2KWIA

Ralb-rlip76 (ralbp1) complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
178
structure length
178
Chain Sequence
GQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein, protein binding
molecule keywords Ras-related protein Ral-B
total genus 44
structure length 178
sequence length 178
ec nomenclature
pdb deposition date 2010-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2kwiA00
1Z6TA 2IUTA 2VP6A 1MO5A 2V7QA 3BRWD 4P4SA 4XIGS 4HAUA 2ZAOA 4MYTA 4RFSB 1W5TA 2OESA 4PC1A 3K70C 4Q7JB 3V4RA 5C1BA 3GEIA 5CDFA 4UQOA 1FTNA 2W2VA 3D7MA 4OL0A 4BECA 1XF9A 1TU3A 5CYPA 5KSYA 1KK2A 1OFHA 3EPLA 2O5VA 4Q4LA 4O3MA 2GNOA 5G41A 4P31A 2B8WA 1OIXA 4YDSA 4PR0A 4TL6A 1KI3A 3THWA 4HYYA 4XVQA 4HSEA 1A1VA 3P4YA 5IHPA 2ZU6A 1GG2A 2CNWD 2OAQ1 4PZZA 4ABYA 1KNXA 4TSFD 5JEDA 2QMEA 4KBGA 2V8OA 4YC7A 1W0JA 2J46A 1KIMA 1GM5A 1GNQA 4GMXA 3U3OA 4DIDA 2CHVA 1BYUA 1Y3AA 2JIZD 2W00A 1R2QA 3K0CC 4OHVA 5FOWA 5BYJA 3LX8A 1N6RA 2YINC 1E2JA 3NIBA 2QE7D 4BFZA 5L3SA 4DLZA 3U44B 1IBRA 1TADA 1Z22A 5FTKA 4QKQA 2QP9X 1E1RA 5A4JA 5EZ6B 2HF8A 4JSTA 3B60A 5DGXA 4RSGA 4PQFA 1KJWA 3M4YA 1G3UA 4LJ7A 5FUVA 3K0AA 3GD7A 1TEXA 4UKDA 4KSBA 3PEUA 2P5TB 1G7RA 3K0EA 3GEHA 3NHAA 1B23P 4TL7A 1TPZA 4YMSA 5JI3E 1S9DA 1Z28A 3BH0A 3BK7A 3ECCA 3HU3A 3GLHB 1QHXA 2ZVQX 4NYJR 4Q1DA 2G83A 1XCGB 4IVRA 3LV8A 4CEJA 2BBWA 4C0SA 2AXNA 4P4UA 3Q7QA 2CCJA 2G0NA 2XEXA 2ZRMA 4B3BA 4FXPA 4A0FA 3MUFA 4BFXA 3CNNA 4DLRA 4BRUA 3AM1A 1E79A 4WAUA 1JNYA 2WWHA 2R6AA 2PEZA 2QORA 4R2IA 3VHXA 4JIMA 5IDVA 1W2HA 1LF0A 1KZ7B 3DEFA 3WMGA 5CITA 4Q7MB 2FU5C 2IUUA 2OLJA 2IL1A 1W44A 1HQYE 1D2EA 3FTQA 3Q8XB 2NO7A 1ZJ6A 1AS0A 3WP1B 2D2FA 3NWJA 2XSZD 4B32A 5EZ5A 3SJBA 4DKXA 1IONA 1X8LA 1MT0A 4LHZA 4M1TA 5EXXA 2K5UA 4ACBA 2ZI9A 4LOAA 4QBHA 1W4CA 4QL3A 3LH5A 1T8TA 1NJGA 1KK0A 3T61A 4RCZA 1E9EA 4QGAA 1QVRA 5FL7D 1G9XA 1E0SA 1W49A 4YLGA 2VSXA 2OFOA 3B1ZA 3I8SA 5F3WB 3CNLA 2F7SA 3M6AA 2DWPA 2GJ8A 4CVNA 3AB3A 2BJVA 1DAIA 3AP3A 4MYHA 3ADBA 3A1SA 5DYGA 3FVQA 3T12A 1X1SA 6Q21A 4ZDKA 5IK2A 4AYXA 2AN9A 3PUZA 2CL0X 3MLEA 4GOJA 5HZHA 1BKDR 2VP5A 1VG0B 1ANKA 1ZVQA 4F4JA 1KDPA 2H8KA 3CR8A 1RZ3A 2VRWA 3VMFA 5AUPB 3A1VA 3TR0A 4BZQA 2C95A 2OCBA 4D82A 2QA5A 2XZPA 5P21A 3T1TA 2R44A 4GPTA 2V4ZA 1E1QD 5LB4A 4LZZA 2ONKA 1G3QA 3CZQA 1DBSA 1AN0A 3R7WA 1ZD9A 2CMKA 1TQ6A 1AZTA 1N6IA 2A5DA 1G1MA 3ZVNA 1WCV1 3U6BA 3EIQA 1W4BA 3L43A 3O8DA 3THYA 5DNYB 3VFDA 1N6PA 1ZM2A 1KHTA 2FZ4A 1XX6A 4E07A 1VHLA 2AWNA 2BVNA 4NCJA 4DLSA 1OXXK 1DTSA 1GSIA 3DOFA 4OJQA 4LJ4A 2QPOA 4HAYA 4L15A 1D8TA 3KB1A 5SZIA 1U0LA 1AS2A 4YXWD 3LD9A 1TMKA 1OHHD 4GP6A 3BIFA 5J4KA 1KO8A 3NVAA 2HT6A 2GZDA 3QKRA 4G5SA 1OXVA 2BBOA 4YQFA 3PQCA 4G1UC 4HUQB 3W34A 3GJ5A 2X8AA 1W4RA 1XXHA 1JPNA 4A9AA 3U7FB 1W1WA 2F9MA 3DKPA 3CF2A 2KE5A 3BERA 4AYTA 2Q9CA 3QIAA 4LYAA 4LBWA 3EX7C 1SKYE 1MR3F 2G77B 3L0IB 2Q3FA 2KJQA 1DAHA 3BB4A 2LCFA 2ZROA 4URWR 2A78A 3RS2A 4D4KA 3CH4B 3OIUA 3FE2A 1HEIA 4HB3A 1RW4A 3RNLA 1EX6A 2XB2A 2PZFA 5EE0A 2H16A 2AWOA 4KHZA 2GRJA 3TVDA 4GI7A 2D7DA 3Q5EA 2O8FA 2JLWA 2WJYA 4ON9A 3FHCB 3N2EA 4CF7A 1KI6B 1KGDA 3KKNA 5HR5A 4Q1EA 3ICEA 3TQFA 1NG9A 1R6BX 3FWYA 121PA 3K0FA 3E5HA 2REOA 4TLDA 3ZVMA 1E1QA 1VTKA 1ZCBA 3N5CA 1KJYA 3QI2A 3CWZA 3F8TA 4PC7A 1U8YA 5KHOC 3OE7D 4W9MC 4NU0A 1Z06A 2GA8A 4V0LA 1O3YA 4J0QA 2C2HA 2H57A 3DL0A 1OFUX 1OIWA 1ZNXA 2XTMA 4B3XA 1XBTA 3PUWA 3EC1A 1H8HA 3QY0A 3FMOB 1XPOA 3D8BA 1G6OA 2NG1A 4NONA 4IDQA 3K9LA 4BZXA 4P4TA 5TY0A 1IN5A 4F4CA 3OF5A 1X6VA 3RS3A 1SVKA 2ZREA 1WMSA 2X77A 3AQ4A 1FP7A 4P33A 4TWZA 2MMGA 5SZKB 3KUDA 4RD4A 4HDOB 3DPUA 4MGYR 5FOTA 2O8DA 4MUBA 4PAOA 3G82C 3UG7A 3H86A 2IC5A 3FKSA 1JXMA 1OJLA 5JI2E 1U90A 2QT1A 1JJVA 2IS4A 4DT1B 2KI5A 1PZNA 3SQWA 3F0TA 3NKVA 2N42A 5DE3A 4JBWA 5HE8A 4OKSA 1ZD8A 4Q4JA 1G64A 1KNQA 2A2ZA 1XTRA 2DHRA 2WHXA 1OXSC 3LA6A 1SHZA 5TARA 2QBYA 2QTVB 1XD8A 5KTYA 4Q01A 1US8B 1T0JB 1YZUA 3GJ7A 1U2RA 4Q48A 1VCNA 2ZE5A 3GLIA 1Z07A 2JLQA 2OXRA 4MRVA 3I72A 2CNWA 2AR7A 2Z43A 3BB3A 1A5TA 4JL5A 2KBEA 1PLKA 1P3JA 4A6XA 4DCTA 2CDNA 3CO5A 4HZIA 3EZ9A 2JIZA 5CDFE 3GPLA 2Z4RA 2GK7A 1KKMA 4F93B 2HLDA 4X8OA 2IBMA 4ZI3A 3ZS9A 4K8OA 1PVOA 3I1FA 1KK1A 1R8QA 2G1KA 1L7VC 3KFVA 3P1JA 1Q44A 5BN4A 2BCJQ 3TH5A 2O8BB 2ZRAA 4NCHA 1L2TA 1BO6A 3OIWA 5FL3A 2VA8A 4PZLA 1EFRD 3OE7A 4RZ2A 2VP4A 1VPLA 3NC0C 3PG5A 1G4UR 2HYDA 1I2DA 2R65A 4C9BA 2VLIA 1XEWY 1OFIA 4QGGA 2N46A 3W3AA 5JLJA 2Z6VA 1E6CA 4A92A 2VH5R 3QVVA 4URZR 3K70D 4URUR 4AKHA 3RSOA 2X1VA 2IS6A 3DVLA 3T1QA 2O0HA 2V7QD 3A1TA 2EFCB 4EDHA 5E3HA 4TTRA 4AG6A 1DOAA 4LHVA 1E9RA 2F1HA 1G8HA 5H8WA 1G8FA 1S96A 2OO7A 1J8YF 3NEYA 4V03A 3SHFA 3HDTA 4EPWA 3THYB 1KI8A 1KYIA 4M9ZA 4NL4H 1E2EA 3E70C 1I4TD 1II9A 2VSFA 2FF7A 2FOLA 4JKIA 1JAIA 1UKZA 2F3RA 1GAJA 5E7IA 1ZRHA 1QHYA 1W36C 1HE8B 3W9YA 2D2EA 2ODWA 4EPRA 1U99A 3CRVA 3A1UA 3D31A 5DN6D 1G4AE 1P2TA 3GFPA 3LXXA 4TZ0A 1ZC4A 2IWRA 1HURA 3OFND 3CX7A 5CB8A 1E69A 1KKLA 2JLRA 1TX4B 5EXPA 5J4LA 2P0EA 1A2KC 5FUYA 4MUAA 5HKKA 3RS7A 1SVWA 2HEIA 5HE9A 2JASA 2WKPA 3WNDA 4D0GA 1F2TA 2PEYA 4QRHA 2ZI3A 3QKUA 1X8JA 2QTHA 3ZIAA 4FINA 5DLQC 3WYGA 1FX0B 1Z47A 3KL4A 3MG9A 2B92A 4BRWA 1JJ7A 1ZU4A 2WOOA 3EASA 1XNJA 5F2EA 1G5TA 3THWB 4Q02A 2HCBA 1KDRA 1XDBA 3I32A 1TTTA 1SVSA 3GJ0A 4NKRA 3OEHD 1NLZA 4AWXA 1F6BA 4LPSA 4X8LA 5KO2A 1PLLA 4AI6A 2W6IA 4YDHB 1TF2A 1KZGB 4TT3D 5ELXA 4E5UA 5EP1A 1VG1A 2PMKA 3AP2A 1CF4A 3SJCA 3AVYA 2KBFA 3FFAA 4M0LA 4JJKA 2QGNA 3OEEA 2Q0HA 3KQUA 2PMDA 2ZIAA 4C3ZA 4E03A 4RY2A 3VTKA 2VF8A 3FPAA 2D74A 2KB0A 1EFTA 2CJWA 4RD2A 3L0OA 3DDCA 2RAPA 2JEOA 2QE7A 2GESA 2BHRA 1GZSA 1N5JA 5FOVA 3QOFA 4ZKEA 1YZTA 4C0QC 4Q19A 5JJKA 5FOXA 3LAWA 2QQEA 1I2MA 2A7QA 2GCNA 5CJ2A 3U3MA 4NZYA 1WXQA 2DFKB 4RZXA 4Q21A 4GSYA 4PPQA 4CEJB 1P6XA 1J2JA 3SC3A 3X1YA 4LBVA 3EXAA 4RKFA 5AJZA 2ZRKA 4NTZA 1UADA 3WBKA 1XMVA 4QM6A 4MYUA 4NYIR 1Q20A 1E2DA 2CL6X 2ZYUX 2RHDA 3REGA 2IYRA 3KJGA 2V1XA 4HI0E 2FDCA 3RRMA 4LYFA 4CT4B 5L3VA 2E1RA 1OPXA 2CK3A 1FMLA 2A5YB 2QTFA 4LSGA 2E9SA 3RRZA 1SKQA 2FPLA 1IXZA 4H1VA 1MOZA 2LKCA 1KAGA 5C4GB 2IA5A 4LC0A 3DHWC 1S1CA 1NBMD 2IXEA 5EP3A 3V9PA 4C2TA 1XEXA 1XTJA 3IBGA 1NG1A 1DAGA 1ZNYA 4QM7A 3NEJA 1ZBDA 5EUMA 3IEVA 2CCKA 3AVUA 3OEHA 3KX2A 5SZJA 3EC2A 2R8RA 3U5ZB 4HZUA 5G3ZA 3BS4A 4PHFA 1JALA 2ZR9A 3ZDQA 1JEDA 3KKPA 2WSSA 1P9NA 1P5ZB 3KKOA 4A15A 1EG7A 3LNCA 3ZH9B 2O8BA 2GKSA 1CEEA 4IXNA 4A0RA 4GOXA 2AK3A 1WE2A 5LPNA 4M1MA 4US0R 1Z63A 1G7SA 5DIFA 3SZRA 2EYQA 1KY2A 1V43A 3W6PA 3A8TA 1NVVQ 3AVOA 1VCMA 2B7CA 2J7PA 3RRYA 1YR9A 3U7EB 2W83A 2ZS8A 2Z83A 3NBYC 4JL6A 4RZ3A 5AR1A 3CZPA 3QXSA 1QZXA 4CGZA 3UANA 4BFSA 3AVVA 2GVZC 1ZINA 4HLUA 4B34A 2QU8A 3WHKA 4KCGA 3SBEA 1E99A 2C77A 1LNZA 3EA5A 4PC3A 1KK3A 1RYHA 1FP6A 4U00A 3QUSA 4ZDWA 4LHXA 1VDZA 2L0XA 1KSGA 4LYHA 2JJ8A 3LVRE 4DT1A 3OAAA 5GJWC 3H1TA 3L8ZA 1E2NA 1W47A 2FGJA 1DARA 2IXFA 4KU4A 3SE0A 4DXAA 2AD1A 3RWMB 4BEJA 4V0NA 2ZS9A 3UWOA 3WY9A 1AZSC 1UEIA 2XZOA 3RC8A 2ZITA 1R0YA 4DCVA 3BC1A 1Q3TA 1X3SA 2F6RA 4D80A 1F3OA 1W36D 2N1BA 1LS6A 3IBYA 4KI0A 4D2IA 4LI0A 3DKVA 2BMEA 4KFTA 4PPGA 2ATXA 4AD8A 1IQPA 5AJVB 4BLTA 4C0AC 2HDNB 3B13B 2Z5FA 4MKHA 2PCLA 3BAFA 4HLDA 3U3RA 4TLBA 1E2HA 4URXR 4DCSA 1RJ9A 4Q9LA 1UEJA 1HUQA 2BKUA 5HZKA 1B0UA 2B8TA 2CLSA 4LV5B 1E3MA 3RWOA 1NN3A 1QG2A 4QBFA 4DBLC 2CXXA 2HLDD 4GFDA 1YQTA 2IYSA 3U60B 4F91B 2XXAB 4KSCA 1OSNA 3W3ZB 1GIAA 3AVQA 4TQUS 2UVQA 4ZCMA 3U7GA 1TUEA 1OLOA 1CR4A 2BBSA 2WV9A 2NIPA 3C5CA 5JJIA 3TUJC 1FUUA 2C03A 2ZJYA 1PUJA 2W0SA 2BIFA 3DO6A 3QEOA 5FPTA 2C9OA 4AC9A 3I73A 2R9VA 3CR7A 1P73A 1QG4A 4LJ8A 1CBUA 4NDZA 2IWHA 1LS1A 4JZKA 4PPNA 2NOAA 4XJXA 1PJRA 3CUEF 1Z83A 5TMPA 2IK8A 4OI2A 4F38A 3U4QA 4FMBB 3W5JA 4A8JC 4UXIA 3AKCA 3QF7A 2PJZA 3MD0A 3ND8A 4FMDB 5G3YA 2QBYB 2J41A 2YWEA 4RCYA 1J90A 4DDUA 2O8CB 3CBQA 4JVNA 1DS6A 4IDOA 1DO0A 1NN0A 2AD5A 2EW1A 2VHTA 4OK3A 5SZHB 1Y63A 3X1XA 1G17A 2VYFA 1SVLA 4G0NA 4Q4AA 3VX4A 2YC2C 1D2NA 1XP8A 4DUGA 1J99A 5FBLB 4NBSA 5GJVC 2VQSA 1YRAA 2FSGA 2FEMA 1VKJA 1S1MA 5FTJA 1YR7A 2J0VA 1QDEA 4TN1A 4ACAA 2Q6TA 4M53A 3A6PC 1CJKC 3MAAC 1XEFA 3Q9LA 4HAZA 4JLPA 3ZS8A 1YZLA 2JCSA 2SHKA 3NTUA 1UBGA 1EX7A 2RMKA 4A8JA 4S35A 2YOHA 3QF4B 3CRW1 2W2TA 3CM0A 2PLFA 1SXJA 1XWIA 3QXHA 1P72A 1G291 5J4YA 4OQXA 1NBME 2IUSA 2YHSA 2ZJBA 2ZRIA 4ARZA 2D06A 2XTZA 2JJ1A 521PA 2HXYA 4NE2A 4BWYA 1E0AA 3SNHA 4IFBA 3SU8A 3IEUA 1FQJA 1E9DA 1MO4A 4IDNA 2GXSA 1YHNA 4F7WA 2UZIR 5J4HA 1G18A 4KYIB 2WJHA 3QXCA 4GBMA 4Q7KA 4Z8XA 2ZRLA 4LV8B 1SXJE 2WAXA 1ZUNB 3UKDA 3P27A 4EPXA 2WWIA 4LBYA 1GILA 3OEED 2YVUA 2ZRDA 1JPJA 3KJEA 3RSLA 4QOSA 3VR2A 4QJ5A 2ORWA 5EP2A 4XSGA 4B6FA 2RGNA 2VO1A 3AVPA 3WRXC 3FMPB 1OXUA 5BW8A 1MRSA 1KI9A 2H92A 3QPWA 5L8VA 4DLUA 4JLAA 2ERYA 4Q4HB 3CX8A 1ONBA 4C2UA 4MRNA 5FR1A 1ZMXA 2JDIA 2BV3A 2FEOA 4NYIQ 1CP2A 1C9KA 4HAWA 1CRQA 2OG2A 4HLCA 5DN6A 1VECA 3P26A 3U2QA 4TMZA 4MQBA 1DAKA 4LUCA 3LBHA 5B58C 3N70A 3BH7A 4TMKA 3RLFA 1UF9A 2EFHB 3NBXX 1DADA 1NP6A 2DY1A 4QBGB 2WWGA 1QHSA 4OJKA 1GL7A 3LFUA 2J9RA 3PXGA 1TQDA 3AKYA 4M8NE 1OB2A 4A2WA 3NH9A 4JMPA 1F2UA 4L5BA 5L3RA 4D4JA 2F43A 3HU1A 1K8RA 4MDFA 2CLDX 3Q5DA 1S0UA 4IJMA 4RJLA 2IXGA 4A82A 1KJZA 2OILA 2X2FA 4JT4A 5J47A 4IHQA 4PO9A 2WWYA 2G9NA 1WP9A 3JZMA 1E2QA 4S2EA 3H4MA 3LW7A 4A8JB 2IYXA 1EGAA 4RD1A 1JR6A 5IRCD 3AUXA 1ZAKA 3AF4A 3HR8A 5BYKA 3U3KA 4M1SA 4Z51A 3X1DA 2VSOA 3EIEA 621PA 1GKUB 1FL9A 5DO9A 4PZYA 4IVPA 1R7RA 1DAMA 2NPFA 3FYHA 5B30A 4TSFA 2YKGA 4PC6A 1XZPA 3TAHA 2ONJA 1E2IA 4LJ9A 1KO5A 1NMYA 3K1JA 4M2LA 1AGPA 1BMFD 3ZZTA 3B5JA 5KNBA 2IX3A 2QRZA 2PT7A 3AF3A 2HUPA 3TIFA 4NHOA 3KKMA 1G7TA 2UZ3A 4XWOA 5FH9A 3G0HA 3IPXA 3K0FB 4QXAA 1VG9B 3IHLA 5CIQA 4MYCA 1GRNA 1ELOA 1WBDA 4AK9A 3B78A 3UK6A 4QBIA 2QP3A 2PCJA 1BS1A 2ZUCA 3KKQA 4LY6A 3HR7A 2EFDB 1MABA 3C5HA 5K8IA 2IHBA 3HPRA 4HEJA 3AF0A 3CLVA 4Q1FA 5FR2A 3WYFA 1E9FA 4DSTA 2FWRA 1RPZA 2BWJA 4NYJQ 3SR0A 3NH6A 5FBRB 3IQWA 4IRUB 2R6CA 3B9QA 2OCYC 1C1YA 1OIVA 2ASEA 3DMNA 1Q1ZA 2QN6A 1XPRA 5DI3A 4ZO4A 1SHKA 3HJNA 1DE0A 2RGEA 3IO5A 3QG1A 4XTRA 3P4XA 4EIWA 4XD7D 3R20A 5BWMA 2OV2A 4LCBA 221PA 3VNUA 4JVLA 1RIFA 3RABA 5K8TA 1N5IA 2C5LA 4HUQA 4M4SA 4O2LA 4Q00A 3I62A 3LWNA 1KDOA 4FCVA 4YMUA 2ANCA 1YZKA 2RGXA 5EE1A 4CEIA 4IOJA 5E7MA 3M1IA 5CM8B 3ZD6A 3R9WA 1YRBA 4LYJA 4ARZB 1BYIA 3AH8A 2R6DA 421PA 3O8BA 3QF4A 3TLXA 4OI1A 1M2OB 1UKYA 3ETLA 1EFHA 4D0LB 3SEAA 4ZIRA 3JVVA 3BH6A 3C16C 2F55A 3REFA 4II7A 2HYIC 5AUQA 3GP8A 2RKOA 3B1WA 5FI0B 1SXJB 1XEWX 3IIMA 4EPTA 1JQJC 2ZJ2A 2PX0A 5KDDA 1IHUA 1FZQA 4JL8A 4PX9A 4CIDA 1IJFA 4KODA 5KSPA 1MH1A 3C15C 4JLBA 1TL7C 2CE7A 5KUTA 1TQ2A 2Q9AA 1YVDA 2JGNA 1NY6A 1C4OA 4UJ5A 4BASA 2HXSA 4WZ6A 1E9AA 2A30A 2ZRFA 3NDBB 2OM2A 1IXSB 1R0WA 3PEVA 4IOLA 5TV2A 1NVUQ 1WA5A 5IF9A 2ODEA 1ZIOA 2G0TA 4AG5A 2RGDA 4FCTA 3HWSA 3IGFA 4HB0A 4MRRA 4CDGA 4UNRA 2ZYTX 4Q5IA 3C4JA 1P60A 2GVDC 1NIJA 3Q72A 1R5NA 2GCOB 1TU4A 1A2BA 3ADDA 5FBWB 1N5LA 3UMFA 2ZM5A 4BLQA 3FMFA 2PH1A 3K8YA 4QHTA 1N0VC 2XNDD 5TDHA 4KYUA 2OBNA 4XTCS 4K81B 4YMTA 3PENA 2XOKD 4A0HA 3WHLA 1NSTA 1KSJA 2YOGA 3B6EA 1VHTA 1CR1A 4LGMA 1NF3A 2O0JA 2WZQA 2ZPTX 3A4LA 3LLUA 4Z1MA 4M1YA 5EE5B 2QGZA 4DRZA 5JJLA 4G5RA 4HLUC 1ESMA 1XXHB 2P6RA 1S3SA 2OSBA 2F3TA 2YV5A 2GWHA 2QEQA 2ZI5A 2HT1A 1NMXA 1WDTA 2E87A 1XJQA 1FUKA 3VHLB 1RYFA 3TUIC 2VPPA 1KI2A 4M21A 1WRBA 3ZLJA 4US1R 1W46A 3BFKA 1AKEA 1ZIPA 4C0KA 3QG5A 2XB4A 2FNAA 3MJHA 1R10A 5B64A 1LFDB 1HYQA 1AQYA 4DSNA 8OHMA 4KLNA 3RDPA 2IT1A 4PHTA 2IS2A 1GNRA 3MRSA 1XTKA 4R2HA 2VTKA 2VF7A 2OCPA 2VBCA 1YJ5A 4DLYA 2V1UA 3KZ1E 1WQ1R 2ORIA 2GCPA 2WMOB 4PC2A 1OW3B 1N5KA 3K0AB 3AV0B 1T6NA 1NRJB 2EFEB 2QPTA 3SN6A 4ZKDA 4EQ6A 2RGCA 5E7JA 2AFHE 2I3BA 4QNRA 1P2VA 4G5OA 1JXOA 5H70A 1AKYA 2ZJAA 3RS0A 4CYMA 1OFTA 3MWKA 4DJTA 2W6JA 1IN4A 1M7HA 3LXRA 1KI1A 1N25A 1Z0DA 3GLFA 2FN4A 1EWRA 4D81A 1Q1QA 1ZM9A 3ZZ0A 3SJAA 1GTVA 2WICA 5CB6A 2RGGA 2ZYWX 5TVKA 1JI0A 2QNRA 3PIRA 4AYWA 2KSQA 1OH8A 2QSYA 2W0MA 5F98A 2PL3A 3BJIC 2H5EA 2QQ0A 2F1RA 4XVUA 2J7KA 3OHMA 2OZEA 3IHWA 2D7CA 4A36A 1O87A 3RHFA 1TAGA 4MGKR 3VR3A 1W5SA 1SULA 2FFAA 2P3SA 4PXAA 2GAOA 4JLKA 1N6KA 1DAEA 2W58A 3QBTA 2DR3A 2OBMA 3U7HB 3AF1A 3VR4A 3FKSD 4NH0A 1UKEA 4Q1CA 1Z6XA 2WVJA 4KFUA 4C30A 1OYYA 3JVUA 5HPYB 4HAXA 1CS4C 1S9HA 4N1AA 3WRYC 4TZ6A 1IY0A 1XB2A 3BORA 4JLJA 2YJTD 1GWNA 5AJWA 1VCIA 4GRAA 3BE4A 3AVXA 5B57C 3VAAA 3GLIE 2H18A 2ECKA 4RZUA 4URVR 1EFCA 3SQXA 2ZAMA 3CNOA 3NBFA 1UPTA 3DZDA 4L9WA 2EFGA 4UNPA 3H2YA 4LX0A 1OH7A 2YWFA 4I1VA 3SJZA 4NYMR 1Z29A 1U81A 1KI4A 3KXIA 2QT0A 2YYZA 2DYKA 1XPUA 1ZD1A 1KSFX 2R62A 3DMDA 1LVGA 1M8PA 5C46F 4H1UA 3L82B 1A7JA 3RANA 4TMWA 5BN5A 1R4AA 1P62B 3FKQA 2ATVA 1MRNA 1S4QA 1G3IA 2FFQA 2ODNA 3LVQE 4PAQA 4BPBA 2EVWX 5K8LA 1NKSA 4CEHB 1HE1C 2DPXA 3GJ8A 3R9IA 2I1VB 4KITB 2A5GA 5JCZA 1XD9A 4POAA 1NLYA 4LDJA 2CHGA 2CVFA 1TF5A 2FA9A 4P3YA 4NYMQ 4TYWA 1N0WA 1HY3A 2Z4SA 4QHYA 5G53C 1Q1BA 1AGRA 4GZMA 3TSWA 3WBJA 1G5RA 4G5QA 1JAHA 3HU2A 2XITA 1CLUA 4NCKA 3FFBA 4HB2A 4XH9B 1T3SA 3P32A 1E4VA 1E96A 1COWA 3DM5A 1NVXQ 3AGQA 2G3YA 1MO3A 1XFAA 2Q3HA 1MABB 1KO7A 2FX3A 4IFEA 4KLZA 2FFHA 3UWKA 3QPVA 4LHWA 3CPHA 4OI4A 1GDDA 3EZ2A 4DDTA 1GUAA 5J40A 5C4MA 2WKRA 2J0UB 2ZJZA 1G5PA 2IYVA 3LBNA 2JATA 3SHWA 3A4MA 1QHNA 3NDPA 4ZDJA 3L0SA 3B9PA 1VMAA 4O2RA 4LWZA 2DBYA 2A5FA 4Q9JA 5DISB 4A1FA 3U6KA 2IW3A 2XAUA 5KNCA 1E4YA 5CK5A 4LJYA 5KSOA 4OQFA 4R7ZA 3VKWA 5IT5A 1T5LA 2A5JA 4D6PA 4B73A 1AIPA 4JVMA 2ZJOA 2O8DB 4RFSA 1Z8FA 1LW7A 2JDID 3UXMA 2QSZA 4A2PA 2C8VA 2IF2A 5CLQA 2VP2A 3QXXA 3X1ZA 1D6JA 1SVOA 2P65A 4FIDA 1I4LD 4YMVA 1AJEA 2J5XA 4OQNA 4NMMA 3GJ4A 2QRNA 2H1LA 1UJ2A 2NTYC 4QG7A 5CLLA 2ZS7A 3CF6R 4P0TA 3K53A 4B44A 2VHCA 3E1SA 2ZU0C 1U9IC 2GEUA 2IYYA 3W8RA 3ADCA 1KAOA 2DWOA 4KXFB 3EARA 1AK2A 4OQLA 1P2SA 3TQCA 4Q7LA 2WMNB 1QHHA 5DI9A 3ND9A 1G20E 1Z6AA 5L3QB 2F1IA 2Z0MA 3CIOA 2FE4A 4UNNA 2QPAA 3RYTC 1LV7A 2KWIA 3LW8A 2BMJA 4CRWB 3SDZA 2NQ2C 3IILA 5BQ5A 3K9NA 4JBXA 3KUCA 3CB4A 2OXCA 3PITA 4BLRA 1EFUA 1XZQA 4XVRA 5DI3B 5JFGA 2CHQA 1TUIA 1A82A 1II8B 3BD9A 2OLKA 3FGNA 4QFMA 3BBPA 4V0ME 3TE6A 3K09A 3EWSA 1JEEA 1ODFA 4N0EA 2JLUA 1U8AA 5A0FA 1Q21A 1Q1EA 3A36A 5LD2C 4EPVA 1QHIA 4JYBA 5DSZA 3THXA 2F9LA 1NSFA 4LJ6A 1CKEA 4O25A 3IO3A 1JR3E 3D6TB 4DDWA 3L8YA 3CF0A 1UBEA 4LJ5A 2MMCA 4KVAA 5KNDA 2GJ9A 5AUOB 4JLMA 4PQRA 4B3FX 1MO6A 3VU9A 1AM4D 5FBVB 1NL3A 3GLHE 4R9UC 4L9SA 4WBSA 5EQTA 4C0BA 3R8CA 3ZZUA 4B75A 2RH5A 3OIVA 5JS8A 1W2GA 2AKAB 1GVNB 1FNNA 3LX5A 721PA 5JHGB 5J4VA 3V00A 5FPHA 1G6HA 1R0XA 5FOUA 3SI7A 1D5CA 2RCNA 1E1RD 1H65A 3EPJA 1M34E 4NCIA 2ZRCA 4B3GA 1KI6A 3ZVRA 5JWOA 3WYAA 3PCRB 4B6EA 4ZIRB 5JWRA 3MJRA 5LD2B 4MH0R 2EWVA 4PHHA 2NO6A 5FTMA 1FX0A 2B21A 2NGRA 2WWXA 4L16A 4LPKA 4R71A 1Z0JA 3FHOA 3C8UA 5EXSA 1Z2CA 4IVQA 2R6GA 5KDLA 2X19A 1E2KA 1W0JD 3K0CA 2I4IA 3C7KA 4PPFA 3DOEA 4GDFA 3PEYA 4AY2A 3HP1A 3ZIAD 3MFYA 4V0MA 3KQKA 1F60A 1K6MA 2P2LA 2GF0A 2ZI6A 3PUVA 4I4LA 5HCIA 1NI3A 4QC2A 2ZSDA 3O47A 3T5DA 4DVGA 3B85A 2BDTA 1M74A 5L3QA 2FFBA 3CRRA 4PFSA 1N0UA 2D4HA 2ZJ8A 1UM8A 1XU4A 3TJZA 5FOSA 1CRPA 4ILEA 4DCUA 2P5SA 4RKEA 2DFNA 2XTNA 2QUZA 5KPJA 1GL6A 3I5XA 2W6ID 1HH4A 1YE8A 1OH6A 1E79D 2WAYA 5JECA 1IOZA 4DWJA 4A0GA 3QE0A 2NMVA 3IKJA 4FN5A 1G3MA 3TMKA 2W6JD 4PO1A 1OKKA 4CW7A 2XJ9A 1VG8A 4LBZA 2MSEB 5TXGA 3GCGA 4WW0A 5GJCA 2ZVPX 4M1KA 1E2PA 1IJEA 1G16A 2HJVA 2XSZA 5JS7A 1E9BA 5FUXA 1VYUA 3TW8B 3AF2A 1NVVR 1FMJA 1SVIA 2YWGA 1F2UB 4OBEA 5JCPA 4ZV4A 2G1JA 2QAGB 2ZSAA 4F92B 2AL7A 4V0KA 2ZYVX 1W36B 1H8ED 2JAQA 3KJHA 4B43A 3DZ8A 4U02A 1DG3A 3SYLA 1NLFA 2WPDD 3PVSA 3QKTA 4MRSA 4Z8YA 4L4UA 3GFOA 3UIEA 4MKFA 2PJRA 2Q21A 3BXZA 3QKRB 1EESA 2GBLC 3THXB 1TQ4A 4WOPA 5FUWA 4Z54A 5FPSA 1HQCA 4DLVA 5LB2A 2ZE7A 2ZRPA 4F4IA 2CE2X 4L8GA 4TL8A 1GP2A 4DLTA 2V3CC 1G41A 3I61A 4QGHA 4AKIA 2GJAA 4C0JA 1L4YA 2C96A 4FWTA 4GT1A 4RVCA 1RRGA 2A9KA 3CRMA 3C41J 3I8XA 2IYUA 3PEWA 5FBQB 3B2EA 1ZUIA 1P2UA 3NXSA 3TGPA 1HT1E 3EZFA 4I99A 1QRAA 4TTQA 5KDOA 1QHHB 2FGKA 3EG5A 3LDAA 2V9PA 2XX3A 4RD3A 4UXJA 4CEHA 1EXMA 3A37A 4JVSB 3VR1A 4N0DA 1EWQA 2BEJA 2GJSA 2VHQA 4URYR 1CULC 3BFVA 2R6FA 3VKGA 1ZCAA 3AKEA 4BE7B 5CM9C 1OKKD 4DLXA 3MCAA 4Q66C 4Q9KA 2CLCX 3PUYA 2GDJA 1X86B 4XOIA 2JLVA 3EPKA 2CEAA 2ZEJA 4JSYA 4LK2A 4CT5A 3U61B 1IY2A 4JT2A 1IN8A 4FMCF 2J0UA 1ZC3A 1X1RA 1Z0IA 4TL9A 1RKBA 2C9CA 2REBA 1OT3A 4I81A 4EFNA 2DWQA 2IYZA 4GZLA 1LB1B 1VYTA 1Q3HA 3SYKA 4G01B 2F43B 4Y0AA 4BFTA 2DFTA 4XWKA 2NO0A 4EFLA 4G5GA 3O8CA 3FHTA 1RE0A 5LDDC 1VIAA 2HCJB 2HF9A 4WXPA 4QNMA 4BFYA 1E9SA 4JLDA 1KMHB 1YZGA 1OHHA 2OUKA 5B2ZA 1XMJA 2QENA 5JRJA 2JLXA 5FI1B 1IN6A 4M22A 1P9RA 1HV8A 3TNFA 3AUYA 5AWFC 4TYYA 1SGWA 1U94A 1KMHA 3KXLA 3MGCA 1SZPA 4QGFA 2WJJA 4KAXA 3SFVA 4DB2A 4B48A 3F5FA 4QJ3A 2VEDA 1Z0FA 5HCNA 4B71A 3W6NA 4DZZA 2W2XA 1N3BA 2ZQ5A 4OK5A 3ZYCA 3KQLA 2ORVA 3BB1A 1N6NA 3A4NA 4NPHA 5F9FA 1NY5A 1QHGA 3FB4A 4EJSB 5A5GA 1SQ5A 1KO4A 4Q18A 1LF5A 3THOA 2JJ1D 1E0JA 2QROA 2BM1A 3PFIA 2OFWA 3GLFE 4OK6A 2FJUA 1II8A 2IYTA 2MSCB 1XTSA 2BJWA 4MKIA 4PHGA 4C7OB 1ZYUA 2DCUA 2YZ2A 4MGIR 3K70B 1Z5ZA 3LY5A 4JBYA 1W0KA 2C98A 4DEXA 2V55B 4JLNA 3KQHA 2V6IA 4WZBE 2ZJ5A 1DVRA 4E22A 1JR3D 1OE0A 1GRRA 4LRWA 4JLVA 1M7BA 4JYCA 2PZGA 2QMUA 2CCGA 4WA7A 1E0KA 4BFUA 3OIYA 1F48A 2FSIA 4GP7A 2HJGA 2BMFA 2GZAA 1UFQA 1VCOA 1P4SA 2FPKA 1T3HA 5G40A 3Q7PA 4GMDA 4B2IA 2DB3A 5KSZA 3QXJA 1Z6YA 3Q3JB 1CJVC 2WIAA 2IEZA 4ZI2A 1MV5A 4HDQB 2BOVA 4EUNA 1FW6A 3UG6A 3H84A 2GAAA 1T3LA 2XGJA 2OE2A 2QAGC 3IUYA 3KJIA 3SOPA 2C78A 2AKYA 2UKDA 4EFMA 3ADKA 3HYRA 2OAP1 2P6UA 3SS8A 3WP0A 5UKDA 1Z08A 4ESHA 1YZNA 3GEEA 3IDQA 3K9GA 1XD2B 3CW2A 1FOEB 4ERNA 1CJMA 3W5IA 4Q47A 4JJZA 2MSDB 2RGBA 5DHAA 3RS4A 1CIPA 4Q4AB 4B76A 1L4UA 3B1XA 3MWYW 1E9CA 2ZXUA 1CU1A 3N2IA 4UJ3A 4TLCA 3ZQ6A 1XCMA 1ZNZA 4P4SB 4TQ9A 4WXRA 2GTPA 2RHMA 2X2EA 3B8HA 4G3XA 1L8QA 3QKSA 4BLSA 2J3EA 5FFMA 1XD2A 3LRPA 3KFXA 2GF9A 3ZJYA 1R0ZA 2IYLD 4GL2A 3A1WA 2JA1A 3J81k 4B2LA 2WTUA 1MKYA 2ZETA 4TLAA 3BGWA 1F2TB 2PLRA 2WOJA 1E98A 5EJEA 1TEVA 2R2AA 2H17A 5FPKA 2B7BA 1V5WA 2DFLA 1DO2A 3WMFA 4D4MA 2ZRJA 1KO1A 1BMFA 1W0KD 4MRPA 2G6BA 4H9GA 3EA0A 1UAAA 1DPFA 3GLFB 1NVWQ 3IPYA 3B1YA 4MGZR 4BFVA 1N2CE 2GXAA 1CJUC 1KDTA 2QL6A 3OESA 2P67A 3G5UA 3T5GA 2BKEA 2OCAA 2QZ4A 2FSFA 3VX3A 1JR3A 3QPUA 4FWIB 4UNSA 3RVBA 4DSOA 4EQ6B 3VKHA 4R98A 2BMDA 1M1YE 2OEPA 2ZRGA 4C0LA 4A4DA 3R8FA 3TUZC 4B2PA 2ZRBA 2NO1A 1G19A 2FPMA 2B6HA 4PANA 2V6JA 4HDCA 2ZI7A 3L2OB 1FFHA 1BOFA 3AGPA 5JSZA 2GCOA 1YR6A 3B82A 4EJSA 1UBFA 5DH9A 4AURA 3F3YA 4IXMA 3TR5A 1OXTA 1RVDA 4Q03A 1WBBA 4V0OA 2F1JA 4BQSA 4XD7A 2BEKA 5JBQA 5CYOA 4M9QA 2RGNC 3KDSE 4U7DA 1Z0KA 2ZR0A 4CEIB 1E2MA 4TTPA 4CZ2A 3FOZA 1GRQA 3ASZA 5AJXA 2WJIA 2YNMA 3I92A 1G3RA 3MWLA 2CJWB 3T34A 3T35A 2XZLA 3BWDD 2GXQA 2VHUA 1JBKA 1Q12A 3ICQB 3PR1A 2LKDA 3TSOA 2J0QA 1M6NA 1KSHA 1ZM4A 1CR2A 4B47A 1KMQA 4TLEA 5GJBA 2QI9C 5JMTA 2NO9A 1BIFA 1II0A 1R5OA 3EW9A 5E95A 1P75A 4C7OA 4PAMA 4A2QA 1U0HC 3IIKA 3OFNA 1G8YA 4HB4A 3W6OA 1DEKA 4X8HA 4AIIA 5FTLA 1E2LA 3B7GA 3LO5A 5EE9A 4ZCIA 2EQBA 4RFVA 2CVHA 5L3SB 4TMXA 1A4RA 5HKKD 2PZEA 2O8EA 4ZDIA 3T1OA 4JLOA 2GK6A 3A58B 4KO8A 5AK0A 1RRPA 3W8NA 5JHHB 4OQMA 1R5BA 3LQRA 5D3QA 4W5JA 2CBZA 1SXJC 4W5HA 2OFXA 3WXMA 3UMSA 3C14C 5HTKA 4Q4JB 2ZRNA 5EP4A 3X1WA 4HUTA 5GADl 2ZSEA 1CR0A 1XJCA 2IS1A 4TQAA 3MMPA 4D26A 1AQUA 1SVMA 1XRJA 3LLMA 2A3RA 4B33A 2GJKA 3KQNA 3CONA 3AEZA 4EKDA 4ZCLA 2VIIA 1VYVA 4DDVA 3ZVLA 2RB4A 5F9HA 1W7AA 1M7GA 3TKLA 3EWAA 1ZU5A 2O0KA 4HAVA 1KOFA 1AS3A 1NJFA 4OHWA 4DLWA 1QBKC 5CIWA 2WJVA 3ZGXA 4U5XA 2XOKA 2ZSBA 2J0SA 4TT3A 4D25A 1FTSA 2C9YA 2GILA 3CRQA 3NC1C 4MITA 4ESVA 4FCWA 2JLYA 3TRFA 4FMCB 5TB5A 4KVGA 1XMSA 3NBZC 5H1YA 4FW9A 1TNDA 3QQ5A 2YWHA 4EAQA 4C4PA 1RC8A 4FI3C 2ANBA 5EE3A 4IOKA 3GFTA 3R7WB 2CL7X 1N6HA 1QF9A 3WMEA 2QMHA 3I3SR 4OYHA 2GETA 1GFIA 1CTQA 1HT2E 1J8MF 4LHYA 3D3QA 3CPEA 4XSHA 1FQKA 5IK2D 3GMTA 3OZXA 2WJGA 1E2GA 1EK0A 1ZUHA 1U0JA 3W90A 1GNPA 2PT5A 5H68A 4WZAE 2HV8A 5BXQC 2CK3D 5K8UA 3TBKA 5BN3A 2TMKA 1CJTC 4PSKA 4BLOA 1D9ZA 4EJSC 3O8RA 2VP9A 4M1OA 3GLGE 3U44A 3LBIA 3K0SA 3QVUA 2XNSA 1PV4A 1GKIA 1W4AA 1BH2A 1IN7A 2OBLA 1NNEA 3GLIB 3K9HA 1H8EA 1UDXA 3MWJA 3M0EA 3CPJB 4JKYA 4MKGA 3AP1A 2VHJA 5AUNB 2OHFA 2WPDA 3HPQA 3ZD7A 1SKYB 4I1UA 1Q57A 2J7PD 1S8FA 4GOKA 1FPMA 2AX4A 2FH5B 3AKDA 1NBMA 1J7KA 2JJ2D 3MSXA 1IY1A 4V02A 4ASUA 4TMTA 4TYNA 2XJ4A 2WSSD 4B74A 1XJ0A 1DELA 1T8UA 2Y8EA 4M9SA 1ZP6A 1WF3A 1KI7A 2C99A 2NZ8A 3CWQA 3H0KA 3QNUA 4IDPA 5GVRA 3UMRA 2GEVA 1Z3IX 1IXRC 4W5WA 1NMZA 1U9IA 1YR8A 4IDHA 2GXUA 821PA 1E94E 3U3JA 3VQTA 4BGDA 4WIAA 3RRNA 1P7CA 1ZNWA 3E2IA 4KFRA 1ZM7A 3OAAD 3KB2A 3SBDA 4BZPA 2ZI4A 1UDWA 5FTNA 1T9HA 3GJ3A 3KXKA 4IW3B 4O0MA 4Q9HA 3S1AA 4DIEA 1R8SA 4Q4HA 2QY9A 1XXHE 2QG6A 1TF7A 4BEBA 2C04A 3EPHA 4BLPA 3U4QB 5KU1A 4DHEA 5JEEA 1CXZA 2ZE6A 1OV4A 1PLJA 2FSHA 1F5NA 3V4FA 4JS0A 4IEEA 1N6LA 1S3GA 4YMWA 5C2JB 2IF0A 3ZQJA 1Z0AA 2REXB 2EWWA 2IHYA 5D3MB 2WKQA 4KBFA 3IQXA 4A6PA 2P6NA 1Q0UA 2NPIA 5FPYA 1XMIA 1NIPA 2GZHA 1RRFA 3AVTA 2XNDA 3CH5A 4TYPA 2VL7A 2IYQA 1KY3A 2AFIE 3RC3A 4WVFA 4I1SA 2J1LA 4X8MA 4OHXA 2QAGA 4IKEA 1GITA 4Z1MD 2QM8A 1SXJD 4MA4A 5AJYA 1J70A 1FNMA 4DB4A 4TYQA 3PJRA 2ZSFA 1DAFA 4PTLA 4BUJA 3BOSA 3EZ6A 2ZUDA 2BC9A 3VU9B 4OI0A 3LQQA 4IEIA 4DCNA 3T15A 3DM9B 1LY1A 5EUQB 2Q9BA 3GJ6A 5FL7A 2QP4A 3VR6A 4NCNA 1D2MA 1OH5A 1K5DA 1S2MA 1U8ZA 2O8FB 3SFZA 4IOMA 1GL9B 2GHIA 3P20A 2BBTA 2O8EB 2WSMA 3EIHA 4KV9A 4OHYA 3VR5A 3KTAA 2QMOA 2JJ2A 1ETUA 4PO8A 4PSVA 4XWAA 2H7VA 4ASUD 4QHSA 1JQLB 4DEYA 2NZJA 3T1VA 4RD0A 2V54A 4B3CA 1XCPA 3ASYA 1E2FA 2VP0A 5CK4A 2Q3MA 1COWD 1OF1A 2FV8A 4NP6A 4K46A 1ZM3A 5E4FA 3B1VA 2RGAA 3TVTA 4HLQB 3NHBA 1HA3A 3TAUA 3FMIA 3R9XA 1LTQA 4ITRC 3I5YA 2YC4C 4PQYA 4UXHA 5D3MA 5CJPA 3BFXA 2WM9B 5JZVA 2O8CA 4PSAA 4W7SA 4FMDF 4Q1BA 4DUGD 3GLGB 2WBLC 1UKVY 5JSZB 3UATA 4I1OA 1ESNA 2ERXA 5JWHA 1US8A 3L0PA 2ZR7A 4ZPXA 1YKSA 2J59A 3AVWA 1IM2A 1P9WA 4AKGA 4YXWA 2ODBA 4C0HA 2AHOA 3Q85A 4Q1AA 1IAQA 2OT3B 1G8PA 1H8HD 1P61B 4YONB 4N3NA 4DSUA 1VIYA 3K09C 4LC1A 2O52A 4LV6A 1RRCA 1E32A 1T0HB 4UNQA 1GOTA 4B3DA 1NKTA 5EXTA 1X8KA 1T5IA 1Z2AA 4QJ4A 3QBVA 3X2SA 1XTQA 2FMXA 1WB9A 4MDEA 3PV0A 4B35A 5KYKA 3VNVA 2ZTSA 3CX6A 3UPUA 4FD2A 5C18A 2PBRA 1EFRA 2FG5A 4HZUB 1NN1A 1ZW6A 2AXPA 3KTAB 1JECA 1JB1A 3SYNA 4DC9A 5LBIA 1RFLA 4AKEA 3I4LA 4Y0VA 1DG1G 2YOFA 3QSYA 3IIJA 2EYUA 2ZUBA 1N6OA 2QM7A 1KTVA 1PUIA 2J87A 3QKSB 5ANRB 2AK2A 3GJXC 3TW4A 1YZQA 4US2R 3EAQA 1D9XA 1XTIA 4M9XA 2JLSA 1I4DD 4KJZA 3QJYA 4M1WA 4LJAA 1K5GA 3QEJA 3HYTA 4OHZA 2IYWA 3FDIA 2WIBA 1Q22A 3ONWA 3WNCA 4BFWA 4HATA 2XXAA 1W48A 1HTWA 1QVAA 2GBLA 5GVSA 4TMVA 2ZE8A 5M04A 5DHFA 2ZANA 2JLZA 3TSZA 2PX3A 4D4LA 2GEDA 3TK1A 1OYWA 5JRZA 3EZ7A 1Z6GA 2IEYA 4Q9IA 3WNBA 1RJ9B 1NN5A 2D3WA 4D0NA 1T91A 2LWIA 1UBCA 5KPDA 3PUXA 3JZAA 2BCGY 2D62A 2BM0A 2G88A 3T06B 1YU9A 4E09A 3NG1A 4GNKA 4RD6A 3RAPR 1G7CA 5DYIA 2WWFA 2EU8A 2QAJA 5J5CA 1AA9A 1T4GA 4P32A 4EPYA 1G8GA 1GKYA 2ZRHA 2I1QA 3GQBA 3CKLA 3GLGA 2FZLA 1XEXB 3S1AB 1OB5A 5KOYA 4KFSA 2J45A 3GLHA 1G21E 3QENA 1U98A 3RS5A 2WWWA
chains in the Genus database with same CATH superfamily
5H7XA 5KYYB 2RE8A 1CY4A 1NE7A 2JFOA 1P7WA 3A10A 2WM2A 2QTRA 3ONNA 1CUYA 4LHSA 5AK5A 5MFZA 1QFMA 5EKUA 1HEUA 1GFZA 4MULA 3O3NB 1GQFA 3RU2A 4HAUA 4BE4A 1SKMA 1EWYA 1W5TA 1BE8A 1QORA 2OESA 2P9FA 3O7MA 1U31A 3OZIA 5DWVA 4KN5A 4F6RB 2EGUA 1F0YA 3RBVA 1Z4QA 3W78A 4EEXA 5K8CA 1ZIXA 3AESA 4OJYA 3SXUB 3UV6A 3D7MA 2DAPA 2VPIA 1QXSA 5CYPA 1A9TA 1KK2A 2ATEA 1ENYA 3I23A 3FDJA 3PLRA 3VPAA 4Z9FA 2GNOA 1VPWA 4P31A 1CZOA 2XRFA 2B8WA 4ZALA 4YDSA 4PR0A 4Y3UA 4XE5A 2O7NA 4TWBA 4HYYA 4FEYA 3TJRA 3THWA 3HRIA 1A1VA 5IHPA 4X93A 1AGYA 3I28A 3BWEA 3EFEA 4FZ3A 5L4LA 4IHJF 1K08A 4DLBA 4TSFD 1BQEA 4KBGA 4PYRA 1I9CA 1PTJC 4YC7A 2AOVA 1ZA2A 1PI3A 2BD0A 3U3OA 1Y3AA 2HA7A 2JIZD 2W00A 5B2EA 4WJLA 2CFCA 1AKUA 1LTHR 2YINC 2IZ7A 3AOEA 2GA9A 4RJIA 2X5XA 1PT6A 5BRJA 2Z8YA 1Y8CA 2ADMA 4H6PA 1Z22A 1GR1A 2XQIA 4QKQA 1YVPA 1WB4A 2GDZA 1LI7A 5EZ6B 2NSJA 2G40A 3NT2A 1UK7A 4RSGA 3LU1A 4OXYA 4KXQA 3OCYA 4IDAA 1C4KA 2VJMA 5F21A 3GLSA 2HMAA 4WK4B 4DPMA 1NV8A 1CUAA 1TEXA 4KSBA 1JVNA 1PIWA 3PEUA 4QDXA 2VHXA 5L45A 3ZDDA 4G0VA 3OFVA 4DQKA 5EJFA 1VKNA 1KVRA 4DRYA 2P8SA 2FUEA 2VK4A 5E7QA 3SEFA 4J6FA 4JWKA 3PKJA 4WNAA 4YYEA 1S9DA 4Q3KA 2XI4A 3MTEA 5BYBA 3JVIA 2R4TA 3HU3A 1GHTA 1UBSB 4C7MA 2W2LA 2PKQP 2P35A 1N8TA 4IVRA 3LV8A 2VUHB 3GR6A 4BP3A 1X38A 4F04A 3NIGB 4EYGA 4HMQA 2P9HA 2YW9A 1Y5RA 5G0SA 2CCJA 1KAEA 2HQSA 4OFZA 1ZUWA 3OQMA 1OC4A 4DLRA 2X4GA 3ROEA 2VQFB 2PXXA 4RK4A 3S8MA 2CUNA 3RJ5A 1E79A 1SZJG 3ZHUA 4JYMA 2WWHA 3C48A 2R6AA 3KJNA 4BNWA 4IDDA 4FZVA 5IDVA 1UQTA 1KZ7B 1LZKA 1UOOA 2Q0SA 4Q7MB 2FU5C 4R1PA 1E77A 1GAEO 1VCHA 2IUUA 1MDFA 2FCAA 1CQPA 2O3JA 4LXQA 5EJ7A 1CQJA 1J4AA 2PYZA 2Z98A 1W44A 1HQYE 3VVLA 2AE1A 3U3DA 2OHIA 4RVUA 1AD2A 3PNSA 3SMVA 4E2WA 1NP7A 2D2FA 5J1SB 4R4JA 1C1DA 3K1TA 5DF1A 1MT0A 3NNDA 1Y4UA 5KPJA 3PDWA 4M1TA 1DBWA 2LE0A 1CT9A 2K5UA 4MQ4A 1UOPA 4YRRA 5TT1A 2AG6A 1OXBB 1EVKA 4LOAA 1XI2A 2XT0A 4IH1A 3UK1A 4JBLA 1TD1A 1PEAA 3L4SO 4E3ZA 1T8TA 3FLMA 4W6ZA 1KK0A 5AW2A 1I7LA 3FOBA 1NDQA 4IFIA 4RCZA 1JHQA 1E9EA 4WH0A 4JQYA 2FWIA 2DQZA 4CFSA 4YT2A 1MHPA 1QVRA 5HW0A 1XMQB 1K7EB 1QK4A 5DV9A 5F3WB 3HXLA 1KZ1A 3M6AA 4HYEA 2WFLB 2WT9A 4QLOA 4BAZA 3AP3A 4OATA 3ADBA 1F8UA 5ARDA 3A1SA 5E1MA 3WGLA 4YFVA 2EBFX 4Q82A 2NUPB 1PT9A 2AN9A 3DBLB 4ND5A 3HVRA 2G4VA 3GPDG 1BKDR 2VP5A 4MVJD 1NULA 3WR5A 3ZE2B 4CMBA 4YRZA 2R6HA 3BHNA 3I9JA 5EIBC 1KDPA 3QMMA 3R44A 4CI0B 4F4JA 2GEJA 2WP0A 2ZSJA 2RFLA 3CR8A 3R5XA 5AUPB 2HQBA 3A1VA 3EUEA 3TR0A 4RHCA 5BR7A 5GV7A 2F62A 1KORA 1ZIDA 1PYGA 3T1TA 2R44A 4RIHA 4TKVB 2EKQA 4MW2A 2HLHA 1X1QA 1E1QD 1ZI6A 2WWRA 2ID4A 3JYQA 4LZZA 4XQCA 4BYMA 1U0GA 2ZYGA 4EVSA 2CD7A 2O48X 3ICPA 3LT4A 3PI6A 4AG3A 1AZTA 1N6IA 3QKIA 3SCZA 3VHRA 5CXXA 3ZJ4A 3OY7A 4MVYA 2J5KA 3ZJTA 5C7LO 1TAQA 1Q1NA 3UVEA 4A2CA 5DNYB 2B4RO 3UGTA 2FN3A 4KV7A 1BZYA 1JL3A 2BVNA 1NYQA 3H99A 3LYLA 4RIFA 2VYND 3MMSA 3NM5A 1DTSA 1OCEA 4KG7A 4LJ4A 5KCZA 3E9NA 1JZSA 2OZLB 4AJPA 1UK8A 1D8TA 1HG1A 2BTOA 4N0MA 4WLOA 4BVKA 2BTEA 5DNAA 2GCIA 3JZFA 5SZIA 1O96B 4RK5A 3LZ6A 1QRTA 4U8HA 1NBOA 1SPBS 2BFAA 4YRAA 5EA2A 4KGDA 3NVAA 2HT6A 4R84A 2JIBA 2RBGA 3LT0A 3QKRA 4G5SA 4YQFA 5FNVF 4HUQB 2WLSA 1UMDB 3PWTA 2F1OA 3WDMA 1FB5A 1W4RA 1AQIA 3O38A 1RKVA 1Z2PX 3U7FB 1U5BB 3DKPA 1DDIA 2KE5A 3AF6A 2ILVA 2W4MA 1YBHA 2OOKA 1EE9A 2B4YA 4LYAA 3V4SA 1KEEA 3EX7C 3DZCA 2FPRA 2GAFA 4HNTA 1PK8A 2WFZA 1AC5A 3T3NA 1IOWA 4KW7A 2JVKA 2IHVA 4EHLA 1PQYA 2DFVA 3RS2A 4D4KA 5JYBA 1EFAA 3MJCA 3OFJA 1APBA 2XMPA 3COZA 3OA0A 3S29A 1KEKA 2RI0A 3O3CA 1EX6A 3ZIDA 2BR4A 4NE7A 1RI3A 1P5HA 2GRJA 2O8FA 3OSZA 2A86A 2G9ZA 3QLUA 1SRRA 2K2QB 3SR4A 4HRVA 2FY8A 1EFKA 1T8SA 2B1QA 3TQFA 1FPQA 2FE1A 2P9YA 2J3LA 4JJ8A 121PA 5CH3A 5TPZD 2REOA 3BTSA 1TU0A 2A0KA 4F5WA 4FB5A 4CPDA 5DTIA 3CXUA 3B1JA 1KJ8A 1U0SY 2VXYA 1M66A 5IAEA 4CFZA 2JGFA 4F12A 1P4GA 4U2FA 1U8YA 3HMKA 3OE7D 4KXMA 4Y6LA 2PLNA 4W9MC 3PE6A 3AY3A 3C39A 4NU0A 5F33A 1Z06A 1YB5A 4BQIA 2AFRA 2BEWA 4J0QA 4UUBA 3UMGA 4HCJA 1BEEA 2HSWA 3DL0A 3HCWA 4YQYA 4GC5A 3RBXA 4CIAA 3CLKA 3I58A 4RO0A 2ZWOA 1OIWA 2FG6C 2IHKA 2P62A 3R24A 4O6VA 2FPSA 3JWPA 4MV5A 3U3XA 2BF4A 4B3XA 1UJBA 3OT5A 3VPFA 4HVLA 1A71A 1O54A 2MYTA 4KNYA 5EZQA 3C3XA 2H2IA 4NONA 4W9RA 4OXKA 4KWHA 5EZYA 4D46A 3OF5A 2JL1A 4QRDA 1K8ZB 1Q19A 1SVKA 3IMCA 1DG9A 2QRKA 3KE8A 3RYHA 5F5LA 4FDAA 1P9LA 4FDMA 4Y2XA 3LUHA 2CLIB 1LRKA 2QRUA 4J16A 3DPUA 3G0BA 4JJ7A 4MGYR 4WJKB 3AYZB 4NCXA 4PAOA 3UJDA 1G0OA 3UG7A 2A94A 2MINB 5JI2E 3QBDA 1JHRA 2IS4A 1ORDA 4RZHA 2GN1A 4N41A 5CVDA 3Q0IA 2HBQA 2P68A 5KTPA 1PZNA 3ZWNA 2PYDA 5EIEA 1JVBA 2XB6A 2YV2A 4WASA 5DE3A 1O8CA 2IY9A 1MEEA 5HE8A 1DTWB 3VNAA 2KLBA 4UHCA 4C5BA 2DHRA 1YGYA 2WHXA 4QU0A 1OXSC 3LA6A 3HKCB 4AF8A 4CF5A 1FSPA 1G5IA 3ZX5A 1DKPA 1R6UA 2ZWIA 1G8JA 5EWLA 3KEQA 4XB1A 4YEDA 4EJ6A 2NVUA 3F5DA 3GJ7A 4Q48A 1MJGA 1EGQA 3ENNA 2E85A 3WLOA 2JLQA 4ATNA 4MRVA 3R8XA 1A9RA 3DTNA 2AF4C 3A3NA 2H9IA 4X7RA 5JPCA 4ZA2A 4EO9A 3M1LA 2B9EA 3VAZA 2CDNA 4R3WA 1QTRA 2AVNA 4JP5A 3EZ9A 3EY9A 1NUUA 3P9KA 1KR5A 3G2HA 3GPLA 1Z73A 1Q7GA 2GK7A 1K4KA 3O4VA 1U8UA 3SX2A 3UCFA 2DWCA 3ESBA 1PVOA 3G9ZA 1KK1A 3UB3A 2EL9A 2BFWA 4PZDA 1Q44A 1KL7A 3JYPA 2JBAB 5BN4A 2IBSA 5HTOA 2ZRAA 3EFOB 4X94A 3WLMA 3OIWA 4EECA 3FSGD 1K9SA 2X2OA 1LPAB 1GQRA 3NM4A 4XWTA 4BQRA 3OQ6A 3ZJVA 5CHEA 2G67A 2O2YA 2VP4A 1VPLA 1ZLYA 2TSYB 3NC0C 3AOGA 1KVTA 5ALKA 3S2ZA 3UMYA 1OREA 2HYDA 1VHWA 4PCAA 5DYTA 1PZXA 3I6BA 4D97A 3DHNA 4OGWA 1XEWY 4DMFA 5TS2A 2YQ5A 2BFFB 2N46A 2XRYA 3AG6A 2ENWA 2NV0A 1T2UA 1NX6A 2J5BA 2VH5R 3TZEA 5AJUA 5ER6A 3HHEA 3QVVA 5ALDA 3SZLA 5IJ0B 2NU8B 4AU1A 3K70D 4V24A 4AKHA 4BMDA 4FFBA 2LCQA 4BMNA 1OPRA 3AX6A 3E3LA 4K6MA 2PGNA 1BCRB 2QYTA 4MWCA 2VUTA 3OD1A 2EFCB 5JS2A 2C54A 4E5DA 4FFSA 1YQ9A 2GBPA 2F1HA 4JEUA 4IGAA 4MPPA 1J8YF 5IKXA 4F8EA 2ZB3A 3HDTA 3SLRA 4E4YA 4MR7B 3PHCA 2LDXA 1BE6A 3A7EA 3E70C 3NHWA 4GM4A 3UT6A 2VSFA 5C1OA 5LQJA 2FF7A 4U9UA 3RVNA 5JQGF 2FMHA 4JKIA 1UKZA 3A25A 2C88A 2FJPA 4KYTA 1AO0A 1WETA 1U2EA 4XDZA 4ZXPA 3WIOA 1O6CA 2TMGA 1Q84A 1NKVA 1HE8B 4RMIA 3W9YA 2D2EA 4BVAA 1ECLA 2IZ0A 3ZHCA 1JG1A 1EXWA 2JI4A 2ODWA 4HQLA 4XM2A 5C8YF 3CRVA 5KWJA 5HILA 2M32A 1HKHA 2XKAA 3UUFA 2JCBA 3DC2A 3SVTA 4Z53A 5G0VA 4TZ0A 3HKDB 3N28A 3WK8A 1V9SA 3OFND 5FCDA 4M7RA 4GMHA 4UCFA 4CBVA 4QT4A 5ALJA 4RYDA 3N2KA 1FFYA 4TV8A 2P0EA 3PQEA 1PG5A 1SVWA 3WB1A 2JASA 4D0GA 2PEYA 4V0RA 2ZI3A 1IC6A 4OB8A 1NW9B 3MLAA 2ICAA 5EJ4A 3H2KA 2Q5EA 1NQTA 1LSJA 4N5NA 5EQFA 3RROA 5A02A 5DLQC 2IPXA 1KWGA 3I4FA 3KZOA 1Z47A 5J2TF 2LZ0A 3MG9A 2B92A 3N0VA 1ZU4A 4BXOA 1N3YA 3DGEC 2VRNA 5I9IA 1KS2A 3THWB 4Q02A 1JT9A 2J08A 2OHOA 3OOYA 4BKUA 2DF8A 4M9RA 3OEHD 4NKRA 2GPWA 2V3CC 1FEZA 3MGGA 4I6GA 4Q9DA 4IWXA 1GPMA 2Y1LA 1DC4A 4WEOA 4V39A 5LP6F 1GTSA 2PRSA 2DLCX 5ELXA 3AJ8A 3IPAA 3JX9A 4E5UA 1VG1A 3LKZA 2KBFA 4U0KA 4WXMA 4Y6PA 5J4HA 1U4OA 2RG7A 4M0LA 3B36A 3OEEA 1O7JA 2Q0HA 3BXXA 3KQUA 2ZCVA 2HTFA 2ZIAA 3RHSA 1I8TA 2Q0XA 4BMPB 4C3ZA 2Q5QA 1WW2A 3O2NA 3VTKA 4ZI7A 2ZW9A 4GKJB 2KB0A 7GPBA 1ZR4A 3JR7A 1CY6A 3L0OA 2E4ZA 3TSAA 3A9UA 2X9QA 3Q6IA 3CF4A 3F1LA 2BHRA 1NA5A 1GZSA 1VKHA 2QT9A 3VOBA 4Q19A 1DXYA 3SXJA 5DNWA 1C3OB 4CLXA 4RGBA 3U3MA 1F7VA 1JYSA 1K86A 2C4UA 4CEJB 2WYUA 1P6XA 3LL7A 4PSUA 5HFJA 4C4OA 4HBZA 1J2JA 1PS8A 1SCKA 3KQOA 4ZOLA 5DTMA 1NPTO 1PJ2A 2A9VA 5G1PA 3X1YA 4KNVA 5IN4A 5AESA 5CLHA 1XYVA 1JBQA 2QTVA 4UMFA 1UADA 4NS4A 1NW8A 1T25A 2JZCA 1CUWA 3B53X 3WBKA 4XFJA 1XELA 5AW3A 2A58A 4MYUA 1Q7RA 1U7HA 1Q20A 2I6SA 4UU0A 4GP9A 2VP3A 3N2GA 2Z56A 1VLVA 2C3MA 4N65A 4O08A 1YRLA 3REGA 5IMSA 2E5LB 2W2LD 3D3EA 4HI0E 2XBUA 3A7DA 3VYTB 5A3JA 3QVSA 2GX6A 5DCYA 1V41E 3KDAA 4CT4B 5L3VA 1GNVA 1OPXA 5LXTF 5LQSA 3T3DA 2YZKA 1XZBA 1E61A 3PFFA 4XIJA 5HRCA 4MB0A 2HJSA 4ECAA 3PNKA 1MD9A 3HNRA 1UWLA 3NDJA 1XNQB 3HSYA 3AOEC 1MA3A 2R5NA 1HX7A 4L8VA 4R54A 4BO6A 3ML1A 3UHJA 2WYIA 4F6LA 1NBMD 3BEOA 4NJEA 3RFTA 2CUKA 2IXEA 3LA8A 1LA2A 4QECA 3PZRA 4FGUA 4XARA 1M5UA 4W4TA 1E18A 1PZFA 5LMCA 4EATA 4MQFA 1JJAA 2ZSUA 4QM7A 4ZVVA 1ZBDA 4RELA 4F2DA 3W8DA 1SR8A 1QONA 4X6YA 3V80A 3ZI7A 4X1OA 3KX2A 5A3RA 5JCOC 2R8RA 4ZYYA 1HZZA 3U5ZB 4HZUA 4IYRA 1Z74A 3L0CA 3TVYA 2GLXA 1OLSB 1SPXA 3KKPA 5TQVA 2NZWA 3Q9SA 1P9NA 1RAFA 3D6MA 1RABA 4FDLA 3KKOA 1L8OA 5A05A 4B31A 1EE1A 3OY2A 4IQGA 2IV3A 3M6VA 5AHXA 3RTEA 3ROQA 3KR1A 5A4IS 5A03A 1GG9A 4EBBA 3FI0A 1XHLA 5G4KA 2M6SA 6NULA 4AIRA 4EJ2A 4AY3A 4CMIB 2VQ3A 5K0CA 5LPNA 1G7SA 2E18A 3EIUA 4LAFA 3LTNC 4W5OA 1UPFA 1XKLA 1RXIA 2ODAA 2A33A 1Z7WA 3EA4A 4BXOB 1NDHA 1VCMA 2ZVDA 4TWRA 3RRYA 4NBKA 8ATCA 2XA1A 4L6IA 3EEBA 4PLPA 4UBLA 4NY1A 1ODSA 1M2GA 2X76A 1TM7E 4IIJF 4EZIA 4JL6A 4P81A 4RZ3A 4NJOA 5AR1A 5AVQA 4JODA 4CDRA 4CGZA 3AVVA 3D0KA 4EX6A 2WU8A 1VRCA 4B82A 4RDIA 1C1HA 4BEWA 1XKXA 4DUZB 3WHKA 4RIGA 4MI3A 4X00A 5HKBA 2VYQA 5CJJA 3AETB 1Y5LA 1OFUA 1ISRA 1KK3A 1RYHA 3ZOZA 5BN1A 1HNWB 1HOTA 1FP6A 2JLCA 3DV0A 5JW6A 2XHEA 2L0XA 3PQ6A 2OCLA 1PGJA 4H4EA 2A9RA 3BM5A 4DT1A 2IKSA 5DM60 1KEWA 2HWXA 4HSGA 5EHZA 2N1MA 1IPFA 1JQAA 3OJWA 5GJWC 1VLJA 3FOCA 4HEHA 3H1TA 1V7CA 2FGJA 3L8ZA 4KU4A 1DARA 4RA6A 5BPFA 3EQ6A 4KC0A 2AD1A 3OQIB 4DM4A 3DKRA 3UWOA 3WY9A 1AZSC 3RC8A 5KWSA 3QW2A 4C89A 5LQUA 1LCIA 1Y9EA 2FI1A 2RHTA 2QK4A 4H35A 2HMVA 4UBMA 3W9SA 4QYMA 3DEAA 4FDTA 2AJLI 1LS6A 2PVPA 1UP6A 3IBYA 2HCFA 2B37A 3GC6A 4UVEA 3TJMA 3N6RA 4D2IA 3W4IA 1GQ2A 3WIBA 5AJVB 4ZWNA 1INLA 4GX5A 1NV9A 3NWEA 3QV1A 4H7HA 3TB4A 4B6GA 1E2HA 4WZAA 1HQDA 4DCSA 1Y7LA 4JC4A 4R2WA 1L5NA 4TLMB 1YQWA 2B8TA 1PFVA 2B3TA 3RWOA 4WOBA 1QG2A 2A6PA 2QMZA 1H94A 2AN5A 2CXXA 2JJYA 4IP0A 4QBFA 1YQTA 4G8BA 4H7IA 5DMHA 3ECAA 3R9KA 4FFPA 4V3BA 3LSYA 1CRZA 2QR2A 2W98A 3CVOA 4LGVA 4UFNA 3I5MA 4NDAA 1C8LA 1FTQA 4LG1A 3U7GA 2OZVA 2BBSA 1P2BA 2ZT6A 3C5CA 5CLGA 4C6TA 3GJTA 4F3YA 3NZEA 5IM4A 1GPLA 3EFOA 5E0KB 3GLKA 2WILA 4L08A 4XR4A 5IM5A 3TUJC 3O26A 1JMVA 2PANA 1NSYA 5BOSA 4I55A 1CY8A 5CVTA 1KEPA 2OP1A 3HCFA 2IOHA 2W0SA 3W79A 3GT3A 4J49A 2XCSB 4EUHA 2DQYA 4TVKA 4EJ0A 4PYLA 4A23A 2C9OA 3S81A 4UCQA 2DE0X 3IUQA 1Q0PA 2XKKA 4LJ8A 4NDZA 1EU1A 3IUBA 4GMGA 4L27A 4JZKA 1RZRD 1A7AA 2NZ2A 2IELA 2HU2A 1XTZA 3AR3A 1BE0A 2WFLA 3DWIA 4TS4A 3PNPA 3W5JA 4A8JC 4HZGA 3D8UA 1FLDA 5F3RA 3AKCA 3Q7TA 5AM2A 1WSAA 2AKEA 2RJOA 5G3YA 5JVDB 2I0FA 2J41A 4D4HA 1O4VA 2YN4A 3CBQA 1DS6A 4IDOA 4JVNA 5G0WA 3PYXA 1DX6A 1JHAA 1NN0A 2AD5A 2GZ2A 2V97A 3KNZA 4FQ7A 2QVYX 4HRAA 4CU5A 2PUGA 1V3TA 2J85A 1C81A 3AR5A 3MTIA 3OF2A 2VYFA 1SVLA 4IRMA 4X71A 5JCXA 4FGLA 1KQOA 3FZQA 3N7TA 3IQDB 1ULUA 1YRAA 2LTAA 2RGUA 5LQKA 4FFRA 4AZ3B 1EMDA 1C3VA 1YR7A 1ZOSA 2GYVA 1QDEA 2J0VA 2QVXX 3LPCA 2Q6TA 4RLFA 1DRUA 4TN1A 1CJKC 1LTKA 4EB6A 4BWVA 3KVYA 1W5EA 3Q9LA 4JLPA 5HGJA 4EWLA 2CXUA 5DCWA 3CMMA 3NWOA 4FJ2A 3DAGA 3CRW1 3OX3A 5F4BA 5KCMA 4E6EA 5EMJA 3KQPA 2BYTA 3OMXA 1A27A 2OO5C 4UASA 1XRLA 4N54A 4AM8A 2FMUA 4D9MA 1VHDA 3IP1A 4KIUA 3MCVA 1M2OA 3EZLA 1JLHA 2CT8A 1DZ3A 3ELYA 2XTZA 4IZOA 1FDRA 2VDVE 521PA 4UTVA 1KS9A 4HDSB 5AO9A 3UC9A 2Q7OE 5JDCC 4RTJA 1JS1X 1D1QA 4JITA 4Y98A 2LXNA 4K8RB 4RKQA 4AUNA 1FQJA 5ALOA 4OOEA 1MO4A 3V3KA 3VBCA 1MPTA 1NYTA 3DE1X 3LT5A 4QZVA 3HS3A 4NLLA 5AVSA 4MI1A 1D4ZA 3VU1A 2WTAA 1F12A 5JAIA 3FBGA 4IGKA 1P7VA 3R5HA 4J0KA 4LV8B 3ZY2A 1N1MA 4NXMB 2WAXA 2QXUA 2REQB 1PT8A 3P27A 3N39C 4TWIA 4NOJA 3DZFA 4BUCA 2QVGA 3MUNA 1GILA 2QTNA 4Y9SA 2CV2A 1IE3A 3VR2A 5C9ZA 3WS7A 2I6FA 2EFYA 1KZ4A 2ORWA 3CFYA 1M2FA 4QJ5A 2ESRA 5E38A 4XJTA 1OXUA 4M0CA 5H9VA 1SU8A 1KI9A 2HA2A 3HACA 2PQ6A 4HH0A 1H2YA 1D0SA 2JBWA 4L28A 5GIPE 1V8BA 3MAGA 4JLAA 4AO6A 1LBEA 4RVHA 5JBNA 2Y66A 1ZK3A 4GXTA 4JOCA 3PRKE 2I4OA 2JDIA 5FP0A 2BV3A 5IASA 2OBBA 3G17A 4NYIQ 4GBGA 5DB4A 3H3XA 1YA4A 4JOBA 5E9WA 1CRQA 3ZWCA 5DN6A 1H0KA 4KXVA 3B48A 5LOVF 4FGJA 4EYSA 2FOXA 4JT9A 2OBXA 1I1HA 1DAKA 4LUCA 1Y1KE 5CT5A 1QVVA 1T1GA 4JR1A 1XL1A 2GEBA 3BH7A 4YRDA 2XWQA 3E3NA 4JZYA 4PLYA 5LUAA 3DXYA 3EXFB 3E8SA 2DY1A 4P3PA 1FU8A 1SJ9A 3DT9A 3P9PA 3QH4A 4OJKA 3LFUA 3QK7A 4QARA 1TQDA 3O1LA 4E12A 1RYBA 4F9FA 1SUAA 1HDOA 5DM1A 4A2WA 1SA0B 3UB4A 3NH9A 4JMPA 1F2UA 3TD2A 5L3RA 5BWCA 2V8BA 1L7PA 2E4UA 4HRYA 3SR3A 3ZGOA 3S8EA 4MDFA 3E3AA 2XUAA 5F73A 3T0FA 1RLOA 2AW5A 5DM2A 5LA6F 5J47A 3AR9A 4IHQA 4PG4A 1MU0A 1W1UA 2H2HA 4EYEA 2R8BA 3LK6A 3RKUA 4S2EA 1QPGA 2AG8A 3HNPA 1CUBA 1NATA 3WFIA 2P3OA 2QTZA 4GM0A 5DFAA 3AUXA 3A9SA 4E2YA 3HR8A 3QV2A 4IUBS 2D5BA 2FTKE 3HI4A 4KE7A 4R81A 3P9RA 4PZAA 4CLDA 4EB6B 1HO3A 4WGGA 1NASA 2R1TB 3R6WA 1GGVA 1XZIA 2ONCA 3LQKA 1XMPA 3ESYA 621PA 2AZTA 3NC4A 5KMGB 1BFKA 1LSSA 2Z3VA 4PZYA 3ZZMA 1SBTA 3PKZA 3WL7A 4V1CB 1ZSVA 1LDYA 5B30A 1T4BA 5MN4A 5C7IO 1SD5A 1QBGA 2B83A 1KO5A 3BMNB 3PX3A 4M2LA 2IYEA 1Z26A 3G3EA 4MVCA 1HNZB 3V8NA 1ND6A 3KSRA 5KNBA 1PR1A 2IX3A 2QRZA 2D00A 2PHZA 4HYTA 4V3CA 2AZDA 1UDCA 4IS3A 2YWCA 2CMFA 1J1ZA 3KKMA 4NHOA 5FH9A 1PE0A 1XZFA 3G0HA 3CLSC 3EC7A 3Q9NA 2RHWA 3IHLA 1GRNA 3L8EA 3UAVA 1WZUA 1F1JA 2RGWA 5EKSA 2V7EA 4Z0NA 5LC1A 2BFNA 4DR6B 4GWKA 2ZUCA 1BS1A 1HMPA 3K3PA 2G04A 4IINA 4L5AA 4S1TA 5FPPA 3RUCA 3UTDA 3CY6A 4M1EA 1V1RA 3D3KA 4DSTA 3PQ7A 3FSJX 3FGOA 2FWRA 1LQTA 4CQLA 4YRNA 1RPZA 1J2YA 1E1NA 1Y1LA 1RPAA 1FUIA 3EZYA 4FKMA 4RVGA 2X0EA 2R6CA 3C5VA 3EFBA 1Z12A 3L6RA 4XCXA 4Z3DA 1OIVA 2V65A 5DNCA 1YCFA 1P18A 1U4NA 2QN6A 3ZWVA 3CZ5A 3EISA 2WQ6A 3LS2A 5CT9A 1E3IA 3NAMA 4FSXA 1L7XA 1DE0A 3ITDA 2RGEA 5DYNA 3ZLUA 1X13A 5JPDA 3NJRA 2Q6VA 4QYSA 2X1LA 3DVRX 4TKMA 2R7KA 4Z9BA 1N5IA 3L4BC 2V58A 3GRAA 4LMPA 4HUQA 3M3PA 2V9ZA 2OAGA 5ECWA 3I62A 2BKXA 2OORC 4LCJA 4O4LB 3EZGA 4JJ6A 4JDUA 3B6JA 1ZD3A 3R9WA 5EWMA 1ZY2A 4LYJA 1M1NA 3L6OO 1IL0A 3TTUA 3AEUB 1M2OB 3IDZA 4XX1A 1EFHA 2AI2A 1JJFA 3BTVA 3CKKA 3JVVA 4TS1A 4X24A 3D8NA 5D85A 3DR5A 3SEAA 4J0HA 3EVGA 1P1IA 3S44A 2RKOA 1BEZA 3AI3A 4XYMA 1N77A 3O8OA 3OETA 4QEKA 5FRDA 4W1QA 5ED0A 4CTJA 4PTZA 4DMRA 1MVOA 4N12A 4PX9A 5ITVA 2Z2ZA 2ZBQA 3HHPA 4KODA 5KSPA 3QUBA 3IE1A 1I33A 5B2FA 2CE7A 1ZI8A 3PUKA 5KUTA 1DBVO 1U3VA 4QLAA 3KYDB 1SMKA 3SQMA 1YZHA 5HEKA 1E7WA 1DXOA 1W9MA 2ZTHA 2HXSA 3QTBA 4EEKA 2AN3A 1D6SA 1RHUA 2A30A 4KN6A 1I5OA 1IXSB 1JSRA 1OI7A 1R0WA 2Q4TA 4Y8VA 5TV2A 4DANA 2P5YA 3GG2A 1VL5A 3MGBA 4KQ6A 4R68A 2AFHB 2QN3A 1IEWA 1JDVA 2XA2A 3ZHRA 2P9GA 1O8BA 2ZIUB 2OCKA 3ZWQA 4GEGA 3GLQA 5KNCA 3C5WP 3Q41A 5AM3A 1MXHA 4WY2A 1U04A 3EMKA 1OX6A 4HB0A 3TKAA 2XYGA 4J94A 4MRRA 4A6EA 1GZ7A 3A9VA 4ETMA 5ENVA 5DGCA 1WOMA 3C4JA 5K8VA 4Q4DA 4ZHQB 1OVGA 1P60A 1NIJA 2GVDC 4LYGA 5IVHA 2P0AA 5BWLA 1R18A 1O2DA 1W6UA 1L5FA 5FBWB 3EQ2A 1F2DA 1Y4ZA 1N5LA 4E2XA 2ZM5A 4AO7A 4KO1S 4ZFNA 3WA6A 3F71A 2XDYA 1Q95A 4JB8A 4EHKA 2AB0A 4J7AA 4QHTA 3V97A 1N0VC 2XNDD 3AESB 4RMHA 5TDHA 4K81B 1GG8A 4A0HA 3BJRA 1U9JA 4GPBA 3ZWOA 1VHTA 1T15A 4CM4B 1CY7A 3IA2A 3A4LA 4QNNA 3TOZA 1CY2A 4K6OA 4HRXA 1YBAA 5EE5B 1ECGA 1GGMA 2A3NA 2PQ2A 2Y9PB 4DRZA 4P08A 2I2CA 3PGXA 4KWIA 1XXHB 2HJHA 3ETGA 4H0CA 2FQ1A 1BS9A 2OSBA 3LUGA 5G4LA 3WK7A 1NMXA 1WXFA 1CQJB 2G6TA 1HL3A 1NJ5A 1XJQA 2SKCA 2ZB4A 3GJRA 2XDAA 3QUTA 4G4GA 4ALLA 4C7VA 3BFPA 1RYFA 1QYRA 1WRBA 1JR4A 5I6DA 4R51A 4US1R 1GZ4A 3SZUA 1MB0A 1AK9A 3BFKA 3C4QA 5CTJA 4C0KA 4DM7A 2HAEA 4P22A 5TJHA 1O58A 2H11A 4ROTA 3NTRA 5B64A 1EKXA 1V25A 3IEKA 4B0OA 2X0JA 3GRZA 4IDBA 3BQNB 3ZTWA 1V9LA 2EBUA 4OLBA 2IT1A 2JH8A 1EDBA 2Q3LA 3QFTA 2IS2A 1JFFB 3RT9A 3MS7A 4ZIRA 5HJEA 5F78A 1IHOA 4C4RA 1WCYA 2ASVA 2FLKA 1IPHA 2GPNA 2YXEA 4HH4A 4NZPA 4OF4A 4UCXA 3TW6A 3WLAA 3GOQA 2VBCA 1YJ5A 4MW5A 3AYXB 1UPXA 1VL0A 3V33A 3KYCB 4PC2A 4Y2JA 5CW2A 5C32A 3HXPA 3HXMA 5IP5A 4NXNB 3K0AB 5BWBA 3U26A 1ORWA 4KH0A 2EFEB 3R2JA 1MX5A 1P9OA 3QLTA 4HJRA 1T9GS 4HR7A 1V6AA 2RGCA 5E9JA 2AFHE 3UA4A 3KVRA 2PNJA 4KXUA 4CHGA 3H65A 4J29A 4RJKA 4AVYA 4G5OA 5KAMA 2OFFA 3G6KA 1AKYA 3AHIA 1OFTA 4DJTA 3T41A 1IN4A 4YJ3F 1T1SA 1KI1A 3PD1A 3GLFA 2PZKA 2J3DA 3VNBA 5I8PA 1Z2DA 2VZEA 3PPXA 5E8JA 4B2YA 1QMGA 3ADOA 1ZM9A 1SXHA 5HFNA 1GTVA 1ZSYA 2WICA 2X8JA 2JK1A 3L6DA 3TX2A 4D8TA 4EHDA 4ZC8A 1NONA 2CWWA 5LQNA 3CO0S 1IAVA 2H00A 3AJ9A 2C3OA 4N6OA 2J7KA 3HUUA 3PPVA 4IUYA 4W63A 2OFPA 1IHPA 1RBZA 4JLSA 3IHWA 2LUOA 4A36A 4AY4A 4DIFA 4WK2B 1TAGA 2LV8A 4XPIA 3V8EA 1SULA 1NVAA 1QOQB 2FFAA 4ZV9A 1GLVA 3DO5A 3CN9A 4JLKA 3TIVA 3NHSA 1E4EB 1DAEA 1ONSA 2DR3A 2OBMA 2QLMA 3OJXA 2JIPA 3B6MA 3LWBA 1DIOB 4LDQA 3ESDA 5EEGA 3DE7X 4RDXA 5I3CA 1DRVA 1FJXA 2WVJA 4KFUA 1OYYA 1OQAA 3I1YA 1IZ9A 1XJ5A 1IY0A 3MCUA 4DCJA 4JLJA 2PS3A 3WHPA 1GWNA 1PFKA 2XNCA 4WN3A 3T0GA 5A0TA 3PD7A 5HKLA 5IVIA 1LK5A 1Z35A 2ECKA 2H18A 3KKEA 1EA5A 1QG0A 1VFNA 1ZK0A 2YX1A 3AIKA 4C76A 1X1BA 2XCTB 4QD3A 1D0VA 2ACVA 3WDSA 5JZOA 2FP3A 3TL2A 5FHRA 3ZDEA 1N32B 1VJDA 4L9WA 4EKGA 5FOQA 2EZTA 2C4WA 1DMRA 4FR0A 4ZOLB 4B5LA 5G1NA 3FRHA 3BILA 4J0DA 2YWFA 2AQHA 3KOUA 5LP1A 3RUIA 4NYMR 4L3WA 4EW1A 1KI4A 3KXIA 3ZBTA 2FFRA 4DYVA 3WA7A 4JK3A 5DLDA 1FP2A 5FUQA 1XPUA 2A4KA 1ZI9A 1ZD1A 2GGSA 3AXSA 4FE7A 3ZOKA 2PSFA 1PJ4A 5C46F 3AQIA 1E62A 2VCHA 2WUFA 1LNSA 1Y82A 3A31A 5L7YA 4TMWA 3RANA 3TTYA 1R4AA 1P62B 3FKQA 3GB9A 3EMVA 4GWGA 4RK7A 3N8HA 5D3ZA 2PYIA 2X0KA 2YASA 3WRWA 4AMBA 5G0TA 4U7JA 2ODNA 3LVQE 3QVJA 3C8MA 3NRBA 3EJWA 1D4OA 3UAOA 4CEHB 1HE1C 3L01A 3FTNA 2RKBA 2VA9A 4RTMA 1QUFA 3JS5A 4EKEA 1TF5A 4R2LA 4NYMQ 1N0WA 3CLSD 1HY3A 3G2LA 3IAS1 4HO1X 3LOQA 1XVVA 3ROFA 1Q1BA 2QPLA 2Z2JA 2ZZKA 3BF7A 1G5RA 3D1LA 1HDYA 4JB3A 4U2KA 5ETJA 3G6WA 2ZKLA 2Q5HA 4XWGA 4U2DA 4XH9B 1FU7A 1T3SA 4IHKA 4Q4CA 1I5EA 3UJ3X 1YR2A 4XVHA 3NM6B 4OQDA 5K01A 1NBWB 5T6BA 1NVXQ 3D4IA 3EVEA 4KLZA 2DPMA 5D5HA 4W5RA 2FFHA 2FSSA 3E48A 3PJDA 3SY8A 2G80A 4YYZA 2B5OA 4OI4A 3KOWA 4U4AA 2XUKA 3HYCA 1NXWA 1QPBA 1WNFA 4DDTA 1DKNA 1GUAA 3NX4A 5J40A 3ZLTA 2C07A 5DLPA 5C4MA 1NVGA 2XCIA 5LZ9A 3IMGA 2ZJZA 1H4SA 1IDOA 2IYVA 3LGXA 4K26A 1DCKA 5ECGC 3SHWA 2VZLA 4B8ZA 3NDPA 3ENVA 1XG5A 1ZRMA 3L0SA 4Y1FA 3PCXA 1T29A 1TA9A 2I6QA 2W93A 1Y6GA 1OA0A 5JADA 2A5FA 5EYPB 1JEQB 2C7GA 2LGJA 1G8KA 1E4YA 1PN3A 4YCSA 2EGGA 4GMKA 3SC6A 1Q1GA 1FQWA 3GDFA 2NNWB 3ANYB 3VKWA 3ZHTA 1L7AA 1KP2A 4EJFA 4N18A 5IT5A 5K3OA 2HI0A 3FNRA 2R7AA 4B84A 1L7OA 4GVPA 1HDXA 3LY8A 4JP8A 4YR9A 2HMUA 2ZJOA 4CODB 2QS9A 4UATA 4AZTA 3MOSA 2JDID 1L4GA 3CX3A 3UXMA 1S4MA