2KWIB

Ralb-rlip76 (ralbp1) complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
molecule keywords Ras-related protein Ral-B
molecule tags Transport protein, protein binding
source organism Homo sapiens
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwiB00
2KWHA 2XTLA 3CKDA 2X9YA 2X9XA 4J2CA 4L0RA 2X9WA 1IJ5A 3S4UA 2CA5A 2KWIB 2C5IT 4EYYR 2IC6A 3P7IA 1LRZA 1ZKEA 1LVFA 3N5LA 2C5KT 3QK6A 3CVRA 2K48A 1H7CA 1Z0PA 3L3PA 2G0UA 4FI5A 2MBGA 1QSDA 3FXDB 3QUJA 3TKLB 3FXEB 4DNDA 1IJ6A 2C5JA 2IC9A 3MXZA 4CQIA 4B6XA
chains in the Genus database with same CATH superfamily
5HEHA 4HWFA 2K5BB 4GYSA 2RPAA 5JRCB 2OLTA 2W61A 5L47A 1O3XA 5FY0A 3PUZF 2XAFB 4JYAT 5LHIB 4TWFA 3TLVA 5AQLB 4LFBT 4PFPA 1IBMT 4M1PA 2W4XA 4X1YE 2AE9A 5ABGA 5FVLA 4EIWA 2J62A 2YN6A 2DCFA 2I6HA 1I6ZA 4E7ZA 3RC3A 4QX7B 2WCAA 2JQ9A 3F57A 2X68A 2W63A 3AE3A 4G63A 3GN5B 3S4UA 4EOZB 3Q5XA 2C5IT 4PK5A 1MIWA 3JADA 2XQ4A 4B3TT 1UCUA 2FUPA 4YSZA 3AEEA 3SFDA 4H9PC 5AQRB 3UU3A 3I1AA 3Q2MA 1W0AA 3PTRB 1WRDA 2L8KA 4IDPA 2NW7A 1KFYA 2CBIA 3AEFA 2CWYA 5L3FB 4HFHA 4UIGA 1H7CA 1Z0PA 2WBLA 4I50E 5FXWA 1MIYA 1W9RA 1M7KA 3KBUA 3OPCA 1V9DA 5JR9C 3ZSTA 3NKZA 4C91A 4YHJA 4U72A 1LVFA 4H63H 4ILUA 4EV6A 3AE1A 2LRKA 2YINA 2V7JA 2V5DA 1G73A 2KNDA 4O4LE 4LMJA 4KP3C 4YTMA 4ZI3C 4I55E 3KVBA 2WWUA 5HXHA 1HG2A 2KXPB 4TWDA 2OV9A 4X62T 2B1EA 2LM9A 4YSYA 3B5MA 2KMFA 5CA1E 4L0RA 4EYUA 1GQEA 2CLYC 3VR9A 4HTEA 4IDQA 3A5XA 4PK6A 4EYYR 4ILAA 1WFDA 4PJJA 3N9OA 3HI2A 3NVOA 2QGSA 2X67A 4EEBA 4IE7A 2XQYA 5ABFB 2XPKA 5LJNA 5L4EA 4TV9E 4HFEA 2DHRA 2IUBA 4TNVA 2E8IA 3QB5K 4QXHB 4ZZBA 1IBKT 4DBRA 1BR2A 2BG9E 1OEDC 5JR9B 4YTNA 3ZN0B 1YXRA 1UGOA 3NWIA 5LB7B 2BKPA 2PBIA 4ANJA 4CXWA 4DR6T 4V1Av 4DV3T 3AA7B 2VURA 2N2NA 4XAXB 5IYZE 3PE0A 3GWHA 2XAGB 1XZYA 4JI8T 5CFBA 5J2UE 1J1JA 3TLSA 4N78D 1WR6A 4KMCA 3RGLA 3R84B 2ZM6T 3SOLA 4ZI3D 3EABA 4LF5T 4HGAA 1G8XA 2CLYB 3LBXB 1ZHCA 4LF6T 3CVRA 4LFCT 4X1KE 3OTOT 3VHLA 4HFCA 5FY7A 2WY2A 1X79A 4CN6A 1NWMX 3NRYA 2H7OA 1MMGA 2W2UA 2UXDT 4DV6T 4KX6A 2QYWA 4JLEA 5H6RB 1UX5A 5L3CB 4OYKA 2RP4A 3UQ4A 1N36T 1OEDB 2VASA 3AA0B 1HR0T 2E9XA 3C51A 4WBNE 2YU2A 2X9XA 2BDEA 5L3GB 4KHPT 2XQ3A 3QB5A 3O4XE 4IREA 4P09A 5LBQB 5LBMA 1KK7A 3CPZA 3EAMA 2CE7A 1WYCA 4Q25A 5BR8T 4ZS3A 2IC6A 2JQKA 1D1AA 2Q9QA 5LA6E 4DV0T 1J5ET 4OX9T 5LJMA 3O1HA 2WZHA 4BJMA 4A56A 4HFBA 5IHYA 4DR7T 4GKJT 2BBHA 3NBXX 5JDNA 2A9UA 3QC9A 2LT3A 3LDQB 5ABEA 4CI3B 2CWOA 3UULA 4Z8XA 4ZI2C 4O2AE 3B57A 2D2SA 1D0XA 2LSKA 2XQAA 2C0SA 4IE6A 4IDOA 4O2BE 5HCMA 4IDZA 5LMUT 3SWHA 3AAEB 3HKCE 2UXBT 3L8RA 4EB6E 4AKLA 1HG5A 1UUSA 2EHOC 3RYIE 4AIUA 4G2AA 4HFDA 2NW9A 2MPKA 1MNEA 4O4HE 4P0BA 1VRBA 3PURA 3D0TA 4JBWF 3A7MA 2W00A 2WMNA 3AEAA 2UU9T 2ES0A 5HXEA 4CXXA 3AXJB 3RYHE 4QH4A 3AA1B 5C2TA 3RYCE 1US7B 5M4YA 5DQWA 3JC6D 3RC8A 1X9BA 1Z8UA 5H6QB 3SRZA 3SFEA 2IIUA 2CRBA 2W62A 3ONJA 2KZ7B 4GK0E 4KUMB 5LHHB 4ZI2D 2I0MA 2BS2A 2VVSA 5GONE 1LKXA 3TLTA 4KBMB 2E9XD 2WSSV 2EHOB 5DQVA 4TN7B 4H9OC 5CA0E 2LE8A 4NPPA 2LHNA 1HNXT 3F31A 5AFUL 5J0ZA 2PJQA 3C4WA 5FKYA 3ONXA 4DV2T 2N9DA 3L09A 2EHOD 3CIRA 5IUXA 4QX8B 4U33A 4DUZT 3K3QC 3RQWA 4I43B 2WU5A 4I4TE 5JTGA 4H63V 4YT0A 2K24A 2XM2A 3CK6A 4TNWA 4QH5A 3J7Yq 4IL9A 1N34T 4PW8A 3QNUA 4JI1T 4P0AA 3N9QA 1I94T 5FXVA 4OYJA 5JVDE 2QVAA 1KEYA 1XNRT 4UF0B 3IA3A 3AECA 2E2AA 2WP9A 1D1BA 3LK3B 4YJ3E 4AISA 2NW8A 4MALA 2BG9C 5C3JA 4UV8B 2YOEA 1T98A 3M3ZB 5AQVB 2XQ7A 2ZM0A 1T7SA 3CMLA 1DU2A 2DNXA 1S35A 5EK3A 2HHHT 1EZ3A 5F5WA 1SE7A 4ZXLA 2XAHB 4UV9B 3A8YC 2R6GF 1Y64B 4AQFA 1AJ3A 4JI4T 5HYAA 4ADZA 3I9YA 1HX1B 3CX6B 2JIWA 2CPTA 3GA8A 1MMDA 3IBPA 4UR9A 2ODUA 1R8IA 4IE0A 4DR5T 2H3RA 4JUYA 2JMHA 2XAQB 4DR2T 3AAAB 2W67A 4YLHA 2VKDA 5DJQC 2V1DB 5FNVE 2WU2A 2LOPA 4ZOLE 3TKLB 3N9LA 4IGUA 5F3JA 3K8PC 2BG9B 1IBLT 1ZP0A 3C98B 3NZPA 3MK7C 3UU5A 4PK4A 1MMAA 3PUSA 2J4GA 2V6XA 5L4HA 4A97A 3ZC1A 3O9XA 2DLRA 3PDYA 2NOXA 2XUEA 3VU7H 4P1NA 4EEDA 2XM1A 3LK42 2XSAA 2CHOA 4NUVA 5JDLA 3Q9DA 2Z6EA 4O4JE 1YW0A 4QWNB 2V6YB 3N2GE 3KDSE 2PTFA 2H88A 2YKSA 4U74A 1FIOA 5LMNT 4YTPA 2XJ7A 5DABA 4DIDB 3L39A 1XDPA 2BS3A 2M6IA 2KLQA 3B13A 3CKDA 4QXCB 1HF8A 3MZKB 3RRCA 2M67A 2N1GA 2A2FX 1NENA 2MBGA 4QH1A 2Y6XA 2BVLA 4NXNT 2ACZA 2OA5A 1HNWT 3RYFE 3ANWB 3FZKB 3ZPOA 3O1JA 4UXNB 4B6XA 3BQLA 2V5CA 1MIVA 1S94A 2VVNA 3PU8A 3DP7A 4AQYT 4UELA 1JNRA 3FZLB 4QKNA 4TX5A 5AQTB 3T1HT 5AQKB 1KF6A 4OHFA 4TV8E 1HFAA 5J1GA 2YEVC 4AKIA 2PG8A 1KNRA 3SS1A 2LM2A 2UUBT 3LFMA 2X51A 2E5LT 4EXTA 5JQGE 3UUMA 5HXRA 2XQ9A 3P4QA 5LXTE 5HCJA 3FBLA 3U3IA 4JEHB 5KXJA 4Z90A 3ZKRA 3OKQA 2IDOB 2IW5B 2VQFT 3PV0F 2WDVA 3MKDA 4L9IA 3CWZB 4PNIA 2UXCT 4DVDA 3UU4A 1T8BA 5LGNB 2CA5A 3KV9A 1OWAA 3IEEA 4U7YA 5LHGB 3H3AA 3ZMZB 3I0OA 3AE4A 4U31A 2BZBA 2V7MA 3E08A 2ODVA 4EGWA 4L5GA 5AQPB 3EI0A 3RIUA 2HN2A 4DV5T 2WDQA 4XBFB 4X1IE 2CCQA 2WB5A 2D9DA 5KMGP 3CQXC 4EZHA 2VKOA 1IJ5A 5IWAT 3KFWX 2CHNA 5FXZA 3AVSA 2JPFA 3AE5A 5LG4A 3ZT6A 2IC9A 4HWHA 1UURA 3EVYA 1XWMA 3ZEFB 3FBZA 4TZ4C 4DMWA 2L9QA 2BVMA 3PJAJ 4CZZB 3UQ7A 3N5LA 4KI0F 4FI5A 3CX8B 4B3RT 1IZNB 2VKHA 1U5PA 4EZ4A 3PUXF 5AQUB 4ZEYA 3JC6C 3UTKA 4JI0T 2XTLA 3PUQA 3CQGB 2D0UA 2VWAA 4IHJE 4WW0A 3FZFB 3HL6A 3UUNA 2XQ8A 2E5VA 2VQET 5AQQB 3BK9A 5C8YE 4B3ST 4H9SE 3ZSSA 2E9XC 5AQSB 5AQJB 5HEUA 3ETVA 2ZMAA 2WS3A 2KINB 2KT9A 2YU1A 3WAJA 1E2AA 4YXDA 5HWYA 5JREA 4GOUA 2LHRA 2LSGA 1Y01A 3AB3B 4YHHT 2XZEA 4QHOA 2X66A 5FMNA 3ZMVB 4H9NC 2KWIB 1VCTA 3CX7B 2G0UA 5HEOA 2Q9QC 1CUNA 3Q5DA 2HN1A 5JRCA 4C90A 4A98A 3VRBA 4KHZF 4F8HA 1XMQT 2JJ9A 4J2CA 1D0YA 4IT4A 2Y8DA 4ZHQE 4JI6T 1SA0E 1LRZA 4COFA 4MHCA 4K0KT 4NUUA 3KV4A 2C5JA 3DJBA 4JV5T 3RH3A 3UU8A 3AA6B 2XY8B 3ZMSB 3MJXA 3KBTA 3KINB 5EK2A 2E9XB 5EZYE 3O1IA 5AQHB 1N32T 1D1CA 5AQGB 1YKHB 1N33T 4LF7T 3E0ZA 3GN5A 4MBQA 1HX8A 4AKRB 1YKEB 2A72A 2JRKA 4U2ZA 2BKNA 4AI6A 5LGUB 2DL1A 3PU3A 5A1LA 4IE5A 2C5KT 3JAEA 3PUYF 1W09A 4HKAA 2H7VC 4DNDA 3ZC0A 1KNZA 1U4QA 3LSVA 3N2KE 4LFAT 2FJBA 4DV4T 3BQKA 3ZN1B 4NIQA 3H3MA 4TWHA 3ZCJA 2Q9QD 2X9HA 3ESLA 3TLUA 5AQMB 4JI7T 5J2TE 2UUAT 4JI5T 2D0TA 1VCSA 4U2YA 4PJMA 5ADXL 4I0UA 4TUYE 2WM9A 1MMNA 3RRWA 5FYMA 5HEGA 4DBQA 2XASB 2CM0A 4ZS2A 5JDGA 2V7KA 3ZCIA 3PUAA 2V6YA 1BR0A 2ZM2A 3RIFA 3ZMTB 5L3BB 4DV7T 3AE2A 4O8SA 1ZKEA 2XQ5A 5TAOA 4HEAA 4ERRA 3ZYLA 1FJGT 3KV6A 4GYRA 3I0QA 5KX5E 3RF1A 4PJLA 2X9YA 4IIJE 2D5UA 5EK4A 3X1DA 5FVKA 5ABFA 3ANWA 1E1HB 5LYJE 2LEHA 4ISTA 3N9NA 1HTJF 2XSBA 1YQ4A 3LG7A 4WYVA 2UXXB 2YK0A 5JR9A 2LKGA 2W66A 4BJNA 4WBOA 3QOFA 3VKGA 4DV1T 4CXYA 1HNZT 2K48A 5ETWA 2FJAA 1ZV4X 4X5TA 3N9MA 3M65A 2V26A 4AKGA 3P4SA 2K3WA 4DO0A 2BBJA 3K3NA 4NXMT 3HA4A 3PUWF 2H89A 4ILBA 4ISSA 3PUVF 3E22E 4CI2B 2JQHA 2NP9A 3OVUA 5ABHA 3LBXA 3HKDE 2KWHA 3EDVA 4IL4A 3AE7A 4H9RC 4OK0A 3H37A 1XMOT 5BMVE 5LG3A 1ZOYA 4WZXA 4UVBB 3G06A 2YDQA 1J5WA 3AVRA 2MTQA 3W15B 2CXFA 4IDNA 1OEDA 3ZT7A 2M6BA 5FP3A 3UUBA 4AQFC 4O4IE 1L0VA 3UT5E 2SPCA 3AE6A 4U3CA 3UFGA 3VKHA 2WAUA 2QRXA 3BQIA 3ZJ1A 4LF8T 3WI3A 4HFVA 4QXBB 1ZEEA 2DI4A 5HXSA 1W0BA 3LK2B 5FY1A 2VL0A 5CJ5A 1WYBA 2J1DG 1QUUA 4YSXA 2LLYA 4IE4A 4UVAB 4XZCA 4BA9A 1XDOA 4UVCB 2LSIA 3OYXA 3R6NA 2WZIA 3UFEA 3KVAA 4PAGA 2VKJA 2CEAA 3MA9A 3K1SA 5JDHA 1E7PA 4PJNA 3P4WA 2ZLYA 2LSJA 2YDRA 4HWDA 3EDUA 4MFRA 5LCYA 5FL1A 3AEBA 2X9WA 4JEUB 3V5SA 4GIWA 3P50A 2FBWA 2CXLA 1UX4A 2WQYA 1YD8G 3JCFA 4HE8A 2V8SV 2QA7A 4H9QC 3MXZA 3ONLC 3C4XA 2X0LB 3Q5WA 4ILCA 3OBVE 4CN4A 4YY3T 5AQOB 4GK5E 3J9X1 3F2EA 2CBJA 3RPUA 3KV5A 2LRLA 4YJ2E 2F4VT 4DMVA 3JAFA 1CHUA 5L2LA 1LVKA 3NZQA 5E0OA 2Y48B 4ZI7E 4PFOA 2BS4A 3C50A 5CB4E 3GMIA 1M62A 2MYSA 3EHZA 2WMOA 3EUHA 3NRXA 2XQ6A 3AXJA 5LNKA 3FXEB 3IF8B 2VL8A 2I59A 2V7IA 3PJAA 4OFZA 1SHZC 5JDFA 4A5XA 2L3LA 3I9WA 4DR1T 4AKHA 5FXXA 4Z91A 1D0ZA 1KNPA 4CN1A 2IMLA 1BR1A 3ZT5A 3Q5EA 1BR4A 2CMRA 2MOZA 4LMLA 4LMKA 2GK9A 3HKEE 2K9AA 4X64T 3QK6A 2EHOA 3FZHB 3C64A 3V5UA 1NAFA 3ETUA 2WWVA 2ACXA 1B7TA 5JH7E 5LOVE 1VOMA 2JMKA 3RKOA 1HS7A 3FHNA 4DR4T 1NEKA 1WCRA 3P7IA 3N2OA 3RLFF 2FJDA 3RIUC 2P9BA 4JI3T 1IAPA 3P8CD 3T8OA 3U78A 2LOSA 4MLKA 2CXDA 3RX6A 4YFSA 2BKOA 3AE8A 1T72A 3ZLIA 4BAYB 4DR3T 4DUYT 1IJ6A 3ZYKA 2ZM8A 4EAHA 5AQNB 2LSYA 5L3DB 1UK5A 2UXNB 2XAJB 2HH7A 1WLXA 2PFVA 5LGTB 1OEDE 4UF0A 1FMVA 3FB2A 4LF4T 1XNQT 4HWCA 3HKBE 1FMWA 3L3PA 4HWIB 5FL0A 2HPLA 2AXDS 3K3OA 3ZJ2A 4ZZCA 3AEDA 5AQFB 4F6RC 3TLWA 4HN9A 3PUGA 2V7LA 1OXZA 3P4PA 5JDMA 1FEWA 3UUXB 2UUCT 3ZYMA 4AQGA 5F8PA 3RIAA 2WDRA 2NTYA 3AAIA 1JNZA 2IAKA 5L3EB 2KSRA 2VK9A 4GKKT 5AQIB 5HWXA 2J47A 3P4RA 3ZMUB 3MACA 4UEMA 3N9PA 2IHR1 5HEJA 2DWGA 3HR0A 3VRAA 3RHWA 3ABVA 1YQ3A 2B76A 4K0UA 5LP6E 3WAKA 5HAXA 5JDQA 2JQQA 2NR4A 2YDSA 2HPJA 1QSDA 3C4ZA 2Q9QB 4FJOA 2RA1A 4CQIA 3LJCA 5CGMA 2W0GA 2MAWA 2X0HA 4WNKA 3OJAA 3T1YT 2BG9A 2NWBA 4X65T 2LJLA 3UU6A 2NTXA 4B3MT 2X0YA 3FXDB 5KDMC 3QUJA 1HCIA 1SUMB 4HFIA 3DTOA 2LKHA 3FZMB 4JI2T 1QLBA 3RI5A 3CQCB 2A3DA 4X20E 2DWKA 3RKGA 1WR0A 2XHEB 3VR8A 3RQUA 5HXCA 3OYZA 3IHRA 4AXPA 1MNDA 4U7IA 4X66T 4LF9T 4E7SA 3AE9A 2FJEA 2VB6A 3AEGA 4ASKA 4CI1B
chains in the Genus database with same CATH topology
3ZJ1A 5HXEA 4CXXA 2K5BB 4GYSA 5KMGP 3CQXC 5JRCB 4EZHA 2W61A 2VKOA 1IJ5A 3WI3A 4HFVA 3RYHE 4QXBB 1ZEEA 2DI4A 3AA1B 5HXSA 1O3XA 5FY0A 3LK2B 3KFWX 5FY1A 2XAFB 1WYBA 2J1DG 1QUUA 5FXZA 5LHIB 4IE4A 3AVSA 4UVAB 4XZCA 3RYCE 2JPFA 1US7B 5M4YA 5DQWA 5LG4A 3JC6D 4BA9A 3RC8A 5H6QB 4UVCB 2IC9A 2LSIA 3SRZA 4PFPA 3OYXA 3EVYA 3R6NA 3ZEFB 3FBZA 4TZ4C 4DMWA 4M1PA 3UFEA 3KVAA 4PAGA 2L9QA 2VKJA 4X1YE 2CEAA 2BVMA 2W62A 3MA9A 2KZ7B 4GK0E 4CZZB 5JDHA 4EIWA 3N5LA 4KUMB 5LHHB 4ZI2D 4FI5A 3CX8B 4PJNA 5GONE 1LKXA 2DCFA 1IZNB 2ZLYA 4E7ZA 2VKHA 1U5PA 2LSJA 4KBMB 4EZ4A 3RC3A 2E9XD 2WSSV 3JC6C 4QX7B 2EHOB 3UTKA 5DQVA 3EDUA 3F57A 4MFRA 2XTLA 5LCYA 2X68A 2W63A 3PUQA 4TN7B 4H9OC 5CA0E 2LE8A 4G63A 2X9WA 3CQGB 2LHNA 3GN5B 4GIWA 4JEUB 3V5SA 2D0UA 3S4UA 4EOZB 2VWAA 3Q5XA 2C5IT 4IHJE 3F31A 2CXLA 1UX4A 5AFUL 4WW0A 2PJQA 4PK5A 1YD8G 3C4WA 3HL6A 1MIWA 3ONXA 2N9DA 3L09A 3UUNA 2EHOD 4HE8A 2QA7A 1UCUA 4H9QC 3BK9A 5C8YE 3MXZA 4H9PC 3C4XA 2X0LB 3Q5WA 4H9SE 3I1AA 3Q2MA 4QX8B 2E9XC 3OBVE 3K3QC 4I43B 3PTRB 1WRDA 3ETVA 2L8KA 2NW7A 4I4TE 4GK5E 3J9X1 4H63V 2ZMAA 2CWYA 3F2EA 5L3FB 2KINB 4UIGA 1H7CA 1Z0PA 2WBLA 2KT9A 4I50E 2K24A 2YU1A 3RPUA 3WAJA 3KV5A 5FXWA 4YJ2E 4DMVA 1MIYA 3J7Yq 5L2LA 5HWYA 3KBUA 1LVKA 3NZQA 5JREA 4GOUA 2LHRA 2LSGA 3AB3B 5E0OA 4PW8A 2Y48B 4QHOA 2X66A 4ZI7E 5FMNA 1V9DA 4P0AA 3N9QA 4PFOA 3ZMVB 5JR9C 3C50A 5CB4E 4C91A 3GMIA 4YHJA 4H9NC 5FXVA 2KWIB 4U72A 4OYJA 3CX7B 1LVFA 5JVDE 4H63H 2MYSA 4ILUA 2WMOA 2G0UA 3EUHA 2Q9QC 3NRXA 4UF0B 1CUNA 5LNKA 3FXEB 3IF8B 2YINA 5JRCA 4C90A 2VL8A 2I59A 2V7JA 2V7IA 1G73A 4OFZA 2JJ9A 2KNDA 4O4LE 1D1BA 3LK3B 1SHZC 4J2CA 1D0YA 2Y8DA 4KP3C 5JDFA 4ZHQE 1SA0E 4YJ3E 4ZI3C 4I55E 3KVBA 2WWUA 1LRZA 2NW8A 2L3LA 5HXHA 4MHCA 4MALA 1HG2A 2KXPB 4NUUA 3I9WA 3KV4A 4AKHA 5FXXA 4UV8B 2C5JA 3DJBA 2B1EA 1D0ZA 3RH3A 2LM9A 3AA6B 1BR1A 1T98A 2KMFA 3ZMSB 1BR4A 2CMRA 2MOZA 5CA1E 3MJXA 4L0RA 3KBTA 4EYUA 2CLYC 3KINB 2ZM0A 5EK2A 2GK9A 2E9XB 4HTEA 3HKEE 3CMLA 5EZYE 3A5XA 4PK6A 3O1IA 2K9AA 2DNXA 4EYYR 1S35A 4PJJA 3N9OA 3QK6A 5EK3A 1EZ3A 3HI2A 1D1CA 2QGSA 2X67A 2EHOA 1YKHB 3C64A 4IE7A 2XAHB 4UV9B 1NAFA 2XQYA 3ETUA 3V5UA 3E0ZA 3GN5A 5LJNA 2ACXA 4TV9E 1B7TA 5JH7E 4MBQA 2DHRA 5LOVE 1Y64B 2E8IA 1VOMA 1HX8A 4AKRB 1YKEB 2A72A 2JRKA 4QXHB 2JMKA 4AQFA 4AI6A 3RKOA 5LGUB 1HS7A 3PU3A 1AJ3A 3FHNA 5HYAA 4DBRA 1BR2A 4ADZA 4IE5A 3I9YA 5A1LA 3P7IA 5JR9B 3N2OA 2C5KT 3CX6B 3GA8A 1MMDA 3IBPA 2P9BA 2H7VC 4HKAA 3ZN0B 2ODUA 4DNDA 4IE0A 3ZC0A 1KNZA 2PBIA 4ANJA 4CXWA 2H3RA 1IAPA 1U4QA 3P8CD 3T8OA 4JUYA 3U78A 4V1Av 3AA7B 2JMHA 2XAQB 3AAAB 2N2NA 2LOSA 3N2KE 4XAXB 4MLKA 4YLHA 5IYZE 2CXDA 3PE0A 3RX6A 2VKDA 3BQKA 3ZN1B 5DJQC 2V1DB 3GWHA 2XAGB 5FNVE 3ZCJA 2LOPA 2Q9QD 4YFSA 2X9HA 3ESLA 3ZLIA 4BAYB 4ZOLE 3TKLB 3N9LA 4IGUA 5F3JA 3K8PC 1IJ6A 3C98B 2ZM8A 3NZPA 3ZYKA 4EAHA 2LSYA 5L3DB 3MK7C 5J2UE 2UXNB 2XAJB 5J2TE 2HH7A 2D0TA 4PK4A 4N78D 1WR6A 4KMCA 1WLXA 3R84B 3SOLA 1MMAA 2PFVA 4PJMA 5LGTB 3PUSA 5ADXL 4UF0A 4ZI3D 1FMVA 3FB2A 4TUYE 2WM9A 4HGAA 1MMNA 1G8XA 3ZC1A 2CLYB 3LBXB 3RRWA 1ZHCA 5FYMA 4DBQA 3O9XA 3CVRA 3HKBE 1FMWA 2XASB 3L3PA 2DLRA 2CM0A 4ZS2A 3PDYA 2V7KA 5JDGA 4X1KE 2NOXA 2XUEA 3VU7H 2HPLA 3VHLA 3PUAA 5FY7A 3ZCIA 3K3OA 3LK42 3ZJ2A 1X79A 4NUVA 1BR0A 1NWMX 2ZM2A 5JDLA 3NRYA 2H7OA 3ZMTB 3Q9DA 1MMGA 5L3BB 2Z6EA 4F6RC 4O4JE 4JLEA 4O8SA 1YW0A 4QWNB 5H6RB 1UX5A 4HN9A 3N2GE 5L3CB 3PUGA 1ZKEA 2V7LA 5TAOA 3KDSE 2RP4A 1OXZA 4OYKA 5JDMA 4HEAA 1FEWA 4U74A 4ERRA 3ZYLA 3UUXB 1FIOA 3ZYMA 3KV6A 2VASA 4GYRA 3AA0B 5DABA 4AQGA 2E9XA 3C51A 5F8PA 3I0QA 2NTYA 4WBNE 5KX5E 2YU2A 2KLQA 3AAIA 4PJLA 3B13A 3CKDA 2X9YA 2IAKA 2X9XA 4IIJE 2D5UA 4QXCB 1HF8A 2BDEA 3MZKB 5EK4A 5L3EB 5L3GB 3O4XE 3ANWA 3RRCA 2VK9A 2M67A 2N1GA 4P09A 2A2FX 5LBQB 1E1HB 5HWXA 5LYJE 5LBMA 1KK7A 2MBGA 2LEHA 3ZMUB 3MACA 2Y6XA 2BVLA 4UEMA 3N9PA 4ISTA 3N9NA 3CPZA 1HTJF 2OA5A 2CE7A 3RYFE 3ANWB 3LG7A 3ZPOA 2DWGA 3O1JA 4UXNB 4B6XA 2UXXB 2YK0A 5JR9A 1WYCA 3BQLA 1MIVA 1S94A 3HR0A 3PU8A 4BJNA 4WBOA 3DP7A 4UELA 4ZS3A 3VKGA 2IC6A 4QKNA 1D1AA 2Q9QA 4K0UA 5LP6E 4TX5A 4CXYA 3WAKA 5HAXA 5LA6E 2K48A 5ETWA 5LJMA 3O1HA 1ZV4X 2JQQA 5JDQA 3N9MA 3M65A 2HPJA 1QSDA 4BJMA 4OHFA 2V26A 3C4ZA 4TV8E 1HFAA 4A56A 4AKGA 5J1GA 2YEVC 2Q9QB 4FJOA 4AKIA 2PG8A 2RA1A 4CQIA 3LJCA 2W0GA 5IHYA 3SS1A 4WNKA 3NBXX 4DO0A 5JDNA 3K3NA 3LFMA 3OJAA 3QC9A 2X51A 2LT3A 3HA4A 4CI3B 4EXTA 5JQGE 3UUMA 2CWOA 2NWBA 5HXRA 2LJLA 3UULA 2NTXA 5LXTE 4Z8XA 4ZI2C 3FBLA 4O2AE 3B57A 3FXDB 4JEHB 3U3IA 2D2SA 5KDMC 3QUJA 1D0XA 2LSKA 1HCIA 4ISSA 3E22E 2C0SA 4CI2B 2NP9A 3OKQA 2IW5B 3DTOA 3MKDA 4L9IA 3LBXA 3CWZB 3HKDE 2KWHA 4PNIA 3EDVA 4IE6A 4DVDA 4O2BE 4H9RC 4OK0A 5LGNB 2CA5A 3H37A 5BMVE 4IDZA 3KV9A 1OWAA 3IEEA 3SWHA 5LHGB 3AAEB 3CQCB 3HKCE 3H3AA 2A3DA 4UVBB 4X20E 3I0OA 3ZMZB 4EB6E 4AKLA 2DWKA 1HG5A 2XHEB 2BZBA 2EHOC 2V7MA 3RYIE 4G2AA 3E08A 2ODVA 2NW9A 3AVRA 2MTQA 4L5GA 2CXFA 3W15B 5HXCA 1MNEA 4O4HE 4P0BA 5FP3A 4AQFC 3OYZA 4O4IE 3UT5E 1VRBA 2SPCA 3IHRA 4AXPA 3PURA 3D0TA 1MNDA 2W00A 4E7SA 4XBFB 4X1IE 2WMNA 2VB6A 4ASKA 4CI1B 2CCQA 3VKHA 2ES0A 2WAUA 3BQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWH A;  2XTL A;  3CKD A;  2X9Y A;  2X9X A;  4J2C A;  4L0R A;  2X9W A;  1IJ5 A;  3S4U A;  2CA5 A;  2KWI B;  2C5I T;  4EYY R;  2IC6 A;  3P7I A;  1LRZ A;  1ZKE A;  1LVF A;  3N5L A;  2C5K T;  3QK6 A;  3CVR A;  2K48 A;  1H7C A;  1Z0P A;  3L3P A;  2G0U A;  4FI5 A;  2MBG A;  1QSD A;  3FXD B;  3QUJ A;  3TKL B;  3FXE B;  4DND A;  1IJ6 A;  2C5J A;  2IC9 A;  3MXZ A;  4CQI A;  4B6X A; 
#chains in the Genus database with same CATH topology
 5HEH A;  4HWF A;  2K5B B;  4GYS A;  2RPA A;  5JRC B;  2OLT A;  2W61 A;  5L47 A;  1O3X A;  5FY0 A;  3PUZ F;  2XAF B;  4JYA T;  5LHI B;  4TWF A;  3TLV A;  5AQL B;  4LFB T;  4PFP A;  1IBM T;  4M1P A;  2W4X A;  4X1Y E;  2AE9 A;  5ABG A;  5FVL A;  4EIW A;  2J62 A;  2YN6 A;  2DCF A;  2I6H A;  1I6Z A;  4E7Z A;  3RC3 A;  4QX7 B;  2WCA A;  2JQ9 A;  3F57 A;  2X68 A;  2W63 A;  3AE3 A;  4G63 A;  3GN5 B;  3S4U A;  4EOZ B;  3Q5X A;  2C5I T;  4PK5 A;  1MIW A;  3JAD A;  2XQ4 A;  4B3T T;  1UCU A;  2FUP A;  4YSZ A;  3AEE A;  3SFD A;  4H9P C;  5AQR B;  3UU3 A;  3I1A A;  3Q2M A;  1W0A A;  3PTR B;  1WRD A;  2L8K A;  4IDP A;  2NW7 A;  1KFY A;  2CBI A;  3AEF A;  2CWY A;  5L3F B;  4HFH A;  4UIG A;  1H7C A;  1Z0P A;  2WBL A;  4I50 E;  5FXW A;  1MIY A;  1W9R A;  1M7K A;  3KBU A;  3OPC A;  1V9D A;  5JR9 C;  3ZST A;  3NKZ A;  4C91 A;  4YHJ A;  4U72 A;  1LVF A;  4H63 H;  4ILU A;  4EV6 A;  3AE1 A;  2LRK A;  2YIN A;  2V7J A;  2V5D A;  1G73 A;  2KND A;  4O4L E;  4LMJ A;  4KP3 C;  4YTM A;  4ZI3 C;  4I55 E;  3KVB A;  2WWU A;  5HXH A;  1HG2 A;  2KXP B;  4TWD A;  2OV9 A;  4X62 T;  2B1E A;  2LM9 A;  4YSY A;  3B5M A;  2KMF A;  5CA1 E;  4L0R A;  4EYU A;  1GQE A;  2CLY C;  3VR9 A;  4HTE A;  4IDQ A;  3A5X A;  4PK6 A;  4EYY R;  4ILA A;  1WFD A;  4PJJ A;  3N9O A;  3HI2 A;  3NVO A;  2QGS A;  2X67 A;  4EEB A;  4IE7 A;  2XQY A;  5ABF B;  2XPK A;  5LJN A;  5L4E A;  4TV9 E;  4HFE A;  2DHR A;  2IUB A;  4TNV A;  2E8I A;  3QB5 K;  4QXH B;  4ZZB A;  1IBK T;  4DBR A;  1BR2 A;  2BG9 E;  1OED C;  5JR9 B;  4YTN A;  3ZN0 B;  1YXR A;  1UGO A;  3NWI A;  5LB7 B;  2BKP A;  2PBI A;  4ANJ A;  4CXW A;  4DR6 T;  4V1A v;  4DV3 T;  3AA7 B;  2VUR A;  2N2N A;  4XAX B;  5IYZ E;  3PE0 A;  3GWH A;  2XAG B;  1XZY A;  4JI8 T;  5CFB A;  5J2U E;  1J1J A;  3TLS A;  4N78 D;  1WR6 A;  4KMC A;  3RGL A;  3R84 B;  2ZM6 T;  3SOL A;  4ZI3 D;  3EAB A;  4LF5 T;  4HGA A;  1G8X A;  2CLY B;  3LBX B;  1ZHC A;  4LF6 T;  3CVR A;  4LFC T;  4X1K E;  3OTO T;  3VHL A;  4HFC A;  5FY7 A;  2WY2 A;  1X79 A;  4CN6 A;  1NWM X;  3NRY A;  2H7O A;  1MMG A;  2W2U A;  2UXD T;  4DV6 T;  4KX6 A;  2QYW A;  4JLE A;  5H6R B;  1UX5 A;  5L3C B;  4OYK A;  2RP4 A;  3UQ4 A;  1N36 T;  1OED B;  2VAS A;  3AA0 B;  1HR0 T;  2E9X A;  3C51 A;  4WBN E;  2YU2 A;  2X9X A;  2BDE A;  5L3G B;  4KHP T;  2XQ3 A;  3QB5 A;  3O4X E;  4IRE A;  4P09 A;  5LBQ B;  5LBM A;  1KK7 A;  3CPZ A;  3EAM A;  2CE7 A;  1WYC A;  4Q25 A;  5BR8 T;  4ZS3 A;  2IC6 A;  2JQK A;  1D1A A;  2Q9Q A;  5LA6 E;  4DV0 T;  1J5E T;  4OX9 T;  5LJM A;  3O1H A;  2WZH A;  4BJM A;  4A56 A;  4HFB A;  5IHY A;  4DR7 T;  4GKJ T;  2BBH A;  3NBX X;  5JDN A;  2A9U A;  3QC9 A;  2LT3 A;  3LDQ B;  5ABE A;  4CI3 B;  2CWO A;  3UUL A;  4Z8X A;  4ZI2 C;  4O2A E;  3B57 A;  2D2S A;  1D0X A;  2LSK A;  2XQA A;  2C0S A;  4IE6 A;  4IDO A;  4O2B E;  5HCM A;  4IDZ A;  5LMU T;  3SWH A;  3AAE B;  3HKC E;  2UXB T;  3L8R A;  4EB6 E;  4AKL A;  1HG5 A;  1UUS A;  2EHO C;  3RYI E;  4AIU A;  4G2A A;  4HFD A;  2NW9 A;  2MPK A;  1MNE A;  4O4H E;  4P0B A;  1VRB A;  3PUR A;  3D0T A;  4JBW F;  3A7M A;  2W00 A;  2WMN A;  3AEA A;  2UU9 T;  2ES0 A;  5HXE A;  4CXX A;  3AXJ B;  3RYH E;  4QH4 A;  3AA1 B;  5C2T A;  3RYC E;  1US7 B;  5M4Y A;  5DQW A;  3JC6 D;  3RC8 A;  1X9B A;  1Z8U A;  5H6Q B;  3SRZ A;  3SFE A;  2IIU A;  2CRB A;  2W62 A;  3ONJ A;  2KZ7 B;  4GK0 E;  4KUM B;  5LHH B;  4ZI2 D;  2I0M A;  2BS2 A;  2VVS A;  5GON E;  1LKX A;  3TLT A;  4KBM B;  2E9X D;  2WSS V;  2EHO B;  5DQV A;  4TN7 B;  4H9O C;  5CA0 E;  2LE8 A;  4NPP A;  2LHN A;  1HNX T;  3F31 A;  5AFU L;  5J0Z A;  2PJQ A;  3C4W A;  5FKY A;  3ONX A;  4DV2 T;  2N9D A;  3L09 A;  2EHO D;  3CIR A;  5IUX A;  4QX8 B;  4U33 A;  4DUZ T;  3K3Q C;  3RQW A;  4I43 B;  2WU5 A;  4I4T E;  5JTG A;  4H63 V;  4YT0 A;  2K24 A;  2XM2 A;  3CK6 A;  4TNW A;  4QH5 A;  3J7Y q;  4IL9 A;  1N34 T;  4PW8 A;  3QNU A;  4JI1 T;  4P0A A;  3N9Q A;  1I94 T;  5FXV A;  4OYJ A;  5JVD E;  2QVA A;  1KEY A;  1XNR T;  4UF0 B;  3IA3 A;  3AEC A;  2E2A A;  2WP9 A;  1D1B A;  3LK3 B;  4YJ3 E;  4AIS A;  2NW8 A;  4MAL A;  2BG9 C;  5C3J A;  4UV8 B;  2YOE A;  1T98 A;  3M3Z B;  5AQV B;  2XQ7 A;  2ZM0 A;  1T7S A;  3CML A;  1DU2 A;  2DNX A;  1S35 A;  5EK3 A;  2HHH T;  1EZ3 A;  5F5W A;  1SE7 A;  4ZXL A;  2XAH B;  4UV9 B;  3A8Y C;  2R6G F;  1Y64 B;  4AQF A;  1AJ3 A;  4JI4 T;  5HYA A;  4ADZ A;  3I9Y A;  1HX1 B;  3CX6 B;  2JIW A;  2CPT A;  3GA8 A;  1MMD A;  3IBP A;  4UR9 A;  2ODU A;  1R8I A;  4IE0 A;  4DR5 T;  2H3R A;  4JUY A;  2JMH A;  2XAQ B;  4DR2 T;  3AAA B;  2W67 A;  4YLH A;  2VKD A;  5DJQ C;  2V1D B;  5FNV E;  2WU2 A;  2LOP A;  4ZOL E;  3TKL B;  3N9L A;  4IGU A;  5F3J A;  3K8P C;  2BG9 B;  1IBL T;  1ZP0 A;  3C98 B;  3NZP A;  3MK7 C;  3UU5 A;  4PK4 A;  1MMA A;  3PUS A;  2J4G A;  2V6X A;  5L4H A;  4A97 A;  3ZC1 A;  3O9X A;  2DLR A;  3PDY A;  2NOX A;  2XUE A;  3VU7 H;  4P1N A;  4EED A;  2XM1 A;  3LK4 2;  2XSA A;  2CHO A;  4NUV A;  5JDL A;  3Q9D A;  2Z6E A;  4O4J E;  1YW0 A;  4QWN B;  2V6Y B;  3N2G E;  3KDS E;  2PTF A;  2H88 A;  2YKS A;  4U74 A;  1FIO A;  5LMN T;  4YTP A;  2XJ7 A;  5DAB A;  4DID B;  3L39 A;  1XDP A;  2BS3 A;  2M6I A;  2KLQ A;  3B13 A;  3CKD A;  4QXC B;  1HF8 A;  3MZK B;  3RRC A;  2M67 A;  2N1G A;  2A2F X;  1NEN A;  2MBG A;  4QH1 A;  2Y6X A;  2BVL A;  4NXN T;  2ACZ A;  2OA5 A;  1HNW T;  3RYF E;  3ANW B;  3FZK B;  3ZPO A;  3O1J A;  4UXN B;  4B6X A;  3BQL A;  2V5C A;  1MIV A;  1S94 A;  2VVN A;  3PU8 A;  3DP7 A;  4AQY T;  4UEL A;  1JNR A;  3FZL B;  4QKN A;  4TX5 A;  5AQT B;  3T1H T;  5AQK B;  1KF6 A;  4OHF A;  4TV8 E;  1HFA A;  5J1G A;  2YEV C;  4AKI A;  2PG8 A;  1KNR A;  3SS1 A;  2LM2 A;  2UUB T;  3LFM A;  2X51 A;  2E5L T;  4EXT A;  5JQG E;  3UUM A;  5HXR A;  2XQ9 A;  3P4Q A;  5LXT E;  5HCJ A;  3FBL A;  3U3I A;  4JEH B;  5KXJ A;  4Z90 A;  3ZKR A;  3OKQ A;  2IDO B;  2IW5 B;  2VQF T;  3PV0 F;  2WDV A;  3MKD A;  4L9I A;  3CWZ B;  4PNI A;  2UXC T;  4DVD A;  3UU4 A;  1T8B A;  5LGN B;  2CA5 A;  3KV9 A;  1OWA A;  3IEE A;  4U7Y A;  5LHG B;  3H3A A;  3ZMZ B;  3I0O A;  3AE4 A;  4U31 A;  2BZB A;  2V7M A;  3E08 A;  2ODV A;  4EGW A;  4L5G A;  5AQP B;  3EI0 A;  3RIU A;  2HN2 A;  4DV5 T;  2WDQ A;  4XBF B;  4X1I E;  2CCQ A;  2WB5 A;  2D9D A;  5KMG P;  3CQX C;  4EZH A;  2VKO A;  1IJ5 A;  5IWA T;  3KFW X;  2CHN A;  5FXZ A;  3AVS A;  2JPF A;  3AE5 A;  5LG4 A;  3ZT6 A;  2IC9 A;  4HWH A;  1UUR A;  3EVY A;  1XWM A;  3ZEF B;  3FBZ A;  4TZ4 C;  4DMW A;  2L9Q A;  2BVM A;  3PJA J;  4CZZ B;  3UQ7 A;  3N5L A;  4KI0 F;  4FI5 A;  3CX8 B;  4B3R T;  1IZN B;  2VKH A;  1U5P A;  4EZ4 A;  3PUX F;  5AQU B;  4ZEY A;  3JC6 C;  3UTK A;  4JI0 T;  2XTL A;  3PUQ A;  3CQG B;  2D0U A;  2VWA A;  4IHJ E;  4WW0 A;  3FZF B;  3HL6 A;  3UUN A;  2XQ8 A;  2E5V A;  2VQE T;  5AQQ B;  3BK9 A;  5C8Y E;  4B3S T;  4H9S E;  3ZSS A;  2E9X C;  5AQS B;  5AQJ B;  5HEU A;  3ETV A;  2ZMA A;  2WS3 A;  2KIN B;  2KT9 A;  2YU1 A;  3WAJ A;  1E2A A;  4YXD A;  5HWY A;  5JRE A;  4GOU A;  2LHR A;  2LSG A;  1Y01 A;  3AB3 B;  4YHH T;  2XZE A;  4QHO A;  2X66 A;  5FMN A;  3ZMV B;  4H9N C;  2KWI B;  1VCT A;  3CX7 B;  2G0U A;  5HEO A;  2Q9Q C;  1CUN A;  3Q5D A;  2HN1 A;  5JRC A;  4C90 A;  4A98 A;  3VRB A;  4KHZ F;  4F8H A;  1XMQ T;  2JJ9 A;  4J2C A;  1D0Y A;  4IT4 A;  2Y8D A;  4ZHQ E;  4JI6 T;  1SA0 E;  1LRZ A;  4COF A;  4MHC A;  4K0K T;  4NUU A;  3KV4 A;  2C5J A;  3DJB A;  4JV5 T;  3RH3 A;  3UU8 A;  3AA6 B;  2XY8 B;  3ZMS B;  3MJX A;  3KBT A;  3KIN B;  5EK2 A;  2E9X B;  5EZY E;  3O1I A;  5AQH B;  1N32 T;  1D1C A;  5AQG B;  1YKH B;  1N33 T;  4LF7 T;  3E0Z A;  3GN5 A;  4MBQ A;  1HX8 A;  4AKR B;  1YKE B;  2A72 A;  2JRK A;  4U2Z A;  2BKN A;  4AI6 A;  5LGU B;  2DL1 A;  3PU3 A;  5A1L A;  4IE5 A;  2C5K T;  3JAE A;  3PUY F;  1W09 A;  4HKA A;  2H7V C;  4DND A;  3ZC0 A;  1KNZ A;  1U4Q A;  3LSV A;  3N2K E;  4LFA T;  2FJB A;  4DV4 T;  3BQK A;  3ZN1 B;  4NIQ A;  3H3M A;  4TWH A;  3ZCJ A;  2Q9Q D;  2X9H A;  3ESL A;  3TLU A;  5AQM B;  4JI7 T;  5J2T E;  2UUA T;  4JI5 T;  2D0T A;  1VCS A;  4U2Y A;  4PJM A;  5ADX L;  4I0U A;  4TUY E;  2WM9 A;  1MMN A;  3RRW A;  5FYM A;  5HEG A;  4DBQ A;  2XAS B;  2CM0 A;  4ZS2 A;  5JDG A;  2V7K A;  3ZCI A;  3PUA A;  2V6Y A;  1BR0 A;  2ZM2 A;  3RIF A;  3ZMT B;  5L3B B;  4DV7 T;  3AE2 A;  4O8S A;  1ZKE A;  2XQ5 A;  5TAO A;  4HEA A;  4ERR A;  3ZYL A;  1FJG T;  3KV6 A;  4GYR A;  3I0Q A;  5KX5 E;  3RF1 A;  4PJL A;  2X9Y A;  4IIJ E;  2D5U A;  5EK4 A;  3X1D A;  5FVK A;  5ABF A;  3ANW A;  1E1H B;  5LYJ E;  2LEH A;  4IST A;  3N9N A;  1HTJ F;  2XSB A;  1YQ4 A;  3LG7 A;  4WYV A;  2UXX B;  2YK0 A;  5JR9 A;  2LKG A;  2W66 A;  4BJN A;  4WBO A;  3QOF A;  3VKG A;  4DV1 T;  4CXY A;  1HNZ T;  2K48 A;  5ETW A;  2FJA A;  1ZV4 X;  4X5T A;  3N9M A;  3M65 A;  2V26 A;  4AKG A;  3P4S A;  2K3W A;  4DO0 A;  2BBJ A;  3K3N A;  4NXM T;  3HA4 A;  3PUW F;  2H89 A;  4ILB A;  4ISS A;  3PUV F;  3E22 E;  4CI2 B;  2JQH A;  2NP9 A;  3OVU A;  5ABH A;  3LBX A;  3HKD E;  2KWH A;  3EDV A;  4IL4 A;  3AE7 A;  4H9R C;  4OK0 A;  3H37 A;  1XMO T;  5BMV E;  5LG3 A;  1ZOY A;  4WZX A;  4UVB B;  3G06 A;  2YDQ A;  1J5W A;  3AVR A;  2MTQ A;  3W15 B;  2CXF A;  4IDN A;  1OED A;  3ZT7 A;  2M6B A;  5FP3 A;  3UUB A;  4AQF C;  4O4I E;  1L0V A;  3UT5 E;  2SPC A;  3AE6 A;  4U3C A;  3UFG A;  3VKH A;  2WAU A;  2QRX A;  3BQI A;  3ZJ1 A;  4LF8 T;  3WI3 A;  4HFV A;  4QXB B;  1ZEE A;  2DI4 A;  5HXS A;  1W0B A;  3LK2 B;  5FY1 A;  2VL0 A;  5CJ5 A;  1WYB A;  2J1D G;  1QUU A;  4YSX A;  2LLY A;  4IE4 A;  4UVA B;  4XZC A;  4BA9 A;  1XDO A;  4UVC B;  2LSI A;  3OYX A;  3R6N A;  2WZI A;  3UFE A;  3KVA A;  4PAG A;  2VKJ A;  2CEA A;  3MA9 A;  3K1S A;  5JDH A;  1E7P A;  4PJN A;  3P4W A;  2ZLY A;  2LSJ A;  2YDR A;  4HWD A;  3EDU A;  4MFR A;  5LCY A;  5FL1 A;  3AEB A;  2X9W A;  4JEU B;  3V5S A;  4GIW A;  3P50 A;  2FBW A;  2CXL A;  1UX4 A;  2WQY A;  1YD8 G;  3JCF A;  4HE8 A;  2V8S V;  2QA7 A;  4H9Q C;  3MXZ A;  3ONL C;  3C4X A;  2X0L B;  3Q5W A;  4ILC A;  3OBV E;  4CN4 A;  4YY3 T;  5AQO B;  4GK5 E;  3J9X 1;  3F2E A;  2CBJ A;  3RPU A;  3KV5 A;  2LRL A;  4YJ2 E;  2F4V T;  4DMV A;  3JAF A;  1CHU A;  5L2L A;  1LVK A;  3NZQ A;  5E0O A;  2Y48 B;  4ZI7 E;  4PFO A;  2BS4 A;  3C50 A;  5CB4 E;  3GMI A;  1M62 A;  2MYS A;  3EHZ A;  2WMO A;  3EUH A;  3NRX A;  2XQ6 A;  3AXJ A;  5LNK A;  3FXE B;  3IF8 B;  2VL8 A;  2I59 A;  2V7I A;  3PJA A;  4OFZ A;  1SHZ C;  5JDF A;  4A5X A;  2L3L A;  3I9W A;  4DR1 T;  4AKH A;  5FXX A;  4Z91 A;  1D0Z A;  1KNP A;  4CN1 A;  2IML A;  1BR1 A;  3ZT5 A;  3Q5E A;  1BR4 A;  2CMR A;  2MOZ A;  4LML A;  4LMK A;  2GK9 A;  3HKE E;  2K9A A;  4X64 T;  3QK6 A;  2EHO A;  3FZH B;  3C64 A;  3V5U A;  1NAF A;  3ETU A;  2WWV A;  2ACX A;  1B7T A;  5JH7 E;  5LOV E;  1VOM A;  2JMK A;  3RKO A;  1HS7 A;  3FHN A;  4DR4 T;  1NEK A;  1WCR A;  3P7I A;  3N2O A;  3RLF F;  2FJD A;  3RIU C;  2P9B A;  4JI3 T;  1IAP A;  3P8C D;  3T8O A;  3U78 A;  2LOS A;  4MLK A;  2CXD A;  3RX6 A;  4YFS A;  2BKO A;  3AE8 A;  1T72 A;  3ZLI A;  4BAY B;  4DR3 T;  4DUY T;  1IJ6 A;  3ZYK A;  2ZM8 A;  4EAH A;  5AQN B;  2LSY A;  5L3D B;  1UK5 A;  2UXN B;  2XAJ B;  2HH7 A;  1WLX A;  2PFV A;  5LGT B;  1OED E;  4UF0 A;  1FMV A;  3FB2 A;  4LF4 T;  1XNQ T;  4HWC A;  3HKB E;  1FMW A;  3L3P A;  4HWI B;  5FL0 A;  2HPL A;  2AXD S;  3K3O A;  3ZJ2 A;  4ZZC A;  3AED A;  5AQF B;  4F6R C;  3TLW A;  4HN9 A;  3PUG A;  2V7L A;  1OXZ A;  3P4P A;  5JDM A;  1FEW A;  3UUX B;  2UUC T;  3ZYM A;  4AQG A;  5F8P A;  3RIA A;  2WDR A;  2NTY A;  3AAI A;  1JNZ A;  2IAK A;  5L3E B;  2KSR A;  2VK9 A;  4GKK T;  5AQI B;  5HWX A;  2J47 A;  3P4R A;  3ZMU B;  3MAC A;  4UEM A;  3N9P A;  2IHR 1;  5HEJ A;  2DWG A;  3HR0 A;  3VRA A;  3RHW A;  3ABV A;  1YQ3 A;  2B76 A;  4K0U A;  5LP6 E;  3WAK A;  5HAX A;  5JDQ A;  2JQQ A;  2NR4 A;  2YDS A;  2HPJ A;  1QSD A;  3C4Z A;  2Q9Q B;  4FJO A;  2RA1 A;  4CQI A;  3LJC A;  5CGM A;  2W0G A;  2MAW A;  2X0H A;  4WNK A;  3OJA A;  3T1Y T;  2BG9 A;  2NWB A;  4X65 T;  2LJL A;  3UU6 A;  2NTX A;  4B3M T;  2X0Y A;  3FXD B;  5KDM C;  3QUJ A;  1HCI A;  1SUM B;  4HFI A;  3DTO A;  2LKH A;  3FZM B;  4JI2 T;  1QLB A;  3RI5 A;  3CQC B;  2A3D A;  4X20 E;  2DWK A;  3RKG A;  1WR0 A;  2XHE B;  3VR8 A;  3RQU A;  5HXC A;  3OYZ A;  3IHR A;  4AXP A;  1MND A;  4U7I A;  4X66 T;  4LF9 T;  4E7S A;  3AE9 A;  2FJE A;  2VB6 A;  3AEG A;  4ASK A;  4CI1 B; 
#chains in the Genus database with same CATH homology
 3ZJ1 A;  5HXE A;  4CXX A;  2K5B B;  4GYS A;  5KMG P;  3CQX C;  5JRC B;  4EZH A;  2W61 A;  2VKO A;  1IJ5 A;  3WI3 A;  4HFV A;  3RYH E;  4QXB B;  1ZEE A;  2DI4 A;  3AA1 B;  5HXS A;  1O3X A;  5FY0 A;  3LK2 B;  3KFW X;  5FY1 A;  2XAF B;  1WYB A;  2J1D G;  1QUU A;  5FXZ A;  5LHI B;  4IE4 A;  3AVS A;  4UVA B;  4XZC A;  3RYC E;  2JPF A;  1US7 B;  5M4Y A;  5DQW A;  5LG4 A;  3JC6 D;  4BA9 A;  3RC8 A;  5H6Q B;  4UVC B;  2IC9 A;  2LSI A;  3SRZ A;  4PFP A;  3OYX A;  3EVY A;  3R6N A;  3ZEF B;  3FBZ A;  4TZ4 C;  4DMW A;  4M1P A;  3UFE A;  3KVA A;  4PAG A;  2L9Q A;  2VKJ A;  4X1Y E;  2CEA A;  2BVM A;  2W62 A;  3MA9 A;  2KZ7 B;  4GK0 E;  4CZZ B;  5JDH A;  4EIW A;  3N5L A;  4KUM B;  5LHH B;  4ZI2 D;  4FI5 A;  3CX8 B;  4PJN A;  5GON E;  1LKX A;  2DCF A;  1IZN B;  2ZLY A;  4E7Z A;  2VKH A;  1U5P A;  2LSJ A;  4KBM B;  4EZ4 A;  3RC3 A;  2E9X D;  2WSS V;  3JC6 C;  4QX7 B;  2EHO B;  3UTK A;  5DQV A;  3EDU A;  3F57 A;  4MFR A;  2XTL A;  5LCY A;  2X68 A;  2W63 A;  3PUQ A;  4TN7 B;  4H9O C;  5CA0 E;  2LE8 A;  4G63 A;  2X9W A;  3CQG B;  2LHN A;  3GN5 B;  4GIW A;  4JEU B;  3V5S A;  2D0U A;  3S4U A;  4EOZ B;  2VWA A;  3Q5X A;  2C5I T;  4IHJ E;  3F31 A;  2CXL A;  1UX4 A;  5AFU L;  4WW0 A;  2PJQ A;  4PK5 A;  1YD8 G;  3C4W A;  3HL6 A;  1MIW A;  3ONX A;  2N9D A;  3L09 A;  3UUN A;  2EHO D;  4HE8 A;  2QA7 A;  1UCU A;  4H9Q C;  3BK9 A;  5C8Y E;  3MXZ A;  4H9P C;  3C4X A;  2X0L B;  3Q5W A;  4H9S E;  3I1A A;  3Q2M A;  4QX8 B;  2E9X C;  3OBV E;  3K3Q C;  4I43 B;  3PTR B;  1WRD A;  3ETV A;  2L8K A;  2NW7 A;  4I4T E;  4GK5 E;  3J9X 1;  4H63 V;  2ZMA A;  2CWY A;  3F2E A;  5L3F B;  2KIN B;  4UIG A;  1H7C A;  1Z0P A;  2WBL A;  2KT9 A;  4I50 E;  2K24 A;  2YU1 A;  3RPU A;  3WAJ A;  3KV5 A;  5FXW A;  4YJ2 E;  4DMV A;  1MIY A;  3J7Y q;  5L2L A;  5HWY A;  3KBU A;  1LVK A;  3NZQ A;  5JRE A;  4GOU A;  2LHR A;  2LSG A;  3AB3 B;  5E0O A;  4PW8 A;  2Y48 B;  4QHO A;  2X66 A;  4ZI7 E;  5FMN A;  1V9D A;  4P0A A;  3N9Q A;  4PFO A;  3ZMV B;  5JR9 C;  3C50 A;  5CB4 E;  4C91 A;  3GMI A;  4YHJ A;  4H9N C;  5FXV A;  2KWI B;  4U72 A;  4OYJ A;  3CX7 B;  1LVF A;  5JVD E;  4H63 H;  2MYS A;  4ILU A;  2WMO A;  2G0U A;  3EUH A;  2Q9Q C;  3NRX A;  4UF0 B;  1CUN A;  5LNK A;  3FXE B;  3IF8 B;  2YIN A;  5JRC A;  4C90 A;  2VL8 A;  2I59 A;  2V7J A;  2V7I A;  1G73 A;  4OFZ A;  2JJ9 A;  2KND A;  4O4L E;  1D1B A;  3LK3 B;  1SHZ C;  4J2C A;  1D0Y A;  2Y8D A;  4KP3 C;  5JDF A;  4ZHQ E;  1SA0 E;  4YJ3 E;  4ZI3 C;  4I55 E;  3KVB A;  2WWU A;  1LRZ A;  2NW8 A;  2L3L A;  5HXH A;  4MHC A;  4MAL A;  1HG2 A;  2KXP B;  4NUU A;  3I9W A;  3KV4 A;  4AKH A;  5FXX A;  4UV8 B;  2C5J A;  3DJB A;  2B1E A;  1D0Z A;  3RH3 A;  2LM9 A;  3AA6 B;  1BR1 A;  1T98 A;  2KMF A;  3ZMS B;  1BR4 A;  2CMR A;  2MOZ A;  5CA1 E;  3MJX A;  4L0R A;  3KBT A;  4EYU A;  2CLY C;  3KIN B;  2ZM0 A;  5EK2 A;  2GK9 A;  2E9X B;  4HTE A;  3HKE E;  3CML A;  5EZY E;  3A5X A;  4PK6 A;  3O1I A;  2K9A A;  2DNX A;  4EYY R;  1S35 A;  4PJJ A;  3N9O A;  3QK6 A;  5EK3 A;  1EZ3 A;  3HI2 A;  1D1C A;  2QGS A;  2X67 A;  2EHO A;  1YKH B;  3C64 A;  4IE7 A;  2XAH B;  4UV9 B;  1NAF A;  2XQY A;  3ETU A;  3V5U A;  3E0Z A;  3GN5 A;  5LJN A;  2ACX A;  4TV9 E;  1B7T A;  5JH7 E;  4MBQ A;  2DHR A;  5LOV E;  1Y64 B;  2E8I A;  1VOM A;  1HX8 A;  4AKR B;  1YKE B;  2A72 A;  2JRK A;  4QXH B;  2JMK A;  4AQF A;  4AI6 A;  3RKO A;  5LGU B;  1HS7 A;  3PU3 A;  1AJ3 A;  3FHN A;  5HYA A;  4DBR A;  1BR2 A;  4ADZ A;  4IE5 A;  3I9Y A;  5A1L A;  3P7I A;  5JR9 B;  3N2O A;  2C5K T;  3CX6 B;  3GA8 A;  1MMD A;  3IBP A;  2P9B A;  2H7V C;  4HKA A;  3ZN0 B;  2ODU A;  4DND A;  4IE0 A;  3ZC0 A;  1KNZ A;  2PBI A;  4ANJ A;  4CXW A;  2H3R A;  1IAP A;  1U4Q A;  3P8C D;  3T8O A;  4JUY A;  3U78 A;  4V1A v;  3AA7 B;  2JMH A;  2XAQ B;  3AAA B;  2N2N A;  2LOS A;  3N2K E;  4XAX B;  4MLK A;  4YLH A;  5IYZ E;  2CXD A;  3PE0 A;  3RX6 A;  2VKD A;  3BQK A;  3ZN1 B;  5DJQ C;  2V1D B;  3GWH A;  2XAG B;  5FNV E;  3ZCJ A;  2LOP A;  2Q9Q D;  4YFS A;  2X9H A;  3ESL A;  3ZLI A;  4BAY B;  4ZOL E;  3TKL B;  3N9L A;  4IGU A;  5F3J A;  3K8P C;  1IJ6 A;  3C98 B;  2ZM8 A;  3NZP A;  3ZYK A;  4EAH A;  2LSY A;  5L3D B;  3MK7 C;  5J2U E;  2UXN B;  2XAJ B;  5J2T E;  2HH7 A;  2D0T A;  4PK4 A;  4N78 D;  1WR6 A;  4KMC A;  1WLX A;  3R84 B;  3SOL A;  1MMA A;  2PFV A;  4PJM A;  5LGT B;  3PUS A;  5ADX L;  4UF0 A;  4ZI3 D;  1FMV A;  3FB2 A;  4TUY E;  2WM9 A;  4HGA A;  1MMN A;  1G8X A;  3ZC1 A;  2CLY B;  3LBX B;  3RRW A;  1ZHC A;  5FYM A;  4DBQ A;  3O9X A;  3CVR A;  3HKB E;  1FMW A;  2XAS B;  3L3P A;  2DLR A;  2CM0 A;  4ZS2 A;  3PDY A;  2V7K A;  5JDG A;  4X1K E;  2NOX A;  2XUE A;  3VU7 H;  2HPL A;  3VHL A;  3PUA A;  5FY7 A;  3ZCI A;  3K3O A;  3LK4 2;  3ZJ2 A;  1X79 A;  4NUV A;  1BR0 A;  1NWM X;  2ZM2 A;  5JDL A;  3NRY A;  2H7O A;  3ZMT B;  3Q9D A;  1MMG A;  5L3B B;  2Z6E A;  4F6R C;  4O4J E;  4JLE A;  4O8S A;  1YW0 A;  4QWN B;  5H6R B;  1UX5 A;  4HN9 A;  3N2G E;  5L3C B;  3PUG A;  1ZKE A;  2V7L A;  5TAO A;  3KDS E;  2RP4 A;  1OXZ A;  4OYK A;  5JDM A;  4HEA A;  1FEW A;  4U74 A;  4ERR A;  3ZYL A;  3UUX B;  1FIO A;  3ZYM A;  3KV6 A;  2VAS A;  4GYR A;  3AA0 B;  5DAB A;  4AQG A;  2E9X A;  3C51 A;  5F8P A;  3I0Q A;  2NTY A;  4WBN E;  5KX5 E;  2YU2 A;  2KLQ A;  3AAI A;  4PJL A;  3B13 A;  3CKD A;  2X9Y A;  2IAK A;  2X9X A;  4IIJ E;  2D5U A;  4QXC B;  1HF8 A;  2BDE A;  3MZK B;  5EK4 A;  5L3E B;  5L3G B;  3O4X E;  3ANW A;  3RRC A;  2VK9 A;  2M67 A;  2N1G A;  4P09 A;  2A2F X;  5LBQ B;  1E1H B;  5HWX A;  5LYJ E;  5LBM A;  1KK7 A;  2MBG A;  2LEH A;  3ZMU B;  3MAC A;  2Y6X A;  2BVL A;  4UEM A;  3N9P A;  4IST A;  3N9N A;  3CPZ A;  1HTJ F;  2OA5 A;  2CE7 A;  3RYF E;  3ANW B;  3LG7 A;  3ZPO A;  2DWG A;  3O1J A;  4UXN B;  4B6X A;  2UXX B;  2YK0 A;  5JR9 A;  1WYC A;  3BQL A;  1MIV A;  1S94 A;  3HR0 A;  3PU8 A;  4BJN A;  4WBO A;  3DP7 A;  4UEL A;  4ZS3 A;  3VKG A;  2IC6 A;  4QKN A;  1D1A A;  2Q9Q A;  4K0U A;  5LP6 E;  4TX5 A;  4CXY A;  3WAK A;  5HAX A;  5LA6 E;  2K48 A;  5ETW A;  5LJM A;  3O1H A;  1ZV4 X;  2JQQ A;  5JDQ A;  3N9M A;  3M65 A;  2HPJ A;  1QSD A;  4BJM A;  4OHF A;  2V26 A;  3C4Z A;  4TV8 E;  1HFA A;  4A56 A;  4AKG A;  5J1G A;  2YEV C;  2Q9Q B;  4FJO A;  4AKI A;  2PG8 A;  2RA1 A;  4CQI A;  3LJC A;  2W0G A;  5IHY A;  3SS1 A;  4WNK A;  3NBX X;  4DO0 A;  5JDN A;  3K3N A;  3LFM A;  3OJA A;  3QC9 A;  2X51 A;  2LT3 A;  3HA4 A;  4CI3 B;  4EXT A;  5JQG E;  3UUM A;  2CWO A;  2NWB A;  5HXR A;  2LJL A;  3UUL A;  2NTX A;  5LXT E;  4Z8X A;  4ZI2 C;  3FBL A;  4O2A E;  3B57 A;  3FXD B;  4JEH B;  3U3I A;  2D2S A;  5KDM C;  3QUJ A;  1D0X A;  2LSK A;  1HCI A;  4ISS A;  3E22 E;  2C0S A;  4CI2 B;  2NP9 A;  3OKQ A;  2IW5 B;  3DTO A;  3MKD A;  4L9I A;  3LBX A;  3CWZ B;  3HKD E;  2KWH A;  4PNI A;  3EDV A;  4IE6 A;  4DVD A;  4O2B E;  4H9R C;  4OK0 A;  5LGN B;  2CA5 A;  3H37 A;  5BMV E;  4IDZ A;  3KV9 A;  1OWA A;  3IEE A;  3SWH A;  5LHG B;  3AAE B;  3CQC B;  3HKC E;  3H3A A;  2A3D A;  4UVB B;  4X20 E;  3I0O A;  3ZMZ B;  4EB6 E;  4AKL A;  2DWK A;  1HG5 A;  2XHE B;  2BZB A;  2EHO C;  2V7M A;  3RYI E;  4G2A A;  3E08 A;  2ODV A;  2NW9 A;  3AVR A;  2MTQ A;  4L5G A;  2CXF A;  3W15 B;  5HXC A;  1MNE A;  4O4H E;  4P0B A;  5FP3 A;  4AQF C;  3OYZ A;  4O4I E;  3UT5 E;  1VRB A;  2SPC A;  3IHR A;  4AXP A;  3PUR A;  3D0T A;  1MND A;  2W00 A;  4E7S A;  4XBF B;  4X1I E;  2WMN A;  2VB6 A;  4ASK A;  4CI1 B;  2CCQ A;  3VKH A;  2ES0 A;  2WAU A;  3BQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...