2KW7A

Solution nmr structure of the n-terminal domain of protein pg_0361 from p.gingivalis, northeast structural genomics consortium target pgr37a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFETGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the N-terminal domain of protein PG_0361 from P.gingivalis, Northeast Structural Genomics Consortium Target Target PgR37A
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
molecule keywords Conserved domain protein
total genus 49
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kw7A00
2LT2A 3PW9A 4OA3A 5ANPA 2KW7A 2KPTA 2MPBA 3PVHA 3PTJA
chains in the Genus database with same CATH superfamily
4JUUA 2ENXA 1GQZA 2KW7A 5HA4A 1BWZA 3EDNA 4JBDA 4J9WA 1T6KA 5IWEA 2QB7A 4J9XA 2IW4A 1WPMA 3PW9A 3DEVA 3FVEA 1W62A 3EKMA 3W5WA 3G7KA 1K23A 4OA3A 4K7GB 2MPBA 1XUBA 2OTNA 2LT2A 2EB0A 4LG3A 1U1XA 4JCIA 4RPAA 4LS9A 2GKEA 3ICJA 2Q9JA 2Q9HA 2PW0A 4JD7A 4GL6A 3WQZA 5H2YA 1S7JA 2KPTA 1WPPA 3PVHA 2ZXOA 1TM0A 2AZPA 4IJZA 3IGHX 2H9FA 1SDJA 2ZVFA 1U1WA 3PTJA 5H2GA 1U1VA 1K20A 5M47A 4Q2HA 3G98A 2QB8A 2YMAA 2PVZA 2ZXRA 2HAWA 1I74A 1U0KA 4K7XA 1W61A 5ANPA 4IK0A 1XUAA 4PY9A 4K8LA 1QY9A 3EJXA 4DUNA 4LB0A 2ZXPA 1QYAA 2QB6A 2GKJA 4Q60A 1YM5A 1IR6A
chains in the Genus database with same CATH topology
4JUUA 2ENXA 1GQZA 2KW7A 5HA4A 1BWZA 3EDNA 4JBDA 4J9WA 1T6KA 5IWEA 2QB7A 4J9XA 2IW4A 1WPMA 3PW9A 3DEVA 3FVEA 1W62A 3EKMA 3W5WA 3G7KA 1K23A 4OA3A 4K7GB 2MPBA 1XUBA 2OTNA 2LT2A 2EB0A 4LG3A 1U1XA 4JCIA 4RPAA 4LS9A 2GKEA 3ICJA 2Q9JA 2Q9HA 2PW0A 4JD7A 4GL6A 3WQZA 5H2YA 1S7JA 2KPTA 1WPPA 3PVHA 2ZXOA 1TM0A 2AZPA 4IJZA 3IGHX 2H9FA 1SDJA 2ZVFA 1U1WA 3PTJA 5H2GA 1U1VA 1K20A 5M47A 4Q2HA 3G98A 2QB8A 2YMAA 2PVZA 2ZXRA 2HAWA 1I74A 1U0KA 4K7XA 1W61A 5ANPA 4IK0A 1XUAA 4PY9A 4K8LA 1QY9A 3EJXA 4DUNA 4LB0A 2ZXPA 1QYAA 2QB6A 2GKJA 4Q60A 1YM5A 1IR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT2 A;  3PW9 A;  4OA3 A;  5ANP A;  2KW7 A;  2KPT A;  2MPB A;  3PVH A;  3PTJ A; 
#chains in the Genus database with same CATH topology
 4JUU A;  2ENX A;  1GQZ A;  2KW7 A;  5HA4 A;  1BWZ A;  3EDN A;  4JBD A;  4J9W A;  1T6K A;  5IWE A;  2QB7 A;  4J9X A;  2IW4 A;  1WPM A;  3PW9 A;  3DEV A;  3FVE A;  1W62 A;  3EKM A;  3W5W A;  3G7K A;  1K23 A;  4OA3 A;  4K7G B;  2MPB A;  1XUB A;  2OTN A;  2LT2 A;  2EB0 A;  4LG3 A;  1U1X A;  4JCI A;  4RPA A;  4LS9 A;  2GKE A;  3ICJ A;  2Q9J A;  2Q9H A;  2PW0 A;  4JD7 A;  4GL6 A;  3WQZ A;  5H2Y A;  1S7J A;  2KPT A;  1WPP A;  3PVH A;  2ZXO A;  1TM0 A;  2AZP A;  4IJZ A;  3IGH X;  2H9F A;  1SDJ A;  2ZVF A;  1U1W A;  3PTJ A;  5H2G A;  1U1V A;  1K20 A;  5M47 A;  4Q2H A;  3G98 A;  2QB8 A;  2YMA A;  2PVZ A;  2ZXR A;  2HAW A;  1I74 A;  1U0K A;  4K7X A;  1W61 A;  5ANP A;  4IK0 A;  1XUA A;  4PY9 A;  4K8L A;  1QY9 A;  3EJX A;  4DUN A;  4LB0 A;  2ZXP A;  1QYA A;  2QB6 A;  2GKJ A;  4Q60 A;  1YM5 A;  1IR6 A; 
#chains in the Genus database with same CATH homology
 4JUU A;  2ENX A;  1GQZ A;  2KW7 A;  5HA4 A;  1BWZ A;  3EDN A;  4JBD A;  4J9W A;  1T6K A;  5IWE A;  2QB7 A;  4J9X A;  2IW4 A;  1WPM A;  3PW9 A;  3DEV A;  3FVE A;  1W62 A;  3EKM A;  3W5W A;  3G7K A;  1K23 A;  4OA3 A;  4K7G B;  2MPB A;  1XUB A;  2OTN A;  2LT2 A;  2EB0 A;  4LG3 A;  1U1X A;  4JCI A;  4RPA A;  4LS9 A;  2GKE A;  3ICJ A;  2Q9J A;  2Q9H A;  2PW0 A;  4JD7 A;  4GL6 A;  3WQZ A;  5H2Y A;  1S7J A;  2KPT A;  1WPP A;  3PVH A;  2ZXO A;  1TM0 A;  2AZP A;  4IJZ A;  3IGH X;  2H9F A;  1SDJ A;  2ZVF A;  1U1W A;  3PTJ A;  5H2G A;  1U1V A;  1K20 A;  5M47 A;  4Q2H A;  3G98 A;  2QB8 A;  2YMA A;  2PVZ A;  2ZXR A;  2HAW A;  1I74 A;  1U0K A;  4K7X A;  1W61 A;  5ANP A;  4IK0 A;  1XUA A;  4PY9 A;  4K8L A;  1QY9 A;  3EJX A;  4DUN A;  4LB0 A;  2ZXP A;  1QYA A;  2QB6 A;  2GKJ A;  4Q60 A;  1YM5 A;  1IR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...