  5EVZ A;  1OKJ A;  3VGK A;  3TSP A;  1E4G T;  4BRN A;  2O4I A;  2A5X A;  3T1H K;  2E6L A;  2QKB A;  1ZBF A;  2HHQ A;  1BGX T;  1B92 A;  1XUP O;  4LH5 A;  1UOC A;  3N4Q A;  3AY9 A;  3I8D A;  2GWK A;  1NGE A;  2E8A A;  4EAH D;  1J6Z A;  3LDO A;  2V7Y A;  1LCU A;  1T7P A;  3O1B A;  1Q9Y A;  4CHY A;  5F0X A;  4DS5 A;  1MWK A;  2ZD1 A;  1NK4 A;  4CBW A;  4FWK A;  1NOY A;  4BQL A;  1BI4 B;  3C6U A;  2YNG A;  3GE1 A;  4B08 A;  5JS1 A;  1XI1 A;  2FBT A;  4DS4 A;  4CJW A;  1NJX A;  3U9D A;  1TAU A;  3ALY A;  4FVU A;  4RG8 A;  3U6F A;  1NGJ A;  4KH6 A;  5ADX A;  3IG1 A;  4CJV A;  1EO1 A;  2B4J A;  5DK5 A;  5AZJ A;  1HKC A;  5C2D A;  2YKN A;  1JCF A;  1VQK N;  4DWI A;  1RFQ A;  3DLR A;  4NB4 A;  4CEA A;  4FWN A;  1HPZ A;  4WQ5 C;  4FPA A;  3HPG A;  4KHQ A;  2NRX A;  3SBT A;  3KTQ A;  4FLZ A;  2Q3S A;  4XH1 A;  1C1A A;  1WNS A;  1UA0 A;  1VQ9 N;  2FC0 A;  1KFD A;  2P9N A;  3CQX A;  3ZSW A;  4BGB A;  4EHU A;  3CXC M;  4CGD A;  1TYQ B;  1TKD A;  4XH4 A;  4LF8 K;  5D3G A;  3OA9 A;  4C8O A;  3HP6 A;  1WLJ A;  5KPT A;  1NK5 A;  1TYQ A;  4CF0 A;  1KQS M;  4V19 S;  4BWJ A;  4ZHR A;  3LDL A;  1QSL A;  4AHS A;  2XY7 A;  1ATS A;  3FFI A;  3VQC A;  3THW B;  2O8E A;  4E89 A;  4MLH A;  3P4I A;  2NNW A;  5M1P A;  4KHU A;  1S3X A;  1W9H A;  4QAG A;  2DFH A;  4BRE A;  1DTT A;  3D6R A;  3F9K A;  4CIE A;  4J2A A;  4W5Q A;  1RGI A;  4DV7 K;  1WUA A;  1U6Z A;  3NF6 A;  3OYN A;  3C6T A;  3C6A A;  4O5F A;  1LAW A;  3DWL A;  4R5P A;  4CF8 A;  4CGG A;  2NRV A;  4DFJ A;  1QSY A;  4PY5 A;  3TPQ A;  2Z1I A;  1M1K O;  2QWN A;  5C10 A;  3AVF A;  4O8K A;  4FL9 A;  3CJA A;  3VEO A;  4EHT A;  4H4O A;  4Q5V A;  2DY4 A;  4J2E A;  4WQ4 A;  4CFA A;  1BOT O;  1NGH A;  3SPZ A;  1YT3 A;  5GAH P;  1YXQ A;  3PIO L;  3KZB A;  1RBV A;  2ZF5 O;  3VQD A;  2QWQ A;  4IJA A;  4RCH A;  4YDU C;  4BWM A;  5BRD A;  4FM2 A;  1LOT B;  3LL3 A;  1DTQ A;  4AHT A;  3T1A A;  1D5A A;  4I7F A;  2A6A A;  1GLC G;  3GL1 A;  4BRP A;  1NKE A;  1N6Q A;  1ZBH A;  4KV8 A;  1SV5 A;  1HQU A;  1HQE A;  3LP2 A;  4B9U A;  1Q18 A;  3E9L A;  1KC8 O;  1B9D A;  2KZZ A;  4JD2 B;  4JK9 A;  4BG9 A;  1VQ7 N;  2HOE A;  3L8B A;  3KWI A;  2F4V K;  3H1Q A;  3OYG A;  4CZH A;  3AVN A;  4JRQ A;  3MDQ A;  2AJQ A;  4BRK A;  3VA3 A;  3CCE N;  5CYQ A;  3O4N A;  5AQH A;  3RVC A;  4B3R K;  4B1X B;  1HMV A;  4DFK A;  2ZE2 A;  4I6M B;  1HRH A;  3R1X A;  3RRG A;  2HHX A;  1SAZ A;  3ZET B;  4BRD A;  1RDA A;  3BY5 A;  4FPB A;  3UKR A;  3VF6 A;  3D2E A;  4B8C A;  4BC4 A;  3ASM A;  3OYI A;  3ZEU B;  1S1W A;  3AVH A;  3DLH A;  2P9P B;  3IRX A;  3CFR A;  2IOC A;  4A62 A;  2YI1 A;  4X64 K;  3WXM B;  3H46 O;  1BDG A;  4KHS A;  1CZ9 A;  1N32 K;  3LAL A;  2NLX A;  4BE0 A;  3ZSY A;  3T1Y K;  4JEP A;  2A3Z A;  3CER A;  5H1S Q;  2IVO A;  5AQX A;  4DFM A;  3TAF A;  2X74 A;  4KTQ A;  4Z4C A;  4M45 A;  4M3W A;  1L5U A;  1Y64 A;  4DFP A;  3TAG A;  3AVB A;  1BA0 A;  3VEV A;  3OS2 A;  1HKB A;  4JKH A;  3V6D A;  3AA2 A;  1ZBI A;  4CJK A;  1MDU B;  3TTF A;  4DKW A;  4OPH A;  3V9X A;  1XHZ A;  2W40 A;  5AQF A;  4BE1 A;  4CJ5 A;  3FE1 A;  2FF6 A;  1HNX K;  4ILJ A;  1C0U A;  3VQP A;  4CJS A;  2R7Y A;  3MK6 A;  5J2Q A;  2P9S A;  1IG9 A;  2WC9 A;  3K5N A;  3JYT A;  2DPN A;  4YDU A;  3M8Q A;  3M8R A;  3KKR A;  2BAN A;  4H5R A;  4K0K K;  3L2R A;  5C12 A;  3HRG A;  2O8B B;  4PA1 A;  3AO3 A;  1K8K B;  3C94 A;  5AQW A;  3PIP L;  1BQN A;  3LM2 A;  1A5W A;  3MEC A;  4DSF A;  3G71 N;  2OTL N;  4FWS A;  3I0R A;  2OPP A;  1N8R O;  1SL0 A;  2VYP A;  4WFN L;  3K59 A;  3QEV A;  3M8S A;  3PLA A;  4M41 A;  3O6W A;  2FSK A;  3SJH A;  3CM6 A;  3WXJ A;  3T19 A;  2HHH K;  4K42 A;  1QHA A;  2P9U B;  3OBW A;  3CC7 N;  3MEE A;  4IOX A;  1SKW A;  1F21 A;  4DQS A;  3BDP A;  5BR8 K;  3VQ9 A;  4CGI A;  3DXM A;  1NGB A;  2HBL A;  4BGA A;  3NFA A;  1JXB A;  3HOT A;  1N5Y A;  1JJ2 M;  4KB1 A;  4DQQ A;  2YNF A;  2BE2 A;  4DUZ K;  3H1V X;  5CE3 A;  4W5N A;  1VSE A;  3A5M C;  5BN9 A;  4BR7 A;  2NRZ A;  1BO5 O;  2QWL A;  4RW9 A;  3OJU A;  5GAG P;  1NG9 A;  4BRG A;  1BUP A;  1SQK A;  2YX6 A;  2E2P A;  3CG7 A;  2D1K A;  4M7X A;  2D0C A;  1VSM A;  1NU0 A;  3A0I X;  3VEZ A;  3EN9 A;  3NH0 A;  1SZ2 A;  3HM8 A;  2HHT A;  1HPM A;  2G8W A;  4GY2 B;  1BWF O;  4DUY K;  4DR5 K;  4AHV A;  1RDB A;  1VQ5 N;  5C24 A;  3T7Z A;  2P9S B;  1HYS A;  1XC9 A;  3HTV A;  1IBK K;  2VWK A;  4B1V A;  2KLA A;  3TTC A;  1XQS C;  2D5R A;  5JS2 A;  4OKK A;  5AQZ A;  3OW2 M;  3QEX A;  4DV2 K;  3OJS A;  3BGR A;  1W2B M;  4IJN A;  4BC2 A;  4B9L A;  2HBJ A;  3VA0 A;  1YJN N;  4FK0 A;  4PL8 A;  4CZG A;  1JCE A;  4H5V A;  2UYT A;  4KAZ A;  1ATN A;  3AAP A;  3QBW A;  4NCB A;  3QB0 A;  1RTI A;  1WAF A;  3P31 A;  1DLO A;  2HNZ A;  1C0M A;  4FOI A;  1YTA A;  4CZJ A;  1X9M A;  4DR6 K;  3W0L A;  1WOQ A;  3KLE A;  3JXU A;  2OAN A;  2P9L A;  4CER A;  3JAM O;  4LY7 A;  2DFE A;  4JI3 K;  4FJ7 A;  1JLF A;  4CJR A;  4OKE A;  3O9Q A;  1NJW A;  3PSI A;  4JKG A;  3ZT0 A;  4F8R A;  3WNF A;  4JI2 K;  2P51 A;  2J4R A;  4CD3 A;  4AQY K;  3CCQ N;  2YKM A;  3E01 A;  1P8Z A;  2P9N B;  3QIP A;  3VES A;  4JI7 K;  4JKA A;  5EU7 A;  4FSV A;  1IKX A;  1R0A A;  3EKS A;  1YAG A;  4H0P A;  4CJP A;  5E84 A;  3O5B A;  1QQM A;  5C42 A;  3K5O A;  4CJF A;  2OA8 A;  1KFS A;  2O8E B;  2ZJP L;  4E7K A;  2VG7 A;  2RKI A;  3EE9 A;  1BA1 A;  1RTJ A;  2XO7 A;  1CXQ A;  3SAG A;  4A59 A;  4JHD B;  4Q0B A;  1D4X A;  4DV3 K;  3KD1 E;  3AVL A;  3WNH A;  1M90 O;  1YI2 N;  3CC2 N;  3ULD A;  4HTL A;  3VF4 A;  3C65 A;  3L2Q A;  1EXQ A;  2W42 A;  4IZ9 A;  5BRE A;  1QQC A;  4CK2 A;  3PV8 A;  1EWR A;  4KHN A;  2BH1 A;  1NOZ A;  3BZC A;  4OPK A;  1QE1 A;  4CW7 B;  1QTM A;  2D0B A;  4DTR A;  2W6L A;  3ZSX A;  4N41 A;  4BVO A;  4FJG A;  1JKH A;  4JS5 A;  3JSM A;  1TUY A;  1QQN A;  1BIZ A;  1RIL A;  5K14 A;  4DV1 K;  2Z1G A;  3L2W A;  5FRN A;  3SI6 A;  2WOM A;  2P9I A;  3WXI A;  3IAY A;  1VQ8 N;  1VQN N;  3IMX A;  1J54 A;  1YJ9 N;  2OTJ N;  3VN5 A;  4W5T A;  4NCG A;  2GV9 A;  4O0I A;  1NGD A;  2YHB A;  1IJJ A;  5AQK A;  5HLF A;  2HMP A;  3EKU A;  4H0X B;  4WQ4 C;  2HW3 A;  4YOT A;  3O9T A;  1KAY A;  5LY3 A;  1T44 A;  4DTS A;  3VTH A;  3A5O C;  4C23 A;  4FJ9 A;  1SKS A;  4RTF D;  3U3G A;  3LWM A;  4GVM A;  4A2A A;  3ZSV A;  2Q36 A;  2KKZ A;  2KHO A;  3N4P A;  3SV4 A;  2P5O A;  2CGK A;  1ZBS A;  4E19 A;  1NGF A;  2Z1H A;  2RE2 A;  4LF9 K;  2RF2 A;  1O13 A;  1NKB A;  4CJE A;  2ZJR L;  4E1N A;  3ENB A;  5AZJ B;  5A2Q O;  4IDK A;  3LAK A;  4B3O A;  4JN4 A;  1YF5 L;  5AFU H;  3K5L A;  4ILG B;  3LPT A;  3R3L A;  3ZLJ A;  1DKG D;  2WFB A;  2DFF A;  3NH2 A;  4GV3 A;  3DLK A;  1SS6 A;  1NK9 A;  3UKR B;  3L4Q A;  4BRQ A;  1FKO A;  3HVR A;  3AGK A;  4EFH A;  4LSN A;  1Y97 A;  4DSK A;  2BTF A;  1XNR K;  3J7A P;  1GLJ O;  4I6M A;  1VSD A;  1W7A A;  4DV4 K;  1HJO A;  4CHZ A;  2GEM A;  3DRR A;  3CI5 A;  2AA4 A;  3PO4 A;  3P39 A;  1FXX A;  3KLI A;  1WBD A;  2HHW A;  1IV0 A;  3U3Y A;  3ZSR A;  4H5N A;  4CJ7 A;  3CMA N;  4KH5 A;  5EXW A;  2VGN A;  3LZJ A;  1NMD A;  3LP0 A;  3THW A;  5KI6 A;  4M3X A;  1ZBU A;  2Q2R A;  3TAB A;  2VG5 A;  2ASM A;  4G9Z A;  3ZX2 A;  4CJ3 A;  5FPN A;  4MDB A;  1J9A A;  3HZ6 A;  3LP3 A;  1J5O A;  4GMJ B;  3HM9 A;  1YUW A;  2F8T A;  5JVG L;  3LM9 A;  4F4K A;  3DLL L;  3SCX A;  2ATQ A;  1GLE G;  1NLV A;  1ASW A;  4E3S A;  5I42 A;  1ZBL A;  4DU3 A;  4CHO A;  2CGL A;  4DSI A;  3RMC A;  4IG3 A;  2E5L K;  4JI0 K;  4N47 A;  2P1J A;  1VK0 A;  2NZT A;  1WSE A;  1U45 A;  1S72 N;  1RBU A;  1S9E A;  3BUZ B;  3A2F A;  2IDO A;  2YJF A;  1L3S A;  2IS3 A;  5IWA K;  5SWM A;  3VQA A;  3CJ9 A;  4JK8 A;  5J2N A;  1NMN A;  2XY6 A;  1DGK N;  1TKX A;  1VSK A;  4Z0U A;  4FJ8 A;  4DLG A;  3C0B A;  3R6M A;  2FBX A;  4X62 K;  5LJW A;  2LSN A;  2D0P A;  2BDP A;  2ZGZ A;  1I94 K;  4DR1 K;  1VSJ A;  1VQM N;  4DSL A;  3L3U A;  5FPM A;  3CPW M;  4MLE A;  4F3T A;  4FVM A;  3UB5 A;  3D2E B;  4FJL A;  4G1Q A;  2H3G X;  1QSS A;  1ZC6 A;  2PAV A;  3RRH A;  3VER A;  4W5R A;  1WSF A;  3NVK A;  4FWR A;  1OH6 A;  5AZI A;  3AO4 A;  4DV6 K;  3KK7 A;  2JLE A;  3EL2 A;  4Z94 A;  3J7Z O;  3DMJ A;  1W0H A;  2ASP A;  4CFB A;  2QWR A;  3SUO A;  2YCH A;  2PBD A;  3ZYY X;  4FCY A;  4Z4I A;  1YJW N;  4KFB A;  4KPY A;  3LDQ A;  4PUO A;  1RTD A;  1OVQ A;  4CGH A;  3FFK B;  2UUB K;  3SJJ A;  4Z4F A;  4BR2 A;  3DXM B;  2VWJ A;  3KK1 A;  4ELV A;  5HL7 L;  2KFZ A;  3VEN A;  4JKF A;  3ZT1 A;  3WNG A;  1YIT N;  4PWD A;  4AHU A;  4DQ8 A;  4DMN A;  2PY5 A;  2P9K A;  4IFV A;  5AQT A;  1A5V A;  4CK3 A;  1OVY A;  5DMR A;  2RN2 A;  5JIC A;  4WYB A;  4NYN A;  3LWL A;  4DTN A;  2KQ2 A;  3QEP A;  4CEZ A;  4FJH A;  2E2N A;  5C25 A;  1IG8 A;  5DM7 L;  3Q7C A;  1Q82 O;  1RT5 A;  4OPJ A;  3MN7 A;  2QW9 A;  3GOI A;  1WSH A;  1U4B A;  3MWP A;  3ZSO A;  5AQM A;  2KZM A;  3VQ6 A;  4BE2 A;  3S3N A;  1QS4 A;  1RT3 A;  3RSE A;  1O1W A;  5SZT A;  1IBL K;  1ESV A;  1KVC A;  1WN7 A;  3O4W A;  3ENH A;  3S3O A;  4UY8 O;  3ULE A;  3BZK A;  4JRP A;  1KRP A;  4DTO A;  3H6E A;  1T03 A;  2QTD A;  2ITM A;  5FPD A;  3DLG A;  3G25 A;  2V7Z A;  5LMN K;  4FLU A;  3ENO A;  4AH9 A;  3AAR A;  3OYH A;  2P9I B;  4OLA A;  4LSL A;  4OX9 K;  4B3S K;  4M3Z A;  1X3N A;  5LL6 Z;  5J1E A;  4O8U A;  1EQY A;  3DOK A;  1RT4 A;  4CJU A;  4MO4 A;  5HBM A;  4M3R A;  3TSQ A;  2KTQ A;  5TKY A;  1QVG M;  2FSN A;  2ZM6 K;  3PO5 A;  4H0T B;  3M8P A;  4AHR A;  4F3O A;  3K57 A;  4IEI A;  3AA5 X;  3OS1 A;  3SNN A;  2P9U A;  2WBN A;  4KB0 A;  3DLB A;  4M63 C;  3O9S A;  4DTM A;  4HUG A;  3V81 A;  5DM6 L;  1W97 L;  2HVH A;  5FRO A;  1VQO N;  3HVT A;  5JLF A;  4B9S A;  4FZZ A;  5C2F A;  4ZTJ A;  4AM6 A;  2YHY A;  3G6E N;  4DV5 K;  4B9T A;  1LWE A;  1KLN A;  4O5B A;  3OYE A;  3LPU A;  5HP1 A;  5KGW A;  3RR8 A;  4F2S A;  2B6A A;  2E1Y A;  3PSF A;  2X6N A;  4HCB A;  5AQP A;  4GV6 A;  4CF2 A;  3VQ5 A;  3MXI A;  3CQY A;  1S5J A;  3PUF A;  1TK8 A;  3SYZ A;  3MAQ A;  3NH1 A;  3MX2 A;  3HPO A;  5JLH A;  3RMD A;  4H03 B;  4BC5 A;  4LF6 K;  1XMO K;  5EY4 A;  4BRH A;  4DSJ A;  1TL3 A;  3CCV N;  3B6O A;  1HR0 K;  4CZK A;  3FZM A;  3NGI A;  4I2Q A;  1YTU A;  4DQP A;  4JKB A;  3V1Q A;  3PX0 A;  3C7N B;  2GTD A;  3C95 A;  3TAP A;  3G10 A;  3AGR A;  2VWB A;  1BL3 A;  3CET A;  3VF2 A;  1HNZ K;  4KKO A;  2HND A;  3WNE A;  3WQT A;  1VQ6 N;  3MN6 A;  4B9V A;  1HLU A;  3SAH A;  1V4T A;  2QEX N;  1BG3 A;  1C0F A;  3O9R A;  4MQ3 A;  5AQV A;  4DR2 K;  4H5T A;  1TVR A;  4IDH A;  2X6S A;  3HT3 A;  1FJG K;  3HP9 A;  4K8Z A;  3HL8 A;  1HNI A;  3OYA A;  1IH7 A;  2GUI A;  4KH4 A;  1TK0 A;  2P9P A;  3H3N O;  2VQF K;  4BDY A;  4YOR A;  1CXU A;  5AR0 A;  4BR9 A;  3KK3 A;  1RBS A;  4CED A;  3KHY A;  5LMU K;  5AQU A;  5JVH L;  4KHW A;  3F9M A;  5KPZ A;  4JKD A;  2YJE A;  1WSJ A;  4PL7 A;  1UA1 A;  4JV5 K;  3CCS N;  1D8Y A;  4FZX C;  4F2R A;  4GV9 A;  4I9L A;  1JCG A;  3VGL A;  4DG1 A;  4PQU A;  1NBW A;  3DAW A;  3QNN A;  4FJJ A;  5HRS A;  3A5N C;  3CYM A;  3SBG A;  3QML A;  1TUU A;  5CYM A;  4H5W A;  5I9E B;  1JLC A;  3LDP A;  1YVN A;  3ZX3 A;  3CHW A;  4KHY A;  2RHK A;  1HNV A;  1T6C A;  3IUC A;  1XNQ K;  4XEI A;  3I0S A;  4H0V B;  3WXK A;  1NK8 A;  4BQZ A;  2Y1I A;  1K73 O;  1HUX A;  2Q97 A;  4LF4 K;  2YHA A;  4RW4 A;  3O3F A;  4WE1 A;  5CR4 A;  4YOX A;  3FZF A;  3OYB A;  2OPS A;  1JL2 A;  5GAE P;  3GG4 A;  3VEW A;  1U48 A;  4CZL A;  2E88 A;  3ZEU A;  5KGX A;  2FXU A;  2GUP A;  2EWS A;  3LAN A;  4U67 L;  2UXC K;  2Y1J A;  4QS8 A;  1QVF M;  3HBT A;  2A1R A;  1EWQ A;  4GVE A;  3WXL A;  1LWC A;  1YHQ N;  3R8E A;  2DTU A;  3RR7 A;  2O8F B;  4UQG A;  2ITG A;  1N36 K;  1QHT A;  2OYQ A;  2HHU A;  1VSL A;  3UKU A;  2XY5 A;  3MX5 A;  5EOY A;  3R9P A;  3ID8 A;  4C8L A;  4IKF A;  3NGZ A;  1VQL N;  2O8D B;  3FZK A;  5E41 A;  4IEE A;  3OYM A;  3ATV A;  3EYZ A;  1RTH A;  4X65 K;  4FW1 A;  1BIS A;  2WUS A;  5AQI A;  1IKV A;  2HHV A;  4FLY A;  4DQI A;  1S1V A;  2NRR A;  3S3M A;  3NBP A;  4DV0 K;  3QLH A;  5BN8 A;  1GLD G;  3ISN C;  1VSH A;  1IKY A;  4B3T K;  4DF8 A;  4N5S A;  2OZS A;  1S1U A;  5B8H A;  4DCH A;  3THX B;  1JL1 A;  3TSU A;  4MFB A;  4J2B A;  1CZA N;  3LDN A;  2CH6 A;  2JGU A;  4FJN A;  4FXD A;  1TGO A;  1RT7 A;  4H8K A;  4JLH A;  3V4I A;  1UWB A;  4E0D A;  4M42 A;  4OO1 J;  3FZH A;  3VQ8 A;  4KRF A;  3KIO A;  1IKW A;  4NCA A;  2QK9 A;  3TAM A;  4K41 A;  3ZT3 A;  3KJV A;  4DF4 A;  2O8F A;  4CEB A;  3VQQ A;  2QWO A;  1T05 A;  2Z1J A;  1FW6 A;  2E20 A;  1J5E K;  1GLL O;  4MDA A;  3SZ2 A;  1UAX A;  3P38 A;  3HOS A;  3O08 A;  3O1W A;  4RW8 A;  3AVI A;  3EZ5 A;  1BCO A;  3ITH A;  4K8X A;  1GOB A;  4FWM A;  4CIG A;  4R79 A;  3OYJ A;  1SL1 A;  2HF3 A;  2G8K A;  1BU6 O;  3AVK A;  3P1G A;  5KRT A;  3ZSQ A;  2QXL A;  4PKH A;  2JWK A;  1DEJ A;  2Q1N A;  3ZX0 A;  2YHX A;  4DTJ A;  2FF3 B;  2F7T A;  3E1Y A;  4J8F A;  3VEY A;  5HRP A;  4FZY A;  1IBM K;  3A5L C;  3SUP A;  3NF8 A;  3QBX A;  2OPQ A;  2QI2 A;  5BPM A;  3M6G A;  2BGG A;  5FLX O;  3VET A;  2IVP A;  3D2F A;  1KAX A;  2NUB A;  3EE8 A;  3JS6 A;  4YOU A;  1R59 O;  1WAJ A;  3CCM N;  4AM7 A;  3MCP A;  4BR0 A;  3D45 A;  3OYC A;  4FM0 A;  1MA9 B;  4B9M A;  5HRR A;  1S1T A;  4CK1 A;  1BIU A;  1VAZ A;  3BP8 A;  1TV6 A;  3DJC A;  3TU5 A;  5GIN A;  5LJV A;  2PFU A;  3NCI A;  1ZYQ A;  3P5J A;  4CEO A;  3DXK B;  3FGU A;  3C7N A;  4QCL A;  3RSE B;  3SMS A;  4HWI A;  4BRF A;  4BRI A;  4YY3 K;  4LFC K;  1ILY A;  3O4Q A;  1X1P A;  4BRM A;  3L0Q A;  1N34 K;  2ZWH A;  1GLA G;  3KD5 E;  4I2P A;  4O55 A;  4ZTF A;  2GWJ A;  1LV5 A;  4ELU A;  1NGI A;  1I3A A;  4QOZ B;  1KAZ A;  4ID1 A;  4EP5 A;  2VG6 A;  4DU4 A;  2HMI A;  4KI6 A;  2BUP A;  4CZI A;  4FW2 A;  3LP1 A;  3D7E O;  4C8N A;  4OPA A;  2O4G A;  5HRN A;  1NKC A;  4CJ4 A;  4QS7 A;  2V52 B;  5MLC Q;  5JMV A;  1RDD A;  1T6D A;  2ZGY A;  5EX5 A;  4KRE A;  4CJQ A;  4YOW A;  3L6Q A;  3I8B A;  4HHT A;  1Z26 A;  2G8I A;  1TK5 A;  3CD6 N;  2CH5 A;  1K6Y A;  4ISE A;  1ZXO A;  2X78 A;  1C0T A;  4H0O A;  3KVG A;  5AQJ A;  2WON A;  3MED A;  4FLT A;  3W3D A;  3THY A;  1WSI A;  2OPR A;  2VCP A;  2I7N A;  5AZI B;  2YNH A;  3TWH A;  1HKG A;  4MO5 A;  2PYJ A;  4LC9 B;  4NXM K;  3FR0 A;  3E9O A;  3DM2 A;  4IG0 A;  1X3M A;  3KK2 A;  4KI4 A;  1U2V A;  3CCU N;  3QFU A;  2O8C B;  1L3V A;  1EET A;  2QXF A;  1NGG A;  4NO7 A;  3GDQ A;  3HXM A;  4WQ5 A;  4EIA A;  3NGY A;  3ZSZ A;  1TKT A;  4A61 A;  4PHT X;  5AFU A;  2A42 A;  4FJI A;  2A40 A;  2P9K B;  1HJR A;  4FM1 A;  4PKI A;  1E3M A;  3ATU A;  2GEL A;  4E7H A;  2QWM A;  3NF7 A;  3O3H A;  4C1N K;  1LAV A;  1HX1 A;  4H0Y B;  3VQE A;  3QNO A;  3CCR N;  4XIU A;  1Q9X A;  2OZM A;  3A8Y A;  3V9S A;  5J2M A;  5BPN A;  4FJM A;  4CE9 A;  3I33 A;  4OVL A;  3K5M A;  4ISG A;  1CZB A;  1S1X A;  2HB5 A;  3HO1 A;  3E66 A;  4CJL A;  3IFR A;  1X9J A;  5AQR A;  2JWL A;  1JLQ A;  3DYA A;  3KKS A;  2QWP A;  3PY8 A;  3SQ0 A;  2YHW A;  1REV A;  2IVN A;  4OLB A;  1G15 A;  4LH4 A;  3NE6 A;  5GIP A;  3TAN A;  4CI6 A;  2YNI A;  2HHS A;  4ID5 A;  1RDC A;  1BHL A;  1EP4 A;  4ICL A;  3OHR A;  4GW6 A;  2OCE A;  4LFB K;  4BY9 C;  3QFP A;  1MWM A;  2GBZ A;  3F73 A;  4IBN A;  3RMA A;  4LFA K;  2O8C A;  3DRP A;  3P83 D;  3OYK A;  2IAJ A;  3CJB A;  4M7Y A;  4E1M A;  2I7P A;  4CF1 A;  3WEE B;  3AVM A;  1Q8I A;  1TAQ A;  3QDK A;  4BR4 A;  3OVN A;  3FLC O;  5M1K A;  4BRO A;  5C15 A;  1ASV A;  2QA4 N;  3NDK A;  1S6P A;  1LW0 A;  3K2P A;  4AIL C;  1NK7 A;  3HST B;  5KQ8 A;  1B9F A;  3BF1 A;  1KXP A;  4BRL A;  2FSJ A;  4J2D A;  2CGJ A;  3PX4 A;  3NMU A;  4OJR A;  5AQO A;  4YOV A;  4M3T A;  3CCJ N;  4IFE A;  5F2R A;  4HTU A;  1H1V A;  4GNI A;  2A1S A;  5IT9 O;  3ZT4 A;  3CJ1 A;  4IO9 L;  4IOC L;  1SUQ A;  4CGJ A;  3G4S N;  4JAX A;  3K58 A;  1FKP A;  1NJZ A;  4CJT A;  3DI6 A;  3DXK A;  4AHC A;  5E26 A;  5AQN A;  2O8D A;  3SUQ A;  2Q0U A;  4ISF A;  1S6Q A;  3H45 C;  3KLF A;  4ILH A;  5M1Q A;  4O44 A;  2W41 A;  5TKW A;  1RNH A;  3L2V A;  4HUF A;  2F9W A;  4LF5 K;  4Y1D A;  3IKM A;  5I3U A;  1E4F T;  3KLG A;  3T3F A;  3WUH A;  3CME N;  3U9Z A;  1K8K A;  4DQR A;  5HOO A;  4ELT A;  3HSC A;  2GX9 A;  3OBY A;  4Z4E A;  3WT0 A;  1C1C A;  4WFB L;  3EZW A;  3AA3 A;  2E2O A;  3ZT2 A;  4CFD A;  4PKG A;  1LW2 A;  2UUA K;  4NYF A;  1OH5 A;  3D0P A;  2EHG A;  3EO3 A;  1NK6 A;  2P9L B;  2HBM A;  3AO2 A;  4B9Q A;  4CEC A;  1GOA A;  4CZF A;  1D9F A;  3F5T A;  1XHX A;  1NJI O;  3CPE A;  4CBX A;  3RWU A;  4CF9 A;  1VHX A;  3S41 A;  3VQ7 A;  2W6K A;  2XRI A;  3U4L A;  3OS0 A;  4JI8 K;  1GLB G;  4TSX A;  1KTQ A;  1RCH A;  1SL2 A;  1HYZ A;  2NRH A;  1NNE A;  1YIJ N;  3TAR A;  4FLV A;  3V9U A;  1NJY A;  3LDS A;  5FRM A;  1RBR A;  4IWV A;  4E1J A;  4CEE A;  4A2B A;  4NXN K;  2UXD K;  3F2K A;  1RBT A;  2IC3 A;  4A5B A;  3QIN A; 
#chains in the Genus database with same CATH homology
 2YHA A;  4RW4 A;  2Q3S A;  4NCG A;  4W5T A;  4WE1 A;  3O3F A;  1C1A A;  2GV9 A;  1WNS A;  4O0I A;  3V9Z A;  1UA0 A;  3OYB A;  2FC0 A;  1KFD A;  2YHB A;  3OYD A;  4FK4 A;  3ZSW A;  1L3U A;  2OPS A;  1JL2 A;  5HLF A;  4CGD A;  1U48 A;  1TKD A;  4CEQ A;  2HW3 A;  4CHN A;  5D3G A;  5KGX A;  4C8O A;  3LAN A;  5J2P A;  3HP6 A;  4BDZ A;  2Y1J A;  1WLJ A;  1NK5 A;  3CFP A;  4DTS A;  4CF0 A;  2A1R A;  4FJ9 A;  2G8V A;  1SKS A;  4BWJ A;  1LWC A;  4ZHR A;  3U3G A;  1QSL A;  4EZ9 A;  3LWM A;  4GVM A;  4AHS A;  4N56 A;  3RR7 A;  3ZSV A;  5KTQ A;  2DTU A;  2XY7 A;  4UQG A;  3FFI A;  3VQC A;  3SV4 A;  2ITG A;  2P5O A;  1QHT A;  4E89 A;  1VSF A;  4JS4 A;  2OYQ A;  4E19 A;  4KHU A;  1W9H A;  4QAG A;  2DFH A;  2HHU A;  1JLB A;  1VSL A;  2Z1H A;  3HK2 A;  2XY5 A;  1DTT A;  3F9K A;  2F96 A;  2RF2 A;  4CIE A;  1TKZ A;  4W5Q A;  3SQ1 A;  1NKB A;  4C8L A;  4IKF A;  4J2A A;  3NGZ A;  4CJE A;  3VQB A;  3NF6 A;  4E1N A;  5E41 A;  3C6T A;  3OYN A;  3OYM A;  2PZS A;  1LAW A;  4IDK A;  1RTH A;  3EYZ A;  3LAK A;  4R5P A;  2XY8 A;  4CF8 A;  4CGG A;  4B3O A;  1Z25 A;  4FW1 A;  1BIS A;  2I5J A;  4DFJ A;  1QSY A;  3PX6 A;  4PY5 A;  4FJK A;  1MU2 A;  3O3G A;  1IKV A;  2Z1I A;  3K5L A;  4FLY A;  2HHV A;  3MXM A;  3LPT A;  4DQI A;  1S1V A;  3S3M A;  2F8S A;  3NBP A;  1D9D A;  3QLH A;  3ISN C;  3SQ4 A;  1VSH A;  2DFF A;  3NH2 A;  3AVF A;  1IKY A;  1U04 A;  3DLK A;  4EZ6 A;  4DF8 A;  4H4O A;  4N5S A;  4Q5V A;  1S1U A;  2OZS A;  1NK9 A;  4J2E A;  3LZI A;  2DY4 A;  1JL1 A;  1NJZ A;  4CFA A;  1VRT A;  1FKO A;  3HVR A;  3SPZ A;  4MFB A;  5CZ2 A;  1YT3 A;  4J2B A;  4LSN A;  1RBV A;  4DSE A;  2JGU A;  1Y97 A;  2EX3 A;  3QO9 A;  3VQD A;  4DSK A;  4FJN A;  4FXD A;  1VSD A;  1TGO A;  1RT7 A;  4BWM A;  4FM2 A;  1WSG A;  1ASU A;  4H8K A;  4CHZ A;  4JLH A;  1DTQ A;  1UWB A;  3DRR A;  4AHT A;  3V4I A;  4E0D A;  3T1A A;  1D5A A;  4I7F A;  3PO4 A;  4M42 A;  1NKE A;  1C1B A;  1FXX A;  3KLI A;  1N6Q A;  3VQ8 A;  3OYL A;  3ZSR A;  3U3Y A;  1ZBH A;  4KRF A;  3KIO A;  1IKW A;  4KV8 A;  3V9W A;  1SV5 A;  1VRU A;  4NCA A;  1HQU A;  2ZQB A;  3LZJ A;  2QK9 A;  3LP0 A;  1HQE A;  3LP2 A;  3TAM A;  3ZT3 A;  4B9U A;  3KJV A;  4DF4 A;  4CEB A;  1B9D A;  3VQQ A;  5KI6 A;  2KZZ A;  4M3X A;  1ZBU A;  1T05 A;  2Z1J A;  3L8B A;  3TAB A;  2VG5 A;  3QEI A;  3QES A;  5T7B A;  4CJ3 A;  3SZ2 A;  1UAX A;  3RMB A;  1J9A A;  1NK0 A;  3LP3 A;  3AVI A;  4RW8 A;  3AVN A;  3OYG A;  1BCO A;  3EZ5 A;  2IGI A;  3ITH A;  4JRQ A;  1J5O A;  4K8X A;  1GOB A;  4CIG A;  1U47 A;  2AJQ A;  4GMJ B;  3OYJ A;  3HM9 A;  3VA3 A;  1SL1 A;  2F8T A;  2G8K A;  5CYQ A;  4H4M A;  4F4K A;  3AVK A;  2HVI A;  3O4N A;  2XHB A;  1BQM A;  3P1G A;  3MXJ A;  5KRT A;  3ZSQ A;  2D0A A;  1HMV A;  3B6P A;  2ZE2 A;  4DTU A;  1HRH A;  4DFK A;  2ATQ A;  3SCX A;  3RRG A;  2HHX A;  1RDA A;  3TI0 A;  1TL1 A;  1ASW A;  4E3S A;  4BDP A;  5I42 A;  1ZBL A;  4DU3 A;  1KVA A;  4CHO A;  4DTJ A;  1KVB A;  4DSI A;  5HRP A;  3RMC A;  4IG3 A;  4FZY A;  4CES A;  1RT2 A;  4FLW A;  3SUP A;  4O4G A;  4B8C A;  3ASM A;  3NF8 A;  3NF9 A;  2P1J A;  4N47 A;  1VK0 A;  3AA4 A;  3OYI A;  1WSE A;  1U45 A;  1FK9 A;  1S1W A;  3AVH A;  1HYV A;  2OPQ A;  3IRX A;  3IS9 A;  3CFR A;  3DLH A;  3QEW A;  3V1R A;  2IOC A;  3HJF A;  2BGG A;  1RBU A;  1S9E A;  3A2F A;  3AVJ A;  2IDO A;  4KHS A;  1L3S A;  1CZ9 A;  2NUB A;  2IS3 A;  5CZ1 A;  5SWM A;  3LAL A;  4E7K A;  1WAJ A;  3HPH A;  3VQA A;  3D45 A;  3V1O A;  3OYC A;  4BE0 A;  4FM0 A;  3ZSY A;  5J2N A;  2XY6 A;  1TKX A;  3S9H A;  1VSK A;  4B9M A;  3LAM A;  5HRR A;  1S1T A;  4Z0U A;  4CK1 A;  1BIU A;  3THV A;  4FJ8 A;  4DLG A;  3TAE A;  2FBX A;  3AVG A;  1TV6 A;  4OKJ A;  2ETJ A;  4RW7 A;  4YNQ A;  3DRS A;  4DFM A;  2X74 A;  3DLE A;  3NCI A;  3TAF A;  3SPY A;  2LSN A;  1ZYQ A;  4KTQ A;  4Z4C A;  2BDP A;  3P5J A;  4CEO A;  4DU1 A;  1VSJ A;  4M45 A;  4DSL A;  1XWL A;  4QCL A;  3L3U A;  4Y1C A;  4M3W A;  3SUN A;  1BCM A;  2KFZ A;  4HUE A;  1L5U A;  4DFP A;  3TAG A;  4FVM A;  3AVB A;  4F3T A;  3QIO A;  3OS2 A;  1JXE A;  4DTP A;  4FJL A;  3O4Q A;  3VQ4 A;  1X1P A;  4G1Q A;  3V6D A;  4KO0 A;  1QSS A;  5FDL A;  3AA2 A;  1ZBI A;  3RRH A;  5HRO A;  4I2P A;  4O55 A;  4W5R A;  1WSF A;  4ZTF A;  3KD5 E;  4CJK A;  1LV5 A;  4ELU A;  1T8E A;  3V9X A;  3AO4 A;  3TR8 A;  1I3A A;  2JLE A;  3TAQ A;  1XHZ A;  4CHQ A;  4QOZ B;  4BE1 A;  4CJ5 A;  4OGE A;  3DMJ A;  1W0H A;  4ID1 A;  1C0U A;  3VQP A;  4EP5 A;  4CJS A;  3SQ2 A;  2VG6 A;  2R7Y A;  4DU4 A;  2HMI A;  4CFB A;  4KI6 A;  3SUO A;  5J2Q A;  3L3V A;  1IG9 A;  2G8U A;  3K5N A;  3JYT A;  4FW2 A;  3LP1 A;  4C8N A;  3M8Q A;  3M8R A;  4Z4I A;  3KKR A;  4FCY A;  2BAN A;  2O4G A;  3MEG A;  5HRN A;  4KFB A;  4CJ4 A;  3L2R A;  1NKC A;  4KPY A;  4PUO A;  1RTD A;  1KLM A;  1RDD A;  4PA1 A;  1S9G A;  4CGH A;  4KRE A;  3RTV A;  4C8K A;  4E7J A;  2KFN A;  3AO3 A;  4CJQ A;  3SJJ A;  3C94 A;  4Z4F A;  2VWJ A;  4HHT A;  1Z26 A;  3KK1 A;  4ELV A;  1JLG A;  1BQN A;  1X9S A;  2G8I A;  1A5W A;  1KCF A;  2FBY A;  3MEC A;  3G0Z A;  3WNG A;  3ZT1 A;  4DSF A;  1TK5 A;  4PWD A;  4AHU A;  3I0R A;  1K6Y A;  4DMN A;  2OPP A;  1JLE A;  2HHW A;  2X78 A;  1SL0 A;  3L2U A;  2PY5 A;  4IFV A;  1C0T A;  1A5V A;  4CK3 A;  3K59 A;  4L8R B;  5DMR A;  4CGF A;  3QEV A;  3M8S A;  2RN2 A;  4M41 A;  1J53 A;  2WON A;  3MED A;  4FLT A;  1GOC A;  4NYN A;  1RT1 A;  1WSI A;  3LWL A;  4DTN A;  2OPR A;  2KQ2 A;  3QEP A;  4CEZ A;  4FJH A;  2YNH A;  3TWH A;  3CM6 A;  3T19 A;  5C25 A;  1CLQ A;  2PYJ A;  5CY4 A;  3HYF A;  4M3Y A;  1RT5 A;  4OPJ A;  3MEE A;  1WSH A;  1SKW A;  2G8F A;  1U4B A;  4E7L A;  1F21 A;  4DQS A;  2B5J A;  3ZSO A;  3BDP A;  3DM2 A;  4IG0 A;  3KK2 A;  4KI4 A;  2KZM A;  4CFC A;  3VQ9 A;  3VQ6 A;  4BE2 A;  3S3N A;  1QS4 A;  4CGI A;  1RT3 A;  1O1W A;  1L3V A;  1EET A;  2QXF A;  5SZT A;  5KRS A;  3NFA A;  1KVC A;  3HXM A;  1JXB A;  1N5Y A;  2HNY A;  1WN7 A;  4KB1 A;  4W5O A;  4DQQ A;  2YNF A;  3NGY A;  3ZSZ A;  2BE2 A;  3S3O A;  4CCH A;  1TKT A;  3CM5 A;  4JRP A;  2G8H A;  1VSI A;  4W5N A;  1KRP A;  1VSE A;  4DTO A;  1T03 A;  3DLG A;  4FLU A;  4FJI A;  4AH9 A;  3OYH A;  1HJR A;  4LSL A;  4OLA A;  1YVU A;  1RT6 A;  4FM1 A;  4RW9 A;  4M3Z A;  2KW4 A;  3OJU A;  4E7H A;  4E7I A;  5J1E A;  4FJ5 A;  3NF7 A;  3O3H A;  3CG7 A;  1LAV A;  2D0C A;  3VQE A;  1VSM A;  3DOK A;  3QNO A;  1RT4 A;  3QET A;  4CJU A;  2KTQ A;  5HBM A;  4M3R A;  4CHP A;  4XIU A;  1A5X A;  3NH0 A;  3NHG A;  1Q9X A;  5J2M A;  3V9S A;  2OZM A;  2HHT A;  3CFO A;  4RW6 A;  3PO5 A;  4FJM A;  4DTX A;  2G8W A;  4CE9 A;  3M8P A;  4OVL A;  1EX4 A;  4AHR A;  4AHV A;  2E6M A;  3K5M A;  4F3O A;  3K57 A;  1RDB A;  3AO1 A;  1CZB A;  5C24 A;  3OYF A;  1HYS A;  1XC9 A;  1S1X A;  2HB5 A;  3HO1 A;  2RPI A;  3AA5 X;  3OS1 A;  3SNN A;  4CJL A;  4HCC A;  4BAC A;  4FLZ A;  4B9N A;  4KB0 A;  2VWK A;  4FK2 A;  3DLB A;  1JLQ A;  1C6V A;  3DYA A;  2D5R A;  5JS2 A;  3KKS A;  3PY8 A;  4DTM A;  3SQ0 A;  4HUG A;  4OKK A;  3V81 A;  2HVH A;  4FYD A;  5FRO A;  1REV A;  4OLB A;  1G15 A;  1ITG A;  3HVT A;  4LH4 A;  3QEX A;  4B9S A;  3NE6 A;  3H08 A;  3OJS A;  3BGR A;  4FZZ A;  4YFU A;  3TAN A;  4ZTJ A;  4B9L A;  3AV9 A;  3NAE A;  2YNI A;  3VA0 A;  4B9T A;  2HHS A;  4ID5 A;  1LWE A;  4FK0 A;  3AO5 A;  1KLN A;  4O5B A;  1RDC A;  3OYE A;  1BHL A;  1EP4 A;  4ICL A;  3LPU A;  4GW6 A;  5HP1 A;  3OY9 A;  5KGW A;  1SKR A;  4I9Q A;  4Z4G A;  4FLX A;  3RR8 A;  4KAZ A;  2GBZ A;  3F73 A;  4IBN A;  3RMA A;  1JLA A;  4DLE A;  3AVC A;  3DRP A;  4CEF A;  3P83 D;  1EKE A;  4F2S A;  3OYK A;  2B6A A;  2IAJ A;  4NCB A;  4E1M A;  1RTI A;  1WAF A;  2X6N A;  4CF1 A;  1DLO A;  2HNZ A;  3KLH A;  1C0M A;  3DOL A;  4HCB A;  4IFY A;  4CF2 A;  3VQ5 A;  4N76 A;  3MXI A;  3AVM A;  1Q8I A;  1TAQ A;  1S5J A;  3PUF A;  1TK8 A;  3SYZ A;  3MAQ A;  3NH1 A;  3OVN A;  1YTA A;  3HPO A;  1ASV A;  4EP4 A;  1X9M A;  3NDK A;  1S6P A;  1LW0 A;  3K2P A;  4AIL C;  3KLE A;  3RMD A;  1NK7 A;  3HST B;  1B9F A;  4CER A;  4KTZ A;  4HVJ A;  4LY7 A;  2DFE A;  2QKK A;  4FJ7 A;  1JLF A;  4J2D A;  2E4L A;  4DSJ A;  3PX4 A;  4CJR A;  1TL3 A;  4OKE A;  4Z4H A;  3B6O A;  4OJR A;  1NJW A;  4M3T A;  4B8A B;  3AVA A;  3NGI A;  4I2Q A;  3ZT0 A;  4M3U A;  4DQP A;  4F8R A;  1YTU A;  3WNF A;  4HTU A;  1I39 A;  2A1S A;  3V1Q A;  3PX0 A;  3ZT4 A;  1SUQ A;  2P51 A;  4CGJ A;  3UIQ A;  4LD0 A;  3K58 A;  3EY1 A;  1FKP A;  3C95 A;  3TAP A;  4CJT A;  2FBV A;  2YKM A;  3DI6 A;  3E01 A;  4KTW A;  4AHC A;  3CQ8 A;  3QIP A;  2PYL A;  3G10 A;  1X9W A;  2P5G A;  5EU7 A;  4CIF A;  1IKX A;  1R0A A;  1BL3 A;  1LWF A;  3SUQ A;  4C8M A;  4KKO A;  2HND A;  4O0J A;  3WNE A;  1S6Q A;  4CJP A;  3KLF A;  3SV3 A;  1KSP A;  1BI4 A;  4B9V A;  4FJX A;  5C42 A;  4O44 A;  1RNH A;  3K5O A;  4MQ3 A;  3L2V A;  4CJF A;  4HUF A;  1KFS A;  2OA8 A;  2YV0 X;  1TVR A;  2X6S A;  1IO2 A;  2RKI A;  2VG7 A;  4OGC A;  1RTJ A;  3HP9 A;  4Y1D A;  2XO7 A;  3HT3 A;  3QER A;  5I3U A;  1CXQ A;  1L3T A;  4K8Z A;  3KLG A;  3HL8 A;  3T3F A;  3ZCM A;  1U49 A;  1HNI A;  4DQR A;  4Q0B A;  3OYA A;  4ELT A;  1IH7 A;  2GUI A;  3KD1 E;  1TK0 A;  4Z4E A;  3AVL A;  3WNH A;  1C1C A;  3AA3 A;  2O4I A;  3ZT2 A;  2E6L A;  4CFD A;  4BDY A;  1ZBF A;  2QKB A;  2HHQ A;  1BGX T;  1LW2 A;  1B92 A;  1CXU A;  4LH5 A;  1UOC A;  3ULD A;  2W42 A;  4NYF A;  1EXQ A;  3L2Q A;  3D0P A;  2EHG A;  3I8D A;  3KK3 A;  1RBS A;  1QQC A;  4CK2 A;  1NK6 A;  3PV8 A;  4CED A;  1T7P A;  4KHN A;  3AO2 A;  4CEC A;  1GOA A;  4KHW A;  1D9F A;  1XHX A;  1Q9Y A;  1NOZ A;  4CHY A;  4DS5 A;  4OPK A;  1QE1 A;  2ZD1 A;  1WSJ A;  1NK4 A;  3RWU A;  1UA1 A;  4CF9 A;  1NOY A;  1QTM A;  1D8Y A;  4FZX C;  2D0B A;  1BI4 B;  3C6U A;  2YNG A;  3VQ7 A;  4I9L A;  3VN5 A;  4B08 A;  4DTR A;  4F2R A;  2XRI A;  4DG1 A;  1XI1 A;  2FBT A;  3OS0 A;  4PQU A;  5JS1 A;  3QNN A;  4TSX A;  4DS4 A;  4FJJ A;  4CJW A;  1KTQ A;  1RCH A;  5HRS A;  1SL2 A;  1NJX A;  1HYZ A;  3ZSX A;  3CYM A;  4N41 A;  1TAU A;  3TAR A;  3ALY A;  4FLV A;  3V9U A;  1NJY A;  1JKH A;  5CYM A;  3LDS A;  4FJG A;  4JS5 A;  5FRM A;  3JSM A;  1JLC A;  4KHY A;  1RBR A;  4RG8 A;  1HNV A;  3U6F A;  3IG1 A;  1BIZ A;  4CJV A;  2B4J A;  1RIL A;  5DK5 A;  5K14 A;  4CEE A;  2Z1G A;  4DWI A;  2YKN A;  3L2W A;  3I0S A;  5FRN A;  1RBT A;  3SI6 A;  2WOM A;  3DLR A;  4CEA A;  2IC3 A;  1HPZ A;  3IAY A;  1J54 A;  1NK8 A;  3HPG A;  4KHQ A;  2Y1I A;  3KTQ A;  3QIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...