2KWIB

Ralb-rlip76 (ralbp1) complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-B
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein, protein binding
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwiB00
2X9WA 2C5IT 4FI5A 3FXEB 3FXDB 2CA5A 3L3PA 2X9YA 4J2CA 2X9XA 2MBGA 1LRZA 1LVFA 3P7IA 4L0RA 1H7CA 1ZKEA 3N5LA 4B6XA 4EYYR 2KWIB 3CKDA 4DNDA 3TKLB 1QSDA 2C5JA 3S4UA 3CVRA 4CQIA 3QUJA 2C5KT 2K48A 2IC9A 2IC6A 1Z0PA 3MXZA 2KWHA 2XTLA 1IJ6A 3QK6A 1IJ5A 2G0UA
chains in the Genus database with same CATH superfamily
2E2AA 2PFVA 3FXDB 5JR9B 2KNDA 2V7LA 5LMNT 2DL1A 3P7IA 2XJ7A 3RIAA 3NVOA 4X1YE 4OHFA 4QXBB 2WMOA 2X0HA 2W67A 4QX7B 4E7ZA 1KF6A 2XAJB 3WAJA 3K8PC 4YSYA 4JI5T 3M65A 2VURA 2LE8A 1WCRA 4F8HA 5LB7B 4H9QC 3ZN1B 2K3WA 5AQVB 5LGTB 2KSRA 1XZYA 4PNIA 5IYZE 1T72A 3AA0B 5LP6E 2G0UA 1HNZT 4GYRA 4TNVA 4LFCT 2Q9QD 3FBLA 4EYYR 2E9XD 4U74A 5HEGA 3ZC1A 3UU8A 1HR0T 3RC3A 2PTFA 3UUXB 2ACZA 4ZI7E 5LGNB 3MACA 4J2CA 5AQMB 5HXRA 2V7MA 4AKGA 4CXYA 2VWAA 2NWBA 3PUSA 3ANWA 1Y01A 4AQFA 3J9X1 3A7MA 4ZEYA 3PDYA 4BAYB 3KFWX 4HFVA 2JIWA 3PUQA 2J47A 2XY8B 5IUXA 4EEBA 4IDNA 3DJBA 3E22E 4UF0A 2EHOC 4EV6A 4PK5A 4V1Av 4I0UA 2K24A 4GK0E 4HEAA 2KT9A 2H88A 4YTMA 3IF8B 4DR3T 2DHRA 1W0BA 5L3EB 2WU2A 3NKZA 3NZPA 2IUBA 3ANWB 1S35A 1FJGT 1EZ3A 3UULA 3J7Yq 3AE4A 3I1AA 2WWVA 1XMOT 2V6XA 5FMNA 3R84B 1D1AA 3UFGA 1WLXA 4UF0B 4AI6A 2I59A 4O4JE 3MXZA 2YU1A 3AEBA 3RRCA 4OFZA 4DUZT 2VL8A 5H6QB 3RKGA 2A72A 4GIWA 4L0RA 3Q9DA 2FBWA 4IE5A 5IWAT 3ZLIA 4EB6E 2XAFB 2UUCT 1UK5A 4X66T 4IL9A 4QX8B 4DIDB 4DVDA 3L09A 2WBLA 1DU2A 3KVBA 1J1JA 4UELA 3PUXF 4E7SA 2CXLA 3BQLA 5JDGA 3RQWA 3N9OA 4KX6A 5AQSB 5JRCA 4CN6A 1BR1A 1HG5A 4X20E 5ABEA 4H9PC 2WSSV 4YJ2E 3DTOA 2JRKA 4HFDA 1UCUA 3NRXA 2PBIA 5FNVE 3KDSE 3NRYA 3AE5A 4DMWA 2XZEA 2K9AA 1N33T 2XAQB 3QK6A 3AE2A 4TN7B 3K3NA 4DO0A 3QB5A 4ZI3C 4ZI2D 2XSBA 2WCAA 1ZP0A 4DR4T 2BBHA 4DV0T 3PE0A 4PK4A 2W62A 1N32T 4EEDA 1NEKA 4BA9A 2H7VC 3NZQA 1E1HB 2HHHT 4GOUA 2X0YA 1JNZA 2XPKA 3IEEA 4CN4A 2QVAA 2YDRA 3VR9A 2VQFT 1ZEEA 2XM2A 2NW8A 4FJOA 3NBXX 4HFEA 3UUBA 1QLBA 4HFBA 4TNWA 5AQOB 3AE8A 2BG9A 2V5CA 3UU4A 4LMLA 4YSXA 5HCJA 5LJMA 2VQET 2WWUA 2KWHA 3LBXA 2XTLA 1IJ6A 5FXZA 3OKQA 4AQYT 3LG7A 4AKHA 4IE4A 5LJNA 2YN6A 5JTGA 4KHZF 1LKXA 4AIUA 5IHYA 2NP9A 5FYMA 1SA0E 2IIUA 2NR4A 4JI8T 3ETUA 2FJEA 2BG9B 1D1CA 3K3QC 3UT5E 4O8SA 3H37A 3ZCJA 3ONXA 3C51A 1JNRA 5L3CB 5BMVE 1N34T 4PFPA 1G8XA 2E5VA 4LF8T 1FEWA 2P9BA 5LG3A 5EZYE 1Y64B 2H7OA 3P4QA 4AKLA 3SWHA 2FUPA 1HNXT 1MNEA 1IAPA 5AQJB 5L3GB 3O1IA 2CLYB 4JI6T 2IC6A 2IC9A 3SS1A 3EUHA 1XNRT 3PUYF 4BJMA 4H63V 5JVDE 5KDMC 4UVAB 5GONE 2H3RA 5CJ5A 2CXFA 4OYJA 5C3JA 5ABFA 5HWXA 4H9SE 3FZFB 3VHLA 2K48A 4H9RC 1WRDA 4NUUA 4IDOA 3RRWA 2H89A 3H3MA 4NUVA 4IDPA 4OYKA 3SOLA 4Q25A 2KXPB 4KP3C 2WP9A 4EGWA 1M62A 3JC6D 3ETVA 2UU9T 2J4GA 4O4IE 1OEDE 2X68A 5AQFB 4H63H 4X65T 2YKSA 5ABFB 3PUAA 5AQRB 3AEEA 2VKHA 1O3XA 4CXWA 4QWNB 3I9WA 2CXDA 5LCYA 5CGMA 5LOVE 3UU6A 2V6YB 2UXBT 3BK9A 4IE6A 3RF1A 3U78A 3R6NA 4TX5A 3IHRA 2WZIA 3QC9A 2ES0A 2LSGA 2MBGA 4DV4T 3PU3A 3QNUA 2KMFA 2WY2A 4X1KE 3GA8A 2XASB 5FVKA 2DI4A 3AA6B 3X1DA 3C98B 4X64T 3RX6A 3CX7B 2Q9QB 3B13A 2E9XB 5ABHA 4TV9E 4B3ST 2IHR1 1W09A 1XDOA 1HFAA 2XQ6A 1LVFA 2QGSA 4PJMA 5KXJA 5TAOA 2CPTA 4ILUA 3VRAA 2LSYA 5LG4A 4MLKA 1L0VA 4OK0A 4ILAA 4EZ4A 4JI2T 4K0KT 2ZMAA 1UX5A 4TZ4C 4JI1T 2NTYA 3MKDA 3CX6B 5L3DB 1MMNA 2E8IA 3MZKB 4CXXA 3RIUC 1B7TA 3CQXC 2KLQA 1MIWA 5HEOA 2MYSA 4QH5A 4ISTA 3UFEA 1HF8A 4L5GA 3ZMSB 3LK3B 2JMKA 2EHOA 5CB4E 1CUNA 2WDRA 3AE1A 2N2NA 4X62T 4CQIA 4IDZA 3DP7A 4CI2B 2LSKA 1NWMX 3U3IA 3N9NA 4I4TE 4U2YA 5F8PA 2CEAA 2CCQA 3BQKA 3C64A 1HNWT 2X0LB 3CMLA 5JR9C 2FJBA 2XQ3A 3N5LA 3BQIA 4ERRA 4I55E 2VKDA 2WZHA 5HXCA 4DV6T 2VKOA 4UEMA 2RPAA 4PAGA 3AAIA 3ZMVB 1KNZA 2M6BA 4QH4A 2YDQA 3MK7C 4PFOA 3PURA 2UXNB 1HTJF 2FJDA 2GK9A 5J0ZA 1MIVA 4UV8B 1V9DA 1I6ZA 3I9YA 2XHEB 5C8YE 3HL6A 2VVSA 4UV9B 4TV8E 4G2AA 4PJNA 1U4QA 4B3TT 3I0OA 3ZEFB 5FP3A 2WM9A 3CQGB 3LJCA 1OXZA 3AEFA 2ODUA 3T1YT 2D0UA 4LF5T 3EI0A 1KNPA 5FY0A 2VKJA 3RHWA 3JCFA 2X9HA 2C0SA 3AVSA 3ZC0A 2VB6A 3RYCE 4NXMT 4MBQA 5FXWA 2AE9A 5EK2A 2D5UA 1WR0A 4EZHA 5HEJA 1MNDA 3Q5DA 4MFRA 2EHOD 2JQHA 2UXXB 4KUMB 5HXEA 3ZYKA 1SUMB 3CVRA 3RC8A 2CHOA 4JEHB 5KX5E 3OTOT 5J2UE 3AECA 1HX1B 3O9XA 3E08A 2YU2A 4QXCB 3UU3A 5LHHB 1D0XA 2XQ7A 4PK6A 4YHJA 3AXJA 3ZN0B 1UURA 3RYIE 4ZS3A 4ZXLA 5AQPB 4P0AA 2X51A 4O4HE 3OYZA 5AFUL 3N9MA 4QHOA 2X67A 2LSIA 1HX8A 3ABVA 3N9QA 3N2GE 4HFIA 4WW0A 1YQ4A 4EAHA 5HWYA 5HYAA 3JAFA 2Y48B 2X9XA 2LJLA 4WNKA 4DR7T 2BVLA 3Q5XA 4U72A 1QUUA 3HKCE 3HKEE 2ZM2A 4UVBB 3JAEA 5FXVA 5JRCB 2HN1A 3P8CD 3V5SA 1VRBA 3AA7B 4QKNA 3AA1B 4YSZA 2A2FX 5L47A 5EK4A 1H7CA 4TUYE 1BR4A 3ZMTB 1I94T 4DV3T 3QOFA 3SFEA 1FMWA 3OPCA 5E0OA 2V7JA 3ZT5A 2BS4A 4A5XA 3PUVF 4I43B 2NW7A 2DCFA 4ZI3D 2KWIB 3SFDA 2LRKA 5LMUT 4LFAT 1SHZC 1E7PA 2HPLA 3QUJA 4DV1T 4UXNB 4CI3B 4U3CA 3VU7H 4ADZA 2V1DB 2HH7A 2ZM0A 2WMNA 4DV2T 1LRZA 2CM0A 3TLVA 4DV7T 2B1EA 3G06A 2Y8DA 5ADXL 1ZOYA 3T1HT 1WYBA 4PJJA 3N2KE 4Z90A 5AQKB 5F5WA 2C5IT 4LMJA 3A5XA 5LHGB 2L8KA 2DLRA 4O2BE 2XQ8A 4CZZB 4YY3T 4LF7T 2WDVA 4ISSA 1YKHB 2LHRA 3N9LA 4WBOA 2W4XA 2JQKA 2MOZA 4O4LE 1D1BA 3P4RA 3VRBA 3RI5A 3H3AA 4AKIA 2WB5A 3LFMA 2JQ9A 3L39A 3LBXB 5DQVA 2DWKA 4IE7A 2J1DG 2ZLYA 3RH3A 4YT0A 4TWFA 2XAGB 3O1HA 1MMAA 3ZKRA 3AE3A 3P4WA 4DV5T 3KV9A 1J5ET 1SE7A 2FJAA 4PJLA 5LNKA 2J62A 3N9PA 3AEAA 3ZJ2A 2NW9A 2YOEA 4H9OC 1VOMA 1XWMA 5FY1A 2LHNA 4IE0A 4JBWF 3A8YC 3RYFE 5LGUB 4I50E 5LXTE 4JYAT 4YXDA 3TLTA 1ZV4X 2BZBA 2CBJA 3KVAA 2JMHA 3QB5K 5ABGA 5CFBA 3P50A 3KINB 1FMVA 1BR0A 2B76A 3FZMB 2CBIA 5L4HA 2CLYC 4P09A 5L3FB 1T98A 2XQ5A 2D0TA 3LK2B 2BKOA 3ZPOA 2V5DA 5HCMA 2OV9A 2WAUA 5FVLA 5FL1A 3RQUA 3RIUA 2LM2A 3KBTA 2KZ7B 2V7KA 2DNXA 5AQQB 3CKDA 2WQYA 4NXNT 2XSAA 3GN5A 4B3RT 3PV0F 3W15B 2BBJA 3FXEB 2CA5A 2ACXA 3K3OA 4TWDA 3ZSTA 2A9UA 3Q2MA 3RYHE 3N2OA 5JR9A 5LHIB 3I0QA 2WU5A 1YKEB 1IZNB 4DR2T 1KEYA 3AE6A 3C4ZA 4A56A 1OEDC 3GN5B 4ZZCA 2F4VT 4JV5T 1BR2A 5HAXA 3IA3A 4ASKA 4H9NC 5HEUA 5JQGE 4HN9A 2IMLA 4QH1A 5JDMA 2Q9QC 2E9XC 5KMGP 2CRBA 4DMVA 4ZS2A 4UIGA 2UXDT 2V26A 3Q5EA 2XQYA 4ZHQE 5JDLA 3PJAA 1QSDA 1MMGA 1HG2A 2YK0A 3LSVA 3S4UA 3F2EA 3AAAB 3HA4A 4XBFB 5AQHB 4G63A 3NWIA 1XNQT 2LRLA 4FI5A 4NPPA 1US7B 2CMRA 4XZCA 4BJNA 4LMKA 3P4PA 4JI3T 2I6HA 4KHPT 1NAFA 4NIQA 2MPKA 2M6IA 2CWYA 2IW5B 1X9BA 2BS2A 3RKOA 4COFA 2RA1A 2W66A 2EHOB 4DR1T 3CPZA 3L8RA 4C90A 4Z91A 1UGOA 4X5TA 2ZM8A 4P0BA 3UUMA 4IIJE 3RPUA 4CI1B 3VR8A 3CK6A 3KV6A 4C91A 3AE9A 3EHZA 4KMCA 3HI2A 5L2LA 4HFHA 2LM9A 3Q5WA 5DJQC 4IHJE 4LFBT 4U31A 4GKKT 3PUZF 1MMDA 3CWZB 1XMQT 3V5UA 2Y6XA 3F57A 3PU8A 1UUSA 3P4SA 3CIRA 1MIYA 5DABA 2A3DA 4F6RC 2UUBT 3ONLC 5FL0A 1D0ZA 2XQAA 4YHHT 1W9RA 2K5BB 3AEGA 3FZLB 3IBPA 3LDQB 3K1SA 2L3LA 4DBRA 3PTRB 4HWIB 1ZKEA 2L9QA 3TKLB 3AEDA 3T8OA 2W0GA 4LF9T 3EDVA 3GMIA 4K0UA 5BR8T 4EIWA 2V7IA 3M3ZB 1NENA 1G73A 1WR6A 3B5MA 2I0MA 1YW0A 3C4XA 5FXXA 3OJAA 3RGLA 1IBLT 4AQFC 4A97A 3HKBE 3MJXA 2LOPA 2D2SA 2NTXA 4AISA 1D0YA 3MA9A 2WS3A 4HWCA 4L9IA 2CHNA 4ZI2C 4IL4A 2XQ4A 4AQGA 5ETWA 1YD8G 3ZCIA 1AJ3A 2DWGA 2ODVA 3SRZA 5LYJE 2NOXA 4GKJT 4HWHA 2PG8A 1T8BA 3UU5A 2RP4A 3ZT6A 4JLEA 4KBMB 4O2AE 5EK3A 3AXJB 2CWOA 4ILBA 1HCIA 3KV4A 1YXRA 3OBVE 2WDQA 4N78D 4PW8A 2W00A 4DUYT 3EAMA 3ZYMA 3FZKB 3LK42 3E0ZA 1YQ3A 2LKHA 2UUAT 4X1IE 3KV5A 4QXHB 4U2ZA 3ZT7A 3VKGA 1WFDA 3TLSA 4WZXA 4HWFA 4YLHA 3RLFF 4UVCB 4MHCA 4A98A 2LEHA 5J1GA 2AXDS 1GQEA 1Z0PA 4DR6T 1VCTA 3ZJ1A 2HPJA 3FBZA 1IBKT 2X9YA 2VK9A 2YDSA 2CE7A 5DQWA 5FKYA 4DNDA 3B57A 4UR9A 1W0AA 2N9DA 3FB2A 3O4XE 1KFYA 5H6RB 5JDHA 4YFSA 2BG9E 4DR5T 1Z8UA 5JH7E 2E5LT 4JEUB 5HEHA 4B3MT 3UQ4A 4IGUA 5LA6E 4WYVA 2OLTA 4ANJA 5AQNB 4P1NA 4AKRB 2PJQA 1HS7A 2XUEA 4CN1A 4JI4T 4XAXB 2XQ9A 1XDPA 1M7KA 4YTPA 5JDFA 5JREA 4JUYA 2VVNA 5M4YA 5A1LA 1WYCA 1ZHCA 4IT4A 5AQUB 3RIFA 2HN2A 2LSJA 3AVRA 1OWAA 5LBQB 2XAHB 2W2UA 5J2TE 2W61A 3C4WA 3F31A 3CX8B 2LLYA 4HE8A 3FHNA 3ZSSA 1IJ5A 4IREA 4YJ3E 1KK7A 1J5WA 4Z8XA 2X66A 3AE7A 4YTNA 2YEVC 5HXHA 4KI0F 4WBNE 3CQCB 5LBMA 4ILCA 2LKGA 2C5KT 3GWHA 3ONJA 2MAWA 3VKHA 1UX4A 5CA1E 4OX9T 4HWDA 2BG9C 3PUWF 2IDOB 3L3PA 1IBMT 5L3BB 3JADA 3JC6C 4B6XA 1U5PA 3OYXA 3WAKA 4AXPA 3D0TA 2BKNA 4DBQA 1FIOA 3O1JA 2UXCT 4JI0T 4HTEA 4HFCA 3HR0A 3TLWA 1LVKA 1X79A 4GK5E 2M67A 4GYSA 5FY7A 5JDNA 5CA0E 2Z6EA 4EXTA 2BVMA 5JDQA 5HXSA 3TLUA 4M1PA 1VCSA 1E2AA 2BKPA 2JJ9A 2VASA 2JQQA 2W63A 2SPCA 5F3JA 3EABA 3UQ7A 4MALA 2V6YA 2R6GF 1OEDA 2N1GA 5AQIB 3PUGA 1CHUA 3ZMZB 4EYUA 1R8IA 3ZMUB 3UUNA 2V8SV 2OA5A 3HKDE 3OVUA 2X9WA 4EOZB 2VL0A 5AQTB 4TWHA 2Q9QA 1S94A 3AB3B 2E9XA 3UTKA 4U33A 2XM1A 3ZYLA 4HGAA 2C5JA 4HKAA 3PJAJ 3KBUA 2QYWA 5L4EA 1OEDB 4JI7T 5AQLB 4IDQA 1KNRA 4U7YA 3WI3A 2KINB 1T7SA 4ZZBA 2D9DA 3ESLA 3FZHB 2JPFA 3AAEB 3C50A 3EDUA 2IAKA 2LT3A 2MTQA 4U7IA 2QA7A 2LOSA 4LF4T 1N36T 5C2TA 4ZOLE 2ZM6T 3EVYA 2BDEA 2BS3A 4LF6T 5AQGB 2QRXA 2YINA
chains in the Genus database with same CATH topology
2L3LA 2PFVA 4UVAB 3FXDB 4I43B 5JR9B 2KNDA 2V7LA 2NW7A 5GONE 4DBRA 3P7IA 2H3RA 3PTRB 1ZKEA 2L9QA 2CXFA 2DCFA 4OYJA 4X1YE 4ZI3D 2KWIB 4OHFA 3TKLB 5HWXA 4H9SE 4QXBB 2WMOA 3T8OA 2W0GA 1SHZC 2HPLA 3QUJA 3VHLA 2K48A 3EDVA 4H9RC 3GMIA 4UXNB 4K0UA 4CI3B 4QX7B 4EIWA 1WRDA 4NUUA 2V7IA 4E7ZA 3VU7H 4ADZA 2V1DB 2HH7A 2XAJB 3WAJA 3K8PC 1G73A 1WR6A 3RRWA 2ZM0A 1YW0A 3M65A 2WMNA 1LRZA 2LE8A 3C4XA 4NUVA 5FXXA 2CM0A 3OJAA 4OYKA 3SOLA 4AQFC 2KXPB 3HKBE 4KP3C 2B1EA 4H9QC 3ZN1B 3MJXA 5LGTB 2Y8DA 5ADXL 2LOPA 4PNIA 2D2SA 3JC6D 2NTXA 3ETVA 5IYZE 1D0YA 1WYBA 4O4IE 3MA9A 2X68A 4PJJA 4H63H 3AA0B 4L9IA 4ZI2C 3N2KE 5LP6E 2G0UA 4AQGA 5ETWA 1YD8G 3ZCIA 1AJ3A 2C5IT 4GYRA 3PUAA 3A5XA 2DWGA 5LHGB 2ODVA 2L8KA 2DLRA 2VKHA 1O3XA 2Q9QD 3FBLA 4O2BE 4CZZB 4EYYR 3SRZA 4CXWA 2E9XD 4U74A 4QWNB 5LYJE 4ISSA 3ZC1A 3I9WA 1YKHB 2NOXA 2CXDA 5LCYA 2LHRA 3N9LA 4WBOA 4O4LE 2MOZA 1D1BA 5LOVE 2PG8A 3RC3A 3BK9A 4IE6A 3U78A 3R6NA 2RP4A 4TX5A 3IHRA 3UUXB 3H3AA 4JLEA 3QC9A 4ZI7E 2ES0A 2LSGA 5LGNB 3MACA 4KBMB 4O2AE 4J2CA 2MBGA 4AKIA 5HXRA 2V7MA 3PU3A 4AKGA 4CXYA 2VWAA 5EK3A 2KMFA 2NWBA 3PUSA 3LFMA 3ANWA 4X1KE 4AQFA 2CWOA 2XASB 3GA8A 3LBXB 3J9X1 5DQVA 1HCIA 3KV4A 3PDYA 3OBVE 2DWKA 4N78D 2DI4A 4BAYB 3KFWX 4HFVA 4PW8A 3AA6B 3C98B 4IE7A 3RX6A 3PUQA 2J1DG 3CX7B 2W00A 2Q9QB 2ZLYA 3B13A 3RH3A 3ZYMA 2E9XB 4TV9E 3LK42 2XAGB 3E0ZA 3O1HA 3DJBA 3E22E 4UF0A 1HFAA 1MMAA 2EHOC 4PK5A 1LVFA 2QGSA 4X1IE 4PJMA 5TAOA 4V1Av 2K24A 4GK0E 4HEAA 4ILUA 3KV5A 2KT9A 4QXHB 3IF8B 2DHRA 2LSYA 3KV9A 5L3EB 5LG4A 4MLKA 4PJLA 3VKGA 4OK0A 3NZPA 5LNKA 3N9PA 4EZ4A 3ZJ2A 3ANWB 1S35A 2NW9A 4WBNE 2ZMAA 4H9OC 1UX5A 4YLHA 1VOMA 5FY1A 2LHNA 4TZ4C 4IE0A 2NTYA 1EZ3A 3UULA 3J7Yq 3MKDA 4UVCB 3I1AA 4MHCA 3CX6B 5L3DB 1MMNA 5FMNA 3R84B 1D1AA 3RYFE 5LGUB 2LEHA 5J1GA 2E8IA 1WLXA 3MZKB 4I50E 4UF0B 4CXXA 1B7TA 2I59A 5LXTE 4AI6A 1Z0PA 3CQXC 4O4JE 3MXZA 2YU1A 1ZV4X 2BZBA 2KLQA 3RRCA 1MIWA 3ZJ1A 4OFZA 3KVAA 2JMHA 2VL8A 2HPJA 3FBZA 2MYSA 5H6QB 2X9YA 2A72A 4ISTA 3UFEA 2VK9A 4GIWA 1HF8A 2CE7A 4L0RA 4L5GA 3ZMSB 3LK3B 3Q9DA 2JMKA 5DQWA 2EHOA 3KINB 5CB4E 4IE5A 3ZLIA 4EB6E 2XAFB 1CUNA 1FMVA 3B57A 4DNDA 2N9DA 3FB2A 3O4XE 5H6RB 5JDHA 1BR0A 2N2NA 4YFSA 4CQIA 5JH7E 4IDZA 3DP7A 4JEUB 4QX8B 2CLYC 4CI2B 4DVDA 4P09A 3L09A 5L3FB 2WBLA 3KVBA 4IGUA 1T98A 2LSKA 1NWMX 3U3IA 3N9NA 4I4TE 5F8PA 2CEAA 2CCQA 5LA6E 3BQKA 3C64A 4UELA 4E7SA 2CXLA 2X0LB 3BQLA 3CMLA 4ANJA 5JR9C 2D0TA 3N5LA 3BQIA 4AKRB 4ERRA 3LK2B 4I55E 5JDGA 2VKDA 2PJQA 5HXCA 3ZPOA 2VKOA 2XUEA 1HS7A 3N9OA 4UEMA 4PAGA 3AAIA 3ZMVB 5JDNA 1KNZA 2WAUA 4XAXB 5JRCA 5JDFA 1BR1A 5JREA 3MK7C 4JUYA 1HG5A 4X20E 4PFOA 3PURA 4H9PC 5M4YA 2WSSV 5A1LA 3KBTA 1WYCA 2KZ7B 1ZHCA 2UXNB 2V7KA 2DNXA 4YJ2E 3DTOA 2JRKA 2LSJA 1HTJF 2GK9A 1UCUA 1MIVA 3CKDA 3NRXA 2PBIA 3AVRA 4UV8B 1V9DA 1OWAA 5FNVE 2XAHB 5LBQB 3I9YA 3GN5A 2XHEB 3KDSE 3NRYA 5J2TE 2W61A 3C4WA 5C8YE 3F31A 3HL6A 3CX8B 4HE8A 4DMWA 3FHNA 2K9AA 2XAQB 3QK6A 1IJ5A 4TN7B 3K3NA 3W15B 4UV9B 4YJ3E 4DO0A 1KK7A 3FXEB 4ZI3C 2CA5A 4ZI2D 4Z8XA 2X66A 2ACXA 3K3OA 2YEVC 4TV8E 5HXHA 3Q2MA 3PE0A 3RYHE 3N2OA 4G2AA 3CQCB 4PJNA 4PK4A 1U4QA 5JR9A 5LBMA 2W62A 5LHIB 3I0QA 1YKEB 3I0OA 2C5KT 3GWHA 3ZEFB 3VKHA 5FP3A 1IZNB 1UX4A 4BA9A 5CA1E 2WM9A 3CQGB 3LJCA 2H7VC 3C4ZA 1OXZA 3NZQA 4A56A 1E1HB 2ODUA 3L3PA 3GN5B 2D0UA 4GOUA 5L3BB 3JC6C 4B6XA 1BR2A 1U5PA 3OYXA 5FY0A 5HAXA 4ASKA 4H9NC 3WAKA 3IEEA 4AXPA 2VKJA 3D0TA 2X9HA 5JQGE 2C0SA 3AVSA 3ZC0A 4DBQA 2VB6A 1FIOA 3O1JA 4HN9A 3RYCE 4MBQA 5FXWA 4HTEA 3HR0A 2D5UA 5EK2A 5JDMA 1LVKA 1X79A 4GK5E 2M67A 2Q9QC 4GYSA 5FY7A 4EZHA 1ZEEA 2E9XC 5KMGP 2NW8A 4DMVA 5CA0E 4ZS2A 2Z6EA 4EXTA 4FJOA 4UIGA 2BVMA 5JDQA 1MNDA 2V26A 5HXSA 3NBXX 2XQYA 4ZHQE 5JDLA 4MFRA 2EHOD 4M1PA 2UXXB 1QSDA 1MMGA 1HG2A 2YK0A 4KUMB 5HXEA 3ZYKA 2JJ9A 3S4UA 3CVRA 3F2EA 3RC8A 4JEHB 2VASA 3AAAB 5KX5E 3HA4A 4XBFB 5J2UE 2JQQA 4G63A 2W63A 3O9XA 2SPCA 4FI5A 3E08A 1US7B 5F3JA 2CMRA 4MALA 2YU2A 4XZCA 4QXCB 4BJNA 2N1GA 5LHHB 3PUGA 1D0XA 3ZMZB 5LJMA 1NAFA 4EYUA 4PK6A 4YHJA 2WWUA 3ZMUB 2KWHA 3ZN0B 3LBXA 2XTLA 2CWYA 1IJ6A 5FXZA 2IW5B 3RKOA 3OKQA 3UUNA 3RYIE 3LG7A 2RA1A 2OA5A 2EHOB 3CPZA 3HKDE 4ZS3A 4AKHA 2X9WA 4EOZB 4P0AA 4IE4A 4C90A 5LJNA 2X51A 4O4HE 2Q9QA 1S94A 3OYZA 3AB3B 5AFUL 1LKXA 2ZM8A 2E9XA 3UTKA 5IHYA 4P0BA 3N9MA 4QHOA 3UUMA 3ZYLA 2NP9A 5FYMA 4HGAA 2X67A 2C5JA 1SA0E 4HKAA 2LSIA 1HX8A 4IIJE 3RPUA 3KBUA 3ETUA 3N9QA 1D1CA 3N2GE 4CI1B 3K3QC 3KV6A 4WW0A 4EAHA 3UT5E 4C91A 5HWYA 4O8SA 3H37A 4KMCA 3ZCJA 5HYAA 3HI2A 3ONXA 2Y48B 5L2LA 2X9XA 2LJLA 4WNKA 3C51A 2BVLA 2LM9A 5L3CB 3Q5WA 3Q5XA 4U72A 5BMVE 5DJQC 1QUUA 3HKCE 3WI3A 4PFPA 3HKEE 1G8XA 2KINB 2ZM2A 4UVBB 5FXVA 5JRCB 4IHJE 3ESLA 2JPFA 3AAEB 3C50A 3EDUA 1FEWA 2P9BA 3P8CD 2IAKA 5EZYE 3V5SA 1VRBA 3AA7B 1MMDA 4QKNA 3AA1B 1Y64B 3CWZB 2A2FX 2H7OA 3V5UA 4AKLA 2Y6XA 3F57A 3PU8A 5EK4A 3SWHA 2LT3A 2MTQA 1H7CA 2QA7A 1MNEA 4TUYE 1MIYA 1BR4A 1IAPA 2A3DA 5DABA 3ZMTB 2LOSA 4F6RC 1D0ZA 5L3GB 3O1IA 2CLYB 4ZOLE 1FMWA 2K5BB 2IC6A 2IC9A 3IBPA 3SS1A 3EUHA 5E0OA 2V7JA 4BJMA 4H63V 5JVDE 3EVYA 2BDEA 5KDMC 2YINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9W A;  2C5I T;  4FI5 A;  3FXE B;  3FXD B;  2CA5 A;  3L3P A;  2X9Y A;  4J2C A;  2X9X A;  2MBG A;  1LRZ A;  1LVF A;  3P7I A;  4L0R A;  1H7C A;  1ZKE A;  3N5L A;  4B6X A;  4EYY R;  2KWI B;  3CKD A;  4DND A;  3TKL B;  1QSD A;  2C5J A;  3S4U A;  3CVR A;  4CQI A;  3QUJ A;  2C5K T;  2K48 A;  2IC9 A;  2IC6 A;  1Z0P A;  3MXZ A;  2KWH A;  2XTL A;  1IJ6 A;  3QK6 A;  1IJ5 A;  2G0U A; 
#chains in the Genus database with same CATH topology
 2E2A A;  2PFV A;  3FXD B;  5JR9 B;  2KND A;  2V7L A;  5LMN T;  2DL1 A;  3P7I A;  2XJ7 A;  3RIA A;  3NVO A;  4X1Y E;  4OHF A;  4QXB B;  2WMO A;  2X0H A;  2W67 A;  4QX7 B;  4E7Z A;  1KF6 A;  2XAJ B;  3WAJ A;  3K8P C;  4YSY A;  4JI5 T;  3M65 A;  2VUR A;  2LE8 A;  1WCR A;  4F8H A;  5LB7 B;  4H9Q C;  3ZN1 B;  2K3W A;  5AQV B;  5LGT B;  2KSR A;  1XZY A;  4PNI A;  5IYZ E;  1T72 A;  3AA0 B;  5LP6 E;  2G0U A;  1HNZ T;  4GYR A;  4TNV A;  4LFC T;  2Q9Q D;  3FBL A;  4EYY R;  2E9X D;  4U74 A;  5HEG A;  3ZC1 A;  3UU8 A;  1HR0 T;  3RC3 A;  2PTF A;  3UUX B;  2ACZ A;  4ZI7 E;  5LGN B;  3MAC A;  4J2C A;  5AQM B;  5HXR A;  2V7M A;  4AKG A;  4CXY A;  2VWA A;  2NWB A;  3PUS A;  3ANW A;  1Y01 A;  4AQF A;  3J9X 1;  3A7M A;  4ZEY A;  3PDY A;  4BAY B;  3KFW X;  4HFV A;  2JIW A;  3PUQ A;  2J47 A;  2XY8 B;  5IUX A;  4EEB A;  4IDN A;  3DJB A;  3E22 E;  4UF0 A;  2EHO C;  4EV6 A;  4PK5 A;  4V1A v;  4I0U A;  2K24 A;  4GK0 E;  4HEA A;  2KT9 A;  2H88 A;  4YTM A;  3IF8 B;  4DR3 T;  2DHR A;  1W0B A;  5L3E B;  2WU2 A;  3NKZ A;  3NZP A;  2IUB A;  3ANW B;  1S35 A;  1FJG T;  1EZ3 A;  3UUL A;  3J7Y q;  3AE4 A;  3I1A A;  2WWV A;  1XMO T;  2V6X A;  5FMN A;  3R84 B;  1D1A A;  3UFG A;  1WLX A;  4UF0 B;  4AI6 A;  2I59 A;  4O4J E;  3MXZ A;  2YU1 A;  3AEB A;  3RRC A;  4OFZ A;  4DUZ T;  2VL8 A;  5H6Q B;  3RKG A;  2A72 A;  4GIW A;  4L0R A;  3Q9D A;  2FBW A;  4IE5 A;  5IWA T;  3ZLI A;  4EB6 E;  2XAF B;  2UUC T;  1UK5 A;  4X66 T;  4IL9 A;  4QX8 B;  4DID B;  4DVD A;  3L09 A;  2WBL A;  1DU2 A;  3KVB A;  1J1J A;  4UEL A;  3PUX F;  4E7S A;  2CXL A;  3BQL A;  5JDG A;  3RQW A;  3N9O A;  4KX6 A;  5AQS B;  5JRC A;  4CN6 A;  1BR1 A;  1HG5 A;  4X20 E;  5ABE A;  4H9P C;  2WSS V;  4YJ2 E;  3DTO A;  2JRK A;  4HFD A;  1UCU A;  3NRX A;  2PBI A;  5FNV E;  3KDS E;  3NRY A;  3AE5 A;  4DMW A;  2XZE A;  2K9A A;  1N33 T;  2XAQ B;  3QK6 A;  3AE2 A;  4TN7 B;  3K3N A;  4DO0 A;  3QB5 A;  4ZI3 C;  4ZI2 D;  2XSB A;  2WCA A;  1ZP0 A;  4DR4 T;  2BBH A;  4DV0 T;  3PE0 A;  4PK4 A;  2W62 A;  1N32 T;  4EED A;  1NEK A;  4BA9 A;  2H7V C;  3NZQ A;  1E1H B;  2HHH T;  4GOU A;  2X0Y A;  1JNZ A;  2XPK A;  3IEE A;  4CN4 A;  2QVA A;  2YDR A;  3VR9 A;  2VQF T;  1ZEE A;  2XM2 A;  2NW8 A;  4FJO A;  3NBX X;  4HFE A;  3UUB A;  1QLB A;  4HFB A;  4TNW A;  5AQO B;  3AE8 A;  2BG9 A;  2V5C A;  3UU4 A;  4LML A;  4YSX A;  5HCJ A;  5LJM A;  2VQE T;  2WWU A;  2KWH A;  3LBX A;  2XTL A;  1IJ6 A;  5FXZ A;  3OKQ A;  4AQY T;  3LG7 A;  4AKH A;  4IE4 A;  5LJN A;  2YN6 A;  5JTG A;  4KHZ F;  1LKX A;  4AIU A;  5IHY A;  2NP9 A;  5FYM A;  1SA0 E;  2IIU A;  2NR4 A;  4JI8 T;  3ETU A;  2FJE A;  2BG9 B;  1D1C A;  3K3Q C;  3UT5 E;  4O8S A;  3H37 A;  3ZCJ A;  3ONX A;  3C51 A;  1JNR A;  5L3C B;  5BMV E;  1N34 T;  4PFP A;  1G8X A;  2E5V A;  4LF8 T;  1FEW A;  2P9B A;  5LG3 A;  5EZY E;  1Y64 B;  2H7O A;  3P4Q A;  4AKL A;  3SWH A;  2FUP A;  1HNX T;  1MNE A;  1IAP A;  5AQJ B;  5L3G B;  3O1I A;  2CLY B;  4JI6 T;  2IC6 A;  2IC9 A;  3SS1 A;  3EUH A;  1XNR T;  3PUY F;  4BJM A;  4H63 V;  5JVD E;  5KDM C;  4UVA B;  5GON E;  2H3R A;  5CJ5 A;  2CXF A;  4OYJ A;  5C3J A;  5ABF A;  5HWX A;  4H9S E;  3FZF B;  3VHL A;  2K48 A;  4H9R C;  1WRD A;  4NUU A;  4IDO A;  3RRW A;  2H89 A;  3H3M A;  4NUV A;  4IDP A;  4OYK A;  3SOL A;  4Q25 A;  2KXP B;  4KP3 C;  2WP9 A;  4EGW A;  1M62 A;  3JC6 D;  3ETV A;  2UU9 T;  2J4G A;  4O4I E;  1OED E;  2X68 A;  5AQF B;  4H63 H;  4X65 T;  2YKS A;  5ABF B;  3PUA A;  5AQR B;  3AEE A;  2VKH A;  1O3X A;  4CXW A;  4QWN B;  3I9W A;  2CXD A;  5LCY A;  5CGM A;  5LOV E;  3UU6 A;  2V6Y B;  2UXB T;  3BK9 A;  4IE6 A;  3RF1 A;  3U78 A;  3R6N A;  4TX5 A;  3IHR A;  2WZI A;  3QC9 A;  2ES0 A;  2LSG A;  2MBG A;  4DV4 T;  3PU3 A;  3QNU A;  2KMF A;  2WY2 A;  4X1K E;  3GA8 A;  2XAS B;  5FVK A;  2DI4 A;  3AA6 B;  3X1D A;  3C98 B;  4X64 T;  3RX6 A;  3CX7 B;  2Q9Q B;  3B13 A;  2E9X B;  5ABH A;  4TV9 E;  4B3S T;  2IHR 1;  1W09 A;  1XDO A;  1HFA A;  2XQ6 A;  1LVF A;  2QGS A;  4PJM A;  5KXJ A;  5TAO A;  2CPT A;  4ILU A;  3VRA A;  2LSY A;  5LG4 A;  4MLK A;  1L0V A;  4OK0 A;  4ILA A;  4EZ4 A;  4JI2 T;  4K0K T;  2ZMA A;  1UX5 A;  4TZ4 C;  4JI1 T;  2NTY A;  3MKD A;  3CX6 B;  5L3D B;  1MMN A;  2E8I A;  3MZK B;  4CXX A;  3RIU C;  1B7T A;  3CQX C;  2KLQ A;  1MIW A;  5HEO A;  2MYS A;  4QH5 A;  4IST A;  3UFE A;  1HF8 A;  4L5G A;  3ZMS B;  3LK3 B;  2JMK A;  2EHO A;  5CB4 E;  1CUN A;  2WDR A;  3AE1 A;  2N2N A;  4X62 T;  4CQI A;  4IDZ A;  3DP7 A;  4CI2 B;  2LSK A;  1NWM X;  3U3I A;  3N9N A;  4I4T E;  4U2Y A;  5F8P A;  2CEA A;  2CCQ A;  3BQK A;  3C64 A;  1HNW T;  2X0L B;  3CML A;  5JR9 C;  2FJB A;  2XQ3 A;  3N5L A;  3BQI A;  4ERR A;  4I55 E;  2VKD A;  2WZH A;  5HXC A;  4DV6 T;  2VKO A;  4UEM A;  2RPA A;  4PAG A;  3AAI A;  3ZMV B;  1KNZ A;  2M6B A;  4QH4 A;  2YDQ A;  3MK7 C;  4PFO A;  3PUR A;  2UXN B;  1HTJ F;  2FJD A;  2GK9 A;  5J0Z A;  1MIV A;  4UV8 B;  1V9D A;  1I6Z A;  3I9Y A;  2XHE B;  5C8Y E;  3HL6 A;  2VVS A;  4UV9 B;  4TV8 E;  4G2A A;  4PJN A;  1U4Q A;  4B3T T;  3I0O A;  3ZEF B;  5FP3 A;  2WM9 A;  3CQG B;  3LJC A;  1OXZ A;  3AEF A;  2ODU A;  3T1Y T;  2D0U A;  4LF5 T;  3EI0 A;  1KNP A;  5FY0 A;  2VKJ A;  3RHW A;  3JCF A;  2X9H A;  2C0S A;  3AVS A;  3ZC0 A;  2VB6 A;  3RYC E;  4NXM T;  4MBQ A;  5FXW A;  2AE9 A;  5EK2 A;  2D5U A;  1WR0 A;  4EZH A;  5HEJ A;  1MND A;  3Q5D A;  4MFR A;  2EHO D;  2JQH A;  2UXX B;  4KUM B;  5HXE A;  3ZYK A;  1SUM B;  3CVR A;  3RC8 A;  2CHO A;  4JEH B;  5KX5 E;  3OTO T;  5J2U E;  3AEC A;  1HX1 B;  3O9X A;  3E08 A;  2YU2 A;  4QXC B;  3UU3 A;  5LHH B;  1D0X A;  2XQ7 A;  4PK6 A;  4YHJ A;  3AXJ A;  3ZN0 B;  1UUR A;  3RYI E;  4ZS3 A;  4ZXL A;  5AQP B;  4P0A A;  2X51 A;  4O4H E;  3OYZ A;  5AFU L;  3N9M A;  4QHO A;  2X67 A;  2LSI A;  1HX8 A;  3ABV A;  3N9Q A;  3N2G E;  4HFI A;  4WW0 A;  1YQ4 A;  4EAH A;  5HWY A;  5HYA A;  3JAF A;  2Y48 B;  2X9X A;  2LJL A;  4WNK A;  4DR7 T;  2BVL A;  3Q5X A;  4U72 A;  1QUU A;  3HKC E;  3HKE E;  2ZM2 A;  4UVB B;  3JAE A;  5FXV A;  5JRC B;  2HN1 A;  3P8C D;  3V5S A;  1VRB A;  3AA7 B;  4QKN A;  3AA1 B;  4YSZ A;  2A2F X;  5L47 A;  5EK4 A;  1H7C A;  4TUY E;  1BR4 A;  3ZMT B;  1I94 T;  4DV3 T;  3QOF A;  3SFE A;  1FMW A;  3OPC A;  5E0O A;  2V7J A;  3ZT5 A;  2BS4 A;  4A5X A;  3PUV F;  4I43 B;  2NW7 A;  2DCF A;  4ZI3 D;  2KWI B;  3SFD A;  2LRK A;  5LMU T;  4LFA T;  1SHZ C;  1E7P A;  2HPL A;  3QUJ A;  4DV1 T;  4UXN B;  4CI3 B;  4U3C A;  3VU7 H;  4ADZ A;  2V1D B;  2HH7 A;  2ZM0 A;  2WMN A;  4DV2 T;  1LRZ A;  2CM0 A;  3TLV A;  4DV7 T;  2B1E A;  3G06 A;  2Y8D A;  5ADX L;  1ZOY A;  3T1H T;  1WYB A;  4PJJ A;  3N2K E;  4Z90 A;  5AQK B;  5F5W A;  2C5I T;  4LMJ A;  3A5X A;  5LHG B;  2L8K A;  2DLR A;  4O2B E;  2XQ8 A;  4CZZ B;  4YY3 T;  4LF7 T;  2WDV A;  4ISS A;  1YKH B;  2LHR A;  3N9L A;  4WBO A;  2W4X A;  2JQK A;  2MOZ A;  4O4L E;  1D1B A;  3P4R A;  3VRB A;  3RI5 A;  3H3A A;  4AKI A;  2WB5 A;  3LFM A;  2JQ9 A;  3L39 A;  3LBX B;  5DQV A;  2DWK A;  4IE7 A;  2J1D G;  2ZLY A;  3RH3 A;  4YT0 A;  4TWF A;  2XAG B;  3O1H A;  1MMA A;  3ZKR A;  3AE3 A;  3P4W A;  4DV5 T;  3KV9 A;  1J5E T;  1SE7 A;  2FJA A;  4PJL A;  5LNK A;  2J62 A;  3N9P A;  3AEA A;  3ZJ2 A;  2NW9 A;  2YOE A;  4H9O C;  1VOM A;  1XWM A;  5FY1 A;  2LHN A;  4IE0 A;  4JBW F;  3A8Y C;  3RYF E;  5LGU B;  4I50 E;  5LXT E;  4JYA T;  4YXD A;  3TLT A;  1ZV4 X;  2BZB A;  2CBJ A;  3KVA A;  2JMH A;  3QB5 K;  5ABG A;  5CFB A;  3P50 A;  3KIN B;  1FMV A;  1BR0 A;  2B76 A;  3FZM B;  2CBI A;  5L4H A;  2CLY C;  4P09 A;  5L3F B;  1T98 A;  2XQ5 A;  2D0T A;  3LK2 B;  2BKO A;  3ZPO A;  2V5D A;  5HCM A;  2OV9 A;  2WAU A;  5FVL A;  5FL1 A;  3RQU A;  3RIU A;  2LM2 A;  3KBT A;  2KZ7 B;  2V7K A;  2DNX A;  5AQQ B;  3CKD A;  2WQY A;  4NXN T;  2XSA A;  3GN5 A;  4B3R T;  3PV0 F;  3W15 B;  2BBJ A;  3FXE B;  2CA5 A;  2ACX A;  3K3O A;  4TWD A;  3ZST A;  2A9U A;  3Q2M A;  3RYH E;  3N2O A;  5JR9 A;  5LHI B;  3I0Q A;  2WU5 A;  1YKE B;  1IZN B;  4DR2 T;  1KEY A;  3AE6 A;  3C4Z A;  4A56 A;  1OED C;  3GN5 B;  4ZZC A;  2F4V T;  4JV5 T;  1BR2 A;  5HAX A;  3IA3 A;  4ASK A;  4H9N C;  5HEU A;  5JQG E;  4HN9 A;  2IML A;  4QH1 A;  5JDM A;  2Q9Q C;  2E9X C;  5KMG P;  2CRB A;  4DMV A;  4ZS2 A;  4UIG A;  2UXD T;  2V26 A;  3Q5E A;  2XQY A;  4ZHQ E;  5JDL A;  3PJA A;  1QSD A;  1MMG A;  1HG2 A;  2YK0 A;  3LSV A;  3S4U A;  3F2E A;  3AAA B;  3HA4 A;  4XBF B;  5AQH B;  4G63 A;  3NWI A;  1XNQ T;  2LRL A;  4FI5 A;  4NPP A;  1US7 B;  2CMR A;  4XZC A;  4BJN A;  4LMK A;  3P4P A;  4JI3 T;  2I6H A;  4KHP T;  1NAF A;  4NIQ A;  2MPK A;  2M6I A;  2CWY A;  2IW5 B;  1X9B A;  2BS2 A;  3RKO A;  4COF A;  2RA1 A;  2W66 A;  2EHO B;  4DR1 T;  3CPZ A;  3L8R A;  4C90 A;  4Z91 A;  1UGO A;  4X5T A;  2ZM8 A;  4P0B A;  3UUM A;  4IIJ E;  3RPU A;  4CI1 B;  3VR8 A;  3CK6 A;  3KV6 A;  4C91 A;  3AE9 A;  3EHZ A;  4KMC A;  3HI2 A;  5L2L A;  4HFH A;  2LM9 A;  3Q5W A;  5DJQ C;  4IHJ E;  4LFB T;  4U31 A;  4GKK T;  3PUZ F;  1MMD A;  3CWZ B;  1XMQ T;  3V5U A;  2Y6X A;  3F57 A;  3PU8 A;  1UUS A;  3P4S A;  3CIR A;  1MIY A;  5DAB A;  2A3D A;  4F6R C;  2UUB T;  3ONL C;  5FL0 A;  1D0Z A;  2XQA A;  4YHH T;  1W9R A;  2K5B B;  3AEG A;  3FZL B;  3IBP A;  3LDQ B;  3K1S A;  2L3L A;  4DBR A;  3PTR B;  4HWI B;  1ZKE A;  2L9Q A;  3TKL B;  3AED A;  3T8O A;  2W0G A;  4LF9 T;  3EDV A;  3GMI A;  4K0U A;  5BR8 T;  4EIW A;  2V7I A;  3M3Z B;  1NEN A;  1G73 A;  1WR6 A;  3B5M A;  2I0M A;  1YW0 A;  3C4X A;  5FXX A;  3OJA A;  3RGL A;  1IBL T;  4AQF C;  4A97 A;  3HKB E;  3MJX A;  2LOP A;  2D2S A;  2NTX A;  4AIS A;  1D0Y A;  3MA9 A;  2WS3 A;  4HWC A;  4L9I A;  2CHN A;  4ZI2 C;  4IL4 A;  2XQ4 A;  4AQG A;  5ETW A;  1YD8 G;  3ZCI A;  1AJ3 A;  2DWG A;  2ODV A;  3SRZ A;  5LYJ E;  2NOX A;  4GKJ T;  4HWH A;  2PG8 A;  1T8B A;  3UU5 A;  2RP4 A;  3ZT6 A;  4JLE A;  4KBM B;  4O2A E;  5EK3 A;  3AXJ B;  2CWO A;  4ILB A;  1HCI A;  3KV4 A;  1YXR A;  3OBV E;  2WDQ A;  4N78 D;  4PW8 A;  2W00 A;  4DUY T;  3EAM A;  3ZYM A;  3FZK B;  3LK4 2;  3E0Z A;  1YQ3 A;  2LKH A;  2UUA T;  4X1I E;  3KV5 A;  4QXH B;  4U2Z A;  3ZT7 A;  3VKG A;  1WFD A;  3TLS A;  4WZX A;  4HWF A;  4YLH A;  3RLF F;  4UVC B;  4MHC A;  4A98 A;  2LEH A;  5J1G A;  2AXD S;  1GQE A;  1Z0P A;  4DR6 T;  1VCT A;  3ZJ1 A;  2HPJ A;  3FBZ A;  1IBK T;  2X9Y A;  2VK9 A;  2YDS A;  2CE7 A;  5DQW A;  5FKY A;  4DND A;  3B57 A;  4UR9 A;  1W0A A;  2N9D A;  3FB2 A;  3O4X E;  1KFY A;  5H6R B;  5JDH A;  4YFS A;  2BG9 E;  4DR5 T;  1Z8U A;  5JH7 E;  2E5L T;  4JEU B;  5HEH A;  4B3M T;  3UQ4 A;  4IGU A;  5LA6 E;  4WYV A;  2OLT A;  4ANJ A;  5AQN B;  4P1N A;  4AKR B;  2PJQ A;  1HS7 A;  2XUE A;  4CN1 A;  4JI4 T;  4XAX B;  2XQ9 A;  1XDP A;  1M7K A;  4YTP A;  5JDF A;  5JRE A;  4JUY A;  2VVN A;  5M4Y A;  5A1L A;  1WYC A;  1ZHC A;  4IT4 A;  5AQU B;  3RIF A;  2HN2 A;  2LSJ A;  3AVR A;  1OWA A;  5LBQ B;  2XAH B;  2W2U A;  5J2T E;  2W61 A;  3C4W A;  3F31 A;  3CX8 B;  2LLY A;  4HE8 A;  3FHN A;  3ZSS A;  1IJ5 A;  4IRE A;  4YJ3 E;  1KK7 A;  1J5W A;  4Z8X A;  2X66 A;  3AE7 A;  4YTN A;  2YEV C;  5HXH A;  4KI0 F;  4WBN E;  3CQC B;  5LBM A;  4ILC A;  2LKG A;  2C5K T;  3GWH A;  3ONJ A;  2MAW A;  3VKH A;  1UX4 A;  5CA1 E;  4OX9 T;  4HWD A;  2BG9 C;  3PUW F;  2IDO B;  3L3P A;  1IBM T;  5L3B B;  3JAD A;  3JC6 C;  4B6X A;  1U5P A;  3OYX A;  3WAK A;  4AXP A;  3D0T A;  2BKN A;  4DBQ A;  1FIO A;  3O1J A;  2UXC T;  4JI0 T;  4HTE A;  4HFC A;  3HR0 A;  3TLW A;  1LVK A;  1X79 A;  4GK5 E;  2M67 A;  4GYS A;  5FY7 A;  5JDN A;  5CA0 E;  2Z6E A;  4EXT A;  2BVM A;  5JDQ A;  5HXS A;  3TLU A;  4M1P A;  1VCS A;  1E2A A;  2BKP A;  2JJ9 A;  2VAS A;  2JQQ A;  2W63 A;  2SPC A;  5F3J A;  3EAB A;  3UQ7 A;  4MAL A;  2V6Y A;  2R6G F;  1OED A;  2N1G A;  5AQI B;  3PUG A;  1CHU A;  3ZMZ B;  4EYU A;  1R8I A;  3ZMU B;  3UUN A;  2V8S V;  2OA5 A;  3HKD E;  3OVU A;  2X9W A;  4EOZ B;  2VL0 A;  5AQT B;  4TWH A;  2Q9Q A;  1S94 A;  3AB3 B;  2E9X A;  3UTK A;  4U33 A;  2XM1 A;  3ZYL A;  4HGA A;  2C5J A;  4HKA A;  3PJA J;  3KBU A;  2QYW A;  5L4E A;  1OED B;  4JI7 T;  5AQL B;  4IDQ A;  1KNR A;  4U7Y A;  3WI3 A;  2KIN B;  1T7S A;  4ZZB A;  2D9D A;  3ESL A;  3FZH B;  2JPF A;  3AAE B;  3C50 A;  3EDU A;  2IAK A;  2LT3 A;  2MTQ A;  4U7I A;  2QA7 A;  2LOS A;  4LF4 T;  1N36 T;  5C2T A;  4ZOL E;  2ZM6 T;  3EVY A;  2BDE A;  2BS3 A;  4LF6 T;  5AQG B;  2QRX A;  2YIN A; 
#chains in the Genus database with same CATH homology
 2L3L A;  2PFV A;  4UVA B;  3FXD B;  4I43 B;  5JR9 B;  2KND A;  2V7L A;  2NW7 A;  5GON E;  4DBR A;  3P7I A;  2H3R A;  3PTR B;  1ZKE A;  2L9Q A;  2CXF A;  2DCF A;  4OYJ A;  4X1Y E;  4ZI3 D;  2KWI B;  4OHF A;  3TKL B;  5HWX A;  4H9S E;  4QXB B;  2WMO A;  3T8O A;  2W0G A;  1SHZ C;  2HPL A;  3QUJ A;  3VHL A;  2K48 A;  3EDV A;  4H9R C;  3GMI A;  4UXN B;  4K0U A;  4CI3 B;  4QX7 B;  4EIW A;  1WRD A;  4NUU A;  2V7I A;  4E7Z A;  3VU7 H;  4ADZ A;  2V1D B;  2HH7 A;  2XAJ B;  3WAJ A;  3K8P C;  1G73 A;  1WR6 A;  3RRW A;  2ZM0 A;  1YW0 A;  3M65 A;  2WMN A;  1LRZ A;  2LE8 A;  3C4X A;  4NUV A;  5FXX A;  2CM0 A;  3OJA A;  4OYK A;  3SOL A;  4AQF C;  2KXP B;  3HKB E;  4KP3 C;  2B1E A;  4H9Q C;  3ZN1 B;  3MJX A;  5LGT B;  2Y8D A;  5ADX L;  2LOP A;  4PNI A;  2D2S A;  3JC6 D;  2NTX A;  3ETV A;  5IYZ E;  1D0Y A;  1WYB A;  4O4I E;  3MA9 A;  2X68 A;  4PJJ A;  4H63 H;  3AA0 B;  4L9I A;  4ZI2 C;  3N2K E;  5LP6 E;  2G0U A;  4AQG A;  5ETW A;  1YD8 G;  3ZCI A;  1AJ3 A;  2C5I T;  4GYR A;  3PUA A;  3A5X A;  2DWG A;  5LHG B;  2ODV A;  2L8K A;  2DLR A;  2VKH A;  1O3X A;  2Q9Q D;  3FBL A;  4O2B E;  4CZZ B;  4EYY R;  3SRZ A;  4CXW A;  2E9X D;  4U74 A;  4QWN B;  5LYJ E;  4ISS A;  3ZC1 A;  3I9W A;  1YKH B;  2NOX A;  2CXD A;  5LCY A;  2LHR A;  3N9L A;  4WBO A;  4O4L E;  2MOZ A;  1D1B A;  5LOV E;  2PG8 A;  3RC3 A;  3BK9 A;  4IE6 A;  3U78 A;  3R6N A;  2RP4 A;  4TX5 A;  3IHR A;  3UUX B;  3H3A A;  4JLE A;  3QC9 A;  4ZI7 E;  2ES0 A;  2LSG A;  5LGN B;  3MAC A;  4KBM B;  4O2A E;  4J2C A;  2MBG A;  4AKI A;  5HXR A;  2V7M A;  3PU3 A;  4AKG A;  4CXY A;  2VWA A;  5EK3 A;  2KMF A;  2NWB A;  3PUS A;  3LFM A;  3ANW A;  4X1K E;  4AQF A;  2CWO A;  2XAS B;  3GA8 A;  3LBX B;  3J9X 1;  5DQV A;  1HCI A;  3KV4 A;  3PDY A;  3OBV E;  2DWK A;  4N78 D;  2DI4 A;  4BAY B;  3KFW X;  4HFV A;  4PW8 A;  3AA6 B;  3C98 B;  4IE7 A;  3RX6 A;  3PUQ A;  2J1D G;  3CX7 B;  2W00 A;  2Q9Q B;  2ZLY A;  3B13 A;  3RH3 A;  3ZYM A;  2E9X B;  4TV9 E;  3LK4 2;  2XAG B;  3E0Z A;  3O1H A;  3DJB A;  3E22 E;  4UF0 A;  1HFA A;  1MMA A;  2EHO C;  4PK5 A;  1LVF A;  2QGS A;  4X1I E;  4PJM A;  5TAO A;  4V1A v;  2K24 A;  4GK0 E;  4HEA A;  4ILU A;  3KV5 A;  2KT9 A;  4QXH B;  3IF8 B;  2DHR A;  2LSY A;  3KV9 A;  5L3E B;  5LG4 A;  4MLK A;  4PJL A;  3VKG A;  4OK0 A;  3NZP A;  5LNK A;  3N9P A;  4EZ4 A;  3ZJ2 A;  3ANW B;  1S35 A;  2NW9 A;  4WBN E;  2ZMA A;  4H9O C;  1UX5 A;  4YLH A;  1VOM A;  5FY1 A;  2LHN A;  4TZ4 C;  4IE0 A;  2NTY A;  1EZ3 A;  3UUL A;  3J7Y q;  3MKD A;  4UVC B;  3I1A A;  4MHC A;  3CX6 B;  5L3D B;  1MMN A;  5FMN A;  3R84 B;  1D1A A;  3RYF E;  5LGU B;  2LEH A;  5J1G A;  2E8I A;  1WLX A;  3MZK B;  4I50 E;  4UF0 B;  4CXX A;  1B7T A;  2I59 A;  5LXT E;  4AI6 A;  1Z0P A;  3CQX C;  4O4J E;  3MXZ A;  2YU1 A;  1ZV4 X;  2BZB A;  2KLQ A;  3RRC A;  1MIW A;  3ZJ1 A;  4OFZ A;  3KVA A;  2JMH A;  2VL8 A;  2HPJ A;  3FBZ A;  2MYS A;  5H6Q B;  2X9Y A;  2A72 A;  4IST A;  3UFE A;  2VK9 A;  4GIW A;  1HF8 A;  2CE7 A;  4L0R A;  4L5G A;  3ZMS B;  3LK3 B;  3Q9D A;  2JMK A;  5DQW A;  2EHO A;  3KIN B;  5CB4 E;  4IE5 A;  3ZLI A;  4EB6 E;  2XAF B;  1CUN A;  1FMV A;  3B57 A;  4DND A;  2N9D A;  3FB2 A;  3O4X E;  5H6R B;  5JDH A;  1BR0 A;  2N2N A;  4YFS A;  4CQI A;  5JH7 E;  4IDZ A;  3DP7 A;  4JEU B;  4QX8 B;  2CLY C;  4CI2 B;  4DVD A;  4P09 A;  3L09 A;  5L3F B;  2WBL A;  3KVB A;  4IGU A;  1T98 A;  2LSK A;  1NWM X;  3U3I A;  3N9N A;  4I4T E;  5F8P A;  2CEA A;  2CCQ A;  5LA6 E;  3BQK A;  3C64 A;  4UEL A;  4E7S A;  2CXL A;  2X0L B;  3BQL A;  3CML A;  4ANJ A;  5JR9 C;  2D0T A;  3N5L A;  3BQI A;  4AKR B;  4ERR A;  3LK2 B;  4I55 E;  5JDG A;  2VKD A;  2PJQ A;  5HXC A;  3ZPO A;  2VKO A;  2XUE A;  1HS7 A;  3N9O A;  4UEM A;  4PAG A;  3AAI A;  3ZMV B;  5JDN A;  1KNZ A;  2WAU A;  4XAX B;  5JRC A;  5JDF A;  1BR1 A;  5JRE A;  3MK7 C;  4JUY A;  1HG5 A;  4X20 E;  4PFO A;  3PUR A;  4H9P C;  5M4Y A;  2WSS V;  5A1L A;  3KBT A;  1WYC A;  2KZ7 B;  1ZHC A;  2UXN B;  2V7K A;  2DNX A;  4YJ2 E;  3DTO A;  2JRK A;  2LSJ A;  1HTJ F;  2GK9 A;  1UCU A;  1MIV A;  3CKD A;  3NRX A;  2PBI A;  3AVR A;  4UV8 B;  1V9D A;  1OWA A;  5FNV E;  2XAH B;  5LBQ B;  3I9Y A;  3GN5 A;  2XHE B;  3KDS E;  3NRY A;  5J2T E;  2W61 A;  3C4W A;  5C8Y E;  3F31 A;  3HL6 A;  3CX8 B;  4HE8 A;  4DMW A;  3FHN A;  2K9A A;  2XAQ B;  3QK6 A;  1IJ5 A;  4TN7 B;  3K3N A;  3W15 B;  4UV9 B;  4YJ3 E;  4DO0 A;  1KK7 A;  3FXE B;  4ZI3 C;  2CA5 A;  4ZI2 D;  4Z8X A;  2X66 A;  2ACX A;  3K3O A;  2YEV C;  4TV8 E;  5HXH A;  3Q2M A;  3PE0 A;  3RYH E;  3N2O A;  4G2A A;  3CQC B;  4PJN A;  4PK4 A;  1U4Q A;  5JR9 A;  5LBM A;  2W62 A;  5LHI B;  3I0Q A;  1YKE B;  3I0O A;  2C5K T;  3GWH A;  3ZEF B;  3VKH A;  5FP3 A;  1IZN B;  1UX4 A;  4BA9 A;  5CA1 E;  2WM9 A;  3CQG B;  3LJC A;  2H7V C;  3C4Z A;  1OXZ A;  3NZQ A;  4A56 A;  1E1H B;  2ODU A;  3L3P A;  3GN5 B;  2D0U A;  4GOU A;  5L3B B;  3JC6 C;  4B6X A;  1BR2 A;  1U5P A;  3OYX A;  5FY0 A;  5HAX A;  4ASK A;  4H9N C;  3WAK A;  3IEE A;  4AXP A;  2VKJ A;  3D0T A;  2X9H A;  5JQG E;  2C0S A;  3AVS A;  3ZC0 A;  4DBQ A;  2VB6 A;  1FIO A;  3O1J A;  4HN9 A;  3RYC E;  4MBQ A;  5FXW A;  4HTE A;  3HR0 A;  2D5U A;  5EK2 A;  5JDM A;  1LVK A;  1X79 A;  4GK5 E;  2M67 A;  2Q9Q C;  4GYS A;  5FY7 A;  4EZH A;  1ZEE A;  2E9X C;  5KMG P;  2NW8 A;  4DMV A;  5CA0 E;  4ZS2 A;  2Z6E A;  4EXT A;  4FJO A;  4UIG A;  2BVM A;  5JDQ A;  1MND A;  2V26 A;  5HXS A;  3NBX X;  2XQY A;  4ZHQ E;  5JDL A;  4MFR A;  2EHO D;  4M1P A;  2UXX B;  1QSD A;  1MMG A;  1HG2 A;  2YK0 A;  4KUM B;  5HXE A;  3ZYK A;  2JJ9 A;  3S4U A;  3CVR A;  3F2E A;  3RC8 A;  4JEH B;  2VAS A;  3AAA B;  5KX5 E;  3HA4 A;  4XBF B;  5J2U E;  2JQQ A;  4G63 A;  2W63 A;  3O9X A;  2SPC A;  4FI5 A;  3E08 A;  1US7 B;  5F3J A;  2CMR A;  4MAL A;  2YU2 A;  4XZC A;  4QXC B;  4BJN A;  2N1G A;  5LHH B;  3PUG A;  1D0X A;  3ZMZ B;  5LJM A;  1NAF A;  4EYU A;  4PK6 A;  4YHJ A;  2WWU A;  3ZMU B;  2KWH A;  3ZN0 B;  3LBX A;  2XTL A;  2CWY A;  1IJ6 A;  5FXZ A;  2IW5 B;  3RKO A;  3OKQ A;  3UUN A;  3RYI E;  3LG7 A;  2RA1 A;  2OA5 A;  2EHO B;  3CPZ A;  3HKD E;  4ZS3 A;  4AKH A;  2X9W A;  4EOZ B;  4P0A A;  4IE4 A;  4C90 A;  5LJN A;  2X51 A;  4O4H E;  2Q9Q A;  1S94 A;  3OYZ A;  3AB3 B;  5AFU L;  1LKX A;  2ZM8 A;  2E9X A;  3UTK A;  5IHY A;  4P0B A;  3N9M A;  4QHO A;  3UUM A;  3ZYL A;  2NP9 A;  5FYM A;  4HGA A;  2X67 A;  2C5J A;  1SA0 E;  4HKA A;  2LSI A;  1HX8 A;  4IIJ E;  3RPU A;  3KBU A;  3ETU A;  3N9Q A;  1D1C A;  3N2G E;  4CI1 B;  3K3Q C;  3KV6 A;  4WW0 A;  4EAH A;  3UT5 E;  4C91 A;  5HWY A;  4O8S A;  3H37 A;  4KMC A;  3ZCJ A;  5HYA A;  3HI2 A;  3ONX A;  2Y48 B;  5L2L A;  2X9X A;  2LJL A;  4WNK A;  3C51 A;  2BVL A;  2LM9 A;  5L3C B;  3Q5W A;  3Q5X A;  4U72 A;  5BMV E;  5DJQ C;  1QUU A;  3HKC E;  3WI3 A;  4PFP A;  3HKE E;  1G8X A;  2KIN B;  2ZM2 A;  4UVB B;  5FXV A;  5JRC B;  4IHJ E;  3ESL A;  2JPF A;  3AAE B;  3C50 A;  3EDU A;  1FEW A;  2P9B A;  3P8C D;  2IAK A;  5EZY E;  3V5S A;  1VRB A;  3AA7 B;  1MMD A;  4QKN A;  3AA1 B;  1Y64 B;  3CWZ B;  2A2F X;  2H7O A;  3V5U A;  4AKL A;  2Y6X A;  3F57 A;  3PU8 A;  5EK4 A;  3SWH A;  2LT3 A;  2MTQ A;  1H7C A;  2QA7 A;  1MNE A;  4TUY E;  1MIY A;  1BR4 A;  1IAP A;  2A3D A;  5DAB A;  3ZMT B;  2LOS A;  4F6R C;  1D0Z A;  5L3G B;  3O1I A;  2CLY B;  4ZOL E;  1FMW A;  2K5B B;  2IC6 A;  2IC9 A;  3IBP A;  3SS1 A;  3EUH A;  5E0O A;  2V7J A;  4BJM A;  4H63 V;  5JVD E;  3EVY A;  2BDE A;  5KDM C;  2YIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...