2KW7A

Solution nmr structure of the n-terminal domain of protein pg_0361 from p.gingivalis, northeast structural genomics consortium target pgr37a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
b'MRVYKPEDVPNVQLADSTRLVTDEAGLLSNAQEEVMNGRLRAIRSSHAVEFAVVTLPSIGDAPLEDFTLKLARQWGVGNEKNNNGLLLVLVLDQRRVRFETGYGLEGYLPDGLLSRIIHDRMIPHFRSGNYAEGLSEGVLAVQQVLDGSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved domain protein
publication title Solution NMR Structure of the N-terminal domain of protein PG_0361 from P.gingivalis, Northeast Structural Genomics Consortium Target Target PgR37A
rcsb
source organism Porphyromonas gingivalis
molecule tags Structural genomics, unknown function
total genus 49
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04536 TPM_phosphatase TPM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.310.50 Alpha Beta Roll Diaminopimelate Epimerase; Chain A, domain 1 Diaminopimelate Epimerase; Chain A, domain 1 2kw7A00
5ANPA 2KW7A 3PVHA 4OA3A 2MPBA 2KPTA 3PTJA 3PW9A 2LT2A
chains in the Genus database with same CATH superfamily
1YM5A 4K7GB 1XUBA 3EDNA 1GQZA 2PW0A 4IK0A 2QB6A 2AZPA 5H2YA 2KPTA 3IGHX 1W61A 4K8LA 3G7KA 2LT2A 4J9WA 2QB7A 4LB0A 4RPAA 2PVZA 2ZXPA 1TM0A 1W62A 4LS9A 1K23A 4GL6A 2YMAA 4OA3A 1I74A 3W5WA 2ZVFA 5ANPA 5M47A 1T6KA 4JD7A 4PY9A 4LG3A 1S7JA 3WQZA 3FVEA 1SDJA 2GKEA 2KW7A 1U0KA 4IJZA 4J9XA 1WPPA 5HA4A 2HAWA 2Q9JA 4JUUA 1QY9A 1U1XA 2QB8A 4Q60A 2GKJA 2EB0A 2MPBA 5IWEA 4DUNA 4JBDA 2ENXA 1QYAA 1IR6A 2OTNA 1BWZA 3G98A 3PTJA 3EJXA 4Q2HA 4JCIA 3DEVA 3PVHA 5H2GA 1XUAA 3EKMA 2IW4A 2ZXOA 1WPMA 1U1WA 1K20A 3PW9A 1U1VA 2ZXRA 4K7XA 3ICJA 2Q9HA 2H9FA
chains in the Genus database with same CATH topology
1YM5A 4K7GB 1XUBA 3EDNA 1GQZA 2PW0A 4IK0A 2QB6A 2AZPA 5H2YA 2KPTA 3IGHX 1W61A 4K8LA 3G7KA 2LT2A 4J9WA 2QB7A 4LB0A 4RPAA 2PVZA 2ZXPA 1TM0A 1W62A 4LS9A 1K23A 4GL6A 2YMAA 4OA3A 1I74A 3W5WA 2ZVFA 5ANPA 5M47A 1T6KA 4JD7A 4PY9A 4LG3A 1S7JA 3WQZA 3FVEA 1SDJA 2GKEA 2KW7A 1U0KA 4IJZA 4J9XA 1WPPA 5HA4A 2HAWA 2Q9JA 4JUUA 1QY9A 1U1XA 2QB8A 4Q60A 2GKJA 2EB0A 2MPBA 5IWEA 4DUNA 4JBDA 2ENXA 1QYAA 1IR6A 2OTNA 1BWZA 3G98A 3PTJA 3EJXA 4Q2HA 4JCIA 3DEVA 3PVHA 5H2GA 1XUAA 3EKMA 2IW4A 2ZXOA 1WPMA 1U1WA 1K20A 3PW9A 1U1VA 2ZXRA 4K7XA 3ICJA 2Q9HA 2H9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANP A;  2KW7 A;  3PVH A;  4OA3 A;  2MPB A;  2KPT A;  3PTJ A;  3PW9 A;  2LT2 A; 
#chains in the Genus database with same CATH topology
 1YM5 A;  4K7G B;  1XUB A;  3EDN A;  1GQZ A;  2PW0 A;  4IK0 A;  2QB6 A;  2AZP A;  5H2Y A;  2KPT A;  3IGH X;  1W61 A;  4K8L A;  3G7K A;  2LT2 A;  4J9W A;  2QB7 A;  4LB0 A;  4RPA A;  2PVZ A;  2ZXP A;  1TM0 A;  1W62 A;  4LS9 A;  1K23 A;  4GL6 A;  2YMA A;  4OA3 A;  1I74 A;  3W5W A;  2ZVF A;  5ANP A;  5M47 A;  1T6K A;  4JD7 A;  4PY9 A;  4LG3 A;  1S7J A;  3WQZ A;  3FVE A;  1SDJ A;  2GKE A;  2KW7 A;  1U0K A;  4IJZ A;  4J9X A;  1WPP A;  5HA4 A;  2HAW A;  2Q9J A;  4JUU A;  1QY9 A;  1U1X A;  2QB8 A;  4Q60 A;  2GKJ A;  2EB0 A;  2MPB A;  5IWE A;  4DUN A;  4JBD A;  2ENX A;  1QYA A;  1IR6 A;  2OTN A;  1BWZ A;  3G98 A;  3PTJ A;  3EJX A;  4Q2H A;  4JCI A;  3DEV A;  3PVH A;  5H2G A;  1XUA A;  3EKM A;  2IW4 A;  2ZXO A;  1WPM A;  1U1W A;  1K20 A;  3PW9 A;  1U1V A;  2ZXR A;  4K7X A;  3ICJ A;  2Q9H A;  2H9F A; 
#chains in the Genus database with same CATH homology
 1YM5 A;  4K7G B;  1XUB A;  3EDN A;  1GQZ A;  2PW0 A;  4IK0 A;  2QB6 A;  2AZP A;  5H2Y A;  2KPT A;  3IGH X;  1W61 A;  4K8L A;  3G7K A;  2LT2 A;  4J9W A;  2QB7 A;  4LB0 A;  4RPA A;  2PVZ A;  2ZXP A;  1TM0 A;  1W62 A;  4LS9 A;  1K23 A;  4GL6 A;  2YMA A;  4OA3 A;  1I74 A;  3W5W A;  2ZVF A;  5ANP A;  5M47 A;  1T6K A;  4JD7 A;  4PY9 A;  4LG3 A;  1S7J A;  3WQZ A;  3FVE A;  1SDJ A;  2GKE A;  2KW7 A;  1U0K A;  4IJZ A;  4J9X A;  1WPP A;  5HA4 A;  2HAW A;  2Q9J A;  4JUU A;  1QY9 A;  1U1X A;  2QB8 A;  4Q60 A;  2GKJ A;  2EB0 A;  2MPB A;  5IWE A;  4DUN A;  4JBD A;  2ENX A;  1QYA A;  1IR6 A;  2OTN A;  1BWZ A;  3G98 A;  3PTJ A;  3EJX A;  4Q2H A;  4JCI A;  3DEV A;  3PVH A;  5H2G A;  1XUA A;  3EKM A;  2IW4 A;  2ZXO A;  1WPM A;  1U1W A;  1K20 A;  3PW9 A;  1U1V A;  2ZXR A;  4K7X A;  3ICJ A;  2Q9H A;  2H9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...