2KWAA

1h, 13c and 15n backbone and side chain resonance assignments of the n-terminal domain of the histidine kinase inhibitor kipi from bacillus subtilis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
GSMTVRYQIEQLGDSAMMIRFGEEINEQVNGIVHAAAAYIEEQPFPGFIECIPAFTSLTVFYDMYEVYKHLPQGISSPFESVKRDVEERLAEIAEDYEVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinase A inhibitor
publication title A Novel Structure of an Antikinase and its Inhibitor
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase inhibitor
total genus 27
structure length 101
sequence length 101
ec nomenclature ec 3.5.2.9: 5-oxoprolinase (ATP-hydrolyzing).
pdb deposition date 2010-03-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 2kwaA00
1WQFA 1WQHA 1F9NA 1ZVUA 1B4BA 4KAWX 3OEPA 2Y3PA 1AB4A 1BGWA 3OREA 4KDDA 3L4KA 3FHZA 1WQGA 3VA7A 3LAJA 4GFQA 2XCOA 3NUHA 1IS1A 2PHCB 2ZFZA 4KC6A 2XCRB 2P5MA 2XCQA 1GE9A 5JVOA 3MMLB 1B4AA 4KB4A 4G0VA 4KB2A 3LAPA 5CJ9A 4FM9A 3QX3A 4G0UA 3FOFA 4J3NA 3BUEA 1EK8A 1WIHA 1DD5A 3V4GA 2RGRA 1XXCA 3OPFA 1ISEA 3ERED 1XXAA 3L4JA 1EH1A 1XXBA 4DDQA 3LPXA 3FOEA 4G0WA 2KWAA 3CAGA 1BJTA
chains in the Genus database with same CATH superfamily
1WCMC 5E68A 3OREA 3HOXK 3GTOC 4OINA 3HOUC 3GEIA 4OIPA 4BLBA 3PO3C 4A3CK 3JSTA 3S15K 3I4NK 4QJVB 3GSIA 4YFNA 4KC6A 1J98A 4C2MC 2JA6A 4P5AA 1HI9A 4WJ3M 5IOQA 3GTKC 1XXCA 1DCOA 2NVQC 3LPXA 3A8KA 5IYDC 1USOA 4YFXA 3WODA 3GTMK 3S2HC 3AD7C 5TMCA 4A3FC 4GFQA 3S1MK 3GEEA 3H0GA 1ZBSA 4BY1K 3S14K 2YU9C 4OIQA 3EQLA 4X6AC 4KB2A 4GTLA 4ILDA 2V6TA 3LAPA 5IP7C 4G0UA 3FOFA 2B63C 1DCPA 5IYCC 3T00A 1WIHA 4MEXA 4BKWA 3OPFA 3G4AA 1Y1VK 4A3DC 1WCMK 2A69A 2JA5C 3GTOK 3HOUK 1IBAA 4QIWL 1G51A 2P8TA 4GTBA 3PO3K 2Y0SL 5IOSA 1TWCA 2GAGC 3K7AC 2A6EA 5L46A 2XCOA 4O2DA 2NVYC 4C2MK 4P5BA 3PO2C 2E2JC 3BP3A 2CFAB 5JVOA 4GTEA 1C0AA 1TWHC 4QIWD 3GTKK 2ZUFA 2Y0SD 4XCHA 2D6FC 2NVQK 1DD5A 4C3JC 4KATA 1SFOC 1ZYRA 4A93C 1XZQB 4A3LK 1O25A 5IYDK 1XXBA 3GTLK 3FOEA 2O5IA 1WQFA 1TWFC 3FKIC 2GSUA 1F93A 4A3FK 4Y52K 1XZPA 4KMHA 1PJ7A 4YG2A 4LQYA 2YU9K 2BE5A 4X6AK 1PJ5A 5IP7K 5CHPA 3GTMA 1O27A 2B63K 1VH2A 5IYCK 3N3YA 3GTPK 2O5JA 1O24A 4A3DK 1XPPA 1O28A 2JA5K 1F7UA 3TFJA 3L4KA 3OEPA 3K7AK 2NVYK 1Y1VA 3PO2K 4A3BC 3GTGC 1WCMA 1R9TK 3GTOA 1TWHK 2XCRB 1GE9A 4AH6A 4A3MC 3MMLB 1BS2A 2W7VA 1YX2A 5TJ3A 4C3JK 1SFOK 2R92C 4A93K 4J3NA 4KN7A 1EK8A 4C3HC 4KARA 1VJEA 1L0WA 4A3EC 5C3EC 4LOWA 3S1QC 1ISEA 2FQOA 4LK1A 2E2IC 3AH5A 3S17C 3FKIK 5C44K 1TWCK 5C4XC 1TWAC 3GTKA 2CW0A 4XLNA 1K83C 1WORA 2R7ZC 2Y3PA 1ZQ1C 4P9SA 5JFEA 3LAJA 4A3JC 1SMYA 3GTLA 1IW7A 1O26A 3S16C 1JOEA 1I50C 4KB4A 4MEYA 4A3KC 2YU9A 1TWGC 4G7ZA 3GIRA 2B63A 4G0WA 2A68A 2KWAA 5IOTA 3GTPA 3GTJC 1UV7A 1YNNA 5TMFA 5C4JC 4LLGA 3S1NC 4A3BK 3GTGK 1Y1WC 1JVIA 3A8JA 2JA5A 3AQPA 1I6VA 4A3MK 3RZOC 1O2AA 2GAHC 2R92K 1J6VA 4YFKA 4KM8A 4C3HK 2NVYA 4A3EK 5C3EK 3S1QK 2E2IK 1R9TA 3S17K 4KASA 5C4XK 2PPBA 1TWHA 4GZYA 1K83K 5IYBC 1RU0A 1SFOA 4A3JK 4KN4A 3A8IA 5M3MK 2E2HC 3FKIA 1I50K 1X31C 3GTQC 4XSZA 4A3KK 1TWGK 3H3VL 4BXXC 1EQRA 1EFWA 2RGRA 4KM9A 1EH1A 5C4JK 3S1NK 1YNJA 1Y1WK 3S2HK 4GTFA 1B4BA 3H3VD 2JA8C 3HOZC 4GTDA 3RZOK 1J6XA 3AD8C 4C3IC 2VUMC 2V6SA 3I4MC 2GSOA 3GTGA 4FM9A 1IE0A 2NVTC 4A3GC 4PAAA 3M4OC 4BBSC 5IYBK 2A6HA 4QJVA 3L4JA 2R92A 4KMUA 3HXAA 1F9NA 3GDZA 4KAWX 2E2IA 2E2HK 1BGWA 5M5XK 3GTQK 1K83A 2E2JK 3GEHA 1WOSA 3CQZC 2XCQA 4BXXK 4GTCA 3IPJA 3M3YC 3S2DC 5D4DA 1I50A 2NVXC 1I6HC 4Y7NC 2FQTA 4Q4ZA 1I3QC 4M1XA 3N0CA 2JA7C 1TWFK 1TWGA 2JA8K 3HOZK 2WAQL 2JH3A 4C3IK 2R93C 3SZYA 2VUMK 5FLMC 1VGXA 3HOVC 3I4MK 3NUHA 5EGEA 1Y1WA 4G7OA 2WB1L 2NVTK 4A3GK 2WAQD 3M4OK 3SZZA 1BDFA 1XZPB 1XXAA 4G7HA 3RZDC 2CFAA 4RMFA 2WB1D 1WOPA 1O29A 5M3FK 1ZVUA 4KMAA 4WILA 1XZQA 3CQZK 1ZXOA 3VA7A 3Q3QA 1IS1A 4LJZA 3S1RC 2P5MA 3M3YK 4BBRC 3S2DK 3DXJA 2E2HA 1KQ4A 4GT9A 2NVXK 1I6HK 1EI6A 4Y7NK 3GTQA 2PA8L 1I3QK 4KMDA 2JA7K 5M5YK 3ERED 3T01A 5IP9C 1TWAK 4A3LC 2R7ZK 3CAGA 4JK1A 3GTLC 2R93K 1WQHA 5FLMK 4KDDA 3HOVK 1JQWA 2PA8D 3FHZA 2JA6C 1WSRA 4Y52C 3S16K 1TWFA 3S0XA 2ZFZA 1WSVA 1B4AA 2VUMA 3GTPC 4XLPA 3RZDK 1IQ0A 2ZUEA 1VLOA 3GTJK 4DDQA 1BJTA 2PMZL 4BY7C 3N0BA 3H0GC 4FZBA 1IL2A 4MQ9A 3S1RK 4BBRK 4AYBL 2V6UA 5IORA 1R9TC 4XSXA 2EBBA 3HOWC 4GTAA 2PMZD 1VRQC 4A3IC 1O2BA 2RH6A 3QX3A 3AQOA 5HL8A 3BUEA 3CQZA 1USMA 5IP9K 1DCHA 4PABA 4AYBD 1J6WA 3HOYC 1V5VA 5M5WK 5C44C 1TWCC 3ADAC 4OIOA 2NVXA 3TTGA 1AB4A 3G4CA 1I3QA 2JA6K 2JA7A 4C45A 4LR2A 3HOXC 5EGHA 1TWAA 2R7ZA 2R93A 4A3CC 3S15C 3I4NC 4ZH4A 5FJ8K 1INNA 1PJ6A 3TFHA 2GSNA 1YCLA 4BY7K 3H0GK 4BLAA 1WOOA 3TFIA 3V4GA 3GTMC 1WQGA 3GTJA 3HOWK 3HKZL 2PHCB 4A3IK 1HQMA 3S1MC 4G0VA 1O2FB 4LK0A 5CJ9A 4BY1C 4Q5SA 3BP8C 3S14C 4BBSK 4NOIA 4WJ4A 3AD9C 3HOYK 4OIRA 1F7VA 3HKZD 3T02A 1Y1VC
chains in the Genus database with same CATH topology
1WQHA 1B4BA 3L4KA 3OEPA 3OREA 4KDDA 4GTDA 3FHZA 1Y1VA 4BLBA 1WCMA 4C3IC 1TWFA 3S0XA 3GTOA 2ZFZA 4KC6A 2XCRB 1GE9A 2GSOA 3MMLB 3GTGA 1B4AA 4C2MC 2JA6A 4P5AA 4FM9A 5TJ3A 2VUMA 4J3NA 1EK8A 4C3HC 4KARA 5IOQA 1XXCA 1ISEA 3L4JA 2R92A 3AH5A 4DDQA 3LPXA 3GTKA 1BJTA 1F9NA 3N0BA 4KAWX 2Y3PA 2E2IA 1BGWA 4FZBA 5JFEA 3LAJA 1K83A 4GFQA 3GTLA 3H0GA 1ZBSA 5IORA 1O26A 2XCQA 4GTAA 4KB4A 4GTCA 4KB2A 4GTLA 4ILDA 3LAPA 1O2BA 2RH6A 3QX3A 3AQOA 4G0UA 3FOFA 3BUEA 3CQZA 2YU9A 1I50A 1WIHA 4BKWA 3OPFA 3G4AA 2B63A 4M1XA 3N0CA 4G0WA 2KWAA 1TWGA 5IOTA 3GTPA 2NVXA 1AB4A 3G4CA 4GTBA 1I3QA 2JH3A 2JA7A 5IOSA 2JA5A 3AQPA 1TWCA 4LR2A 5EGHA 1TWAA 2XCOA 3NUHA 5EGEA 2R7ZA 4P5BA 1Y1WA 1O2AA 2R93A 2CFAB 5JVOA 4GTEA 4KM8A 2NVYA 1R9TA 1DD5A 4KASA 4KATA 4C3JC 1TWHA 2GSNA 1O25A 1XXAA 1XXBA 2CFAA 3FOEA 4BLAA 1SFOA 1WQFA 1O29A 2GSUA 3V4GA 1ZVUA 4KMAA 4KMHA 1WQGA 1ZXOA 4LQYA 3VA7A 3FKIA 3GTJA 3Q3QA 1IS1A 2PHCB 2P5MA 5CHPA 3GTMA 1O27A 2E2HA 4G0VA 1KQ4A 5CJ9A 3N3YA 4GT9A 3GTQA 1O24A 2RGRA 4KMDA 1O28A 4KM9A 3ERED 1EH1A 3CAGA 4GTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WQF A;  1WQH A;  1F9N A;  1ZVU A;  1B4B A;  4KAW X;  3OEP A;  2Y3P A;  1AB4 A;  1BGW A;  3ORE A;  4KDD A;  3L4K A;  3FHZ A;  1WQG A;  3VA7 A;  3LAJ A;  4GFQ A;  2XCO A;  3NUH A;  1IS1 A;  2PHC B;  2ZFZ A;  4KC6 A;  2XCR B;  2P5M A;  2XCQ A;  1GE9 A;  5JVO A;  3MML B;  1B4A A;  4KB4 A;  4G0V A;  4KB2 A;  3LAP A;  5CJ9 A;  4FM9 A;  3QX3 A;  4G0U A;  3FOF A;  4J3N A;  3BUE A;  1EK8 A;  1WIH A;  1DD5 A;  3V4G A;  2RGR A;  1XXC A;  3OPF A;  1ISE A;  3ERE D;  1XXA A;  3L4J A;  1EH1 A;  1XXB A;  4DDQ A;  3LPX A;  3FOE A;  4G0W A;  2KWA A;  3CAG A;  1BJT A; 
#chains in the Genus database with same CATH topology
 1WCM C;  5E68 A;  3ORE A;  3HOX K;  3GTO C;  4OIN A;  3HOU C;  3GEI A;  4OIP A;  4BLB A;  3PO3 C;  4A3C K;  3JST A;  3S15 K;  3I4N K;  4QJV B;  3GSI A;  4YFN A;  4KC6 A;  1J98 A;  4C2M C;  2JA6 A;  4P5A A;  1HI9 A;  4WJ3 M;  5IOQ A;  3GTK C;  1XXC A;  1DCO A;  2NVQ C;  3LPX A;  3A8K A;  5IYD C;  1USO A;  4YFX A;  3WOD A;  3GTM K;  3S2H C;  3AD7 C;  5TMC A;  4A3F C;  4GFQ A;  3S1M K;  3GEE A;  3H0G A;  1ZBS A;  4BY1 K;  3S14 K;  2YU9 C;  4OIQ A;  3EQL A;  4X6A C;  4KB2 A;  4GTL A;  4ILD A;  2V6T A;  3LAP A;  5IP7 C;  4G0U A;  3FOF A;  2B63 C;  1DCP A;  5IYC C;  3T00 A;  1WIH A;  4MEX A;  4BKW A;  3OPF A;  3G4A A;  1Y1V K;  4A3D C;  1WCM K;  2A69 A;  2JA5 C;  3GTO K;  3HOU K;  1IBA A;  4QIW L;  1G51 A;  2P8T A;  4GTB A;  3PO3 K;  2Y0S L;  5IOS A;  1TWC A;  2GAG C;  3K7A C;  2A6E A;  5L46 A;  2XCO A;  4O2D A;  2NVY C;  4C2M K;  4P5B A;  3PO2 C;  2E2J C;  3BP3 A;  2CFA B;  5JVO A;  4GTE A;  1C0A A;  1TWH C;  4QIW D;  3GTK K;  2ZUF A;  2Y0S D;  4XCH A;  2D6F C;  2NVQ K;  1DD5 A;  4C3J C;  4KAT A;  1SFO C;  1ZYR A;  4A93 C;  1XZQ B;  4A3L K;  1O25 A;  5IYD K;  1XXB A;  3GTL K;  3FOE A;  2O5I A;  1WQF A;  1TWF C;  3FKI C;  2GSU A;  1F93 A;  4A3F K;  4Y52 K;  1XZP A;  4KMH A;  1PJ7 A;  4YG2 A;  4LQY A;  2YU9 K;  2BE5 A;  4X6A K;  1PJ5 A;  5IP7 K;  5CHP A;  3GTM A;  1O27 A;  2B63 K;  1VH2 A;  5IYC K;  3N3Y A;  3GTP K;  2O5J A;  1O24 A;  4A3D K;  1XPP A;  1O28 A;  2JA5 K;  1F7U A;  3TFJ A;  3L4K A;  3OEP A;  3K7A K;  2NVY K;  1Y1V A;  3PO2 K;  4A3B C;  3GTG C;  1WCM A;  1R9T K;  3GTO A;  1TWH K;  2XCR B;  1GE9 A;  4AH6 A;  4A3M C;  3MML B;  1BS2 A;  2W7V A;  1YX2 A;  5TJ3 A;  4C3J K;  1SFO K;  2R92 C;  4A93 K;  4J3N A;  4KN7 A;  1EK8 A;  4C3H C;  4KAR A;  1VJE A;  1L0W A;  4A3E C;  5C3E C;  4LOW A;  3S1Q C;  1ISE A;  2FQO A;  4LK1 A;  2E2I C;  3AH5 A;  3S17 C;  3FKI K;  5C44 K;  1TWC K;  5C4X C;  1TWA C;  3GTK A;  2CW0 A;  4XLN A;  1K83 C;  1WOR A;  2R7Z C;  2Y3P A;  1ZQ1 C;  4P9S A;  5JFE A;  3LAJ A;  4A3J C;  1SMY A;  3GTL A;  1IW7 A;  1O26 A;  3S16 C;  1JOE A;  1I50 C;  4KB4 A;  4MEY A;  4A3K C;  2YU9 A;  1TWG C;  4G7Z A;  3GIR A;  2B63 A;  4G0W A;  2A68 A;  2KWA A;  5IOT A;  3GTP A;  3GTJ C;  1UV7 A;  1YNN A;  5TMF A;  5C4J C;  4LLG A;  3S1N C;  4A3B K;  3GTG K;  1Y1W C;  1JVI A;  3A8J A;  2JA5 A;  3AQP A;  1I6V A;  4A3M K;  3RZO C;  1O2A A;  2GAH C;  2R92 K;  1J6V A;  4YFK A;  4KM8 A;  4C3H K;  2NVY A;  4A3E K;  5C3E K;  3S1Q K;  2E2I K;  1R9T A;  3S17 K;  4KAS A;  5C4X K;  2PPB A;  1TWH A;  4GZY A;  1K83 K;  5IYB C;  1RU0 A;  1SFO A;  4A3J K;  4KN4 A;  3A8I A;  5M3M K;  2E2H C;  3FKI A;  1I50 K;  1X31 C;  3GTQ C;  4XSZ A;  4A3K K;  1TWG K;  3H3V L;  4BXX C;  1EQR A;  1EFW A;  2RGR A;  4KM9 A;  1EH1 A;  5C4J K;  3S1N K;  1YNJ A;  1Y1W K;  3S2H K;  4GTF A;  1B4B A;  3H3V D;  2JA8 C;  3HOZ C;  4GTD A;  3RZO K;  1J6X A;  3AD8 C;  4C3I C;  2VUM C;  2V6S A;  3I4M C;  2GSO A;  3GTG A;  4FM9 A;  1IE0 A;  2NVT C;  4A3G C;  4PAA A;  3M4O C;  4BBS C;  5IYB K;  2A6H A;  4QJV A;  3L4J A;  2R92 A;  4KMU A;  3HXA A;  1F9N A;  3GDZ A;  4KAW X;  2E2I A;  2E2H K;  1BGW A;  5M5X K;  3GTQ K;  1K83 A;  2E2J K;  3GEH A;  1WOS A;  3CQZ C;  2XCQ A;  4BXX K;  4GTC A;  3IPJ A;  3M3Y C;  3S2D C;  5D4D A;  1I50 A;  2NVX C;  1I6H C;  4Y7N C;  2FQT A;  4Q4Z A;  1I3Q C;  4M1X A;  3N0C A;  2JA7 C;  1TWF K;  1TWG A;  2JA8 K;  3HOZ K;  2WAQ L;  2JH3 A;  4C3I K;  2R93 C;  3SZY A;  2VUM K;  5FLM C;  1VGX A;  3HOV C;  3I4M K;  3NUH A;  5EGE A;  1Y1W A;  4G7O A;  2WB1 L;  2NVT K;  4A3G K;  2WAQ D;  3M4O K;  3SZZ A;  1BDF A;  1XZP B;  1XXA A;  4G7H A;  3RZD C;  2CFA A;  4RMF A;  2WB1 D;  1WOP A;  1O29 A;  5M3F K;  1ZVU A;  4KMA A;  4WIL A;  1XZQ A;  3CQZ K;  1ZXO A;  3VA7 A;  3Q3Q A;  1IS1 A;  4LJZ A;  3S1R C;  2P5M A;  3M3Y K;  4BBR C;  3S2D K;  3DXJ A;  2E2H A;  1KQ4 A;  4GT9 A;  2NVX K;  1I6H K;  1EI6 A;  4Y7N K;  3GTQ A;  2PA8 L;  1I3Q K;  4KMD A;  2JA7 K;  5M5Y K;  3ERE D;  3T01 A;  5IP9 C;  1TWA K;  4A3L C;  2R7Z K;  3CAG A;  4JK1 A;  3GTL C;  2R93 K;  1WQH A;  5FLM K;  4KDD A;  3HOV K;  1JQW A;  2PA8 D;  3FHZ A;  2JA6 C;  1WSR A;  4Y52 C;  3S16 K;  1TWF A;  3S0X A;  2ZFZ A;  1WSV A;  1B4A A;  2VUM A;  3GTP C;  4XLP A;  3RZD K;  1IQ0 A;  2ZUE A;  1VLO A;  3GTJ K;  4DDQ A;  1BJT A;  2PMZ L;  4BY7 C;  3N0B A;  3H0G C;  4FZB A;  1IL2 A;  4MQ9 A;  3S1R K;  4BBR K;  4AYB L;  2V6U A;  5IOR A;  1R9T C;  4XSX A;  2EBB A;  3HOW C;  4GTA A;  2PMZ D;  1VRQ C;  4A3I C;  1O2B A;  2RH6 A;  3QX3 A;  3AQO A;  5HL8 A;  3BUE A;  3CQZ A;  1USM A;  5IP9 K;  1DCH A;  4PAB A;  4AYB D;  1J6W A;  3HOY C;  1V5V A;  5M5W K;  5C44 C;  1TWC C;  3ADA C;  4OIO A;  2NVX A;  3TTG A;  1AB4 A;  3G4C A;  1I3Q A;  2JA6 K;  2JA7 A;  4C45 A;  4LR2 A;  3HOX C;  5EGH A;  1TWA A;  2R7Z A;  2R93 A;  4A3C C;  3S15 C;  3I4N C;  4ZH4 A;  5FJ8 K;  1INN A;  1PJ6 A;  3TFH A;  2GSN A;  1YCL A;  4BY7 K;  3H0G K;  4BLA A;  1WOO A;  3TFI A;  3V4G A;  3GTM C;  1WQG A;  3GTJ A;  3HOW K;  3HKZ L;  2PHC B;  4A3I K;  1HQM A;  3S1M C;  4G0V A;  1O2F B;  4LK0 A;  5CJ9 A;  4BY1 C;  4Q5S A;  3BP8 C;  3S14 C;  4BBS K;  4NOI A;  4WJ4 A;  3AD9 C;  3HOY K;  4OIR A;  1F7V A;  3HKZ D;  3T02 A;  1Y1V C; 
#chains in the Genus database with same CATH homology
 1WQH A;  1B4B A;  3L4K A;  3OEP A;  3ORE A;  4KDD A;  4GTD A;  3FHZ A;  1Y1V A;  4BLB A;  1WCM A;  4C3I C;  1TWF A;  3S0X A;  3GTO A;  2ZFZ A;  4KC6 A;  2XCR B;  1GE9 A;  2GSO A;  3MML B;  3GTG A;  1B4A A;  4C2M C;  2JA6 A;  4P5A A;  4FM9 A;  5TJ3 A;  2VUM A;  4J3N A;  1EK8 A;  4C3H C;  4KAR A;  5IOQ A;  1XXC A;  1ISE A;  3L4J A;  2R92 A;  3AH5 A;  4DDQ A;  3LPX A;  3GTK A;  1BJT A;  1F9N A;  3N0B A;  4KAW X;  2Y3P A;  2E2I A;  1BGW A;  4FZB A;  5JFE A;  3LAJ A;  1K83 A;  4GFQ A;  3GTL A;  3H0G A;  1ZBS A;  5IOR A;  1O26 A;  2XCQ A;  4GTA A;  4KB4 A;  4GTC A;  4KB2 A;  4GTL A;  4ILD A;  3LAP A;  1O2B A;  2RH6 A;  3QX3 A;  3AQO A;  4G0U A;  3FOF A;  3BUE A;  3CQZ A;  2YU9 A;  1I50 A;  1WIH A;  4BKW A;  3OPF A;  3G4A A;  2B63 A;  4M1X A;  3N0C A;  4G0W A;  2KWA A;  1TWG A;  5IOT A;  3GTP A;  2NVX A;  1AB4 A;  3G4C A;  4GTB A;  1I3Q A;  2JH3 A;  2JA7 A;  5IOS A;  2JA5 A;  3AQP A;  1TWC A;  4LR2 A;  5EGH A;  1TWA A;  2XCO A;  3NUH A;  5EGE A;  2R7Z A;  4P5B A;  1Y1W A;  1O2A A;  2R93 A;  2CFA B;  5JVO A;  4GTE A;  4KM8 A;  2NVY A;  1R9T A;  1DD5 A;  4KAS A;  4KAT A;  4C3J C;  1TWH A;  2GSN A;  1O25 A;  1XXA A;  1XXB A;  2CFA A;  3FOE A;  4BLA A;  1SFO A;  1WQF A;  1O29 A;  2GSU A;  3V4G A;  1ZVU A;  4KMA A;  4KMH A;  1WQG A;  1ZXO A;  4LQY A;  3VA7 A;  3FKI A;  3GTJ A;  3Q3Q A;  1IS1 A;  2PHC B;  2P5M A;  5CHP A;  3GTM A;  1O27 A;  2E2H A;  4G0V A;  1KQ4 A;  5CJ9 A;  3N3Y A;  4GT9 A;  3GTQ A;  1O24 A;  2RGR A;  4KMD A;  1O28 A;  4KM9 A;  3ERE D;  1EH1 A;  3CAG A;  4GTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...