2KW4A

Solution nmr structure of the holo form of a ribonuclease h domain from d.hafniense, northeast structural genomics consortium target dhr1a
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
147
structure length
147
Chain Sequence
MDDRTEYDVYTDGSYVNGQYAWAYAFVKDGKVHYEDADVGKNPAAATMRNVAGEIAAALYAVKKASQLGVKIRILHDYAGIAFWATGEWKAKNEFTQAYAKLMNQYRGIYSFEKVKAHSGNEFNDYVDMKAKSALGIRDLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target DhR1A
rcsb
source organism Desulfitobacterium hafniense
molecule tags Structural genomics, unknown function
total genus 23
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2kw4A00
4DSFA 4KTQA 1HNIA 1LAWA 1BHLA 1Z26A 3AVLA 3OS2A 1W0HA 3D45A 1TKTA 3K5MA 2HB5A 3BDPA 4FJ5A 4GW6A 2XO7A 1G15A 4M3TA 1UWBA 1HYZA 3KKRA 3C6UA 3O3HA 4M3WA 1CXQA 4C8NA 1SUQA 1SKWA 1NKBA 4FJ7A 4HCBA 4KHSA 4M3ZA 4NCAA 1X9MA 4Z4GA 5FROA 4CJ3A 3ZT3A 2R7YA 4K8ZA 4CGGA 3SUOA 1NK8A 2QKKA 3SZ2A 3RMBA 1J53A 5CYMA 2W42A 3OYKA 3OYBA 4DTPA 2HHXA 4ELTA 3CFOA 1ASUA 2JLEA 3CFPA 4F2SA 4M3YA 4DTXA 4PUOA 4PA1A 1NOZA 4FJXA 4FJMA 1JL2A 2E6MA 4LSNA 2NUBA 4FVMA 4CJVA 1C0TA 3MEDA 4ID1A 3LAMA 2YKNA 1SL2A 4KHYA 4FJ8A 4LD0A 3LZIA 4CF8A 2XY5A 2XY6A 4KPYA 1R0AA 3RMAA 3SJJA 4F3OA 3VQ5A 4DWIA 3QLHA 1RTIA 1REVA 3LP0A 1BL3A 2Z1IA 3CQ8A 1D9DA 1SKSA 1NK0A 3SQ1A 4DQQA 4B9TA 1RDAA 2FBYA 1U45A 1IH7A 3MXJA 1J54A 1QHTA 4CJLA 4CFAA 2XRIA 3KK2A 4MQ3A 4M45A 4IBNA 4E3SA 3NF9A 1WN7A 3ISNC 4B8AB 3OY9A 3OYFA 4ELUA 4NYFA 4DU3A 2OA8A 4HUFA 3EYZA 3AA2A 3SQ2A 3LZJA 1BGXT 4GMJB 5C24A 3T1AA 4DQRA 4WE1A 1DTQA 1KLMA 4M3RA 2YNIA 2PZSA 4AHVA 1NK9A 1HNVA 4DSKA 3QEXA 2KW4A 5T7BA 2YKMA 1WSJA 4DTNA 2OPRA 1IKWA 3SYZA 4IFVA 1RT6A 2KTQA 4RW4A 3KLEA 4CF1A 1ZYQA 3AO3A 1QTMA 5EU7A 2ETJA 4E1NA 1RT4A 1JLQA 4MFBA 4NCBA 4KI4A 4NCGA 2F8TA 1BCMA 4Z4HA 1S1UA 3AVNA 5C42A 3NH2A 1BQMA 4DF4A 2QK9A 3RMCA 4FK2A 5J1EA 4UQGA 3RMDA 1YT3A 1XHZA 4AHSA 3TI0A 2Z1GA 1L3UA 3O3FA 2DFFA 2X74A 5HRNA 5CYQA 4E7LA 2D5RA 1FXXA 4H4MA 4DTOA 1GOCA 5HLFA 1YTUA 1U47A 1XHXA 2KQ2A 2I5JA 3ZT1A 5FDLA 4LSLA 4I9LA 4EZ9A 4KHQA 1ITGA 1F21A 3OYIA 5KGXA 4I9QA 1S1XA 3FFIA 4DLGA 4F2RA 4FM0A 2DY4A 2A1SA 3O3GA 3JSMA 3VQ8A 4DQPA 1L3SA 1RT7A 3PUFA 3QEIA 4EZ6A 3A2FA 2PYLA 1BISA 1VK0A 4O55A 5J2QA 3V4IA 4ZTFA 3KIOA 2OYQA 4B3OA 5C25A 4DTSA 3L3VA 4DMNA 4HUGA 3TABA 4KAZA 4DQIA 1EXQA 3OYHA 2Y1JA 4CGJA 2Z1HA 2GBZA 1NK5A 2OZMA 5E41A 3OYEA 4DTUA 3TAFA 3HVTA 3QINA 2PY5A 1BI4B 4QOZB 1LW0A 4N41A 2ZQBA 4Y1CA 4C8MA 1X9SA 4CF9A 2X78A 2BGGA 1FK9A 4DSIA 3TR8A 3LAKA 3HM9A 5D3GA 1ZBHA 3VQDA 4AHCA 4RW7A 3MEEA 1RILA 3NH0A 2VG7A 3K2PA 4OPJA 4KKOA 1LWEA 4H4OA 3ZCMA 2XHBA 4FM2A 3ZSQA 4FM1A 4FLUA 3QERA 3QESA 3S3OA 3DM2A 5I3UA 4KFBA 1ASWA 1KTQA 2IS3A 5CZ1A 1B9FA 2PYJA 4BWJA 4DFJA 3RR7A 3QEVA 2VG5A 3VQBA 1CXUA 3DLEA 4DTRA 1KFDA 3KLGA 3SI6A 2OZSA 1GOAA 4F3TA 2IDOA 2BE2A 4CE9A 1C1BA 3CG7A 1Y97A 4OKJA 1WAFA 1NJWA 1U49A 1RT5A 4FYDA 2G8WA 1RNHA 2X6SA 3NF8A 2FBTA 2LSNA 3PX6A 4Z4CA 5CZ2A 1TVRA 2X6NA 3VQ9A 2HHTA 4CIGA 1K6YA 1ZBUA 3ZSYA 5KRSA 4QAGA 4BE1A 1Q9YA 4QCLA 3TANA 4AILC 3MECA 3OYJA 4R5PA 2Q3SA 4OPKA 4DU1A 5I42A 1SL0A 4CGFA 1NJXA 4CFBA 1SKRA 3TWHA 4B9VA 4IG0A 3ZSWA 3KKSA 1EETA 2FBVA 3T19A 3NDKA 1WAJA 4KHNA 4PY5A 1YTAA 1HQEA 4PQUA 4W5NA 3V9XA 1LWFA 2RN2A 4M41A 3DLRA 1WSGA 3KLIA 3HVRA 1VRUA 4K8XA 4FLYA 1HYSA 3F9KA 4FJNA 4CHYA 1A5WA 4CJWA 3QNOA 4CK3A 4B9MA 1JXEA 4O4GA 2G8KA 2HNDA 3M8PA 4XIUA 2ZE2A 1WSFA 3KJVA 4Z4EA 1N6QA 3MAQA 5KGWA 1EP4A 3DYAA 5SWMA 3AO2A 1BCOA 4CEZA 2YNGA 1XWLA 3AO5A 1KVCA 4CHNA 3QNNA 3S3MA 1HYVA 5KRTA 4CECA 1UAXA 2YHAA 3HPHA 4OKKA 4CIEA 4H8KA 3AA3A 3HSTB 4DF8A 5HROA 2HHUA 1RBSA 3HP6A 3ZSOA 3B6PA 4OGCA 3VN5A 1HPZA 1MU2A 3THVA 4CESA 3WNGA 4N76A 2JGUA 4OJRA 4Y1DA 1NK6A 4CJ5A 4G1QA 4I2PA 3NH1A 1S9GA 1JLEA 1ZBFA 3M8RA 4FLZA 1L5UA 4KTZA 3NF7A 1QQCA 3VQEA 4RW8A 4Z0UA 4OKEA 3ITHA 4DQSA 1QSSA 2DTUA 1UA1A 4AHRA 3OYMA 2OPQA 3P83D 3AVHA 1S9EA 4FJJA 4J2DA 3KTQA 2O4GA 5HRRA 5J2PA 1HJRA 1ASVA 3AVJA 5FRNA 1RDDA 3SQ4A 3OS1A 3NF6A 3IS9A 1RCHA 1TV6A 4HHTA 3V9ZA 1RBTA 4ICLA 4FLTA 4FLVA 3OJSA 2FC0A 1U48A 1Q9XA 4J2BA 3VQPA 1U04A 4FLWA 4CCHA 3ZT2A 3M8SA 1VSMA 2GUIA 4O0JA 4E0DA 3DMJA 3V9WA 3L2WA 4CJKA 3OYNA 3P5JA 4CJRA 4FZYA 3NFAA 1KVBA 4LH4A 4O5BA 1IKYA 3EZ5A 3NE6A 4JRQA 4DFKA 1JLCA 3HL8A 2IAJA 4LH5A 1BIZA 3HYFA 4CEDA 4E7IA 4CFCA 3S9HA 2P5GA 3ZSVA 1HQUA 4E7JA 1IO2A 3V6DA 2A1RA 1CLQA 4F4KA 1WNSA 3I0SA 2G8IA 3LPUA 2F96A 1VSIA 2D0BA 1CZBA 3QIOA 4JRPA 3V1OA 4M3UA 3DRRA 1DTTA 4M42A 4FJLA 4CK2A 4CEEA 1C1CA 1S1WA 3LP2A 4DFMA 4I7FA 4CHPA 1JLAA 1X9WA 4FJHA 5FRMA 4E1MA 4CJQA 4HCCA 1XI1A 4B9LA 2YNFA 5J2NA 2DFHA 3HXMA 4FXDA 1C6VA 1LV5A 4I2QA 4CJTA 2YNHA 4OGEA 4GVMA 4HUEA 1A5VA 3DLGA 1ZBIA 1JLBA 3RRGA 4CHQA 3M8QA 1RBUA 2D0AA 2FBXA 4DG1A 5KTQA 2QXFA 1TK0A 1RTDA 1QSLA 2P5OA 1YVUA 3L3UA 2IC3A 3VQQA 2P51A 4DS5A 1XC9A 3HT3A 3RRHA 3SV3A 1SL1A 3KLFA 3OYDA 2WOMA 1C1AA 4CK1A 1QE1A 3L2UA 1BI4A 1RT2A 3O4QA 3DOKA 3JYTA 3NGYA 2AJQA 4FK0A 5JS2A 2HHVA 3LWMA 1JKHA 3NAEA 4N47A 5CY4A 3ZSZA 4CIFA 3U3YA 4C8LA 1S5JA 3AVFA 3C94A 3EY1A 3CFRA 1NKCA 4FZXC 3AVAA 4Z4FA 2HW3A 4CGHA 4RW6A 3PY8A 1I3AA 1FKPA 4NYNA 1NJZA 1QS4A 4FJIA 1S6QA 3KK1A 4F8RA 3K5LA 3NBPA 4O0IA 3TAMA 1S1VA 1FKOA 1RT3A 2YV0X 3OS0A 3SUPA 1RT1A 3K5NA 1NK7A 4FJGA 4YFUA 3SCXA 4FK4A 4BDPA 1VSHA 1Z25A 3T3FA 3VQ4A 2HHSA 4CERA 3QIPA 1JL1A 3AVIA 3SPZA 2Y1IA 4IDKA 3SPYA 3D0PA 4EP4A 4B9SA 4CGDA 3O4NA 1S6PA 4ZHRA 3KLHA 4KHWA 3PV8A 1TKXA 1LAVA 3LPTA 3F73A 1KVAA 3SNNA 1CZ9A 4J2AA 1BQNA 4LY7A 4CF0A 4JS4A 3VA3A 3L8BA 1W9HA 4DSLA 1C0UA 1WLJA 4AH9A 2WONA 2D0CA 2DFEA 2ITGA 4N56A 1UA0A 3WNFA 2G8VA 1NOYA 1RDBA 2KZZA 2HVHA 3ALYA 4DU4A 4DTMA 4DFPA 3ZSXA 2HHWA 1D9FA 3NHGA 2BANA 3SQ0A 1BIUA 3IG1A 3LP3A 1L3TA 4FZZA 1X1PA 1UOCA 2IOCA 4BWMA 3LP1A 4CJEA 3PO4A 3PX0A 4HVJA 3IRXA 3PO5A 4CEBA 5HRSA 4CJUA 5K14A 2OPPA 3QEPA 4E19A 3I8DA 3AO1A 4CJPA 5JS1A 1IKXA 1J9AA 1SV5A 2B4JA 3LALA 3C95A 2VG6A 4IFYA 3CM5A 1NJYA 3E01A 4HTUA 3G10A 3NGZA 3VA0A 3NCIA 4E7KA 4YNQA 3HK2A 4KB1A 4B08A 1VSKA 4B9UA 3PX4A 3ULDA 4BDYA 3RR8A 1JLFA 4CF2A 1VSJA 3V81A 3H08A 4CJSA 3DRSA 3ZT0A 3K59A 3TAPA 3OVNA 1S1TA 3LWLA 4W5OA 1JXBA 3AA4A 4FW2A 2BDPA 4FW1A 4OLAA 2B6AA 2RPIA 4FLXA 3SUQA 3DLBA 3DOLA 4CEQA 3VQ7A 3S3NA 4CGIA 3IAYA 3OYLA 3BGRA 4AHTA 4B9NA 3KD1E 4KV8A 5KI6A 1Q8IA 3CYMA 3QETA 1T03A 3U6FA 3LANA 5SZTA 3RTVA 4AHUA 1WSIA 3QO9A 3MXMA 1RTHA 2P1JA 3U3GA 3HPOA 4CEAA 3NGIA 4Q5VA 1TAUA 1KFSA 4EP5A 4JLHA 1B9DA 2EX3A 4CJFA 4ZTJA 3VQ6A 3DLHA 3OYAA 4M3XA 3DI6A 1N5YA 4CEFA 4N5SA 3K57A 3K58A 3V1RA 3TAQA 3HJFA 3MEGA 4C8KA 2RKIA 1KLNA 1T05A 1KRPA 2G8UA 2XY8A 1TK5A 2HVIA 2RF2A 3ZT4A 4FJKA 2E4LA 4TSXA 3OYGA 4Z4IA 5HP1A 3QEWA 3MXIA 4W5QA 2HMIA 3TARA 3V1QA 4CHOA 4E89A 3P1GA 1EKEA 4BACA 5J2MA 5DK5A 3LDSA 2IGIA 3WNHA 3AVMA 1T8EA 2QKBA 4KO0A 4CEOA 1KCFA 4BE2A 1TL3A 4CHZA 1KSPA 4IG3A 2KFNA 4OVLA 3AVKA 4E7HA 4DSEA 3ASMA 1TGOA 1I39A 1A5XA 1EX4A 3AA5X 3HPGA 4ID5A 1NKEA 4KHUA 3AO4A 1U4BA 3C6TA 3RWUA 4RG8A 1C0MA 2GV9A 3HP9A 3SV4A 2HNYA 3CM6A 4CFDA 1DLOA 3DLKA 3UIQA 1ZBLA 4KI6A 1WSEA 2B5JA 2HHQA 3AV9A 3G0ZA 4O44A 4KREA 1TK8A 1TAQA 3AVGA 4Q0BA 1TL1A 3L2VA 1LW2A 1O1WA 4DSJA 1HMVA 3V9SA 2ATQA 1WSHA 3AVBA 4DLEA 1TKDA 2G8HA 2YHBA 4FCYA 1JLGA 1IG9A 1T7PA 4JS5A 3KD5E 1D5AA 4L8RB 3VQAA 4KRFA 1HRHA 3SUNA 1IKVA 4OLBA 3OJUA 3DRPA 1D8YA 3I0RA 4C8OA 1VSDA 4FJ9A 2F8SA 1VSFA 5HRPA 3HO1A 2VWKA 4DTJA 4J2EA 3TAGA 2E6LA 3TAEA 2KZMA 2G8FA 3V9UA 4KB0A 1TKZA 1RDCA 1NK4A 2O4IA 3WNEA 2EHGA 3K5OA 2Z1JA 2ZD1A 5HBMA 1L3VA 1QSYA 1RTJA 3L2QA 3ZSRA 4W5TA 4IKFA 4DS4A 1J5OA 3B6OA 4KTWA 2KFZA 3KK3A 4CJ4A 3L2RA 1VRTA 5DMRA 1GOBA 2HNZA 4RW9A 3VQCA 1RBVA 2VWJA 4W5RA 1RBRA 4BDZA 2XY7A 1VSEA 4ELVA 1VSLA 4BE0A 1B92A 3AVCA 4B8CA 3OYCA 4PWDA 2OPSA 1LWCA
chains in the Genus database with same CATH superfamily
1BHLA 3K9JA 3VF6A 3K5MA 2HB5A 4DV3K 2XO7A 3TSQA 5FPNA 3C6UA 4HCBA 4DR4K 2O8DB 4NCAA 2F4VK 3ZT3A 2R7YA 4CGGA 3CI5A 2QKKA 3RMBA 3TTCA 4E1JA 1GLJO 3CFOA 4DV7K 1OH6A 4DTXA 4M3YA 1NOZA 2UXDK 4FJMA 1NGCA 2D0PA 3E1YA 2O8EB 1JL2A 3C6HA 4FWSA 4FVMA 4XH5A 1YVNA 3AGKA 1S72N 2WFBA 2ASOA 2XY6A 3I56N 4A62A 1R0AA 2IVNA 1RTIA 3LP0A 4IWVA 4CZFA 3MX2A 4QS7A 1U45A 2FBYA 5DM7L 2NRXA 4X64K 1QHTA 4CJLA 4CFAA 3VPZA 3KK2A 4E3SA 3VEVA 1WN7A 4NYFA 3AA2A 3AAQA 4BQLA 5M1OA 3T1AA 4WE1A 3K0SA 5T7BA 1WSJA 4YOXA 1RT6A 4CF1A 4E1NA 3T7ZA 5DM6L 4MFBA 4NCBA 5CHIA 1S1UA 4GY2B 2ITMA 1QHAA 1XHZA 1L3UA 5HRNA 5BRFA 1DKGD 4DTOA 2V7ZA 3OYIA 3VMFB 4ILJA 4B3TK 4F2RA 4CZKA 4DQPA 2VWBA 2PYLA 4IOAL 4B3OA 3ZETA 2QWMA 1NGAA 3OYEA 4DTUA 3TAFA 2OANA 4CBXA 3QINA 3L0QA 1BI4B 4QOZB 3VEOA 4N41A 1DEJA 2W40A 4C8MA 2X78A 3TR8A 2A42A 5D3GA 2P9UB 1ZBHA 3VQDA 3NVKA 4RW7A 4JAXA 1RILA 2VG7A 4OPJA 4V19S 4KKOA 4FM2A 2A1RA 3DM2A 3MWTA 1TYQB 4IEIA 5I3UA 1NGFA 2IS3A 4DFJA 3RR7A 1CXUA 5AQHA 3EZWA 3SK3A 1KFDA 3KLGA 3SI6A 2OZSA 1GOAA 1U2VB 4JI1K 4OKJA 1Y97A 4JKEA 1WAFA 1NJWA 1WBDA 4FVUA 4DV1K 5AQGA 2LSNA 3BUZB 5CZ2A 5F2RA 1TVRA 4FWNA 4FSVA 1K6YA 1ZBUA 1IJJA 4AILC 4ISGA 5I42A 1QVGM 2I7NA 2F9WA 2ZWHA 4CGFA 3O9UA 1NJXA 3G4SN 4IG0A 2FBVA 4W5NA 1Z05A 1YTAA 3D7EO 1HYSA 1VRUA 5LJWA 1A5WA 4CK3A 4DR1K 2G8KA 2HNDA 4JKGB 4XIUA 3KK7A 1YUWA 1N6QA 3DYAA 2V52B 2ZM6K 1XWLA 4CHNA 3QNNA 1NJIO 3VETA 4CIEA 1QQOA 5JVHL 3F2KA 1RBSA 2O8EA 4JI8K 3CERA 3HP6A 3ZSOA 4OGCA 3VN5A 1HPZA 3THVA 4CESA 3WNGA 2JGUA 4OJRA 4CJ5A 4EHUA 1L5UA 1QQCA 1OVYA 3J7AP 4DQSA 1QSSA 1JCFA 1S9EA 4A2BA 4J2DA 1XNQK 1HJRA 3H1QA 1RDDA 3FGUA 3IS9A 1RCHA 2WTUA 4HHTA 2PBDA 4FLTA 3TTFA 4B1XB 5EX5A 4H5TA 5C0YA 3R3LA 3M8SA 1VSMA 4K0KK 3DMJA 3VEXA 4BVPA 4DV5K 4CJKA 1WBBA 4JRQA 2IAJA 4DV2K 3LDQA 3HYFA 4E7IA 4H0VB 4CFCA 2P5GA 3ZSVA 3DWLA 4E7JA 4F4KA 1WNSA 3I0SA 2G8IA 3LPUA 1VSIA 1CZBA 5JICA 1I94K 5FPMA 3CD6N 3GDQA 4BC3A 4E1MA 2FF6A 4HCCA 1T6CA 3TU5A 2QI2A 4FXDA 2A40A 1LV5A 4I2QA 4CJTA 2YNHA 4OGEA 3GOIA 3VF2A 4LFBK 3RRGA 3M8QA 2FBXA 1RTDA 1YVUA 3M5RA 4DS5A 1XC9A 3HT3A 3KLFA 1BI4A 2VGMA 3JYTA 2E1ZA 2ZJQL 4DUYK 3NAEA 3U3YA 3AVFA 3QICA 2P9UA 3CFRA 4DCHA 2E88A 4RW6A 1I3AA 3TSUA 1QS4A 4IEEA 3G25A 1TYQA 3WXJA 1NK7A 2FSKA 5GADP 1Z25A 4M63C 4PL8A 2QWOA 4CERA 1JL1A 1U2VA 3F9MA 4ILGB 4QS9A 1P8ZA 4IZ9A 3O4NA 1S6PA 2Q0UA 1MDUB 4ZHRA 3PV8A 1TKXA 4JYAK 1KVAA 5ADXA 3VEWA 4IO9L 4DSLA 3UB5A 2UXBK 4AH9A 2WONA 3A5LC 2DFEA 3MK6A 3Q7BA 3L4IA 2PAVA 3O9TA 2HHWA 1BU6O 3LP3A 3SAFA 4DV4K 4RCHA 1BUPA 2HBLA 4CJEA 4HVJA 3PLAA 4CJUA 3O6WA 4E19A 3I8DA 4JKGA 3AO1A 5AQLA 3RVCA 3AGRA 1SV5A 3D2EB 3E01A 3ZX0A 3G10A 3VA0A 3CCJN 4YNQA 2NRVA 1VSKA 3ULDA 3V81A 3DRSA 4WFAL 3OVNA 3LM9A 3AA4A 3E9LA 4FPBA 4FLXA 3DLBA 4CEQA 3IAYA 3KD1E 4HWIA 5KI6A 3QETA 3I8BA 1T03A 3LANA 5SZTA 3LDLA 3RTVA 3K9KA 1RTHA 3HPOA 4A5AA 3J7YP 4UY8O 3NGIA 1E4GT 4EP5A 4ZTJA 2VCPA 3VQ6A 4M3XA 1N5YA 4N5SA 1VAZA 3HJFA 2WC9A 4C1NI 3CCRN 1KRPA 1V4TA 5A2QO 2XY8A 2YJEA 1TK5A 4AQYK 2HVIA 2RF2A 4O8UA 3ZT4A 2E4LA 4TSXA 3EN9A 1W97L 5HP1A 1GLCG 5IWAK 1E3MA 2KHOA 3TARA 1GLBG 3P1GA 4JV5K 2KKZA 5DK5A 3LDSA 3WNHA 2QKBA 5FLXO 3AY9A 4CHZA 4IG3A 4CW7B 1NU0A 3JXUA 2HF3A 4OVLA 4BR7A 3O5BA 3HPGA 3QFPA 4RG8A 3DXMA 4BR4A 3CM6A 1WSEA 2PFUA 3AV9A 2YHXA 5AQUA 1TK8A 3AVGA 4XEIA 5AQMA 3L2VA 2EWSA 1LW2A 4CZEA 3AVBA 4DLEA 2YHBA 1KXPA 5KQDA 4JS5A 3VQAA 3TPQA 1HRHA 4DR2K 4GV3A 2YJFA 4CI6A 2VWKA 5AQOA 3C6AA 1GLEG 3QB0A 2KZMA 4B1ZA 4JK7A 1HKBA 2Z1JA 2FF3B 4B9QA 4IKFA 4DS4A 3B6OA 1NMDA 3KK3A 4CJ4A 3BY5A 4RW9A 5EOYA 1RBRA 4U67L 1EWRA 4ELVA 5I9EB 1SAZA 3AVCA 3OYCA 4PWDA 4DSFA 4YDUC 1HNIA 1LAWA 1Z26A 3D45A 4JN4A 3BDPA 3GE1A 5LY3A 2QWPA 4H0TB 5AQIA 1G15A 1K9MO 4M3TA 4M3WA 1NKBA 4FJ7A 4KHSA 1HKGA 1ATSA 4K8ZA 3GBTA 3JAMO 3OYKA 1NMNA 1ASUA 4F2SA 3CFPA 4PUOA 4YOWA 5AQPA 2Q97A 3IDHA 3MEDA 1SL2A 4FWLA 4FJ8A 4LD0A 2E2QA 3D2EA 3SBGA 3CMEN 3SJJA 4DWIA 4WQ4C 4B1VA 1BL3A 3CQ8A 1D9DA 3DLLL 1NK0A 5AQTA 1RDAA 3MDQA 3MCAB 1IH7A 1J54A 1YITN 3P4IA 4MQ3A 4M45A 2DPNA 4XH4A 3OY9A 4ELUA 5M1PA 4R79A 4DU3A 2OA8A 3RSEB 1BGXT 4GMJB 5C24A 3CPEA 4M3RA 1KLMA 1WOQA 1NK9A 4DSKA 3QEXA 2KW4A 2I7PA 4K43A 3O8MA 1IKWA 5KPRA 2NNWA 2E20A 3KLEA 1ZYQA 3HI0A 5EU7A 1RT4A 5BR9A 3HTVA 4NCGA 4Z4HA 3AVNA 5C42A 3CCUN 2QK9A 5J1EA 1O13A 5C2FA 4GV9A 2A41A 4AHSA 5GAEP 3O3FA 4JHDB 5CYQA 2D5RA 4MDBA 1XHXA 1T6DA 4KHQA 3E9OA 1F21A 5KGXA 3FFIA 4KH6A 4DLGA 1VQON 1EQYA 2DY4A 2A1SA 3O3GA 1L3SA 1Q86O 1KAZA 3A2FA 1VK0A 5J2QA 2OYQA 5C25A 4DTSA 4DMNA 1EXQA 4CGJA 3I55N 1NK5A 5E41A 1HLUA 2PY5A 3ZX3A 3FFKB 3H3NO 3ZEUA 1N34K 4Y1CA 4LF9K 1Y64A 4AHCA 3ID6A 2HF4A 3QESA 3S3OA 1MA9B 1ASWA 1KTQA 5CZ1A 5LJVA 3MN6A 1K8KA 2A5XA 2QWLA 3CXCM 3VQBA 3WQUA 1C1BA 2QXLA 3CG7A 4DV0K 4WQ4A 3NF8A 3THWB 3VOVA 4IXCA 4Z4CA 3VQ9A 3C0BA 3ZSYA 4QAGA 1IBKK 5C12A 5AQWA 1HR0K 3TANA 3MECA 5BPLA 4R5PA 4OPKA 4DU1A 4CFBA 4K42A 3TWHA 3QDKA 4B9VA 3KKSA 3NDKA 2E1YA 1HQEA 2RHKA 3V9XA 1LWFA 1OH8A 3BZKA 4M7YA 1T44A 4FJNA 3QNOA 4CJWA 3DXKB 4B9MA 1JXEA 4IDHA 1J5EK 4DB3A 4H0XB 3KJVA 4MLEA 4Z4EA 5KGWA 1BCOA 2YNGA 4H5VA 1KVCA 3H46O 5KRTA 4CECA 4OKKA 2YHAA 3HPHA 1VQPN 4YY3K 2YI1A 2HHUA 4BRLA 3SLCA 1MU2A 1NK6A 3FZHA 4G1QA 4I2PA 1S9GA 1JLEA 4I6MB 4KTZA 4RW8A 4Z0UA 3ZLJA 1VQ5N 4X65K 1G99A 2OPQA 3P83D 1FJGK 1C0GA 3UE5A 1GLDG 4OO1J 2GELA 1ASVA 3AVJA 4FWMA 3OS1A 5JVGL 1Q9XA 5TKYA 4B3RK 1U04A 1ZXOA 2GUIA 4O0JA 3RSEA 3VEYA 4NB4A 1Q18A 3P5JA 4BY9C 1KVBA 3FZMA 4PKGA 4CEDA 2ZGYA 3S9HA 3HOTA 4B1WB 3A5OC 4DR5K 2IVPA 4JI2K 4Y0WA 2D0BA 2OCEA 4A5BA 4BQZA 4YOVA 3UKRB 3CJ9A 3PIOL 4JRPA 4DV6K 3V1OA 4M3UA 3DRRA 1DTTA 4M42A 4FJLA 4CK2A 4JHDA 1S1WA 3LP2A 2AP1A 3CF5L 4CHPA 5FRMA 2P9IB 2V51B 2QM1A 4FPAA 5BRHA 4CJQA 3MMVA 1HX1A 5AR0A 3HXMA 4LC9B 1C6VA 1MWKA 4PHTX 1JLBA 2D4WA 4BC5A 1VQLN 1QQNA 2QXFA 4JEPA 3SJHA 1QSLA 3VQQA 4FWQA 1HNWK 1SL1A 4BRHA 1C1AA 3O4QA 4FK0A 5JS2A 2HHVA 3ZSZA 4C8LA 3EY1A 3HZ6A 1NKCA 2HW3A 2NRRA 4FJIA 3TAMA 5JMVA 1S1VA 1FKOA 3SMPA 4A57A 3CCMN 3OS0A 1RT1A 3L6QA 3SCXA 3R9PA 4H03B 4L3QA 4FOEA 3D0PA 4B9SA 4KHWA 1OVQA 3F73A 2GUPA 1CZ9A 3THWA 4LY7A 4CF0A 3VA3A 1ZC6A 4PKHA 1C0UA 4XH1A 4YOUA 4ISFA 1UA0A 3WNFA 1NOYA 1RDBA 4FO0A 2KZZA 2O8DA 2UU9K 5TKWA 3ZSXA 1D9FA 5BREA 1L3TA 4FZZA 1UOCA 2IOCA 2KLAA 3IRXA 3DAWA 2NRWA 4CEBA 3DXKA 5AFUH 3QEPA 4BR2A 3T1YK 1IKXA 1J9AA 2B4JA 3LALA 4IFYA 3SMSA 3CM5A 5AQYA 4HTUA 4E7KA 4KB1A 4B08A 3PX4A 2P9LB 1VQMN 3RR8A 5CE3A 1Q7YO 2NRZA 3OW2M 1VQKN 2RPIA 3DOLA 4I6MA 3OYLA 3BGRA 5E84A 4B9NA 4KV8A 3CYMA 4CJ7A 3A5MC 3VGLA 4JI0K 4AHUA 2UUAK 1BOTO 1XNRK 1KD1O 4CEAA 5B8HA 4Q5VA 3J7ZO 4EFHA 4CJFA 2EX3A 5AZIB 3ATUA 3DI6A 4CEFA 1QVFM 3K58A 3V1RA 3KHYA 4B1UB 3TAQA 2RKIA 4IFEA 4OPHA 4Z4IA 2O8BB 3QEWA 3MXIA 4W5QA 2HMIA 4JI3K 4CHOA 2WBNA 3CJBA 3MCPA 5AQVA 4E89A 4BACA 3ENOA 4BROA 2IGIA 5F0XA 3ATVA 1T8EA 4KO0A 1ZBSA 4BRAA 4CEOA 4DUZK 1KSPA 4BVOA 4BRIA 4CBUA 3UKRA 4JKHA 4ID5A 3BF1A 3AO4A 1U4BA 1EO1A 2P9IA 2GV9A 5LMUK 1BDGA 3SV4A 2HNYA 4CFDA 3CCVN 3DLKA 4KI6A 4C23A 1ZBLA 1ATRA 1NLVA 3WXMB 1VQ8N 1TL1A 1EWQA 4DSJA 1WSHA 1HNXK 2G8HA 4DQ8A 1YF5L 3O08A 3DRPA 3I0RA 1VSFA 4AM7A 4DTJA 4J2EA 3O1WA 2E6LA 3TAEA 2G8FA 4YOYA 1NK4A 3WNEA 2EHGA 1IBLK 2ZD1A 3C7NB 3ULEB 3L2QA 4W5TA 1J5OA 3CQYA 3KWIA 2BTFA 5DMRA 3VQCA 4O8KA 4BDZA 1HJOA 2Q31A 3VESA 4ILHA 1IG8A 1N8RO 4M7XA 4CD3A 1TUUA 5BPNA 3AVLA 1W0HA 3HBTA 4FJ5A 1IV0A 5AQXA 3TSPA 3ENHA 1UWBA 3KKRA 3O3HA 1CXQA 1SKWA 1SUQA 3U9DA 4M3ZA 4Z4GA 4LF6K 4CJ3A 2VQFK 5H1SQ 4BRMA 3SZ2A 2P9PB 4O5FA 2W42A 4X62K 1XMQK 2JLEA 2A6AA 3VEZA 2NZTA 2NUBA 3M1FA 2QWRA 1C0TA 2NLXA 4KHYA 5AQFA 4KPYA 4CF8A 3VQ5A 4WFNL 2P9LA 2Z1IA 4LF4K 5KPZA 1SKSA 3SQ1A 4DQQA 1T3VA 1DT9A 3O80A 4LF5K 4B8AB 5EVZA 5C10A 3U4LA 4HUFA 4FOIA 4DQRA 3WUHA 2W6KA 5C15A 1HNVA 2YKMA 4DTNA 2OPRA 3SYZA 4IFVA 5AZIA 4RW4A 4X66K 3AO3A 4KI4A 4A59A 1NGBA 3LL3A 3GG4A 3NH2A 4JK9A 1BQMA 4DF4A 3RMCA 3LDPA 4UQGA 2Q0RA 3EEQA 3TI0A 3WQTA 1D4XA 2W6LA 4BC2A 2X74A 4WFBL 4E7LA 1YTUA 1FXXA 4H4MA 2VYPA 3CCSN 2KQ2A 2UXCK 2I5JA 5FDLA 4LSLA 1ITGA 4I9QA 4OX9K 4G9ZA 1S1XA 4C1NK 1V4SA 1KQSM 4BRPA 3JSMA 2UUBK 1BISA 4ZTFA 4BRQA 3KIOA 3M3ZA 4DQIA 3OYHA 2P9SB 2Y1JA 1XUPO 1YJNN 2Z1HA 2GBZA 5FPDA 3I33A 2QWQA 3HVTA 3VF4A 1XQSC 3HRGA 5GIPA 2ZQBA 4CF9A 2BGGA 1FK9A 3WEEB 3LAKA 1JCEA 3VENA 3HM9A 2ZJPL 1XMOK 1YHQN 3MEEA 2YHYA 5GAHP 3K2PA 4BRDA 4H4OA 1SQKA 1VQNN 2E5LK 5LMNK 4F9OA 4KFBA 4LFCK 3NMUA 1B9FA 3T69A 1NGDA 3D2FB 3QEVA 4KBOA 5AQSA 4DTRA 2GTDA 4F3TA 4GNIA 2IDOA 2BE2A 2O8CB 4NXMK 1RT5A 3SBTA 4FYDA 3C7NA 3ULEA 4B3MK 1BA1A 4H0OA 2HHTA 3G71N 4CIGA 5KRSA 2GEMA 4BR5A 4BR0A 3CCEN 4QCLA 4JKCA 1SL0A 3ZSWA 1EETA 4KHNA 4PQUA 3FR0A 2IVOA 4M41A 1WSGA 2ASPA 3KLIA 4K8XA 3F9KA 4CHYA 4O4GA 4HTLA 2ZE2A 2Q1NA 1EP4A 4BRCA 2P9PA 5SWMA 4BR9A 3S3MA 1UAXA 3O4WA 3HSTB 4PL7A 1ESVA 3KVGA 3B6PA 1NM1A 3NVMA 3NH1A 3LDOA 3M8RA 1N36K 1VQ6N 3NF7A 5KQ8A 3CQXA 2VQEK 3ITHA 4QS8A 1SZ2A 3CIPA 2DTUA 3THXB 1UA1A 4LF7K 3AVHA 2HBJA 4FJJA 3KTQA 2O4GA 5HRRA 4A61A 2A3ZA 2JWKA 5F1XA 5J2PA 5FRNA 5BRDA 3R6MA 3SQ4A 3NF6A 3PSIA 1RBTA 2HBMA 4ICLA 3OJSA 3T1HK 4H5WA 1U48A 4J2BA 2HHHK 4NLCA 3ZT2A 3OBWA 4NO7A 4CZIA 3L2WA 3OA9A 3OYNA 3CC7N 5M1KA 4O5BA 1IKYA 4DFKA 4K25A 1JLCA 4LH5A 4WQ5C 3V6DA 4EIAA 1R59O 5AQRA 2FSNA 4CBWA 3OHRA 4CD1A 1ATNA 4I7FA 1X9WA 1K73O 4FJHA 4YDUA 2GX9A 4B9LA 3VGKA 3FLCO 4HUEA 4CHQA 2D0AA 3P31A 4DG1A 1JJ2M 3CJ1A 2P9SA 4H5RA 3SV3A 1N32K 2WOMA 1QE1A 1RT2A 3DOKA 4DKWA 3OTOK 1NGIA 1JKHA 1S5JA 5EY4A 4FZXC 3AVAA 5C2DA 1FKPA 4NYNA 1NJZA 4F8RA 3KK1A 4K41A 4EAHD 3NBPA 3FZLA 1VQ7N 4CZHA 3SUPA 3K5NA 4FK4A 4YFUA 4BDPA 1VSHA 3JS6A 3B8AX 3T3FA 3Q7CA 3VQ4A 1ILYA 3SPZA 1GLAG 4RWTA 2O8CA 5M1NA 2HOEA 4CGDA 3KLHA 1LAVA 3SNNA 3ZX2A 4J2AA 3VTIA 1BQNA 4JS4A 3L8BA 2QEXN 1WLJA 3PIPL 2ITGA 4N56A 3EE9A 3FZFA 3OBYA 4DR7K 4MLHA 2FLOA 2P9NB 5KPTA 3NHGA 2BANA 3SQ0A 1KAXA 3PO4A 3PO5A 1YJ9N 4H0YB 1X3NA 5HRSA 5K14A 4BG9A 2OPPA 5AZJB 2F9TA 4CJPA 3CC2N 3FZKA 4JI4K 5JS1A 3C95A 3NGZA 3NCIA 4WQ5A 4BDYA 1JLFA 1VSJA 2P9KB 1M1KO 4CJSA 3ZT0A 3K59A 3C65A 3EE8A 1RDWX 1S1TA 3UKUB 3LWLA 1JXBA 1OH7A 4OLAA 2UYTA 3BP8A 3VQ7A 1TUYA 3R1XA 3ZYYX 2OTJN 4AHTA 4J8FA 3U6FA 3QBWA 4Z94A 2O8FB 3THXA 3CHWA 1WSIA 3VGMA 1Q82O 3MXMA 3U3GA 1TAUA 1HPMA 4H5NA 1B9DA 2CH5A 2YX6A 2D1KA 1VHXA 3K57A 4LFAK 4EHTA 3MEGA 3A5NC 5GIOA 3EKSA 4CVNE 1KLNA 2G8UA 4FJKA 5GINA 3G6EN 3AVMA 3N4PA 1TL3A 1NGEA 2BH1A 3U8XA 2KFNA 3U9ZA 3P39A 4DSEA 1TGOA 1I39A 1A5XA 4KHUA 1NKEA 4GVEA 3C6TA 3RWUA 1C0MA 3KZBA 1DLOA 2B5JA 3LM2A 3KWGA 3QBXA 4AF1A 3G0ZA 1NWKA 1TAQA 3H3OB 1HMVA 2ATQA 4JD2B 1TKDA 2RE2A 1JLGA 1IG9A 1D5AA 3S41A 4RTFD 4KRFA 3SUNA 4OLBA 3CJCA 1D8YA 3THYB 3HO1A 5AQKA 3HM8A 3TAGA 5AJ3K 4KB0A 3V9UA 1RDCA 5ADXH 3H1VX 3K5OA 1L3VA 1RGIA 1QSYA 1RTJA 3ZSRA 3WXKA 4FWKA 3SAHA 4NXNK 3L2RA 2HNZA 5E26A 1B92A 1LCUA 4B8CA 4DR6K 4FM0A 2OPSA 4EZ6A 4KTQA 3OS2A 4MDAA 1BG3A 1TKTA 4GW6A 5M1FA 3VTHA 1HYZA 1NGGA 4C8NA 4A2AA 1X9MA 5FROA 3E66A 4KHPK 3SUOA 1NK8A 1J53A 5CYMA 3OYBA 2P9NA 4DTPA 2HHXA 3VERA 4ELTA 3O9RA 3PSFA 3H6EA 4IOXA 4PA1A 5M1QA 4FJXA 5AQQA 2E6MA 4LSNA 4CJVA 4ID1A 3LAMA 5AZJA 2YKNA 3O9QA 1C0FA 3LZIA 2XY5A 3RMAA 4F3OA 3QLHA 1REVA 5BN8A 5FPEA 1CZAN 2Q36A 3TTDA 2P9KA 4GKJK 4B9TA 2E2NA 3UKUA 3MXJA 2OTLN 2XRIA 4IBNA 4JI5K 3NF9A 3OYFA 3ISNC 3SQ2A 3EYZA 3LZJA 2O8FA 4IJNA 1DTQA 4B3SK 2YNIA 2PZSA 4PKIA 4AHVA 1X9JA 2KTQA 5BR8K 1QTMA 2NRTA 3D6RA 1GLFO 2ETJA 1JLQA 3WT0A 2F8TA 1BCMA 3HOSA 4FK2A 3RMDA 3O9SA 1YT3A 3M6GA 2Z1GA 3QMLA 2DFFA 1KC8O 4FL9A 5HLFA 1GOCA 1U47A 3ZT1A 5BPMA 4I9LA 4EZ9A 3IUCA 5JLHA 2ZJRL 4WCEL 1M90O 3VQ8A 4CZGA 1RT7A 3PUFA 3QEIA 3CJAA 3V4IA 4O55A 2QW9A 1NGHA 3L3VA 4HUGA 3DXMB 3TABA 2IIRA 4KAZA 2YHWA 2OZMA 3W0LA 3FE1A 1LW0A 5LL6Z 4FWPA 1E4FT 1QZ6A 1YI2N 1X9SA 1WUAA 1XC3A 4DSIA 1QQMA 4FWOA 4BC4A 4JD2A 1IBMK 3WXLA 3NH0A 2J4RA 3ZCMA 1LWEA 2XHBA 4FLUA 3QERA 3ZSQA 4FM1A 3W3DA 1YAGA 4IO8A 3J8AA 1W7AA 2PYJA 3CMAN 4BWJA 3THYA 2VG5A 4MO5A 3DLEA 3QFUA 2BUPA 3MN7A 4IOCL 4CE9A 1H1VA 1S3XA 1U49A 2CGLA 2G8WA 1RNHA 2X6SA 2FBTA 3PX6A 2X6NA 2QWNA 1RDUA 2F7TA 1FW6A 4BE1A 4YOTA 1Q9YA 4JKDA 1J6ZA 3OYJA 3EL2A 2Q3SA 1SKRA 4CZMA 3P38A 4PY5A 3T19A 1WAJA 2RN2A 3HVRA 3DLRA 3HSCA 4H0PA 4FLYA 2QA4N 5BN9A 3IKMA 3M8PA 3BZCA 3A0IX 2CGJA 1WSFA 2HBKA 5CR4A 4GV6A 3CPWM 3MAQA 3AO2A 4CEZA 4CZLA 3AO5A 1Q81O 3WXIA 3MN5A 1HYVA 3O1BA 1BO5O 4H8KA 3AA3A 4DF8A 5HROA 2E2OA 3ID8A 4N76A 4Y1DA 4BG8A 2D0OA 2FSJA 1ZBFA 4FLZA 5GAGP 3VQEA 4DHYA 5AFUA 1YIJN 5IT9O 4OKEA 1WB9A 1W2BM 4AHRA 4OPAA 3OYMA 1K8AO 4GKKK 4BGAA 5HL7L 1TV6A 3EKUA 3V9ZA 4FLVA 2FC0A 3VQPA 3EO3A 4FLWA 4CCHA 5MLCQ 1YXQA 2Q2RA 3BEXA 4E0DA 3V9WA 1VQ4N 4CJRA 4FZYA 3NFAA 4LH4A 3NE6A 3EZ5A 1NNEA 1DGKN 3HL8A 1BIZA 2O8BA 1BA0A 1HQUA 1IO2A 2ZGZA 1OKJA 3CJ7A 1CLQA 2F96A 2NRHA 3AARA 3QIOA 4BRNA 4DFMA 4CEEA 1C1CA 1QZ5A 4BREA 1JLAA 5JLFA 1NGJA 1XI1A 2YNFA 5J2NA 2DFHA 3F5TA 3MWPA 1ZBIA 4WYBA 4GVMA 4YHHK 1A5VA 3DLGA 1RBUA 5KTQA 1TK0A 2P5OA 3L3UA 2IC3A 1NBWA 3ZEUB 2P51A 1JCGA 3RRHA 3OYDA 4CK1A 3L2UA 4LF8K 3NGYA 2AJQA 1OH5A 4JKAA 3LWMA 2WUSA 1RFQA 5CY4A 4N47A 4CIFA 4KH4A 3C94A 4Z4FA 4CGHA 3LDNA 3PY8A 3ENBA 1YJWN 1S6QA 3K5LA 1K8KB 4O0IA 3SAGA 4WF9L 1RT3A 2YV0X 2H3GX 4MO4A 1KAYA 1X3MA 4FJGA 4BRFA 1N33K 3CC4N 3J80O 2HHSA 4BRGA 3CETA 3IMXA 3QIPA 4JI7K 3AVIA 2HSTA 2Y1IA 4IDKA 3L4QA 3SPYA 4EP4A 3LPTA 4CZJA 1W9HA 3J81O 5ELZA 1BWFO 2D0CA 2G8VA 1HNZK 2HVHA 3ALYA 1U6ZA 3MX5A 4DU4A 4DTMA 4DFPA 1P90A 1BIUA 3IG1A 1X1PA 3GL1A 4BWMA 3LP1A 4JKBA 3PX0A 3AAPA 3E9PA 2QTDA 2VG6A 1NJYA 3HK2A 3DJCA 4B9UA 2UUCK 1VQ9N 1Z6RA 1S22A 4CF2A 3N4QA 2E8AA 3H08A 4JKFA 5AQNA 3TAPA 4AM6A 4W5OA 3CCQN 4JI6K 4FW2A 2BDPA 4FW1A 2B6AA 3H45C 3SUQA 3S3NA 2GWJA 4CGIA 1Q8IA 4DR3K 2V7YA 3QO9A 2P1JA 5AQJA 2HMPA 1KFSA 4JNEA 2FXUA 4JLHA 3DLHA 4ISEA 4BRKA 3OYAA 4NLBA 1HUXA 4C8KA 1T05A 4JK8A 3OYGA 2GWKA 2YCHA 1NG9A 3V1QA 4IJAA 1EKEA 5J2MA 1SS6A 2CH6A 3BF3A 4BGBA 5HOOA 1KCFA 2ZF5O 4BE2A 4E7HA 3AVKA 1GLLO 3ASMA 2W41A 3ZETB 5AQZA 2VGNA 1HKCA 3CCLN 1EX4A 3AA5X 3HP9A 3UIQA 3IFRA 3R8EA 4B1YB 2HHQA 4O44A 4KREA 2ASMA 4U7BA 4Q0BA 3MN9A 1O1WA 2CGKA 3V9SA 2JWLA 4FCYA 1MWMA 3WEEA 1T7PA 3KD5E 4L8RB 4YORA 4FWRA 1IKVA 5EXWA 3OJUA 4C8OA 1VSDA 4FJ9A 2F8SA 5HRPA 2AA4A 2E2PA 3D2FA 1TKZA 2O4IA 5HBMA 3A8YA 4KTWA 2KFZA 1VRTA 1GOBA 1RBVA 2VWJA 4W5RA 2XY7A 4KH5A 1VSEA 1VSLA 4BE0A 1LOTB 1LWCA
chains in the Genus database with same CATH topology
4DSFA 4KTQA 1HNIA 1LAWA 1BHLA 1Z26A 3AVLA 3OS2A 1W0HA 3D45A 1TKTA 3K5MA 2HB5A 3BDPA 4FJ5A 4GW6A 2XO7A 1G15A 4M3TA 1UWBA 1HYZA 3KKRA 3C6UA 3O3HA 4M3WA 1CXQA 4C8NA 1SUQA 1SKWA 1NKBA 4FJ7A 4HCBA 4KHSA 4M3ZA 4NCAA 1X9MA 4Z4GA 5FROA 4CJ3A 3ZT3A 2R7YA 4K8ZA 4CGGA 3SUOA 1NK8A 2QKKA 3SZ2A 3RMBA 1J53A 5CYMA 2W42A 3OYKA 3OYBA 4DTPA 2HHXA 4ELTA 3CFOA 1ASUA 2JLEA 3CFPA 4F2SA 4M3YA 4DTXA 4PUOA 4PA1A 1NOZA 4FJXA 4FJMA 1JL2A 2E6MA 4LSNA 2NUBA 4FVMA 4CJVA 1C0TA 3MEDA 4ID1A 3LAMA 2YKNA 1SL2A 4KHYA 4FJ8A 4LD0A 3LZIA 4CF8A 2XY5A 2XY6A 4KPYA 1R0AA 3RMAA 3SJJA 4F3OA 3VQ5A 4DWIA 3QLHA 1RTIA 1REVA 3LP0A 1BL3A 2Z1IA 3CQ8A 1D9DA 1SKSA 1NK0A 3SQ1A 4DQQA 4B9TA 1RDAA 2FBYA 1U45A 1IH7A 3MXJA 1J54A 1QHTA 4CJLA 4CFAA 2XRIA 3KK2A 4MQ3A 4M45A 4IBNA 4E3SA 3NF9A 1WN7A 3ISNC 4B8AB 3OY9A 3OYFA 4ELUA 4NYFA 4DU3A 2OA8A 4HUFA 3EYZA 3AA2A 3SQ2A 3LZJA 1BGXT 4GMJB 5C24A 3T1AA 4DQRA 4WE1A 1DTQA 1KLMA 4M3RA 2YNIA 2PZSA 4AHVA 1NK9A 1HNVA 4DSKA 3QEXA 2KW4A 5T7BA 2YKMA 1WSJA 4DTNA 2OPRA 1IKWA 3SYZA 4IFVA 1RT6A 2KTQA 4RW4A 3KLEA 4CF1A 1ZYQA 3AO3A 1QTMA 5EU7A 2ETJA 4E1NA 1RT4A 1JLQA 4MFBA 4NCBA 4KI4A 4NCGA 2F8TA 1BCMA 4Z4HA 1S1UA 3AVNA 5C42A 3NH2A 1BQMA 4DF4A 2QK9A 3RMCA 4FK2A 5J1EA 4UQGA 3RMDA 1YT3A 1XHZA 4AHSA 3TI0A 2Z1GA 1L3UA 3O3FA 2DFFA 2X74A 5HRNA 5CYQA 4E7LA 2D5RA 1FXXA 4H4MA 4DTOA 1GOCA 5HLFA 1YTUA 1U47A 1XHXA 2KQ2A 2I5JA 3ZT1A 5FDLA 4LSLA 4I9LA 4EZ9A 4KHQA 1ITGA 1F21A 3OYIA 5KGXA 4I9QA 1S1XA 3FFIA 4DLGA 4F2RA 4FM0A 2DY4A 2A1SA 3O3GA 3JSMA 3VQ8A 4DQPA 1L3SA 1RT7A 3PUFA 3QEIA 4EZ6A 3A2FA 2PYLA 1BISA 1VK0A 4O55A 5J2QA 3V4IA 4ZTFA 3KIOA 2OYQA 4B3OA 5C25A 4DTSA 3L3VA 4DMNA 4HUGA 3TABA 4KAZA 4DQIA 1EXQA 3OYHA 2Y1JA 4CGJA 2Z1HA 2GBZA 1NK5A 2OZMA 5E41A 3OYEA 4DTUA 3TAFA 3HVTA 3QINA 2PY5A 1BI4B 4QOZB 1LW0A 4N41A 2ZQBA 4Y1CA 4C8MA 1X9SA 4CF9A 2X78A 2BGGA 1FK9A 4DSIA 3TR8A 3LAKA 3HM9A 5D3GA 1ZBHA 3VQDA 4AHCA 4RW7A 3MEEA 1RILA 3NH0A 2VG7A 3K2PA 4OPJA 4KKOA 1LWEA 4H4OA 3ZCMA 2XHBA 4FM2A 3ZSQA 4FM1A 4FLUA 3QERA 3QESA 3S3OA 3DM2A 5I3UA 4KFBA 1ASWA 1KTQA 2IS3A 5CZ1A 1B9FA 2PYJA 4BWJA 4DFJA 3RR7A 3QEVA 2VG5A 3VQBA 1CXUA 3DLEA 4DTRA 1KFDA 3KLGA 3SI6A 2OZSA 1GOAA 4F3TA 2IDOA 2BE2A 4CE9A 1C1BA 3CG7A 1Y97A 4OKJA 1WAFA 1NJWA 1U49A 1RT5A 4FYDA 2G8WA 1RNHA 2X6SA 3NF8A 2FBTA 2LSNA 3PX6A 4Z4CA 5CZ2A 1TVRA 2X6NA 3VQ9A 2HHTA 4CIGA 1K6YA 1ZBUA 3ZSYA 5KRSA 4QAGA 4BE1A 1Q9YA 4QCLA 3TANA 4AILC 3MECA 3OYJA 4R5PA 2Q3SA 4OPKA 4DU1A 5I42A 1SL0A 4CGFA 1NJXA 4CFBA 1SKRA 3TWHA 4B9VA 4IG0A 3ZSWA 3KKSA 1EETA 2FBVA 3T19A 3NDKA 1WAJA 4KHNA 4PY5A 1YTAA 1HQEA 4PQUA 4W5NA 3V9XA 1LWFA 2RN2A 4M41A 3DLRA 1WSGA 3KLIA 3HVRA 1VRUA 4K8XA 4FLYA 1HYSA 3F9KA 4FJNA 4CHYA 1A5WA 4CJWA 3QNOA 4CK3A 4B9MA 1JXEA 4O4GA 2G8KA 2HNDA 3M8PA 4XIUA 2ZE2A 1WSFA 3KJVA 4Z4EA 1N6QA 3MAQA 5KGWA 1EP4A 3DYAA 5SWMA 3AO2A 1BCOA 4CEZA 2YNGA 1XWLA 3AO5A 1KVCA 4CHNA 3QNNA 3S3MA 1HYVA 5KRTA 4CECA 1UAXA 2YHAA 3HPHA 4OKKA 4CIEA 4H8KA 3AA3A 3HSTB 4DF8A 5HROA 2HHUA 1RBSA 3HP6A 3ZSOA 3B6PA 4OGCA 3VN5A 1HPZA 1MU2A 3THVA 4CESA 3WNGA 4N76A 2JGUA 4OJRA 4Y1DA 1NK6A 4CJ5A 4G1QA 4I2PA 3NH1A 1S9GA 1JLEA 1ZBFA 3M8RA 4FLZA 1L5UA 4KTZA 3NF7A 1QQCA 3VQEA 4RW8A 4Z0UA 4OKEA 3ITHA 4DQSA 1QSSA 2DTUA 1UA1A 4AHRA 3OYMA 2OPQA 3P83D 3AVHA 1S9EA 4FJJA 4J2DA 3KTQA 2O4GA 5HRRA 5J2PA 1HJRA 1ASVA 3AVJA 5FRNA 1RDDA 3SQ4A 3OS1A 3NF6A 3IS9A 1RCHA 1TV6A 4HHTA 3V9ZA 1RBTA 4ICLA 4FLTA 4FLVA 3OJSA 2FC0A 1U48A 1Q9XA 4J2BA 3VQPA 1U04A 4FLWA 4CCHA 3ZT2A 3M8SA 1VSMA 2GUIA 4O0JA 4E0DA 3DMJA 3V9WA 3L2WA 4CJKA 3OYNA 3P5JA 4CJRA 4FZYA 3NFAA 1KVBA 4LH4A 4O5BA 1IKYA 3EZ5A 3NE6A 4JRQA 4DFKA 1JLCA 3HL8A 2IAJA 4LH5A 1BIZA 3HYFA 4CEDA 4E7IA 4CFCA 3S9HA 2P5GA 3ZSVA 1HQUA 4E7JA 1IO2A 3V6DA 2A1RA 1CLQA 4F4KA 1WNSA 3I0SA 2G8IA 3LPUA 2F96A 1VSIA 2D0BA 1CZBA 3QIOA 4JRPA 3V1OA 4M3UA 3DRRA 1DTTA 4M42A 4FJLA 4CK2A 4CEEA 1C1CA 1S1WA 3LP2A 4DFMA 4I7FA 4CHPA 1JLAA 1X9WA 4FJHA 5FRMA 4E1MA 4CJQA 4HCCA 1XI1A 4B9LA 2YNFA 5J2NA 2DFHA 3HXMA 4FXDA 1C6VA 1LV5A 4I2QA 4CJTA 2YNHA 4OGEA 4GVMA 4HUEA 1A5VA 3DLGA 1ZBIA 1JLBA 3RRGA 4CHQA 3M8QA 1RBUA 2D0AA 2FBXA 4DG1A 5KTQA 2QXFA 1TK0A 1RTDA 1QSLA 2P5OA 1YVUA 3L3UA 2IC3A 3VQQA 2P51A 4DS5A 1XC9A 3HT3A 3RRHA 3SV3A 1SL1A 3KLFA 3OYDA 2WOMA 1C1AA 4CK1A 1QE1A 3L2UA 1BI4A 1RT2A 3O4QA 3DOKA 3JYTA 3NGYA 2AJQA 4FK0A 5JS2A 2HHVA 3LWMA 1JKHA 3NAEA 4N47A 5CY4A 3ZSZA 4CIFA 3U3YA 4C8LA 1S5JA 3AVFA 3C94A 3EY1A 3CFRA 1NKCA 4FZXC 3AVAA 4Z4FA 2HW3A 4CGHA 4RW6A 3PY8A 1I3AA 1FKPA 4NYNA 1NJZA 1QS4A 4FJIA 1S6QA 3KK1A 4F8RA 3K5LA 3NBPA 4O0IA 3TAMA 1S1VA 1FKOA 1RT3A 2YV0X 3OS0A 3SUPA 1RT1A 3K5NA 1NK7A 4FJGA 4YFUA 3SCXA 4FK4A 4BDPA 1VSHA 1Z25A 3T3FA 3VQ4A 2HHSA 4CERA 3QIPA 1JL1A 3AVIA 3SPZA 2Y1IA 4IDKA 3SPYA 3D0PA 4EP4A 4B9SA 4CGDA 3O4NA 1S6PA 4ZHRA 3KLHA 4KHWA 3PV8A 1TKXA 1LAVA 3LPTA 3F73A 1KVAA 3SNNA 1CZ9A 4J2AA 1BQNA 4LY7A 4CF0A 4JS4A 3VA3A 3L8BA 1W9HA 4DSLA 1C0UA 1WLJA 4AH9A 2WONA 2D0CA 2DFEA 2ITGA 4N56A 1UA0A 3WNFA 2G8VA 1NOYA 1RDBA 2KZZA 2HVHA 3ALYA 4DU4A 4DTMA 4DFPA 3ZSXA 2HHWA 1D9FA 3NHGA 2BANA 3SQ0A 1BIUA 3IG1A 3LP3A 1L3TA 4FZZA 1X1PA 1UOCA 2IOCA 4BWMA 3LP1A 4CJEA 3PO4A 3PX0A 4HVJA 3IRXA 3PO5A 4CEBA 5HRSA 4CJUA 5K14A 2OPPA 3QEPA 4E19A 3I8DA 3AO1A 4CJPA 5JS1A 1IKXA 1J9AA 1SV5A 2B4JA 3LALA 3C95A 2VG6A 4IFYA 3CM5A 1NJYA 3E01A 4HTUA 3G10A 3NGZA 3VA0A 3NCIA 4E7KA 4YNQA 3HK2A 4KB1A 4B08A 1VSKA 4B9UA 3PX4A 3ULDA 4BDYA 3RR8A 1JLFA 4CF2A 1VSJA 3V81A 3H08A 4CJSA 3DRSA 3ZT0A 3K59A 3TAPA 3OVNA 1S1TA 3LWLA 4W5OA 1JXBA 3AA4A 4FW2A 2BDPA 4FW1A 4OLAA 2B6AA 2RPIA 4FLXA 3SUQA 3DLBA 3DOLA 4CEQA 3VQ7A 3S3NA 4CGIA 3IAYA 3OYLA 3BGRA 4AHTA 4B9NA 3KD1E 4KV8A 5KI6A 1Q8IA 3CYMA 3QETA 1T03A 3U6FA 3LANA 5SZTA 3RTVA 4AHUA 1WSIA 3QO9A 3MXMA 1RTHA 2P1JA 3U3GA 3HPOA 4CEAA 3NGIA 4Q5VA 1TAUA 1KFSA 4EP5A 4JLHA 1B9DA 2EX3A 4CJFA 4ZTJA 3VQ6A 3DLHA 3OYAA 4M3XA 3DI6A 1N5YA 4CEFA 4N5SA 3K57A 3K58A 3V1RA 3TAQA 3HJFA 3MEGA 4C8KA 2RKIA 1KLNA 1T05A 1KRPA 2G8UA 2XY8A 1TK5A 2HVIA 2RF2A 3ZT4A 4FJKA 2E4LA 4TSXA 3OYGA 4Z4IA 5HP1A 3QEWA 3MXIA 4W5QA 2HMIA 3TARA 3V1QA 4CHOA 4E89A 3P1GA 1EKEA 4BACA 5J2MA 5DK5A 3LDSA 2IGIA 3WNHA 3AVMA 1T8EA 2QKBA 4KO0A 4CEOA 1KCFA 4BE2A 1TL3A 4CHZA 1KSPA 4IG3A 2KFNA 4OVLA 3AVKA 4E7HA 4DSEA 3ASMA 1TGOA 1I39A 1A5XA 1EX4A 3AA5X 3HPGA 4ID5A 1NKEA 4KHUA 3AO4A 1U4BA 3C6TA 3RWUA 4RG8A 1C0MA 2GV9A 3HP9A 3SV4A 2HNYA 3CM6A 4CFDA 1DLOA 3DLKA 3UIQA 1ZBLA 4KI6A 1WSEA 2B5JA 2HHQA 3AV9A 3G0ZA 4O44A 4KREA 1TK8A 1TAQA 3AVGA 4Q0BA 1TL1A 3L2VA 1LW2A 1O1WA 4DSJA 1HMVA 3V9SA 2ATQA 1WSHA 3AVBA 4DLEA 1TKDA 2G8HA 2YHBA 4FCYA 1JLGA 1IG9A 1T7PA 4JS5A 3KD5E 1D5AA 4L8RB 3VQAA 4KRFA 1HRHA 3SUNA 1IKVA 4OLBA 3OJUA 3DRPA 1D8YA 3I0RA 4C8OA 1VSDA 4FJ9A 2F8SA 1VSFA 5HRPA 3HO1A 2VWKA 4DTJA 4J2EA 3TAGA 2E6LA 3TAEA 2KZMA 2G8FA 3V9UA 4KB0A 1TKZA 1RDCA 1NK4A 2O4IA 3WNEA 2EHGA 3K5OA 2Z1JA 2ZD1A 5HBMA 1L3VA 1QSYA 1RTJA 3L2QA 3ZSRA 4W5TA 4IKFA 4DS4A 1J5OA 3B6OA 4KTWA 2KFZA 3KK3A 4CJ4A 3L2RA 1VRTA 5DMRA 1GOBA 2HNZA 4RW9A 3VQCA 1RBVA 2VWJA 4W5RA 1RBRA 4BDZA 2XY7A 1VSEA 4ELVA 1VSLA 4BE0A 1B92A 3AVCA 4B8CA 3OYCA 4PWDA 2OPSA 1LWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSF A;  4KTQ A;  1HNI A;  1LAW A;  1BHL A;  1Z26 A;  3AVL A;  3OS2 A;  1W0H A;  3D45 A;  1TKT A;  3K5M A;  2HB5 A;  3BDP A;  4FJ5 A;  4GW6 A;  2XO7 A;  1G15 A;  4M3T A;  1UWB A;  1HYZ A;  3KKR A;  3C6U A;  3O3H A;  4M3W A;  1CXQ A;  4C8N A;  1SUQ A;  1SKW A;  1NKB A;  4FJ7 A;  4HCB A;  4KHS A;  4M3Z A;  4NCA A;  1X9M A;  4Z4G A;  5FRO A;  4CJ3 A;  3ZT3 A;  2R7Y A;  4K8Z A;  4CGG A;  3SUO A;  1NK8 A;  2QKK A;  3SZ2 A;  3RMB A;  1J53 A;  5CYM A;  2W42 A;  3OYK A;  3OYB A;  4DTP A;  2HHX A;  4ELT A;  3CFO A;  1ASU A;  2JLE A;  3CFP A;  4F2S A;  4M3Y A;  4DTX A;  4PUO A;  4PA1 A;  1NOZ A;  4FJX A;  4FJM A;  1JL2 A;  2E6M A;  4LSN A;  2NUB A;  4FVM A;  4CJV A;  1C0T A;  3MED A;  4ID1 A;  3LAM A;  2YKN A;  1SL2 A;  4KHY A;  4FJ8 A;  4LD0 A;  3LZI A;  4CF8 A;  2XY5 A;  2XY6 A;  4KPY A;  1R0A A;  3RMA A;  3SJJ A;  4F3O A;  3VQ5 A;  4DWI A;  3QLH A;  1RTI A;  1REV A;  3LP0 A;  1BL3 A;  2Z1I A;  3CQ8 A;  1D9D A;  1SKS A;  1NK0 A;  3SQ1 A;  4DQQ A;  4B9T A;  1RDA A;  2FBY A;  1U45 A;  1IH7 A;  3MXJ A;  1J54 A;  1QHT A;  4CJL A;  4CFA A;  2XRI A;  3KK2 A;  4MQ3 A;  4M45 A;  4IBN A;  4E3S A;  3NF9 A;  1WN7 A;  3ISN C;  4B8A B;  3OY9 A;  3OYF A;  4ELU A;  4NYF A;  4DU3 A;  2OA8 A;  4HUF A;  3EYZ A;  3AA2 A;  3SQ2 A;  3LZJ A;  1BGX T;  4GMJ B;  5C24 A;  3T1A A;  4DQR A;  4WE1 A;  1DTQ A;  1KLM A;  4M3R A;  2YNI A;  2PZS A;  4AHV A;  1NK9 A;  1HNV A;  4DSK A;  3QEX A;  2KW4 A;  5T7B A;  2YKM A;  1WSJ A;  4DTN A;  2OPR A;  1IKW A;  3SYZ A;  4IFV A;  1RT6 A;  2KTQ A;  4RW4 A;  3KLE A;  4CF1 A;  1ZYQ A;  3AO3 A;  1QTM A;  5EU7 A;  2ETJ A;  4E1N A;  1RT4 A;  1JLQ A;  4MFB A;  4NCB A;  4KI4 A;  4NCG A;  2F8T A;  1BCM A;  4Z4H A;  1S1U A;  3AVN A;  5C42 A;  3NH2 A;  1BQM A;  4DF4 A;  2QK9 A;  3RMC A;  4FK2 A;  5J1E A;  4UQG A;  3RMD A;  1YT3 A;  1XHZ A;  4AHS A;  3TI0 A;  2Z1G A;  1L3U A;  3O3F A;  2DFF A;  2X74 A;  5HRN A;  5CYQ A;  4E7L A;  2D5R A;  1FXX A;  4H4M A;  4DTO A;  1GOC A;  5HLF A;  1YTU A;  1U47 A;  1XHX A;  2KQ2 A;  2I5J A;  3ZT1 A;  5FDL A;  4LSL A;  4I9L A;  4EZ9 A;  4KHQ A;  1ITG A;  1F21 A;  3OYI A;  5KGX A;  4I9Q A;  1S1X A;  3FFI A;  4DLG A;  4F2R A;  4FM0 A;  2DY4 A;  2A1S A;  3O3G A;  3JSM A;  3VQ8 A;  4DQP A;  1L3S A;  1RT7 A;  3PUF A;  3QEI A;  4EZ6 A;  3A2F A;  2PYL A;  1BIS A;  1VK0 A;  4O55 A;  5J2Q A;  3V4I A;  4ZTF A;  3KIO A;  2OYQ A;  4B3O A;  5C25 A;  4DTS A;  3L3V A;  4DMN A;  4HUG A;  3TAB A;  4KAZ A;  4DQI A;  1EXQ A;  3OYH A;  2Y1J A;  4CGJ A;  2Z1H A;  2GBZ A;  1NK5 A;  2OZM A;  5E41 A;  3OYE A;  4DTU A;  3TAF A;  3HVT A;  3QIN A;  2PY5 A;  1BI4 B;  4QOZ B;  1LW0 A;  4N41 A;  2ZQB A;  4Y1C A;  4C8M A;  1X9S A;  4CF9 A;  2X78 A;  2BGG A;  1FK9 A;  4DSI A;  3TR8 A;  3LAK A;  3HM9 A;  5D3G A;  1ZBH A;  3VQD A;  4AHC A;  4RW7 A;  3MEE A;  1RIL A;  3NH0 A;  2VG7 A;  3K2P A;  4OPJ A;  4KKO A;  1LWE A;  4H4O A;  3ZCM A;  2XHB A;  4FM2 A;  3ZSQ A;  4FM1 A;  4FLU A;  3QER A;  3QES A;  3S3O A;  3DM2 A;  5I3U A;  4KFB A;  1ASW A;  1KTQ A;  2IS3 A;  5CZ1 A;  1B9F A;  2PYJ A;  4BWJ A;  4DFJ A;  3RR7 A;  3QEV A;  2VG5 A;  3VQB A;  1CXU A;  3DLE A;  4DTR A;  1KFD A;  3KLG A;  3SI6 A;  2OZS A;  1GOA A;  4F3T A;  2IDO A;  2BE2 A;  4CE9 A;  1C1B A;  3CG7 A;  1Y97 A;  4OKJ A;  1WAF A;  1NJW A;  1U49 A;  1RT5 A;  4FYD A;  2G8W A;  1RNH A;  2X6S A;  3NF8 A;  2FBT A;  2LSN A;  3PX6 A;  4Z4C A;  5CZ2 A;  1TVR A;  2X6N A;  3VQ9 A;  2HHT A;  4CIG A;  1K6Y A;  1ZBU A;  3ZSY A;  5KRS A;  4QAG A;  4BE1 A;  1Q9Y A;  4QCL A;  3TAN A;  4AIL C;  3MEC A;  3OYJ A;  4R5P A;  2Q3S A;  4OPK A;  4DU1 A;  5I42 A;  1SL0 A;  4CGF A;  1NJX A;  4CFB A;  1SKR A;  3TWH A;  4B9V A;  4IG0 A;  3ZSW A;  3KKS A;  1EET A;  2FBV A;  3T19 A;  3NDK A;  1WAJ A;  4KHN A;  4PY5 A;  1YTA A;  1HQE A;  4PQU A;  4W5N A;  3V9X A;  1LWF A;  2RN2 A;  4M41 A;  3DLR A;  1WSG A;  3KLI A;  3HVR A;  1VRU A;  4K8X A;  4FLY A;  1HYS A;  3F9K A;  4FJN A;  4CHY A;  1A5W A;  4CJW A;  3QNO A;  4CK3 A;  4B9M A;  1JXE A;  4O4G A;  2G8K A;  2HND A;  3M8P A;  4XIU A;  2ZE2 A;  1WSF A;  3KJV A;  4Z4E A;  1N6Q A;  3MAQ A;  5KGW A;  1EP4 A;  3DYA A;  5SWM A;  3AO2 A;  1BCO A;  4CEZ A;  2YNG A;  1XWL A;  3AO5 A;  1KVC A;  4CHN A;  3QNN A;  3S3M A;  1HYV A;  5KRT A;  4CEC A;  1UAX A;  2YHA A;  3HPH A;  4OKK A;  4CIE A;  4H8K A;  3AA3 A;  3HST B;  4DF8 A;  5HRO A;  2HHU A;  1RBS A;  3HP6 A;  3ZSO A;  3B6P A;  4OGC A;  3VN5 A;  1HPZ A;  1MU2 A;  3THV A;  4CES A;  3WNG A;  4N76 A;  2JGU A;  4OJR A;  4Y1D A;  1NK6 A;  4CJ5 A;  4G1Q A;  4I2P A;  3NH1 A;  1S9G A;  1JLE A;  1ZBF A;  3M8R A;  4FLZ A;  1L5U A;  4KTZ A;  3NF7 A;  1QQC A;  3VQE A;  4RW8 A;  4Z0U A;  4OKE A;  3ITH A;  4DQS A;  1QSS A;  2DTU A;  1UA1 A;  4AHR A;  3OYM A;  2OPQ A;  3P83 D;  3AVH A;  1S9E A;  4FJJ A;  4J2D A;  3KTQ A;  2O4G A;  5HRR A;  5J2P A;  1HJR A;  1ASV A;  3AVJ A;  5FRN A;  1RDD A;  3SQ4 A;  3OS1 A;  3NF6 A;  3IS9 A;  1RCH A;  1TV6 A;  4HHT A;  3V9Z A;  1RBT A;  4ICL A;  4FLT A;  4FLV A;  3OJS A;  2FC0 A;  1U48 A;  1Q9X A;  4J2B A;  3VQP A;  1U04 A;  4FLW A;  4CCH A;  3ZT2 A;  3M8S A;  1VSM A;  2GUI A;  4O0J A;  4E0D A;  3DMJ A;  3V9W A;  3L2W A;  4CJK A;  3OYN A;  3P5J A;  4CJR A;  4FZY A;  3NFA A;  1KVB A;  4LH4 A;  4O5B A;  1IKY A;  3EZ5 A;  3NE6 A;  4JRQ A;  4DFK A;  1JLC A;  3HL8 A;  2IAJ A;  4LH5 A;  1BIZ A;  3HYF A;  4CED A;  4E7I A;  4CFC A;  3S9H A;  2P5G A;  3ZSV A;  1HQU A;  4E7J A;  1IO2 A;  3V6D A;  2A1R A;  1CLQ A;  4F4K A;  1WNS A;  3I0S A;  2G8I A;  3LPU A;  2F96 A;  1VSI A;  2D0B A;  1CZB A;  3QIO A;  4JRP A;  3V1O A;  4M3U A;  3DRR A;  1DTT A;  4M42 A;  4FJL A;  4CK2 A;  4CEE A;  1C1C A;  1S1W A;  3LP2 A;  4DFM A;  4I7F A;  4CHP A;  1JLA A;  1X9W A;  4FJH A;  5FRM A;  4E1M A;  4CJQ A;  4HCC A;  1XI1 A;  4B9L A;  2YNF A;  5J2N A;  2DFH A;  3HXM A;  4FXD A;  1C6V A;  1LV5 A;  4I2Q A;  4CJT A;  2YNH A;  4OGE A;  4GVM A;  4HUE A;  1A5V A;  3DLG A;  1ZBI A;  1JLB A;  3RRG A;  4CHQ A;  3M8Q A;  1RBU A;  2D0A A;  2FBX A;  4DG1 A;  5KTQ A;  2QXF A;  1TK0 A;  1RTD A;  1QSL A;  2P5O A;  1YVU A;  3L3U A;  2IC3 A;  3VQQ A;  2P51 A;  4DS5 A;  1XC9 A;  3HT3 A;  3RRH A;  3SV3 A;  1SL1 A;  3KLF A;  3OYD A;  2WOM A;  1C1A A;  4CK1 A;  1QE1 A;  3L2U A;  1BI4 A;  1RT2 A;  3O4Q A;  3DOK A;  3JYT A;  3NGY A;  2AJQ A;  4FK0 A;  5JS2 A;  2HHV A;  3LWM A;  1JKH A;  3NAE A;  4N47 A;  5CY4 A;  3ZSZ A;  4CIF A;  3U3Y A;  4C8L A;  1S5J A;  3AVF A;  3C94 A;  3EY1 A;  3CFR A;  1NKC A;  4FZX C;  3AVA A;  4Z4F A;  2HW3 A;  4CGH A;  4RW6 A;  3PY8 A;  1I3A A;  1FKP A;  4NYN A;  1NJZ A;  1QS4 A;  4FJI A;  1S6Q A;  3KK1 A;  4F8R A;  3K5L A;  3NBP A;  4O0I A;  3TAM A;  1S1V A;  1FKO A;  1RT3 A;  2YV0 X;  3OS0 A;  3SUP A;  1RT1 A;  3K5N A;  1NK7 A;  4FJG A;  4YFU A;  3SCX A;  4FK4 A;  4BDP A;  1VSH A;  1Z25 A;  3T3F A;  3VQ4 A;  2HHS A;  4CER A;  3QIP A;  1JL1 A;  3AVI A;  3SPZ A;  2Y1I A;  4IDK A;  3SPY A;  3D0P A;  4EP4 A;  4B9S A;  4CGD A;  3O4N A;  1S6P A;  4ZHR A;  3KLH A;  4KHW A;  3PV8 A;  1TKX A;  1LAV A;  3LPT A;  3F73 A;  1KVA A;  3SNN A;  1CZ9 A;  4J2A A;  1BQN A;  4LY7 A;  4CF0 A;  4JS4 A;  3VA3 A;  3L8B A;  1W9H A;  4DSL A;  1C0U A;  1WLJ A;  4AH9 A;  2WON A;  2D0C A;  2DFE A;  2ITG A;  4N56 A;  1UA0 A;  3WNF A;  2G8V A;  1NOY A;  1RDB A;  2KZZ A;  2HVH A;  3ALY A;  4DU4 A;  4DTM A;  4DFP A;  3ZSX A;  2HHW A;  1D9F A;  3NHG A;  2BAN A;  3SQ0 A;  1BIU A;  3IG1 A;  3LP3 A;  1L3T A;  4FZZ A;  1X1P A;  1UOC A;  2IOC A;  4BWM A;  3LP1 A;  4CJE A;  3PO4 A;  3PX0 A;  4HVJ A;  3IRX A;  3PO5 A;  4CEB A;  5HRS A;  4CJU A;  5K14 A;  2OPP A;  3QEP A;  4E19 A;  3I8D A;  3AO1 A;  4CJP A;  5JS1 A;  1IKX A;  1J9A A;  1SV5 A;  2B4J A;  3LAL A;  3C95 A;  2VG6 A;  4IFY A;  3CM5 A;  1NJY A;  3E01 A;  4HTU A;  3G10 A;  3NGZ A;  3VA0 A;  3NCI A;  4E7K A;  4YNQ A;  3HK2 A;  4KB1 A;  4B08 A;  1VSK A;  4B9U A;  3PX4 A;  3ULD A;  4BDY A;  3RR8 A;  1JLF A;  4CF2 A;  1VSJ A;  3V81 A;  3H08 A;  4CJS A;  3DRS A;  3ZT0 A;  3K59 A;  3TAP A;  3OVN A;  1S1T A;  3LWL A;  4W5O A;  1JXB A;  3AA4 A;  4FW2 A;  2BDP A;  4FW1 A;  4OLA A;  2B6A A;  2RPI A;  4FLX A;  3SUQ A;  3DLB A;  3DOL A;  4CEQ A;  3VQ7 A;  3S3N A;  4CGI A;  3IAY A;  3OYL A;  3BGR A;  4AHT A;  4B9N A;  3KD1 E;  4KV8 A;  5KI6 A;  1Q8I A;  3CYM A;  3QET A;  1T03 A;  3U6F A;  3LAN A;  5SZT A;  3RTV A;  4AHU A;  1WSI A;  3QO9 A;  3MXM A;  1RTH A;  2P1J A;  3U3G A;  3HPO A;  4CEA A;  3NGI A;  4Q5V A;  1TAU A;  1KFS A;  4EP5 A;  4JLH A;  1B9D A;  2EX3 A;  4CJF A;  4ZTJ A;  3VQ6 A;  3DLH A;  3OYA A;  4M3X A;  3DI6 A;  1N5Y A;  4CEF A;  4N5S A;  3K57 A;  3K58 A;  3V1R A;  3TAQ A;  3HJF A;  3MEG A;  4C8K A;  2RKI A;  1KLN A;  1T05 A;  1KRP A;  2G8U A;  2XY8 A;  1TK5 A;  2HVI A;  2RF2 A;  3ZT4 A;  4FJK A;  2E4L A;  4TSX A;  3OYG A;  4Z4I A;  5HP1 A;  3QEW A;  3MXI A;  4W5Q A;  2HMI A;  3TAR A;  3V1Q A;  4CHO A;  4E89 A;  3P1G A;  1EKE A;  4BAC A;  5J2M A;  5DK5 A;  3LDS A;  2IGI A;  3WNH A;  3AVM A;  1T8E A;  2QKB A;  4KO0 A;  4CEO A;  1KCF A;  4BE2 A;  1TL3 A;  4CHZ A;  1KSP A;  4IG3 A;  2KFN A;  4OVL A;  3AVK A;  4E7H A;  4DSE A;  3ASM A;  1TGO A;  1I39 A;  1A5X A;  1EX4 A;  3AA5 X;  3HPG A;  4ID5 A;  1NKE A;  4KHU A;  3AO4 A;  1U4B A;  3C6T A;  3RWU A;  4RG8 A;  1C0M A;  2GV9 A;  3HP9 A;  3SV4 A;  2HNY A;  3CM6 A;  4CFD A;  1DLO A;  3DLK A;  3UIQ A;  1ZBL A;  4KI6 A;  1WSE A;  2B5J A;  2HHQ A;  3AV9 A;  3G0Z A;  4O44 A;  4KRE A;  1TK8 A;  1TAQ A;  3AVG A;  4Q0B A;  1TL1 A;  3L2V A;  1LW2 A;  1O1W A;  4DSJ A;  1HMV A;  3V9S A;  2ATQ A;  1WSH A;  3AVB A;  4DLE A;  1TKD A;  2G8H A;  2YHB A;  4FCY A;  1JLG A;  1IG9 A;  1T7P A;  4JS5 A;  3KD5 E;  1D5A A;  4L8R B;  3VQA A;  4KRF A;  1HRH A;  3SUN A;  1IKV A;  4OLB A;  3OJU A;  3DRP A;  1D8Y A;  3I0R A;  4C8O A;  1VSD A;  4FJ9 A;  2F8S A;  1VSF A;  5HRP A;  3HO1 A;  2VWK A;  4DTJ A;  4J2E A;  3TAG A;  2E6L A;  3TAE A;  2KZM A;  2G8F A;  3V9U A;  4KB0 A;  1TKZ A;  1RDC A;  1NK4 A;  2O4I A;  3WNE A;  2EHG A;  3K5O A;  2Z1J A;  2ZD1 A;  5HBM A;  1L3V A;  1QSY A;  1RTJ A;  3L2Q A;  3ZSR A;  4W5T A;  4IKF A;  4DS4 A;  1J5O A;  3B6O A;  4KTW A;  2KFZ A;  3KK3 A;  4CJ4 A;  3L2R A;  1VRT A;  5DMR A;  1GOB A;  2HNZ A;  4RW9 A;  3VQC A;  1RBV A;  2VWJ A;  4W5R A;  1RBR A;  4BDZ A;  2XY7 A;  1VSE A;  4ELV A;  1VSL A;  4BE0 A;  1B92 A;  3AVC A;  4B8C A;  3OYC A;  4PWD A;  2OPS A;  1LWC A; 
#chains in the Genus database with same CATH topology
 1BHL A;  3K9J A;  3VF6 A;  3K5M A;  2HB5 A;  4DV3 K;  2XO7 A;  3TSQ A;  5FPN A;  3C6U A;  4HCB A;  4DR4 K;  2O8D B;  4NCA A;  2F4V K;  3ZT3 A;  2R7Y A;  4CGG A;  3CI5 A;  2QKK A;  3RMB A;  3TTC A;  4E1J A;  1GLJ O;  3CFO A;  4DV7 K;  1OH6 A;  4DTX A;  4M3Y A;  1NOZ A;  2UXD K;  4FJM A;  1NGC A;  2D0P A;  3E1Y A;  2O8E B;  1JL2 A;  3C6H A;  4FWS A;  4FVM A;  4XH5 A;  1YVN A;  3AGK A;  1S72 N;  2WFB A;  2ASO A;  2XY6 A;  3I56 N;  4A62 A;  1R0A A;  2IVN A;  1RTI A;  3LP0 A;  4IWV A;  4CZF A;  3MX2 A;  4QS7 A;  1U45 A;  2FBY A;  5DM7 L;  2NRX A;  4X64 K;  1QHT A;  4CJL A;  4CFA A;  3VPZ A;  3KK2 A;  4E3S A;  3VEV A;  1WN7 A;  4NYF A;  3AA2 A;  3AAQ A;  4BQL A;  5M1O A;  3T1A A;  4WE1 A;  3K0S A;  5T7B A;  1WSJ A;  4YOX A;  1RT6 A;  4CF1 A;  4E1N A;  3T7Z A;  5DM6 L;  4MFB A;  4NCB A;  5CHI A;  1S1U A;  4GY2 B;  2ITM A;  1QHA A;  1XHZ A;  1L3U A;  5HRN A;  5BRF A;  1DKG D;  4DTO A;  2V7Z A;  3OYI A;  3VMF B;  4ILJ A;  4B3T K;  4F2R A;  4CZK A;  4DQP A;  2VWB A;  2PYL A;  4IOA L;  4B3O A;  3ZET A;  2QWM A;  1NGA A;  3OYE A;  4DTU A;  3TAF A;  2OAN A;  4CBX A;  3QIN A;  3L0Q A;  1BI4 B;  4QOZ B;  3VEO A;  4N41 A;  1DEJ A;  2W40 A;  4C8M A;  2X78 A;  3TR8 A;  2A42 A;  5D3G A;  2P9U B;  1ZBH A;  3VQD A;  3NVK A;  4RW7 A;  4JAX A;  1RIL A;  2VG7 A;  4OPJ A;  4V19 S;  4KKO A;  4FM2 A;  2A1R A;  3DM2 A;  3MWT A;  1TYQ B;  4IEI A;  5I3U A;  1NGF A;  2IS3 A;  4DFJ A;  3RR7 A;  1CXU A;  5AQH A;  3EZW A;  3SK3 A;  1KFD A;  3KLG A;  3SI6 A;  2OZS A;  1GOA A;  1U2V B;  4JI1 K;  4OKJ A;  1Y97 A;  4JKE A;  1WAF A;  1NJW A;  1WBD A;  4FVU A;  4DV1 K;  5AQG A;  2LSN A;  3BUZ B;  5CZ2 A;  5F2R A;  1TVR A;  4FWN A;  4FSV A;  1K6Y A;  1ZBU A;  1IJJ A;  4AIL C;  4ISG A;  5I42 A;  1QVG M;  2I7N A;  2F9W A;  2ZWH A;  4CGF A;  3O9U A;  1NJX A;  3G4S N;  4IG0 A;  2FBV A;  4W5N A;  1Z05 A;  1YTA A;  3D7E O;  1HYS A;  1VRU A;  5LJW A;  1A5W A;  4CK3 A;  4DR1 K;  2G8K A;  2HND A;  4JKG B;  4XIU A;  3KK7 A;  1YUW A;  1N6Q A;  3DYA A;  2V52 B;  2ZM6 K;  1XWL A;  4CHN A;  3QNN A;  1NJI O;  3VET A;  4CIE A;  1QQO A;  5JVH L;  3F2K A;  1RBS A;  2O8E A;  4JI8 K;  3CER A;  3HP6 A;  3ZSO A;  4OGC A;  3VN5 A;  1HPZ A;  3THV A;  4CES A;  3WNG A;  2JGU A;  4OJR A;  4CJ5 A;  4EHU A;  1L5U A;  1QQC A;  1OVY A;  3J7A P;  4DQS A;  1QSS A;  1JCF A;  1S9E A;  4A2B A;  4J2D A;  1XNQ K;  1HJR A;  3H1Q A;  1RDD A;  3FGU A;  3IS9 A;  1RCH A;  2WTU A;  4HHT A;  2PBD A;  4FLT A;  3TTF A;  4B1X B;  5EX5 A;  4H5T A;  5C0Y A;  3R3L A;  3M8S A;  1VSM A;  4K0K K;  3DMJ A;  3VEX A;  4BVP A;  4DV5 K;  4CJK A;  1WBB A;  4JRQ A;  2IAJ A;  4DV2 K;  3LDQ A;  3HYF A;  4E7I A;  4H0V B;  4CFC A;  2P5G A;  3ZSV A;  3DWL A;  4E7J A;  4F4K A;  1WNS A;  3I0S A;  2G8I A;  3LPU A;  1VSI A;  1CZB A;  5JIC A;  1I94 K;  5FPM A;  3CD6 N;  3GDQ A;  4BC3 A;  4E1M A;  2FF6 A;  4HCC A;  1T6C A;  3TU5 A;  2QI2 A;  4FXD A;  2A40 A;  1LV5 A;  4I2Q A;  4CJT A;  2YNH A;  4OGE A;  3GOI A;  3VF2 A;  4LFB K;  3RRG A;  3M8Q A;  2FBX A;  1RTD A;  1YVU A;  3M5R A;  4DS5 A;  1XC9 A;  3HT3 A;  3KLF A;  1BI4 A;  2VGM A;  3JYT A;  2E1Z A;  2ZJQ L;  4DUY K;  3NAE A;  3U3Y A;  3AVF A;  3QIC A;  2P9U A;  3CFR A;  4DCH A;  2E88 A;  4RW6 A;  1I3A A;  3TSU A;  1QS4 A;  4IEE A;  3G25 A;  1TYQ A;  3WXJ A;  1NK7 A;  2FSK A;  5GAD P;  1Z25 A;  4M63 C;  4PL8 A;  2QWO A;  4CER A;  1JL1 A;  1U2V A;  3F9M A;  4ILG B;  4QS9 A;  1P8Z A;  4IZ9 A;  3O4N A;  1S6P A;  2Q0U A;  1MDU B;  4ZHR A;  3PV8 A;  1TKX A;  4JYA K;  1KVA A;  5ADX A;  3VEW A;  4IO9 L;  4DSL A;  3UB5 A;  2UXB K;  4AH9 A;  2WON A;  3A5L C;  2DFE A;  3MK6 A;  3Q7B A;  3L4I A;  2PAV A;  3O9T A;  2HHW A;  1BU6 O;  3LP3 A;  3SAF A;  4DV4 K;  4RCH A;  1BUP A;  2HBL A;  4CJE A;  4HVJ A;  3PLA A;  4CJU A;  3O6W A;  4E19 A;  3I8D A;  4JKG A;  3AO1 A;  5AQL A;  3RVC A;  3AGR A;  1SV5 A;  3D2E B;  3E01 A;  3ZX0 A;  3G10 A;  3VA0 A;  3CCJ N;  4YNQ A;  2NRV A;  1VSK A;  3ULD A;  3V81 A;  3DRS A;  4WFA L;  3OVN A;  3LM9 A;  3AA4 A;  3E9L A;  4FPB A;  4FLX A;  3DLB A;  4CEQ A;  3IAY A;  3KD1 E;  4HWI A;  5KI6 A;  3QET A;  3I8B A;  1T03 A;  3LAN A;  5SZT A;  3LDL A;  3RTV A;  3K9K A;  1RTH A;  3HPO A;  4A5A A;  3J7Y P;  4UY8 O;  3NGI A;  1E4G T;  4EP5 A;  4ZTJ A;  2VCP A;  3VQ6 A;  4M3X A;  1N5Y A;  4N5S A;  1VAZ A;  3HJF A;  2WC9 A;  4C1N I;  3CCR N;  1KRP A;  1V4T A;  5A2Q O;  2XY8 A;  2YJE A;  1TK5 A;  4AQY K;  2HVI A;  2RF2 A;  4O8U A;  3ZT4 A;  2E4L A;  4TSX A;  3EN9 A;  1W97 L;  5HP1 A;  1GLC G;  5IWA K;  1E3M A;  2KHO A;  3TAR A;  1GLB G;  3P1G A;  4JV5 K;  2KKZ A;  5DK5 A;  3LDS A;  3WNH A;  2QKB A;  5FLX O;  3AY9 A;  4CHZ A;  4IG3 A;  4CW7 B;  1NU0 A;  3JXU A;  2HF3 A;  4OVL A;  4BR7 A;  3O5B A;  3HPG A;  3QFP A;  4RG8 A;  3DXM A;  4BR4 A;  3CM6 A;  1WSE A;  2PFU A;  3AV9 A;  2YHX A;  5AQU A;  1TK8 A;  3AVG A;  4XEI A;  5AQM A;  3L2V A;  2EWS A;  1LW2 A;  4CZE A;  3AVB A;  4DLE A;  2YHB A;  1KXP A;  5KQD A;  4JS5 A;  3VQA A;  3TPQ A;  1HRH A;  4DR2 K;  4GV3 A;  2YJF A;  4CI6 A;  2VWK A;  5AQO A;  3C6A A;  1GLE G;  3QB0 A;  2KZM A;  4B1Z A;  4JK7 A;  1HKB A;  2Z1J A;  2FF3 B;  4B9Q A;  4IKF A;  4DS4 A;  3B6O A;  1NMD A;  3KK3 A;  4CJ4 A;  3BY5 A;  4RW9 A;  5EOY A;  1RBR A;  4U67 L;  1EWR A;  4ELV A;  5I9E B;  1SAZ A;  3AVC A;  3OYC A;  4PWD A;  4DSF A;  4YDU C;  1HNI A;  1LAW A;  1Z26 A;  3D45 A;  4JN4 A;  3BDP A;  3GE1 A;  5LY3 A;  2QWP A;  4H0T B;  5AQI A;  1G15 A;  1K9M O;  4M3T A;  4M3W A;  1NKB A;  4FJ7 A;  4KHS A;  1HKG A;  1ATS A;  4K8Z A;  3GBT A;  3JAM O;  3OYK A;  1NMN A;  1ASU A;  4F2S A;  3CFP A;  4PUO A;  4YOW A;  5AQP A;  2Q97 A;  3IDH A;  3MED A;  1SL2 A;  4FWL A;  4FJ8 A;  4LD0 A;  2E2Q A;  3D2E A;  3SBG A;  3CME N;  3SJJ A;  4DWI A;  4WQ4 C;  4B1V A;  1BL3 A;  3CQ8 A;  1D9D A;  3DLL L;  1NK0 A;  5AQT A;  1RDA A;  3MDQ A;  3MCA B;  1IH7 A;  1J54 A;  1YIT N;  3P4I A;  4MQ3 A;  4M45 A;  2DPN A;  4XH4 A;  3OY9 A;  4ELU A;  5M1P A;  4R79 A;  4DU3 A;  2OA8 A;  3RSE B;  1BGX T;  4GMJ B;  5C24 A;  3CPE A;  4M3R A;  1KLM A;  1WOQ A;  1NK9 A;  4DSK A;  3QEX A;  2KW4 A;  2I7P A;  4K43 A;  3O8M A;  1IKW A;  5KPR A;  2NNW A;  2E20 A;  3KLE A;  1ZYQ A;  3HI0 A;  5EU7 A;  1RT4 A;  5BR9 A;  3HTV A;  4NCG A;  4Z4H A;  3AVN A;  5C42 A;  3CCU N;  2QK9 A;  5J1E A;  1O13 A;  5C2F A;  4GV9 A;  2A41 A;  4AHS A;  5GAE P;  3O3F A;  4JHD B;  5CYQ A;  2D5R A;  4MDB A;  1XHX A;  1T6D A;  4KHQ A;  3E9O A;  1F21 A;  5KGX A;  3FFI A;  4KH6 A;  4DLG A;  1VQO N;  1EQY A;  2DY4 A;  2A1S A;  3O3G A;  1L3S A;  1Q86 O;  1KAZ A;  3A2F A;  1VK0 A;  5J2Q A;  2OYQ A;  5C25 A;  4DTS A;  4DMN A;  1EXQ A;  4CGJ A;  3I55 N;  1NK5 A;  5E41 A;  1HLU A;  2PY5 A;  3ZX3 A;  3FFK B;  3H3N O;  3ZEU A;  1N34 K;  4Y1C A;  4LF9 K;  1Y64 A;  4AHC A;  3ID6 A;  2HF4 A;  3QES A;  3S3O A;  1MA9 B;  1ASW A;  1KTQ A;  5CZ1 A;  5LJV A;  3MN6 A;  1K8K A;  2A5X A;  2QWL A;  3CXC M;  3VQB A;  3WQU A;  1C1B A;  2QXL A;  3CG7 A;  4DV0 K;  4WQ4 A;  3NF8 A;  3THW B;  3VOV A;  4IXC A;  4Z4C A;  3VQ9 A;  3C0B A;  3ZSY A;  4QAG A;  1IBK K;  5C12 A;  5AQW A;  1HR0 K;  3TAN A;  3MEC A;  5BPL A;  4R5P A;  4OPK A;  4DU1 A;  4CFB A;  4K42 A;  3TWH A;  3QDK A;  4B9V A;  3KKS A;  3NDK A;  2E1Y A;  1HQE A;  2RHK A;  3V9X A;  1LWF A;  1OH8 A;  3BZK A;  4M7Y A;  1T44 A;  4FJN A;  3QNO A;  4CJW A;  3DXK B;  4B9M A;  1JXE A;  4IDH A;  1J5E K;  4DB3 A;  4H0X B;  3KJV A;  4MLE A;  4Z4E A;  5KGW A;  1BCO A;  2YNG A;  4H5V A;  1KVC A;  3H46 O;  5KRT A;  4CEC A;  4OKK A;  2YHA A;  3HPH A;  1VQP N;  4YY3 K;  2YI1 A;  2HHU A;  4BRL A;  3SLC A;  1MU2 A;  1NK6 A;  3FZH A;  4G1Q A;  4I2P A;  1S9G A;  1JLE A;  4I6M B;  4KTZ A;  4RW8 A;  4Z0U A;  3ZLJ A;  1VQ5 N;  4X65 K;  1G99 A;  2OPQ A;  3P83 D;  1FJG K;  1C0G A;  3UE5 A;  1GLD G;  4OO1 J;  2GEL A;  1ASV A;  3AVJ A;  4FWM A;  3OS1 A;  5JVG L;  1Q9X A;  5TKY A;  4B3R K;  1U04 A;  1ZXO A;  2GUI A;  4O0J A;  3RSE A;  3VEY A;  4NB4 A;  1Q18 A;  3P5J A;  4BY9 C;  1KVB A;  3FZM A;  4PKG A;  4CED A;  2ZGY A;  3S9H A;  3HOT A;  4B1W B;  3A5O C;  4DR5 K;  2IVP A;  4JI2 K;  4Y0W A;  2D0B A;  2OCE A;  4A5B A;  4BQZ A;  4YOV A;  3UKR B;  3CJ9 A;  3PIO L;  4JRP A;  4DV6 K;  3V1O A;  4M3U A;  3DRR A;  1DTT A;  4M42 A;  4FJL A;  4CK2 A;  4JHD A;  1S1W A;  3LP2 A;  2AP1 A;  3CF5 L;  4CHP A;  5FRM A;  2P9I B;  2V51 B;  2QM1 A;  4FPA A;  5BRH A;  4CJQ A;  3MMV A;  1HX1 A;  5AR0 A;  3HXM A;  4LC9 B;  1C6V A;  1MWK A;  4PHT X;  1JLB A;  2D4W A;  4BC5 A;  1VQL N;  1QQN A;  2QXF A;  4JEP A;  3SJH A;  1QSL A;  3VQQ A;  4FWQ A;  1HNW K;  1SL1 A;  4BRH A;  1C1A A;  3O4Q A;  4FK0 A;  5JS2 A;  2HHV A;  3ZSZ A;  4C8L A;  3EY1 A;  3HZ6 A;  1NKC A;  2HW3 A;  2NRR A;  4FJI A;  3TAM A;  5JMV A;  1S1V A;  1FKO A;  3SMP A;  4A57 A;  3CCM N;  3OS0 A;  1RT1 A;  3L6Q A;  3SCX A;  3R9P A;  4H03 B;  4L3Q A;  4FOE A;  3D0P A;  4B9S A;  4KHW A;  1OVQ A;  3F73 A;  2GUP A;  1CZ9 A;  3THW A;  4LY7 A;  4CF0 A;  3VA3 A;  1ZC6 A;  4PKH A;  1C0U A;  4XH1 A;  4YOU A;  4ISF A;  1UA0 A;  3WNF A;  1NOY A;  1RDB A;  4FO0 A;  2KZZ A;  2O8D A;  2UU9 K;  5TKW A;  3ZSX A;  1D9F A;  5BRE A;  1L3T A;  4FZZ A;  1UOC A;  2IOC A;  2KLA A;  3IRX A;  3DAW A;  2NRW A;  4CEB A;  3DXK A;  5AFU H;  3QEP A;  4BR2 A;  3T1Y K;  1IKX A;  1J9A A;  2B4J A;  3LAL A;  4IFY A;  3SMS A;  3CM5 A;  5AQY A;  4HTU A;  4E7K A;  4KB1 A;  4B08 A;  3PX4 A;  2P9L B;  1VQM N;  3RR8 A;  5CE3 A;  1Q7Y O;  2NRZ A;  3OW2 M;  1VQK N;  2RPI A;  3DOL A;  4I6M A;  3OYL A;  3BGR A;  5E84 A;  4B9N A;  4KV8 A;  3CYM A;  4CJ7 A;  3A5M C;  3VGL A;  4JI0 K;  4AHU A;  2UUA K;  1BOT O;  1XNR K;  1KD1 O;  4CEA A;  5B8H A;  4Q5V A;  3J7Z O;  4EFH A;  4CJF A;  2EX3 A;  5AZI B;  3ATU A;  3DI6 A;  4CEF A;  1QVF M;  3K58 A;  3V1R A;  3KHY A;  4B1U B;  3TAQ A;  2RKI A;  4IFE A;  4OPH A;  4Z4I A;  2O8B B;  3QEW A;  3MXI A;  4W5Q A;  2HMI A;  4JI3 K;  4CHO A;  2WBN A;  3CJB A;  3MCP A;  5AQV A;  4E89 A;  4BAC A;  3ENO A;  4BRO A;  2IGI A;  5F0X A;  3ATV A;  1T8E A;  4KO0 A;  1ZBS A;  4BRA A;  4CEO A;  4DUZ K;  1KSP A;  4BVO A;  4BRI A;  4CBU A;  3UKR A;  4JKH A;  4ID5 A;  3BF1 A;  3AO4 A;  1U4B A;  1EO1 A;  2P9I A;  2GV9 A;  5LMU K;  1BDG A;  3SV4 A;  2HNY A;  4CFD A;  3CCV N;  3DLK A;  4KI6 A;  4C23 A;  1ZBL A;  1ATR A;  1NLV A;  3WXM B;  1VQ8 N;  1TL1 A;  1EWQ A;  4DSJ A;  1WSH A;  1HNX K;  2G8H A;  4DQ8 A;  1YF5 L;  3O08 A;  3DRP A;  3I0R A;  1VSF A;  4AM7 A;  4DTJ A;  4J2E A;  3O1W A;  2E6L A;  3TAE A;  2G8F A;  4YOY A;  1NK4 A;  3WNE A;  2EHG A;  1IBL K;  2ZD1 A;  3C7N B;  3ULE B;  3L2Q A;  4W5T A;  1J5O A;  3CQY A;  3KWI A;  2BTF A;  5DMR A;  3VQC A;  4O8K A;  4BDZ A;  1HJO A;  2Q31 A;  3VES A;  4ILH A;  1IG8 A;  1N8R O;  4M7X A;  4CD3 A;  1TUU A;  5BPN A;  3AVL A;  1W0H A;  3HBT A;  4FJ5 A;  1IV0 A;  5AQX A;  3TSP A;  3ENH A;  1UWB A;  3KKR A;  3O3H A;  1CXQ A;  1SKW A;  1SUQ A;  3U9D A;  4M3Z A;  4Z4G A;  4LF6 K;  4CJ3 A;  2VQF K;  5H1S Q;  4BRM A;  3SZ2 A;  2P9P B;  4O5F A;  2W42 A;  4X62 K;  1XMQ K;  2JLE A;  2A6A A;  3VEZ A;  2NZT A;  2NUB A;  3M1F A;  2QWR A;  1C0T A;  2NLX A;  4KHY A;  5AQF A;  4KPY A;  4CF8 A;  3VQ5 A;  4WFN L;  2P9L A;  2Z1I A;  4LF4 K;  5KPZ A;  1SKS A;  3SQ1 A;  4DQQ A;  1T3V A;  1DT9 A;  3O80 A;  4LF5 K;  4B8A B;  5EVZ A;  5C10 A;  3U4L A;  4HUF A;  4FOI A;  4DQR A;  3WUH A;  2W6K A;  5C15 A;  1HNV A;  2YKM A;  4DTN A;  2OPR A;  3SYZ A;  4IFV A;  5AZI A;  4RW4 A;  4X66 K;  3AO3 A;  4KI4 A;  4A59 A;  1NGB A;  3LL3 A;  3GG4 A;  3NH2 A;  4JK9 A;  1BQM A;  4DF4 A;  3RMC A;  3LDP A;  4UQG A;  2Q0R A;  3EEQ A;  3TI0 A;  3WQT A;  1D4X A;  2W6L A;  4BC2 A;  2X74 A;  4WFB L;  4E7L A;  1YTU A;  1FXX A;  4H4M A;  2VYP A;  3CCS N;  2KQ2 A;  2UXC K;  2I5J A;  5FDL A;  4LSL A;  1ITG A;  4I9Q A;  4OX9 K;  4G9Z A;  1S1X A;  4C1N K;  1V4S A;  1KQS M;  4BRP A;  3JSM A;  2UUB K;  1BIS A;  4ZTF A;  4BRQ A;  3KIO A;  3M3Z A;  4DQI A;  3OYH A;  2P9S B;  2Y1J A;  1XUP O;  1YJN N;  2Z1H A;  2GBZ A;  5FPD A;  3I33 A;  2QWQ A;  3HVT A;  3VF4 A;  1XQS C;  3HRG A;  5GIP A;  2ZQB A;  4CF9 A;  2BGG A;  1FK9 A;  3WEE B;  3LAK A;  1JCE A;  3VEN A;  3HM9 A;  2ZJP L;  1XMO K;  1YHQ N;  3MEE A;  2YHY A;  5GAH P;  3K2P A;  4BRD A;  4H4O A;  1SQK A;  1VQN N;  2E5L K;  5LMN K;  4F9O A;  4KFB A;  4LFC K;  3NMU A;  1B9F A;  3T69 A;  1NGD A;  3D2F B;  3QEV A;  4KBO A;  5AQS A;  4DTR A;  2GTD A;  4F3T A;  4GNI A;  2IDO A;  2BE2 A;  2O8C B;  4NXM K;  1RT5 A;  3SBT A;  4FYD A;  3C7N A;  3ULE A;  4B3M K;  1BA1 A;  4H0O A;  2HHT A;  3G71 N;  4CIG A;  5KRS A;  2GEM A;  4BR5 A;  4BR0 A;  3CCE N;  4QCL A;  4JKC A;  1SL0 A;  3ZSW A;  1EET A;  4KHN A;  4PQU A;  3FR0 A;  2IVO A;  4M41 A;  1WSG A;  2ASP A;  3KLI A;  4K8X A;  3F9K A;  4CHY A;  4O4G A;  4HTL A;  2ZE2 A;  2Q1N A;  1EP4 A;  4BRC A;  2P9P A;  5SWM A;  4BR9 A;  3S3M A;  1UAX A;  3O4W A;  3HST B;  4PL7 A;  1ESV A;  3KVG A;  3B6P A;  1NM1 A;  3NVM A;  3NH1 A;  3LDO A;  3M8R A;  1N36 K;  1VQ6 N;  3NF7 A;  5KQ8 A;  3CQX A;  2VQE K;  3ITH A;  4QS8 A;  1SZ2 A;  3CIP A;  2DTU A;  3THX B;  1UA1 A;  4LF7 K;  3AVH A;  2HBJ A;  4FJJ A;  3KTQ A;  2O4G A;  5HRR A;  4A61 A;  2A3Z A;  2JWK A;  5F1X A;  5J2P A;  5FRN A;  5BRD A;  3R6M A;  3SQ4 A;  3NF6 A;  3PSI A;  1RBT A;  2HBM A;  4ICL A;  3OJS A;  3T1H K;  4H5W A;  1U48 A;  4J2B A;  2HHH K;  4NLC A;  3ZT2 A;  3OBW A;  4NO7 A;  4CZI A;  3L2W A;  3OA9 A;  3OYN A;  3CC7 N;  5M1K A;  4O5B A;  1IKY A;  4DFK A;  4K25 A;  1JLC A;  4LH5 A;  4WQ5 C;  3V6D A;  4EIA A;  1R59 O;  5AQR A;  2FSN A;  4CBW A;  3OHR A;  4CD1 A;  1ATN A;  4I7F A;  1X9W A;  1K73 O;  4FJH A;  4YDU A;  2GX9 A;  4B9L A;  3VGK A;  3FLC O;  4HUE A;  4CHQ A;  2D0A A;  3P31 A;  4DG1 A;  1JJ2 M;  3CJ1 A;  2P9S A;  4H5R A;  3SV3 A;  1N32 K;  2WOM A;  1QE1 A;  1RT2 A;  3DOK A;  4DKW A;  3OTO K;  1NGI A;  1JKH A;  1S5J A;  5EY4 A;  4FZX C;  3AVA A;  5C2D A;  1FKP A;  4NYN A;  1NJZ A;  4F8R A;  3KK1 A;  4K41 A;  4EAH D;  3NBP A;  3FZL A;  1VQ7 N;  4CZH A;  3SUP A;  3K5N A;  4FK4 A;  4YFU A;  4BDP A;  1VSH A;  3JS6 A;  3B8A X;  3T3F A;  3Q7C A;  3VQ4 A;  1ILY A;  3SPZ A;  1GLA G;  4RWT A;  2O8C A;  5M1N A;  2HOE A;  4CGD A;  3KLH A;  1LAV A;  3SNN A;  3ZX2 A;  4J2A A;  3VTI A;  1BQN A;  4JS4 A;  3L8B A;  2QEX N;  1WLJ A;  3PIP L;  2ITG A;  4N56 A;  3EE9 A;  3FZF A;  3OBY A;  4DR7 K;  4MLH A;  2FLO A;  2P9N B;  5KPT A;  3NHG A;  2BAN A;  3SQ0 A;  1KAX A;  3PO4 A;  3PO5 A;  1YJ9 N;  4H0Y B;  1X3N A;  5HRS A;  5K14 A;  4BG9 A;  2OPP A;  5AZJ B;  2F9T A;  4CJP A;  3CC2 N;  3FZK A;  4JI4 K;  5JS1 A;  3C95 A;  3NGZ A;  3NCI A;  4WQ5 A;  4BDY A;  1JLF A;  1VSJ A;  2P9K B;  1M1K O;  4CJS A;  3ZT0 A;  3K59 A;  3C65 A;  3EE8 A;  1RDW X;  1S1T A;  3UKU B;  3LWL A;  1JXB A;  1OH7 A;  4OLA A;  2UYT A;  3BP8 A;  3VQ7 A;  1TUY A;  3R1X A;  3ZYY X;  2OTJ N;  4AHT A;  4J8F A;  3U6F A;  3QBW A;  4Z94 A;  2O8F B;  3THX A;  3CHW A;  1WSI A;  3VGM A;  1Q82 O;  3MXM A;  3U3G A;  1TAU A;  1HPM A;  4H5N A;  1B9D A;  2CH5 A;  2YX6 A;  2D1K A;  1VHX A;  3K57 A;  4LFA K;  4EHT A;  3MEG A;  3A5N C;  5GIO A;  3EKS A;  4CVN E;  1KLN A;  2G8U A;  4FJK A;  5GIN A;  3G6E N;  3AVM A;  3N4P A;  1TL3 A;  1NGE A;  2BH1 A;  3U8X A;  2KFN A;  3U9Z A;  3P39 A;  4DSE A;  1TGO A;  1I39 A;  1A5X A;  4KHU A;  1NKE A;  4GVE A;  3C6T A;  3RWU A;  1C0M A;  3KZB A;  1DLO A;  2B5J A;  3LM2 A;  3KWG A;  3QBX A;  4AF1 A;  3G0Z A;  1NWK A;  1TAQ A;  3H3O B;  1HMV A;  2ATQ A;  4JD2 B;  1TKD A;  2RE2 A;  1JLG A;  1IG9 A;  1D5A A;  3S41 A;  4RTF D;  4KRF A;  3SUN A;  4OLB A;  3CJC A;  1D8Y A;  3THY B;  3HO1 A;  5AQK A;  3HM8 A;  3TAG A;  5AJ3 K;  4KB0 A;  3V9U A;  1RDC A;  5ADX H;  3H1V X;  3K5O A;  1L3V A;  1RGI A;  1QSY A;  1RTJ A;  3ZSR A;  3WXK A;  4FWK A;  3SAH A;  4NXN K;  3L2R A;  2HNZ A;  5E26 A;  1B92 A;  1LCU A;  4B8C A;  4DR6 K;  4FM0 A;  2OPS A;  4EZ6 A;  4KTQ A;  3OS2 A;  4MDA A;  1BG3 A;  1TKT A;  4GW6 A;  5M1F A;  3VTH A;  1HYZ A;  1NGG A;  4C8N A;  4A2A A;  1X9M A;  5FRO A;  3E66 A;  4KHP K;  3SUO A;  1NK8 A;  1J53 A;  5CYM A;  3OYB A;  2P9N A;  4DTP A;  2HHX A;  3VER A;  4ELT A;  3O9R A;  3PSF A;  3H6E A;  4IOX A;  4PA1 A;  5M1Q A;  4FJX A;  5AQQ A;  2E6M A;  4LSN A;  4CJV A;  4ID1 A;  3LAM A;  5AZJ A;  2YKN A;  3O9Q A;  1C0F A;  3LZI A;  2XY5 A;  3RMA A;  4F3O A;  3QLH A;  1REV A;  5BN8 A;  5FPE A;  1CZA N;  2Q36 A;  3TTD A;  2P9K A;  4GKJ K;  4B9T A;  2E2N A;  3UKU A;  3MXJ A;  2OTL N;  2XRI A;  4IBN A;  4JI5 K;  3NF9 A;  3OYF A;  3ISN C;  3SQ2 A;  3EYZ A;  3LZJ A;  2O8F A;  4IJN A;  1DTQ A;  4B3S K;  2YNI A;  2PZS A;  4PKI A;  4AHV A;  1X9J A;  2KTQ A;  5BR8 K;  1QTM A;  2NRT A;  3D6R A;  1GLF O;  2ETJ A;  1JLQ A;  3WT0 A;  2F8T A;  1BCM A;  3HOS A;  4FK2 A;  3RMD A;  3O9S A;  1YT3 A;  3M6G A;  2Z1G A;  3QML A;  2DFF A;  1KC8 O;  4FL9 A;  5HLF A;  1GOC A;  1U47 A;  3ZT1 A;  5BPM A;  4I9L A;  4EZ9 A;  3IUC A;  5JLH A;  2ZJR L;  4WCE L;  1M90 O;  3VQ8 A;  4CZG A;  1RT7 A;  3PUF A;  3QEI A;  3CJA A;  3V4I A;  4O55 A;  2QW9 A;  1NGH A;  3L3V A;  4HUG A;  3DXM B;  3TAB A;  2IIR A;  4KAZ A;  2YHW A;  2OZM A;  3W0L A;  3FE1 A;  1LW0 A;  5LL6 Z;  4FWP A;  1E4F T;  1QZ6 A;  1YI2 N;  1X9S A;  1WUA A;  1XC3 A;  4DSI A;  1QQM A;  4FWO A;  4BC4 A;  4JD2 A;  1IBM K;  3WXL A;  3NH0 A;  2J4R A;  3ZCM A;  1LWE A;  2XHB A;  4FLU A;  3QER A;  3ZSQ A;  4FM1 A;  3W3D A;  1YAG A;  4IO8 A;  3J8A A;  1W7A A;  2PYJ A;  3CMA N;  4BWJ A;  3THY A;  2VG5 A;  4MO5 A;  3DLE A;  3QFU A;  2BUP A;  3MN7 A;  4IOC L;  4CE9 A;  1H1V A;  1S3X A;  1U49 A;  2CGL A;  2G8W A;  1RNH A;  2X6S A;  2FBT A;  3PX6 A;  2X6N A;  2QWN A;  1RDU A;  2F7T A;  1FW6 A;  4BE1 A;  4YOT A;  1Q9Y A;  4JKD A;  1J6Z A;  3OYJ A;  3EL2 A;  2Q3S A;  1SKR A;  4CZM A;  3P38 A;  4PY5 A;  3T19 A;  1WAJ A;  2RN2 A;  3HVR A;  3DLR A;  3HSC A;  4H0P A;  4FLY A;  2QA4 N;  5BN9 A;  3IKM A;  3M8P A;  3BZC A;  3A0I X;  2CGJ A;  1WSF A;  2HBK A;  5CR4 A;  4GV6 A;  3CPW M;  3MAQ A;  3AO2 A;  4CEZ A;  4CZL A;  3AO5 A;  1Q81 O;  3WXI A;  3MN5 A;  1HYV A;  3O1B A;  1BO5 O;  4H8K A;  3AA3 A;  4DF8 A;  5HRO A;  2E2O A;  3ID8 A;  4N76 A;  4Y1D A;  4BG8 A;  2D0O A;  2FSJ A;  1ZBF A;  4FLZ A;  5GAG P;  3VQE A;  4DHY A;  5AFU A;  1YIJ N;  5IT9 O;  4OKE A;  1WB9 A;  1W2B M;  4AHR A;  4OPA A;  3OYM A;  1K8A O;  4GKK K;  4BGA A;  5HL7 L;  1TV6 A;  3EKU A;  3V9Z A;  4FLV A;  2FC0 A;  3VQP A;  3EO3 A;  4FLW A;  4CCH A;  5MLC Q;  1YXQ A;  2Q2R A;  3BEX A;  4E0D A;  3V9W A;  1VQ4 N;  4CJR A;  4FZY A;  3NFA A;  4LH4 A;  3NE6 A;  3EZ5 A;  1NNE A;  1DGK N;  3HL8 A;  1BIZ A;  2O8B A;  1BA0 A;  1HQU A;  1IO2 A;  2ZGZ A;  1OKJ A;  3CJ7 A;  1CLQ A;  2F96 A;  2NRH A;  3AAR A;  3QIO A;  4BRN A;  4DFM A;  4CEE A;  1C1C A;  1QZ5 A;  4BRE A;  1JLA A;  5JLF A;  1NGJ A;  1XI1 A;  2YNF A;  5J2N A;  2DFH A;  3F5T A;  3MWP A;  1ZBI A;  4WYB A;  4GVM A;  4YHH K;  1A5V A;  3DLG A;  1RBU A;  5KTQ A;  1TK0 A;  2P5O A;  3L3U A;  2IC3 A;  1NBW A;  3ZEU B;  2P51 A;  1JCG A;  3RRH A;  3OYD A;  4CK1 A;  3L2U A;  4LF8 K;  3NGY A;  2AJQ A;  1OH5 A;  4JKA A;  3LWM A;  2WUS A;  1RFQ A;  5CY4 A;  4N47 A;  4CIF A;  4KH4 A;  3C94 A;  4Z4F A;  4CGH A;  3LDN A;  3PY8 A;  3ENB A;  1YJW N;  1S6Q A;  3K5L A;  1K8K B;  4O0I A;  3SAG A;  4WF9 L;  1RT3 A;  2YV0 X;  2H3G X;  4MO4 A;  1KAY A;  1X3M A;  4FJG A;  4BRF A;  1N33 K;  3CC4 N;  3J80 O;  2HHS A;  4BRG A;  3CET A;  3IMX A;  3QIP A;  4JI7 K;  3AVI A;  2HST A;  2Y1I A;  4IDK A;  3L4Q A;  3SPY A;  4EP4 A;  3LPT A;  4CZJ A;  1W9H A;  3J81 O;  5ELZ A;  1BWF O;  2D0C A;  2G8V A;  1HNZ K;  2HVH A;  3ALY A;  1U6Z A;  3MX5 A;  4DU4 A;  4DTM A;  4DFP A;  1P90 A;  1BIU A;  3IG1 A;  1X1P A;  3GL1 A;  4BWM A;  3LP1 A;  4JKB A;  3PX0 A;  3AAP A;  3E9P A;  2QTD A;  2VG6 A;  1NJY A;  3HK2 A;  3DJC A;  4B9U A;  2UUC K;  1VQ9 N;  1Z6R A;  1S22 A;  4CF2 A;  3N4Q A;  2E8A A;  3H08 A;  4JKF A;  5AQN A;  3TAP A;  4AM6 A;  4W5O A;  3CCQ N;  4JI6 K;  4FW2 A;  2BDP A;  4FW1 A;  2B6A A;  3H45 C;  3SUQ A;  3S3N A;  2GWJ A;  4CGI A;  1Q8I A;  4DR3 K;  2V7Y A;  3QO9 A;  2P1J A;  5AQJ A;  2HMP A;  1KFS A;  4JNE A;  2FXU A;  4JLH A;  3DLH A;  4ISE A;  4BRK A;  3OYA A;  4NLB A;  1HUX A;  4C8K A;  1T05 A;  4JK8 A;  3OYG A;  2GWK A;  2YCH A;  1NG9 A;  3V1Q A;  4IJA A;  1EKE A;  5J2M A;  1SS6 A;  2CH6 A;  3BF3 A;  4BGB A;  5HOO A;  1KCF A;  2ZF5 O;  4BE2 A;  4E7H A;  3AVK A;  1GLL O;  3ASM A;  2W41 A;  3ZET B;  5AQZ A;  2VGN A;  1HKC A;  3CCL N;  1EX4 A;  3AA5 X;  3HP9 A;  3UIQ A;  3IFR A;  3R8E A;  4B1Y B;  2HHQ A;  4O44 A;  4KRE A;  2ASM A;  4U7B A;  4Q0B A;  3MN9 A;  1O1W A;  2CGK A;  3V9S A;  2JWL A;  4FCY A;  1MWM A;  3WEE A;  1T7P A;  3KD5 E;  4L8R B;  4YOR A;  4FWR A;  1IKV A;  5EXW A;  3OJU A;  4C8O A;  1VSD A;  4FJ9 A;  2F8S A;  5HRP A;  2AA4 A;  2E2P A;  3D2F A;  1TKZ A;  2O4I A;  5HBM A;  3A8Y A;  4KTW A;  2KFZ A;  1VRT A;  1GOB A;  1RBV A;  2VWJ A;  4W5R A;  2XY7 A;  4KH5 A;  1VSE A;  1VSL A;  4BE0 A;  1LOT B;  1LWC A; 
#chains in the Genus database with same CATH homology
 4DSF A;  4KTQ A;  1HNI A;  1LAW A;  1BHL A;  1Z26 A;  3AVL A;  3OS2 A;  1W0H A;  3D45 A;  1TKT A;  3K5M A;  2HB5 A;  3BDP A;  4FJ5 A;  4GW6 A;  2XO7 A;  1G15 A;  4M3T A;  1UWB A;  1HYZ A;  3KKR A;  3C6U A;  3O3H A;  4M3W A;  1CXQ A;  4C8N A;  1SUQ A;  1SKW A;  1NKB A;  4FJ7 A;  4HCB A;  4KHS A;  4M3Z A;  4NCA A;  1X9M A;  4Z4G A;  5FRO A;  4CJ3 A;  3ZT3 A;  2R7Y A;  4K8Z A;  4CGG A;  3SUO A;  1NK8 A;  2QKK A;  3SZ2 A;  3RMB A;  1J53 A;  5CYM A;  2W42 A;  3OYK A;  3OYB A;  4DTP A;  2HHX A;  4ELT A;  3CFO A;  1ASU A;  2JLE A;  3CFP A;  4F2S A;  4M3Y A;  4DTX A;  4PUO A;  4PA1 A;  1NOZ A;  4FJX A;  4FJM A;  1JL2 A;  2E6M A;  4LSN A;  2NUB A;  4FVM A;  4CJV A;  1C0T A;  3MED A;  4ID1 A;  3LAM A;  2YKN A;  1SL2 A;  4KHY A;  4FJ8 A;  4LD0 A;  3LZI A;  4CF8 A;  2XY5 A;  2XY6 A;  4KPY A;  1R0A A;  3RMA A;  3SJJ A;  4F3O A;  3VQ5 A;  4DWI A;  3QLH A;  1RTI A;  1REV A;  3LP0 A;  1BL3 A;  2Z1I A;  3CQ8 A;  1D9D A;  1SKS A;  1NK0 A;  3SQ1 A;  4DQQ A;  4B9T A;  1RDA A;  2FBY A;  1U45 A;  1IH7 A;  3MXJ A;  1J54 A;  1QHT A;  4CJL A;  4CFA A;  2XRI A;  3KK2 A;  4MQ3 A;  4M45 A;  4IBN A;  4E3S A;  3NF9 A;  1WN7 A;  3ISN C;  4B8A B;  3OY9 A;  3OYF A;  4ELU A;  4NYF A;  4DU3 A;  2OA8 A;  4HUF A;  3EYZ A;  3AA2 A;  3SQ2 A;  3LZJ A;  1BGX T;  4GMJ B;  5C24 A;  3T1A A;  4DQR A;  4WE1 A;  1DTQ A;  1KLM A;  4M3R A;  2YNI A;  2PZS A;  4AHV A;  1NK9 A;  1HNV A;  4DSK A;  3QEX A;  2KW4 A;  5T7B A;  2YKM A;  1WSJ A;  4DTN A;  2OPR A;  1IKW A;  3SYZ A;  4IFV A;  1RT6 A;  2KTQ A;  4RW4 A;  3KLE A;  4CF1 A;  1ZYQ A;  3AO3 A;  1QTM A;  5EU7 A;  2ETJ A;  4E1N A;  1RT4 A;  1JLQ A;  4MFB A;  4NCB A;  4KI4 A;  4NCG A;  2F8T A;  1BCM A;  4Z4H A;  1S1U A;  3AVN A;  5C42 A;  3NH2 A;  1BQM A;  4DF4 A;  2QK9 A;  3RMC A;  4FK2 A;  5J1E A;  4UQG A;  3RMD A;  1YT3 A;  1XHZ A;  4AHS A;  3TI0 A;  2Z1G A;  1L3U A;  3O3F A;  2DFF A;  2X74 A;  5HRN A;  5CYQ A;  4E7L A;  2D5R A;  1FXX A;  4H4M A;  4DTO A;  1GOC A;  5HLF A;  1YTU A;  1U47 A;  1XHX A;  2KQ2 A;  2I5J A;  3ZT1 A;  5FDL A;  4LSL A;  4I9L A;  4EZ9 A;  4KHQ A;  1ITG A;  1F21 A;  3OYI A;  5KGX A;  4I9Q A;  1S1X A;  3FFI A;  4DLG A;  4F2R A;  4FM0 A;  2DY4 A;  2A1S A;  3O3G A;  3JSM A;  3VQ8 A;  4DQP A;  1L3S A;  1RT7 A;  3PUF A;  3QEI A;  4EZ6 A;  3A2F A;  2PYL A;  1BIS A;  1VK0 A;  4O55 A;  5J2Q A;  3V4I A;  4ZTF A;  3KIO A;  2OYQ A;  4B3O A;  5C25 A;  4DTS A;  3L3V A;  4DMN A;  4HUG A;  3TAB A;  4KAZ A;  4DQI A;  1EXQ A;  3OYH A;  2Y1J A;  4CGJ A;  2Z1H A;  2GBZ A;  1NK5 A;  2OZM A;  5E41 A;  3OYE A;  4DTU A;  3TAF A;  3HVT A;  3QIN A;  2PY5 A;  1BI4 B;  4QOZ B;  1LW0 A;  4N41 A;  2ZQB A;  4Y1C A;  4C8M A;  1X9S A;  4CF9 A;  2X78 A;  2BGG A;  1FK9 A;  4DSI A;  3TR8 A;  3LAK A;  3HM9 A;  5D3G A;  1ZBH A;  3VQD A;  4AHC A;  4RW7 A;  3MEE A;  1RIL A;  3NH0 A;  2VG7 A;  3K2P A;  4OPJ A;  4KKO A;  1LWE A;  4H4O A;  3ZCM A;  2XHB A;  4FM2 A;  3ZSQ A;  4FM1 A;  4FLU A;  3QER A;  3QES A;  3S3O A;  3DM2 A;  5I3U A;  4KFB A;  1ASW A;  1KTQ A;  2IS3 A;  5CZ1 A;  1B9F A;  2PYJ A;  4BWJ A;  4DFJ A;  3RR7 A;  3QEV A;  2VG5 A;  3VQB A;  1CXU A;  3DLE A;  4DTR A;  1KFD A;  3KLG A;  3SI6 A;  2OZS A;  1GOA A;  4F3T A;  2IDO A;  2BE2 A;  4CE9 A;  1C1B A;  3CG7 A;  1Y97 A;  4OKJ A;  1WAF A;  1NJW A;  1U49 A;  1RT5 A;  4FYD A;  2G8W A;  1RNH A;  2X6S A;  3NF8 A;  2FBT A;  2LSN A;  3PX6 A;  4Z4C A;  5CZ2 A;  1TVR A;  2X6N A;  3VQ9 A;  2HHT A;  4CIG A;  1K6Y A;  1ZBU A;  3ZSY A;  5KRS A;  4QAG A;  4BE1 A;  1Q9Y A;  4QCL A;  3TAN A;  4AIL C;  3MEC A;  3OYJ A;  4R5P A;  2Q3S A;  4OPK A;  4DU1 A;  5I42 A;  1SL0 A;  4CGF A;  1NJX A;  4CFB A;  1SKR A;  3TWH A;  4B9V A;  4IG0 A;  3ZSW A;  3KKS A;  1EET A;  2FBV A;  3T19 A;  3NDK A;  1WAJ A;  4KHN A;  4PY5 A;  1YTA A;  1HQE A;  4PQU A;  4W5N A;  3V9X A;  1LWF A;  2RN2 A;  4M41 A;  3DLR A;  1WSG A;  3KLI A;  3HVR A;  1VRU A;  4K8X A;  4FLY A;  1HYS A;  3F9K A;  4FJN A;  4CHY A;  1A5W A;  4CJW A;  3QNO A;  4CK3 A;  4B9M A;  1JXE A;  4O4G A;  2G8K A;  2HND A;  3M8P A;  4XIU A;  2ZE2 A;  1WSF A;  3KJV A;  4Z4E A;  1N6Q A;  3MAQ A;  5KGW A;  1EP4 A;  3DYA A;  5SWM A;  3AO2 A;  1BCO A;  4CEZ A;  2YNG A;  1XWL A;  3AO5 A;  1KVC A;  4CHN A;  3QNN A;  3S3M A;  1HYV A;  5KRT A;  4CEC A;  1UAX A;  2YHA A;  3HPH A;  4OKK A;  4CIE A;  4H8K A;  3AA3 A;  3HST B;  4DF8 A;  5HRO A;  2HHU A;  1RBS A;  3HP6 A;  3ZSO A;  3B6P A;  4OGC A;  3VN5 A;  1HPZ A;  1MU2 A;  3THV A;  4CES A;  3WNG A;  4N76 A;  2JGU A;  4OJR A;  4Y1D A;  1NK6 A;  4CJ5 A;  4G1Q A;  4I2P A;  3NH1 A;  1S9G A;  1JLE A;  1ZBF A;  3M8R A;  4FLZ A;  1L5U A;  4KTZ A;  3NF7 A;  1QQC A;  3VQE A;  4RW8 A;  4Z0U A;  4OKE A;  3ITH A;  4DQS A;  1QSS A;  2DTU A;  1UA1 A;  4AHR A;  3OYM A;  2OPQ A;  3P83 D;  3AVH A;  1S9E A;  4FJJ A;  4J2D A;  3KTQ A;  2O4G A;  5HRR A;  5J2P A;  1HJR A;  1ASV A;  3AVJ A;  5FRN A;  1RDD A;  3SQ4 A;  3OS1 A;  3NF6 A;  3IS9 A;  1RCH A;  1TV6 A;  4HHT A;  3V9Z A;  1RBT A;  4ICL A;  4FLT A;  4FLV A;  3OJS A;  2FC0 A;  1U48 A;  1Q9X A;  4J2B A;  3VQP A;  1U04 A;  4FLW A;  4CCH A;  3ZT2 A;  3M8S A;  1VSM A;  2GUI A;  4O0J A;  4E0D A;  3DMJ A;  3V9W A;  3L2W A;  4CJK A;  3OYN A;  3P5J A;  4CJR A;  4FZY A;  3NFA A;  1KVB A;  4LH4 A;  4O5B A;  1IKY A;  3EZ5 A;  3NE6 A;  4JRQ A;  4DFK A;  1JLC A;  3HL8 A;  2IAJ A;  4LH5 A;  1BIZ A;  3HYF A;  4CED A;  4E7I A;  4CFC A;  3S9H A;  2P5G A;  3ZSV A;  1HQU A;  4E7J A;  1IO2 A;  3V6D A;  2A1R A;  1CLQ A;  4F4K A;  1WNS A;  3I0S A;  2G8I A;  3LPU A;  2F96 A;  1VSI A;  2D0B A;  1CZB A;  3QIO A;  4JRP A;  3V1O A;  4M3U A;  3DRR A;  1DTT A;  4M42 A;  4FJL A;  4CK2 A;  4CEE A;  1C1C A;  1S1W A;  3LP2 A;  4DFM A;  4I7F A;  4CHP A;  1JLA A;  1X9W A;  4FJH A;  5FRM A;  4E1M A;  4CJQ A;  4HCC A;  1XI1 A;  4B9L A;  2YNF A;  5J2N A;  2DFH A;  3HXM A;  4FXD A;  1C6V A;  1LV5 A;  4I2Q A;  4CJT A;  2YNH A;  4OGE A;  4GVM A;  4HUE A;  1A5V A;  3DLG A;  1ZBI A;  1JLB A;  3RRG A;  4CHQ A;  3M8Q A;  1RBU A;  2D0A A;  2FBX A;  4DG1 A;  5KTQ A;  2QXF A;  1TK0 A;  1RTD A;  1QSL A;  2P5O A;  1YVU A;  3L3U A;  2IC3 A;  3VQQ A;  2P51 A;  4DS5 A;  1XC9 A;  3HT3 A;  3RRH A;  3SV3 A;  1SL1 A;  3KLF A;  3OYD A;  2WOM A;  1C1A A;  4CK1 A;  1QE1 A;  3L2U A;  1BI4 A;  1RT2 A;  3O4Q A;  3DOK A;  3JYT A;  3NGY A;  2AJQ A;  4FK0 A;  5JS2 A;  2HHV A;  3LWM A;  1JKH A;  3NAE A;  4N47 A;  5CY4 A;  3ZSZ A;  4CIF A;  3U3Y A;  4C8L A;  1S5J A;  3AVF A;  3C94 A;  3EY1 A;  3CFR A;  1NKC A;  4FZX C;  3AVA A;  4Z4F A;  2HW3 A;  4CGH A;  4RW6 A;  3PY8 A;  1I3A A;  1FKP A;  4NYN A;  1NJZ A;  1QS4 A;  4FJI A;  1S6Q A;  3KK1 A;  4F8R A;  3K5L A;  3NBP A;  4O0I A;  3TAM A;  1S1V A;  1FKO A;  1RT3 A;  2YV0 X;  3OS0 A;  3SUP A;  1RT1 A;  3K5N A;  1NK7 A;  4FJG A;  4YFU A;  3SCX A;  4FK4 A;  4BDP A;  1VSH A;  1Z25 A;  3T3F A;  3VQ4 A;  2HHS A;  4CER A;  3QIP A;  1JL1 A;  3AVI A;  3SPZ A;  2Y1I A;  4IDK A;  3SPY A;  3D0P A;  4EP4 A;  4B9S A;  4CGD A;  3O4N A;  1S6P A;  4ZHR A;  3KLH A;  4KHW A;  3PV8 A;  1TKX A;  1LAV A;  3LPT A;  3F73 A;  1KVA A;  3SNN A;  1CZ9 A;  4J2A A;  1BQN A;  4LY7 A;  4CF0 A;  4JS4 A;  3VA3 A;  3L8B A;  1W9H A;  4DSL A;  1C0U A;  1WLJ A;  4AH9 A;  2WON A;  2D0C A;  2DFE A;  2ITG A;  4N56 A;  1UA0 A;  3WNF A;  2G8V A;  1NOY A;  1RDB A;  2KZZ A;  2HVH A;  3ALY A;  4DU4 A;  4DTM A;  4DFP A;  3ZSX A;  2HHW A;  1D9F A;  3NHG A;  2BAN A;  3SQ0 A;  1BIU A;  3IG1 A;  3LP3 A;  1L3T A;  4FZZ A;  1X1P A;  1UOC A;  2IOC A;  4BWM A;  3LP1 A;  4CJE A;  3PO4 A;  3PX0 A;  4HVJ A;  3IRX A;  3PO5 A;  4CEB A;  5HRS A;  4CJU A;  5K14 A;  2OPP A;  3QEP A;  4E19 A;  3I8D A;  3AO1 A;  4CJP A;  5JS1 A;  1IKX A;  1J9A A;  1SV5 A;  2B4J A;  3LAL A;  3C95 A;  2VG6 A;  4IFY A;  3CM5 A;  1NJY A;  3E01 A;  4HTU A;  3G10 A;  3NGZ A;  3VA0 A;  3NCI A;  4E7K A;  4YNQ A;  3HK2 A;  4KB1 A;  4B08 A;  1VSK A;  4B9U A;  3PX4 A;  3ULD A;  4BDY A;  3RR8 A;  1JLF A;  4CF2 A;  1VSJ A;  3V81 A;  3H08 A;  4CJS A;  3DRS A;  3ZT0 A;  3K59 A;  3TAP A;  3OVN A;  1S1T A;  3LWL A;  4W5O A;  1JXB A;  3AA4 A;  4FW2 A;  2BDP A;  4FW1 A;  4OLA A;  2B6A A;  2RPI A;  4FLX A;  3SUQ A;  3DLB A;  3DOL A;  4CEQ A;  3VQ7 A;  3S3N A;  4CGI A;  3IAY A;  3OYL A;  3BGR A;  4AHT A;  4B9N A;  3KD1 E;  4KV8 A;  5KI6 A;  1Q8I A;  3CYM A;  3QET A;  1T03 A;  3U6F A;  3LAN A;  5SZT A;  3RTV A;  4AHU A;  1WSI A;  3QO9 A;  3MXM A;  1RTH A;  2P1J A;  3U3G A;  3HPO A;  4CEA A;  3NGI A;  4Q5V A;  1TAU A;  1KFS A;  4EP5 A;  4JLH A;  1B9D A;  2EX3 A;  4CJF A;  4ZTJ A;  3VQ6 A;  3DLH A;  3OYA A;  4M3X A;  3DI6 A;  1N5Y A;  4CEF A;  4N5S A;  3K57 A;  3K58 A;  3V1R A;  3TAQ A;  3HJF A;  3MEG A;  4C8K A;  2RKI A;  1KLN A;  1T05 A;  1KRP A;  2G8U A;  2XY8 A;  1TK5 A;  2HVI A;  2RF2 A;  3ZT4 A;  4FJK A;  2E4L A;  4TSX A;  3OYG A;  4Z4I A;  5HP1 A;  3QEW A;  3MXI A;  4W5Q A;  2HMI A;  3TAR A;  3V1Q A;  4CHO A;  4E89 A;  3P1G A;  1EKE A;  4BAC A;  5J2M A;  5DK5 A;  3LDS A;  2IGI A;  3WNH A;  3AVM A;  1T8E A;  2QKB A;  4KO0 A;  4CEO A;  1KCF A;  4BE2 A;  1TL3 A;  4CHZ A;  1KSP A;  4IG3 A;  2KFN A;  4OVL A;  3AVK A;  4E7H A;  4DSE A;  3ASM A;  1TGO A;  1I39 A;  1A5X A;  1EX4 A;  3AA5 X;  3HPG A;  4ID5 A;  1NKE A;  4KHU A;  3AO4 A;  1U4B A;  3C6T A;  3RWU A;  4RG8 A;  1C0M A;  2GV9 A;  3HP9 A;  3SV4 A;  2HNY A;  3CM6 A;  4CFD A;  1DLO A;  3DLK A;  3UIQ A;  1ZBL A;  4KI6 A;  1WSE A;  2B5J A;  2HHQ A;  3AV9 A;  3G0Z A;  4O44 A;  4KRE A;  1TK8 A;  1TAQ A;  3AVG A;  4Q0B A;  1TL1 A;  3L2V A;  1LW2 A;  1O1W A;  4DSJ A;  1HMV A;  3V9S A;  2ATQ A;  1WSH A;  3AVB A;  4DLE A;  1TKD A;  2G8H A;  2YHB A;  4FCY A;  1JLG A;  1IG9 A;  1T7P A;  4JS5 A;  3KD5 E;  1D5A A;  4L8R B;  3VQA A;  4KRF A;  1HRH A;  3SUN A;  1IKV A;  4OLB A;  3OJU A;  3DRP A;  1D8Y A;  3I0R A;  4C8O A;  1VSD A;  4FJ9 A;  2F8S A;  1VSF A;  5HRP A;  3HO1 A;  2VWK A;  4DTJ A;  4J2E A;  3TAG A;  2E6L A;  3TAE A;  2KZM A;  2G8F A;  3V9U A;  4KB0 A;  1TKZ A;  1RDC A;  1NK4 A;  2O4I A;  3WNE A;  2EHG A;  3K5O A;  2Z1J A;  2ZD1 A;  5HBM A;  1L3V A;  1QSY A;  1RTJ A;  3L2Q A;  3ZSR A;  4W5T A;  4IKF A;  4DS4 A;  1J5O A;  3B6O A;  4KTW A;  2KFZ A;  3KK3 A;  4CJ4 A;  3L2R A;  1VRT A;  5DMR A;  1GOB A;  2HNZ A;  4RW9 A;  3VQC A;  1RBV A;  2VWJ A;  4W5R A;  1RBR A;  4BDZ A;  2XY7 A;  1VSE A;  4ELV A;  1VSL A;  4BE0 A;  1B92 A;  3AVC A;  4B8C A;  3OYC A;  4PWD A;  2OPS A;  1LWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...