2KWFA

The structure of e-protein activation domain 1 bound to the kix domain of cbp/p300 elucidates leukemia induction by e2a-pbx1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
GVRKGWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRRSRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CREB-binding protein
publication title The structure of E-protein activation domain 1 bound to the KIX domain of CBP/p300 elucidates leukemia induction by E2A-PBX1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 25
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2010-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02172 KIX KIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.20 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Coactivator CBP, KIX domain 2kwfA00
2LQIA 2K0NA 2KWFA 2LQHA 2LXTA 4I9OA 2GUTA 2LXSA 1SB0A 2AGHB 4D7XA 1KDXA
chains in the Genus database with same CATH superfamily
3FWCC 1BJ5A 2LOQA 3B9MA 1H5WA 3MHSB 4FJCB 4G03A 1E7IA 1UORA 3GA9L 2BXGA 1JNBA 5B5TA 3LU6A 3M99C 2AGHB 4LB9A 1KDXA 2BXEA 3B9LA 2E0YA 4OR0A 3UIVA 4S1YA 4W4UB 2BX8A 4BKEA 1MA9A 2QHBA 1LOTA 2GUTA 4F5TA 2DYOA 5IIHA 4TQ0A 5FUOA 2AJEA 4NAWB 5ID9A 4LUFA 4N0FD 4C31B 1TXUA 2BXFA 2BXDA 4LB2A 3SIVB 4ZCGA 4OT2A 4L9QA 4DM0A 2BXOA 4OTUA 2VUEA 1E7EA 3BPJA 3FWBC 1HK1A 1MIVA 2BXHA 3FNMA 3GQUA 3JRYA 2K0NA 2XSIA 4PO0A 4GDXA 2BXKA 2BXCA 3LU7A 4MBEC 3G9KD 3W1SA 3V08A 4J2VA 4D7XA 1BKEA 1N5UA 4GG2A 5IJEA 1E7GA 2LXSA 4G01A 1GNIA 4L9KA 5IIUA 1J78A 3KIKA 3MHHB 1HK3A 2BXNA 2QMCA 4ZC6A 1BM0A 2XMOA 2DG5A 4ZBRA 2I30A 2BXLA 4N3ZA 2BXBA 5GHKA 1IJGA 3KJLA 5IJFA 4TQ1A 5D7GA 2CKXA 1MIWA 2E0XA 2I2ZA 2ROHA 4OTTA 3TDLA 2OT3A 4G04A 4GDKB 4K2CA 4I9OA 3VQIA 3NMUA 2VUFA 1HK5A 2OZBB 1SB0A 2LQIA 4E99A 4IW1A 5IFOA 1MUHA 4JK4A 5ID7A 1NT2B 4FIPB 2KWFA 2EFEA 2EFHA 1E7CA 3SQJA 1MIYA 3ICXA 1LNSA 1H9ZA 1HK2A 2VDBA 1AO6A 3A75A 1VZSA 2JUHA 5IJ5A 1E78A 1E7BA 1HA2A 5DQFA 1VFIA 5GIOA 4F5SA 4EMXA 4DHXB 2DBWA 2XVUA 3H3AA 3CX9A 3V09A 3V03A 4FK5B 2DBUA 2BXPA 4Z9OA 3GQXA 2DBXA 4Z69A 1KW2A 2XVVA 1KXPD 3PLAA 4LA0A 2NNWA 3WHRA 2XVQA 2Z8IA 3H37A 1GNJA 3NVMA 4GDLB 3SIUB 3A73A 4F5UA 2V36A 2XW1A 1HK4A 4N0UD 1FOUA 4K71A 4HGMB 4HGKA 5BPKA 1E7FA 1E7HA 2LXTA 3LU8A 5GINA 5HOZA 3WHSA 3ECPA 3NVKA 1J7EA 1MM8A 3JQZA 5DBYA 2BXIA 2LQHA 4LUHA 3NVIA 2BXMA 1E7AA 2DYMA 2KBZA 4IW2A 4M70B 2Z8KA 1MUSA 2BXAA 1TF0A 2QM6A 2YDFA 2EFDA 2XVWA 4F5VA 4BY9C 2BXQA 4WA6B 2NQOA 2EFCA 5IIXA 4L8UA 4ZBQA 5GIPA 4ZUXV 1O9XA 2XW0A 2Z8JA 4ZBKA 3WHQA
chains in the Genus database with same CATH topology
2LQIA 2K0NA 2KWFA 2LQHA 2LXTA 4I9OA 2GUTA 2LXSA 1SB0A 2AGHB 4D7XA 1KDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQI A;  2K0N A;  2KWF A;  2LQH A;  2LXT A;  4I9O A;  2GUT A;  2LXS A;  1SB0 A;  2AGH B;  4D7X A;  1KDX A; 
#chains in the Genus database with same CATH topology
 3FWC C;  1BJ5 A;  2LOQ A;  3B9M A;  1H5W A;  3MHS B;  4FJC B;  4G03 A;  1E7I A;  1UOR A;  3GA9 L;  2BXG A;  1JNB A;  5B5T A;  3LU6 A;  3M99 C;  2AGH B;  4LB9 A;  1KDX A;  2BXE A;  3B9L A;  2E0Y A;  4OR0 A;  3UIV A;  4S1Y A;  4W4U B;  2BX8 A;  4BKE A;  1MA9 A;  2QHB A;  1LOT A;  2GUT A;  4F5T A;  2DYO A;  5IIH A;  4TQ0 A;  5FUO A;  2AJE A;  4NAW B;  5ID9 A;  4LUF A;  4N0F D;  4C31 B;  1TXU A;  2BXF A;  2BXD A;  4LB2 A;  3SIV B;  4ZCG A;  4OT2 A;  4L9Q A;  4DM0 A;  2BXO A;  4OTU A;  2VUE A;  1E7E A;  3BPJ A;  3FWB C;  1HK1 A;  1MIV A;  2BXH A;  3FNM A;  3GQU A;  3JRY A;  2K0N A;  2XSI A;  4PO0 A;  4GDX A;  2BXK A;  2BXC A;  3LU7 A;  4MBE C;  3G9K D;  3W1S A;  3V08 A;  4J2V A;  4D7X A;  1BKE A;  1N5U A;  4GG2 A;  5IJE A;  1E7G A;  2LXS A;  4G01 A;  1GNI A;  4L9K A;  5IIU A;  1J78 A;  3KIK A;  3MHH B;  1HK3 A;  2BXN A;  2QMC A;  4ZC6 A;  1BM0 A;  2XMO A;  2DG5 A;  4ZBR A;  2I30 A;  2BXL A;  4N3Z A;  2BXB A;  5GHK A;  1IJG A;  3KJL A;  5IJF A;  4TQ1 A;  5D7G A;  2CKX A;  1MIW A;  2E0X A;  2I2Z A;  2ROH A;  4OTT A;  3TDL A;  2OT3 A;  4G04 A;  4GDK B;  4K2C A;  4I9O A;  3VQI A;  3NMU A;  2VUF A;  1HK5 A;  2OZB B;  1SB0 A;  2LQI A;  4E99 A;  4IW1 A;  5IFO A;  1MUH A;  4JK4 A;  5ID7 A;  1NT2 B;  4FIP B;  2KWF A;  2EFE A;  2EFH A;  1E7C A;  3SQJ A;  1MIY A;  3ICX A;  1LNS A;  1H9Z A;  1HK2 A;  2VDB A;  1AO6 A;  3A75 A;  1VZS A;  2JUH A;  5IJ5 A;  1E78 A;  1E7B A;  1HA2 A;  5DQF A;  1VFI A;  5GIO A;  4F5S A;  4EMX A;  4DHX B;  2DBW A;  2XVU A;  3H3A A;  3CX9 A;  3V09 A;  3V03 A;  4FK5 B;  2DBU A;  2BXP A;  4Z9O A;  3GQX A;  2DBX A;  4Z69 A;  1KW2 A;  2XVV A;  1KXP D;  3PLA A;  4LA0 A;  2NNW A;  3WHR A;  2XVQ A;  2Z8I A;  3H37 A;  1GNJ A;  3NVM A;  4GDL B;  3SIU B;  3A73 A;  4F5U A;  2V36 A;  2XW1 A;  1HK4 A;  4N0U D;  1FOU A;  4K71 A;  4HGM B;  4HGK A;  5BPK A;  1E7F A;  1E7H A;  2LXT A;  3LU8 A;  5GIN A;  5HOZ A;  3WHS A;  3ECP A;  3NVK A;  1J7E A;  1MM8 A;  3JQZ A;  5DBY A;  2BXI A;  2LQH A;  4LUH A;  3NVI A;  2BXM A;  1E7A A;  2DYM A;  2KBZ A;  4IW2 A;  4M70 B;  2Z8K A;  1MUS A;  2BXA A;  1TF0 A;  2QM6 A;  2YDF A;  2EFD A;  2XVW A;  4F5V A;  4BY9 C;  2BXQ A;  4WA6 B;  2NQO A;  2EFC A;  5IIX A;  4L8U A;  4ZBQ A;  5GIP A;  4ZUX V;  1O9X A;  2XW0 A;  2Z8J A;  4ZBK A;  3WHQ A; 
#chains in the Genus database with same CATH homology
 2LQI A;  2K0N A;  2KWF A;  2LQH A;  2LXT A;  4I9O A;  2GUT A;  2LXS A;  1SB0 A;  2AGH B;  4D7X A;  1KDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...