2KWIB

Ralb-rlip76 (ralbp1) complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
56
structure length
56
Chain Sequence
b'GSETQAGIKEEIRRQEFLLNSLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ras-related protein Ral-B
publication title The RalB-RLIP76 complex reveals a novel mode of ral-effector interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein, protein binding
total genus 23
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-04-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kwiB00
2CA5A 4CQIA 4B6XA 4FI5A 1Z0PA 4L0RA 2IC9A 3FXDB 3CVRA 3L3PA 1IJ5A 4J2CA 2MBGA 1LVFA 1IJ6A 1QSDA 2X9XA 3FXEB 3MXZA 3N5LA 1ZKEA 3QUJA 2C5JA 2C5IT 3QK6A 1H7CA 2IC6A 3S4UA 1LRZA 4DNDA 2C5KT 3P7IA 2G0UA 2X9WA 2K48A 3TKLB 2KWHA 2XTLA 2KWIB 3CKDA 2X9YA 4EYYR
chains in the Genus database with same CATH superfamily
4LF8T 4ZI3C 2K5BB 2EHOA 5AQIB 5JDNA 5LGNB 2HHHT 3AE9A 4PAGA 5ABEA 4X66T 3LG7A 3OKQA 3WI3A 2KWHA 5C8YE 3SRZA 4TN7B 5HWXA 5CJ5A 4X65T 1LVFA 4PJJA 4QXCB 3ETVA 5J2TE 3N9LA 2C5JA 2JPFA 5EZYE 1JNRA 5AQRB 3J9X1 2JIWA 3IHRA 5DJQC 3NRYA 4DR2T 1UX5A 4LMKA 3N9QA 4IDOA 2V7KA 2CCQA 5FXZA 4HGAA 2WS3A 2W61A 5ABGA 2YK0A 5LG3A 2DWKA 5IHYA 3KVBA 2JMKA 2WDQA 4QWNB 1NWMX 3P7IA 2JJ9A 2X9WA 4YHJA 5JRCA 2JRKA 4WBOA 5EK2A 4JBWF 4IE5A 4KP3C 1JNZA 2R6GF 3FHNA 4AXPA 4GKJT 2BKOA 3CQGB 1E1HB 4ILBA 5HEUA 4TWFA 3ZLIA 2CHNA 2N9DA 2LSGA 2XPKA 4L5GA 2WM9A 3K8PC 2HPJA 5JQGE 3CKDA 1WYBA 3F2EA 4DV0T 3L8RA 2WWUA 3V5UA 4X1YE 2V6XA 4U7IA 4HEAA 3CWZB 3ZJ1A 2XTLA 2IAKA 2E9XD 4O4IE 2C0SA 4ERRA 2D0TA 4BJNA 2BS4A 3N9NA 3F57A 2YU2A 4I55E 3MK7C 2LJLA 5LGUB 4TX5A 5AQKB 3UFGA 4DUZT 4HFVA 2VKJA 3Q2MA 2WB5A 4B3RT 4HWHA 4QX8B 3PURA 1U4QA 3OTOT 4KBMB 1CHUA 2H88A 2QYWA 2PJQA 2CRBA 3UUBA 3O4XE 3RI5A 2WU2A 4P1NA 1QLBA 2WDRA 2HN1A 2EHOB 4UEMA 2RPAA 3QK6A 3PU3A 2RA1A 2UUCT 3GWHA 4AIUA 3ANWB 4JUYA 4C91A 3CQXC 2L9QA 2UU9T 2CBIA 1HG5A 4ZS2A 4XBFB 2WCAA 4ZHQE 3AEDA 3CMLA 5FNVE 2GK9A 2L8KA 2C5KT 1OEDE 1ZP0A 3RX6A 4UVCB 3FZMB 4CI2B 2KT9A 2Q9QD 2MOZA 2XQ5A 4TZ4C 3KV5A 3FZHB 4TV8E 4JI7T 2W66A 4DUYT 4ILCA 1T8BA 3PJAJ 1G73A 2HH7A 2MYSA 3LDQB 2CWYA 1J5ET 3KINB 2VKHA 2Z6EA 5JRCB 2MPKA 4DR4T 3C64A 3AEFA 2LM2A 3PJAA 5GONE 2V1DB 1E7PA 4AKIA 2WQYA 3OVUA 2FJAA 5LNKA 2XAFB 4V1Av 3ZN0B 1XDPA 4GYRA 4ZI2C 3ZC1A 2FJEA 2WMNA 2XQ6A 2ACZA 3L3PA 2KLQA 3C50A 4QH4A 5LHGB 2JMHA 3ZYKA 5AQOB 5FL0A 1M7KA 2N2NA 3AE6A 2DNXA 2D0UA 4PK5A 4YXDA 3B5MA 1L0VA 4TV9E 3ZCJA 4CXWA 4IE4A 1BR0A 3UU6A 2Y8DA 4JI4T 3AE1A 4F6RC 4QKNA 1S35A 5L3BB 5L3FB 3WAJA 4TWDA 3NVOA 3UU4A 3RYHE 2E9XA 3LBXB 4ZEYA 2LEHA 1HX1B 5L2LA 3CVRA 3RLFF 4GKKT 1IJ6A 2MAWA 3RYIE 3UUXB 1D1CA 2L3LA 3RIFA 4ILAA 5ABFA 2LKHA 2E5VA 2LOSA 5AQPB 5AFUL 1OEDA 4HFHA 3ZEFB 2J62A 3MZKB 3GN5A 4IT4A 4NUVA 3EUHA 1UUSA 4QXHB 4AKLA 3AEAA 2BG9E 2IUBA 3ZMSB 1BR4A 3K1SA 4AI6A 2XAHB 4GK0E 4CI1B 5CFBA 4COFA 5IWAT 1KK7A 3S4UA 3SFEA 5JR9A 1VRBA 1IZNB 3A5XA 3P4RA 2KSRA 5IUXA 4B3ST 4PK4A 1Z0PA 3ZT7A 4IE6A 1HNZT 5HXSA 3MA9A 3HA4A 2EHOC 2CE7A 4OFZA 4DNDA 3W15B 4H63H 3ZJ2A 4LFBT 3K3NA 5LHHB 4YTNA 3HR0A 3P4QA 3N9OA 4PK6A 2WBLA 3HL6A 2DCFA 3SFDA 2UUBT 1IJ5A 1HFAA 3TLSA 3JCFA 3FB2A 5JTGA 4G63A 4OYKA 2W00A 4CN6A 2H7VC 2VQET 3DTOA 5HCJA 3SS1A 2VVNA 5L47A 2A3DA 3QB5K 1WRDA 3EDUA 3LK2B 4M1PA 3N2GE 4Z8XA 1QUUA 3VRAA 3MKDA 3PTRB 3AEGA 3P4SA 2YN6A 3RIAA 5JDLA 4LFAT 5AQMB 2E9XB 1BR2A 3AAAB 4L9IA 3Q5WA 4C90A 3EHZA 1T98A 2NP9A 5LB7B 4DV1T 3AXJA 5FVLA 2NOXA 3KV6A 2WU5A 2LRLA 5FMNA 1LKXA 4HFIA 3O9XA 3TLTA 4EYUA 1OEDB 4H9NC 1IBLT 2BG9A 2VKDA 4X1IE 2M67A 2K9AA 3ZMVB 3GN5B 1HNXT 4JI0T 2E2AA 3AE7A 5JDQA 4HN9A 1KNPA 5AQSB 3C4WA 4ZZCA 3PUXF 3SOLA 3AECA 5IYZE 4IGUA 2QA7A 3ZSSA 3HI2A 5FKYA 5JR9B 5L4EA 4EEBA 3ZMUB 3M65A 5C3JA 3HKDE 4IHJE 3PUZF 1YKEB 2I59A 2Q9QB 2B1EA 4DBRA 3OJAA 3CQCB 2BZBA 2DHRA 2YDSA 1W09A 1W0AA 2Y48B 3ANWA 2X0YA 5FXVA 3H3AA 3N9MA 4CXXA 2XY8B 4PW8A 2YKSA 4ZI7E 5F8PA 2J1DG 5H6QB 4XAXB 4P0AA 3CX6B 4JI3T 1KFYA 2V7JA 3ZT5A 2WZHA 3NZPA 2VL8A 4LF4T 2XAGB 4ZZBA 4EGWA 5LYJE 4KI0F 1HG2A 2BKPA 2M6IA 3F31A 4CN1A 4UV8B 2DL1A 4H9PC 3ZT6A 2SPCA 4HKAA 3RKGA 4ZS3A 4LF6T 3AE2A 3ONXA 2OA5A 2XASB 3UT5E 4PJNA 2HPLA 3CX7B 3JC6D 4MHCA 2Y6XA 2I6HA 5DQWA 5KXJA 3L39A 3AXJB 4AKGA 4JI2T 3AE3A 3PUYF 2PFVA 3H37A 3GA8A 4O2AE 3TKLB 1OXZA 2LLYA 3G06A 4KMCA 3JADA 2KZ7B 3FBZA 5L3EB 5DQVA 4U2ZA 2BG9B 3LJCA 3RIUA 5LCYA 1US7B 3PUAA 2MTQA 3B13A 2IIUA 3BQKA 3EVYA 4H9SE 2BS3A 3AEBA 4UVAB 2CEAA 3WAKA 3N5LA 4U74A 4KHPT 2DWGA 3Q9DA 4ANJA 2FUPA 4AQYT 4KX6A 4IE0A 1MIYA 3RH3A 3LBXA 1KF6A 5ABHA 1UCUA 4JI5T 2E9XC 3RC8A 3KV9A 3FZLB 2ZLYA 2XM2A 4WYVA 1WFDA 1YW0A 2UUAT 5J2UE 1H7CA 2XZEA 2YDQA 3AE8A 1MMGA 2AE9A 1YKHB 5CA0E 2XAQB 2XUEA 3ZKRA 4QH1A 2CMRA 2UXCT 4Q25A 1ZHCA 1OEDC 1VCSA 2ZM0A 2IW5B 3K3OA 4UF0A 3AVRA 5J1GA 1WR0A 4TNWA 4P09A 4IE7A 2WZIA 3N9PA 1Z8UA 2V8SV 5HAXA 2CWOA 4NXMT 2NW8A 3LFMA 2QVAA 3N2OA 1VOMA 5F5WA 3ONJA 3AEEA 4OX9T 2RP4A 1FEWA 1X9BA 1N36T 1IBKT 2VL0A 3VR9A 3I9WA 5JR9C 4CI3B 4ISTA 2UXXB 3E08A 2KXPB 3TLUA 2VQFT 4BAYB 3O1JA 4HE8A 3MACA 2KMFA 3ETUA 3O1HA 4UELA 4Z91A 2NR4A 1EZ3A 2JQKA 2CPTA 3KVAA 4YT0A 3LK42 2H7OA 3QB5A 5JVDE 3R84B 3KFWX 1FIOA 5AQHB 1UGOA 4U72A 1NEKA 5JH7E 3VR8A 4PFOA 3PUQA 4OK0A 3OYZA 3B57A 1IAPA 5HXRA 3GMIA 3NZQA 2WP9A 4O4JE 5L3GB 2G0UA 2A2FX 4YHHT 3RRWA 3U3IA 4X64T 2UXBT 2VK9A 5FL1A 5HYAA 3PE0A 4YY3T 1I6ZA 4MLKA 4LF9T 3PDYA 5HEOA 4BA9A 2IMLA 3QNUA 2XAJB 3C98B 4LMJA 4NIQA 2J4GA 4UV9B 2IC9A 4DV6T 2ODUA 1MNDA 2PBIA 4YLHA 4ISSA 1LVKA 2BS2A 5AQFB 2P9BA 3P4PA 4H9QC 3ZSTA 2OLTA 5AQQB 4NPPA 4L0RA 2MBGA 2D2SA 4DMVA 2BG9C 2NTYA 4UF0B 3FZFB 5DABA 4ZOLE 4O4HE 5HXHA 2CHOA 1FJGT 5FXXA 4IDPA 3AE5A 3ZC0A 1SUMB 3M3ZB 2I0MA 1T72A 3UU8A 4DR5T 2WDVA 3BQLA 4HWIB 4JV5T 2V7MA 1XZYA 1GQEA 2BVLA 3VRBA 4DR1T 2CA5A 2Q9QA 3ZMZB 1KEYA 1W9RA 2WMOA 3QUJA 4BJMA 3LSVA 4AQGA 1YXRA 4HFEA 2IDOB 2LSYA 4HFDA 2IHR1 5HEGA 3NWIA 4X5TA 5AQUB 2CBJA 2CM0A 1N33T 3PUWF 3KV4A 1MMNA 3AVSA 1U5PA 2V5CA 2DI4A 2ZM2A 1DU2A 4QHOA 5F3JA 1D1BA 4PFPA 5AQTB 2NW7A 3FXDB 1UURA 3PU8A 3ZCIA 5BR8T 3CK6A 2LSJA 4PNIA 2CXLA 1NENA 2VVSA 2LT3A 2K48A 2XQ3A 3DP7A 4K0UA 3RQWA 3VKGA 1J1JA 4CN4A 2C5IT 5LBQB 3UUNA 2BBHA 2HN2A 3PV0F 4KHZF 5HXEA 2YDRA 2ES0A 3Q5DA 3R6NA 5FY7A 2AXDS 2M6BA 3OPCA 2QGSA 5LBMA 2V5DA 1I94T 3VU7H 2UXDT 3RF1A 2VASA 4Z90A 1O3XA 3X1DA 4I50E 4GK5E 3RIUC 4EZ4A 5AQNB 4YJ2E 3UFEA 2KNDA 4OYJA 4ZXLA 4IREA 4PJMA 3Q5EA 4DO0A 5JREA 4AKRB 2YU1A 4PJLA 1MIWA 2OV9A 3BQIA 1D0YA 5BMVE 5LP6E 2LHNA 4YTPA 3E0ZA 3P8CD 2LSKA 3RPUA 4DV2T 4ZI3D 3JAEA 4IDZA 3PUSA 4AQFA 4WBNE 5LG4A 5LMUT 5FP3A 2F4VT 2ODVA 4JI6T 4LFCT 3UQ4A 1ZKEA 4IDQA 3AA0B 1HR0T 1D1AA 4DV4T 3PUVF 4EV6A 4JI1T 2BBJA 1X79A 1B7TA 1AJ3A 3UULA 2CLYB 4O4LE 4YSXA 3J7Yq 5C2TA 1XWMA 3LK3B 3EI0A 4LMLA 4B6XA 3HKEE 2A9UA 4WW0A 4EEDA 1MMDA 2E8IA 4B3MT 2YOEA 5H6RB 4X20E 3L09A 3UU3A 5JDGA 3CIRA 4CZZB 3A8YC 3AA7B 3IF8B 2W63A 1CUNA 4YFSA 2XHEB 4I43B 1BR1A 2A72A 5KX5E 3ESLA 4UXNB 4HWDA 3ZN1B 3V5SA 4U2YA 2LOPA 5EK3A 2JQHA 2DLRA 3AAIA 1D0ZA 4JI8T 2D5UA 3AA6B 2FBWA 2LSIA 3SWHA 3FZKB 2JQ9A 3NRXA 2WAUA 1ZOYA 3CX8B 3TLWA 4FJOA 4ILUA 3UTKA 4JEUB 2XM1A 1UX4A 5KMGP 5CB4E 3JC6C 4DR3T 4GYSA 4HFCA 4U7YA 3H3MA 4HTEA 4H9OC 2X9HA 5EK4A 3I0OA 4WNKA 1MMAA 5LOVE 2CXFA 2X68A 4K0KT 5LJNA 2PTFA 3Q5XA 3E22E 2NWBA 5ETWA 2YEVC 1HS7A 3NBXX 3ZPOA 1SA0E 4HFBA 2E5LT 4UIGA 2KINB 3OYXA 4HWCA 4YJ3E 4YSZA 4DBQA 2V6YA 4TUYE 5HEJA 5FVKA 1MNEA 4EAHA 3RC3A 3A7MA 4TWHA 4QXBB 4ASKA 1W0BA 4WZXA 2V7IA 3OBVE 5AQGB 4MALA 1ZEEA 2VWAA 1YQ4A 3EDVA 4OHFA 4IL4A 1SHZC 1WCRA 3VKHA 5LGTB 4EXTA 3FXEB 4I4TE 2JQQA 1T7SA 1MIVA 3KBTA 4E7SA 5J0ZA 4A98A 4DV7T 2YINA 3I9YA 4A97A 5JDHA 4H63V 3I1AA 2Q9QC 4E7ZA 3UQ7A 2X51A 4JLEA 4JYAT 2J47A 3RYFE 3AE4A 4O2BE 3ONLC 1FMVA 4ZI2D 4UVBB 2BVMA 2N1GA 5FY0A 2FJBA 4HWFA 2ZMAA 4AKHA 5JDMA 1M62A 1N32T 4B3TT 1XDOA 1E2AA 4DIDB 4IDNA 2PG8A 2FJDA 2XQ8A 3I0QA 1WLXA 2K24A 1HCIA 2X9XA 3RYCE 1XNQT 2CLYC 2LM9A 4X62T 2XQ7A 2LHRA 5ADXL 1Y64B 5E0OA 1WYCA 2QRXA 4YSYA 1HNWT 4DR6T 3IBPA 5HCMA 4CXYA 2XQAA 2X0LB 4AISA 4MFRA 4EZHA 5M4YA 4FI5A 4QH5A 1ZV4X 4ADZA 3RHWA 4NUUA 3TLVA 3C4ZA 4F8HA 5CGMA 4DVDA 3T1YT 4KUMB 2D9DA 3IEEA 5LA6E 2V6YB 1WR6A 2LE8A 2NW9A 5LJMA 1VCTA 3AA1B 4IIJE 3MJXA 4U33A 5AQJB 3N2KE 2X67A 3DJBA 4NXNT 1HF8A 3KBUA 3AB3B 2W0GA 1KNZA 4J2CA 1QSDA 4N78D 5AQVB 3T8OA 3K3QC 4X1KE 2IC6A 3NKZA 3VHLA 2H89A 1V9DA 1J5WA 3ZMTB 3ZYLA 4AQFC 3FBLA 3HKBE 2EHOD 1FMWA 4YTMA 4TNVA 4O8SA 5L4HA 2WSSV 1Y01A 1NAFA 3P50A 3ABVA 1SE7A 3EABA 4IL9A 2KWIB 2XQ4A 3RGLA 2V26A 2B76A 1S94A 3KDSE 3UUMA 1YQ3A 5LXTE 5TAOA 2X66A 5HWYA 2W67A 3MXZA 5FY1A 2K3WA 5CA1E 4G2AA 4A5XA 4U3CA 2WWVA 2NTXA 2UXNB 3P4WA 3UU5A 3O1IA 3RRCA 3BK9A 4DV5T 3HKCE 2ZM6T 2VURA 1HTJF 5L3DB 2XSAA 1R8IA 4EIWA 1HX8A 1IBMT 4EOZB 4DV3T 1D0XA 1G8XA 3ZYMA 5HEHA 2VKOA 3IA3A 3EAMA 2BDEA 4A56A 5AQLB 4GOUA 2CXDA 5LHIB 2W62A 4JEHB 3C4XA 3QC9A 2H3RA 5HXCA 4LF5T 2ZM8A 5LMNT 4I0UA 2XQ9A 2XQYA 1XNRT 2BKNA 1YD8G 3T1HT 5JDFA 4XZCA 2X0HA 5FXWA 4U31A 1N34T 2LRKA 2WY2A 5ABFB 3RKOA 1KNRA 1XMQT 3JAFA 4QX7B 2VB6A 1XMOT 4UR9A 2LKGA 2XSBA 4LF7T 4DMWA 2V7LA 5KDMC 3QOFA 2W2UA 4H9RC 2XJ7A 4CQIA 5FYMA 3C51A 2ACXA 3AAEB 4GIWA 2W4XA 5L3CB 4DR7T 3U78A 4P0BA 4MBQA 1LRZA 3CPZA 3PUGA 5A1LA 3D0TA 1OWAA 3RQUA 4EB6E 1UK5A 2X9YA 4EYYR
chains in the Genus database with same CATH topology
3NBXX 4ZI3C 3ZPOA 2K5BB 1SA0E 2VK9A 3N9OA 4PK6A 2WBLA 3HL6A 2DCFA 5HYAA 2EHOA 1IJ5A 1HFAA 3PE0A 4UIGA 2KINB 5JDNA 3OYXA 4MLKA 5LGNB 3FB2A 4G63A 4PAGA 4OYKA 2W00A 4YJ3E 2H7VC 4DBQA 3PDYA 3DTOA 4BA9A 2XAJB 3C98B 3LG7A 3OKQA 3WI3A 3SS1A 2KWHA 5C8YE 3SRZA 4TN7B 4TUYE 1MNEA 2A3DA 5HWXA 1WRDA 4UV9B 2IC9A 3EDUA 4EAHA 3LK2B 3RC3A 4M1PA 2ODUA 1LVFA 4PJJA 4QXCB 1MNDA 2PBIA 3ETVA 3N2GE 4QXBB 4YLHA 4ASKA 3N9LA 4Z8XA 5J2TE 2C5JA 4ISSA 2JPFA 1LVKA 2V7IA 3OBVE 5EZYE 1QUUA 3J9X1 3MKDA 3PTRB 3IHRA 5DJQC 3NRYA 4MALA 1ZEEA 1UX5A 2P9BA 4H9QC 2VWAA 3N9QA 5JDLA 2E9XB 1BR2A 2V7KA 3AAAB 3EDVA 4L9IA 4OHFA 3Q5WA 1SHZC 2CCQA 4L0RA 4C90A 2MBGA 3VKHA 2D2SA 5FXZA 1T98A 2NP9A 5LGTB 4EXTA 3FXEB 4HGAA 4DMVA 2W61A 4I4TE 2JQQA 2NTYA 2YK0A 4UF0B 2DWKA 5IHYA 3KVBA 2JMKA 2NOXA 4QWNB 5DABA 4ZOLE 1MIVA 3KBTA 4E7SA 3KV6A 1NWMX 3P7IA 2JJ9A 2X9WA 4YHJA 5JRCA 2JRKA 4WBOA 4O4HE 5EK2A 5HXHA 2YINA 3I9YA 4IE5A 5FMNA 1LKXA 4KP3C 3FHNA 5FXXA 5JDHA 3O9XA 4AXPA 4H63V 4EYUA 3I1AA 4H9NC 3CQGB 2Q9QC 1E1HB 2VKDA 3ZC0A 4X1IE 2M67A 4E7ZA 2K9AA 2X51A 4JLEA 3ZLIA 3ZMVB 3GN5B 2N9DA 3RYFE 2LSGA 3BQLA 4L5GA 2WM9A 3K8PC 2HPJA 4O2BE 4ZI2D 1FMVA 4UVBB 2BVMA 2N1GA 5FY0A 2V7MA 5JQGE 2ZMAA 5JDQA 2BVLA 3CKDA 5JDMA 4AKHA 1WYBA 4HN9A 3F2EA 2CA5A 3C4WA 2Q9QA 3ZMZB 2PG8A 2WWUA 3I0QA 1WLXA 2WMOA 3SOLA 3V5UA 4X1YE 2K24A 1HCIA 2X9XA 3RYCE 5IYZE 3QUJA 4IGUA 2QA7A 4BJMA 2CLYC 2LM9A 3HI2A 4AQGA 5JR9B 3ZMUB 3M65A 4HEAA 3CWZB 3ZJ1A 3HKDE 2LHRA 2XTLA 2IAKA 2E9XD 4IHJE 5ADXL 2LSYA 2C0SA 4O4IE 1YKEB 4ERRA 2I59A 1Y64B 5E0OA 2D0TA 4BJNA 2Q9QB 1WYCA 3N9NA 3F57A 2YU2A 4I55E 3MK7C 2LJLA 5LGUB 1HS7A 2CM0A 4TX5A 2B1EA 3IBPA 4DBRA 3KV4A 4HFVA 1MMNA 3AVSA 3OJAA 3CQCB 2BZBA 4CXYA 2VKJA 3Q2MA 4QX8B 1U5PA 2X0LB 2DHRA 3PURA 1U4QA 2Y48B 3ANWA 4MFRA 2DI4A 4KBMB 4EZHA 2ZM2A 2PJQA 4QHOA 5FXVA 5F3JA 3H3AA 3N9MA 1D1BA 4CXXA 5M4YA 4PFPA 4FI5A 4PW8A 1ZV4X 2NW7A 3O4XE 4ZI7E 5F8PA 4ADZA 3FXDB 4NUUA 2J1DG 2EHOB 4UEMA 3PU8A 3ZCIA 5H6QB 3C4ZA 3QK6A 4XAXB 2LSJA 3PU3A 2RA1A 4PNIA 2CXLA 4DVDA 3GWHA 4P0AA 3CX6B 2LT3A 4KUMB 2K48A 3ANWB 4JUYA 4C91A 3CQXC 3IEEA 2L9QA 3DP7A 5LA6E 2V7JA 1WR6A 3NZPA 2VL8A 4K0UA 2LE8A 2XAGB 2NW9A 1HG5A 4ZS2A 5LJMA 5LYJE 4XBFB 3VKGA 3AA1B 1HG2A 4IIJE 4ZHQE 3CMLA 3MJXA 5FNVE 3F31A 2C5IT 5LBQB 3N2KE 2GK9A 2L8KA 4UV8B 3UUNA 2X67A 4H9PC 5HXEA 2C5KT 2ES0A 3RX6A 3R6NA 3DJBA 4UVCB 5FY7A 1HF8A 4CI2B 2SPCA 3KBUA 4HKAA 2KT9A 2Q9QD 2MOZA 4ZS3A 4TZ4C 3KV5A 3AB3B 4TV8E 3ONXA 2OA5A 2QGSA 2W0GA 2XASB 5LBMA 3UT5E 1KNZA 3VU7H 4PJNA 2HPLA 3CX7B 4J2CA 3JC6D 4MHCA 2VASA 1QSDA 4N78D 2Y6XA 5DQWA 3T8OA 1O3XA 3K3QC 4X1KE 4AKGA 1G73A 2HH7A 2MYSA 4I50E 2IC6A 4GK5E 3VHLA 2CWYA 3U3IA 4EZ4A 1V9DA 2PFVA 3KINB 3H37A 2VKHA 3GA8A 4YJ2E 3UFEA 2KNDA 4OYJA 3ZMTB 4O2AE 2Z6EA 3TKLB 3ZYLA 1OXZA 5JRCB 4PJMA 3C64A 4AQFC 4KMCA 3FBLA 4DO0A 2KZ7B 5JREA 3HKBE 4AKRB 2EHOD 2YU1A 3FBZA 5L3EB 1FMWA 5DQVA 4PJLA 5GONE 1MIWA 2V1DB 4O8SA 4AKIA 3BQIA 3LJCA 1D0YA 5BMVE 2WSSV 5LNKA 5LCYA 5LP6E 1US7B 2LHNA 1NAFA 2XAFB 3E0ZA 3P8CD 4V1Av 3ZN0B 2LSKA 3RPUA 3PUAA 4ZI3D 4IDZA 3PUSA 2KWIB 4GYRA 4AQFA 2MTQA 3B13A 4EYYR 4ZI2C 4WBNE 3ZC1A 5LG4A 3BQKA 2WMNA 3EVYA 2V26A 4H9SE 1S94A 3KDSE 5FP3A 3UUMA 4UVAB 2CEAA 5LXTE 2ODVA 2KLQA 3L3PA 5TAOA 3WAKA 2X66A 3C50A 5HWYA 3MXZA 3N5LA 4U74A 5LHGB 1ZKEA 2JMHA 3ZYKA 2DWGA 3AA0B 3Q9DA 5FY1A 1D1AA 2N2NA 2DNXA 2D0UA 4PK5A 4ANJA 4TV9E 4IE0A 3ZCJA 5CA1E 4G2AA 1MIYA 4CXWA 3RH3A 3LBXA 4IE4A 1BR0A 1UCUA 2Y8DA 2E9XC 3RC8A 1X79A 3KV9A 2NTXA 2UXNB 2ZLYA 1B7TA 4F6RC 3O1IA 1YW0A 4QKNA 1S35A 3BK9A 3RRCA 3UULA 5L3BB 5J2UE 5L3FB 1AJ3A 1H7CA 2CLYB 3HKCE 4O4LE 1HTJF 5L3DB 3WAJA 1MMGA 4EIWA 1YKHB 1HX8A 3J7Yq 5CA0E 4EOZB 3LK3B 2XAQB 3RYHE 2XUEA 2E9XA 2CMRA 3LBXB 1D0XA 4B6XA 2LEHA 1G8XA 3HKEE 1ZHCA 5L2LA 3CVRA 4WW0A 3ZYMA 2ZM0A 2VKOA 1IJ6A 1MMDA 2E8IA 2IW5B 2BDEA 3K3OA 4A56A 4UF0A 3AVRA 5J1GA 5H6RB 4X20E 4P09A 3L09A 4GOUA 4IE7A 2CXDA 3RYIE 3UUXB 1D1CA 2L3LA 3N9PA 5JDGA 2W62A 5LHIB 4CZZB 4JEHB 5HAXA 2CWOA 3AA7B 3IF8B 2W63A 3C4XA 2LOSA 3QC9A 1CUNA 2H3RA 5HXCA 2ZM8A 2NW8A 3LFMA 4YFSA 5AFUL 3N2OA 2XHEB 4I43B 2XQYA 1VOMA 1BR1A 2A72A 1YD8G 3MZKB 3ZEFB 5JDFA 5KX5E 3GN5A 3ESLA 4UXNB 4XZCA 2RP4A 1FEWA 3ZN1B 5FXWA 3V5SA 2LOPA 5EK3A 3AAIA 2DLRA 4NUVA 3EUHA 1D0ZA 3I9WA 4QXHB 5JR9C 4CI3B 4ISTA 2UXXB 3E08A 2KXPB 4AKLA 2D5UA 3AA6B 3RKOA 2LSIA 3SWHA 3NRXA 3O1JA 4BAYB 2WAUA 4QX7B 2VB6A 3ZMSB 1BR4A 3CX8B 4HE8A 3MACA 4AI6A 2KMFA 3ETUA 3O1HA 4FJOA 4UELA 4ILUA 2XAHB 4GK0E 4JEUB 3UTKA 4CI1B 1EZ3A 1UX4A 3KVAA 1KK7A 5KMGP 3S4UA 5CB4E 3JC6C 1VRBA 1IZNB 3A5XA 5JR9A 4DMWA 3LK42 4GYSA 2V7LA 5KDMC 2H7OA 4HTEA 4H9OC 2X9HA 5EK4A 5JVDE 3R84B 3KFWX 4H9RC 3I0OA 1FIOA 4WNKA 4PK4A 4U72A 1MMAA 5JH7E 5LOVE 4PFOA 4CQIA 5FYMA 3PUQA 3C51A 2ACXA 2CXFA 2X68A 1Z0PA 3AAEB 4IE6A 4GIWA 4OK0A 3OYZA 5L3CB 3B57A 5HXSA 3MA9A 3U78A 3HA4A 2EHOC 2CE7A 5LJNA 1IAPA 4P0BA 4OFZA 4MBQA 5HXRA 1LRZA 3CPZA 4DNDA 3GMIA 3Q5XA 3PUGA 3W15B 5A1LA 3NZQA 4O4JE 4H63H 3D0TA 1OWAA 2NWBA 3E22E 2G0UA 3ZJ2A 4EB6E 5L3GB 2A2FX 3K3NA 5ETWA 5LHHB 3RRWA 2X9YA 2YEVC 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CA5 A;  4CQI A;  4B6X A;  4FI5 A;  1Z0P A;  4L0R A;  2IC9 A;  3FXD B;  3CVR A;  3L3P A;  1IJ5 A;  4J2C A;  2MBG A;  1LVF A;  1IJ6 A;  1QSD A;  2X9X A;  3FXE B;  3MXZ A;  3N5L A;  1ZKE A;  3QUJ A;  2C5J A;  2C5I T;  3QK6 A;  1H7C A;  2IC6 A;  3S4U A;  1LRZ A;  4DND A;  2C5K T;  3P7I A;  2G0U A;  2X9W A;  2K48 A;  3TKL B;  2KWH A;  2XTL A;  2KWI B;  3CKD A;  2X9Y A;  4EYY R; 
#chains in the Genus database with same CATH topology
 4LF8 T;  4ZI3 C;  2K5B B;  2EHO A;  5AQI B;  5JDN A;  5LGN B;  2HHH T;  3AE9 A;  4PAG A;  5ABE A;  4X66 T;  3LG7 A;  3OKQ A;  3WI3 A;  2KWH A;  5C8Y E;  3SRZ A;  4TN7 B;  5HWX A;  5CJ5 A;  4X65 T;  1LVF A;  4PJJ A;  4QXC B;  3ETV A;  5J2T E;  3N9L A;  2C5J A;  2JPF A;  5EZY E;  1JNR A;  5AQR B;  3J9X 1;  2JIW A;  3IHR A;  5DJQ C;  3NRY A;  4DR2 T;  1UX5 A;  4LMK A;  3N9Q A;  4IDO A;  2V7K A;  2CCQ A;  5FXZ A;  4HGA A;  2WS3 A;  2W61 A;  5ABG A;  2YK0 A;  5LG3 A;  2DWK A;  5IHY A;  3KVB A;  2JMK A;  2WDQ A;  4QWN B;  1NWM X;  3P7I A;  2JJ9 A;  2X9W A;  4YHJ A;  5JRC A;  2JRK A;  4WBO A;  5EK2 A;  4JBW F;  4IE5 A;  4KP3 C;  1JNZ A;  2R6G F;  3FHN A;  4AXP A;  4GKJ T;  2BKO A;  3CQG B;  1E1H B;  4ILB A;  5HEU A;  4TWF A;  3ZLI A;  2CHN A;  2N9D A;  2LSG A;  2XPK A;  4L5G A;  2WM9 A;  3K8P C;  2HPJ A;  5JQG E;  3CKD A;  1WYB A;  3F2E A;  4DV0 T;  3L8R A;  2WWU A;  3V5U A;  4X1Y E;  2V6X A;  4U7I A;  4HEA A;  3CWZ B;  3ZJ1 A;  2XTL A;  2IAK A;  2E9X D;  4O4I E;  2C0S A;  4ERR A;  2D0T A;  4BJN A;  2BS4 A;  3N9N A;  3F57 A;  2YU2 A;  4I55 E;  3MK7 C;  2LJL A;  5LGU B;  4TX5 A;  5AQK B;  3UFG A;  4DUZ T;  4HFV A;  2VKJ A;  3Q2M A;  2WB5 A;  4B3R T;  4HWH A;  4QX8 B;  3PUR A;  1U4Q A;  3OTO T;  4KBM B;  1CHU A;  2H88 A;  2QYW A;  2PJQ A;  2CRB A;  3UUB A;  3O4X E;  3RI5 A;  2WU2 A;  4P1N A;  1QLB A;  2WDR A;  2HN1 A;  2EHO B;  4UEM A;  2RPA A;  3QK6 A;  3PU3 A;  2RA1 A;  2UUC T;  3GWH A;  4AIU A;  3ANW B;  4JUY A;  4C91 A;  3CQX C;  2L9Q A;  2UU9 T;  2CBI A;  1HG5 A;  4ZS2 A;  4XBF B;  2WCA A;  4ZHQ E;  3AED A;  3CML A;  5FNV E;  2GK9 A;  2L8K A;  2C5K T;  1OED E;  1ZP0 A;  3RX6 A;  4UVC B;  3FZM B;  4CI2 B;  2KT9 A;  2Q9Q D;  2MOZ A;  2XQ5 A;  4TZ4 C;  3KV5 A;  3FZH B;  4TV8 E;  4JI7 T;  2W66 A;  4DUY T;  4ILC A;  1T8B A;  3PJA J;  1G73 A;  2HH7 A;  2MYS A;  3LDQ B;  2CWY A;  1J5E T;  3KIN B;  2VKH A;  2Z6E A;  5JRC B;  2MPK A;  4DR4 T;  3C64 A;  3AEF A;  2LM2 A;  3PJA A;  5GON E;  2V1D B;  1E7P A;  4AKI A;  2WQY A;  3OVU A;  2FJA A;  5LNK A;  2XAF B;  4V1A v;  3ZN0 B;  1XDP A;  4GYR A;  4ZI2 C;  3ZC1 A;  2FJE A;  2WMN A;  2XQ6 A;  2ACZ A;  3L3P A;  2KLQ A;  3C50 A;  4QH4 A;  5LHG B;  2JMH A;  3ZYK A;  5AQO B;  5FL0 A;  1M7K A;  2N2N A;  3AE6 A;  2DNX A;  2D0U A;  4PK5 A;  4YXD A;  3B5M A;  1L0V A;  4TV9 E;  3ZCJ A;  4CXW A;  4IE4 A;  1BR0 A;  3UU6 A;  2Y8D A;  4JI4 T;  3AE1 A;  4F6R C;  4QKN A;  1S35 A;  5L3B B;  5L3F B;  3WAJ A;  4TWD A;  3NVO A;  3UU4 A;  3RYH E;  2E9X A;  3LBX B;  4ZEY A;  2LEH A;  1HX1 B;  5L2L A;  3CVR A;  3RLF F;  4GKK T;  1IJ6 A;  2MAW A;  3RYI E;  3UUX B;  1D1C A;  2L3L A;  3RIF A;  4ILA A;  5ABF A;  2LKH A;  2E5V A;  2LOS A;  5AQP B;  5AFU L;  1OED A;  4HFH A;  3ZEF B;  2J62 A;  3MZK B;  3GN5 A;  4IT4 A;  4NUV A;  3EUH A;  1UUS A;  4QXH B;  4AKL A;  3AEA A;  2BG9 E;  2IUB A;  3ZMS B;  1BR4 A;  3K1S A;  4AI6 A;  2XAH B;  4GK0 E;  4CI1 B;  5CFB A;  4COF A;  5IWA T;  1KK7 A;  3S4U A;  3SFE A;  5JR9 A;  1VRB A;  1IZN B;  3A5X A;  3P4R A;  2KSR A;  5IUX A;  4B3S T;  4PK4 A;  1Z0P A;  3ZT7 A;  4IE6 A;  1HNZ T;  5HXS A;  3MA9 A;  3HA4 A;  2EHO C;  2CE7 A;  4OFZ A;  4DND A;  3W15 B;  4H63 H;  3ZJ2 A;  4LFB T;  3K3N A;  5LHH B;  4YTN A;  3HR0 A;  3P4Q A;  3N9O A;  4PK6 A;  2WBL A;  3HL6 A;  2DCF A;  3SFD A;  2UUB T;  1IJ5 A;  1HFA A;  3TLS A;  3JCF A;  3FB2 A;  5JTG A;  4G63 A;  4OYK A;  2W00 A;  4CN6 A;  2H7V C;  2VQE T;  3DTO A;  5HCJ A;  3SS1 A;  2VVN A;  5L47 A;  2A3D A;  3QB5 K;  1WRD A;  3EDU A;  3LK2 B;  4M1P A;  3N2G E;  4Z8X A;  1QUU A;  3VRA A;  3MKD A;  3PTR B;  3AEG A;  3P4S A;  2YN6 A;  3RIA A;  5JDL A;  4LFA T;  5AQM B;  2E9X B;  1BR2 A;  3AAA B;  4L9I A;  3Q5W A;  4C90 A;  3EHZ A;  1T98 A;  2NP9 A;  5LB7 B;  4DV1 T;  3AXJ A;  5FVL A;  2NOX A;  3KV6 A;  2WU5 A;  2LRL A;  5FMN A;  1LKX A;  4HFI A;  3O9X A;  3TLT A;  4EYU A;  1OED B;  4H9N C;  1IBL T;  2BG9 A;  2VKD A;  4X1I E;  2M67 A;  2K9A A;  3ZMV B;  3GN5 B;  1HNX T;  4JI0 T;  2E2A A;  3AE7 A;  5JDQ A;  4HN9 A;  1KNP A;  5AQS B;  3C4W A;  4ZZC A;  3PUX F;  3SOL A;  3AEC A;  5IYZ E;  4IGU A;  2QA7 A;  3ZSS A;  3HI2 A;  5FKY A;  5JR9 B;  5L4E A;  4EEB A;  3ZMU B;  3M65 A;  5C3J A;  3HKD E;  4IHJ E;  3PUZ F;  1YKE B;  2I59 A;  2Q9Q B;  2B1E A;  4DBR A;  3OJA A;  3CQC B;  2BZB A;  2DHR A;  2YDS A;  1W09 A;  1W0A A;  2Y48 B;  3ANW A;  2X0Y A;  5FXV A;  3H3A A;  3N9M A;  4CXX A;  2XY8 B;  4PW8 A;  2YKS A;  4ZI7 E;  5F8P A;  2J1D G;  5H6Q B;  4XAX B;  4P0A A;  3CX6 B;  4JI3 T;  1KFY A;  2V7J A;  3ZT5 A;  2WZH A;  3NZP A;  2VL8 A;  4LF4 T;  2XAG B;  4ZZB A;  4EGW A;  5LYJ E;  4KI0 F;  1HG2 A;  2BKP A;  2M6I A;  3F31 A;  4CN1 A;  4UV8 B;  2DL1 A;  4H9P C;  3ZT6 A;  2SPC A;  4HKA A;  3RKG A;  4ZS3 A;  4LF6 T;  3AE2 A;  3ONX A;  2OA5 A;  2XAS B;  3UT5 E;  4PJN A;  2HPL A;  3CX7 B;  3JC6 D;  4MHC A;  2Y6X A;  2I6H A;  5DQW A;  5KXJ A;  3L39 A;  3AXJ B;  4AKG A;  4JI2 T;  3AE3 A;  3PUY F;  2PFV A;  3H37 A;  3GA8 A;  4O2A E;  3TKL B;  1OXZ A;  2LLY A;  3G06 A;  4KMC A;  3JAD A;  2KZ7 B;  3FBZ A;  5L3E B;  5DQV A;  4U2Z A;  2BG9 B;  3LJC A;  3RIU A;  5LCY A;  1US7 B;  3PUA A;  2MTQ A;  3B13 A;  2IIU A;  3BQK A;  3EVY A;  4H9S E;  2BS3 A;  3AEB A;  4UVA B;  2CEA A;  3WAK A;  3N5L A;  4U74 A;  4KHP T;  2DWG A;  3Q9D A;  4ANJ A;  2FUP A;  4AQY T;  4KX6 A;  4IE0 A;  1MIY A;  3RH3 A;  3LBX A;  1KF6 A;  5ABH A;  1UCU A;  4JI5 T;  2E9X C;  3RC8 A;  3KV9 A;  3FZL B;  2ZLY A;  2XM2 A;  4WYV A;  1WFD A;  1YW0 A;  2UUA T;  5J2U E;  1H7C A;  2XZE A;  2YDQ A;  3AE8 A;  1MMG A;  2AE9 A;  1YKH B;  5CA0 E;  2XAQ B;  2XUE A;  3ZKR A;  4QH1 A;  2CMR A;  2UXC T;  4Q25 A;  1ZHC A;  1OED C;  1VCS A;  2ZM0 A;  2IW5 B;  3K3O A;  4UF0 A;  3AVR A;  5J1G A;  1WR0 A;  4TNW A;  4P09 A;  4IE7 A;  2WZI A;  3N9P A;  1Z8U A;  2V8S V;  5HAX A;  2CWO A;  4NXM T;  2NW8 A;  3LFM A;  2QVA A;  3N2O A;  1VOM A;  5F5W A;  3ONJ A;  3AEE A;  4OX9 T;  2RP4 A;  1FEW A;  1X9B A;  1N36 T;  1IBK T;  2VL0 A;  3VR9 A;  3I9W A;  5JR9 C;  4CI3 B;  4IST A;  2UXX B;  3E08 A;  2KXP B;  3TLU A;  2VQF T;  4BAY B;  3O1J A;  4HE8 A;  3MAC A;  2KMF A;  3ETU A;  3O1H A;  4UEL A;  4Z91 A;  2NR4 A;  1EZ3 A;  2JQK A;  2CPT A;  3KVA A;  4YT0 A;  3LK4 2;  2H7O A;  3QB5 A;  5JVD E;  3R84 B;  3KFW X;  1FIO A;  5AQH B;  1UGO A;  4U72 A;  1NEK A;  5JH7 E;  3VR8 A;  4PFO A;  3PUQ A;  4OK0 A;  3OYZ A;  3B57 A;  1IAP A;  5HXR A;  3GMI A;  3NZQ A;  2WP9 A;  4O4J E;  5L3G B;  2G0U A;  2A2F X;  4YHH T;  3RRW A;  3U3I A;  4X64 T;  2UXB T;  2VK9 A;  5FL1 A;  5HYA A;  3PE0 A;  4YY3 T;  1I6Z A;  4MLK A;  4LF9 T;  3PDY A;  5HEO A;  4BA9 A;  2IML A;  3QNU A;  2XAJ B;  3C98 B;  4LMJ A;  4NIQ A;  2J4G A;  4UV9 B;  2IC9 A;  4DV6 T;  2ODU A;  1MND A;  2PBI A;  4YLH A;  4ISS A;  1LVK A;  2BS2 A;  5AQF B;  2P9B A;  3P4P A;  4H9Q C;  3ZST A;  2OLT A;  5AQQ B;  4NPP A;  4L0R A;  2MBG A;  2D2S A;  4DMV A;  2BG9 C;  2NTY A;  4UF0 B;  3FZF B;  5DAB A;  4ZOL E;  4O4H E;  5HXH A;  2CHO A;  1FJG T;  5FXX A;  4IDP A;  3AE5 A;  3ZC0 A;  1SUM B;  3M3Z B;  2I0M A;  1T72 A;  3UU8 A;  4DR5 T;  2WDV A;  3BQL A;  4HWI B;  4JV5 T;  2V7M A;  1XZY A;  1GQE A;  2BVL A;  3VRB A;  4DR1 T;  2CA5 A;  2Q9Q A;  3ZMZ B;  1KEY A;  1W9R A;  2WMO A;  3QUJ A;  4BJM A;  3LSV A;  4AQG A;  1YXR A;  4HFE A;  2IDO B;  2LSY A;  4HFD A;  2IHR 1;  5HEG A;  3NWI A;  4X5T A;  5AQU B;  2CBJ A;  2CM0 A;  1N33 T;  3PUW F;  3KV4 A;  1MMN A;  3AVS A;  1U5P A;  2V5C A;  2DI4 A;  2ZM2 A;  1DU2 A;  4QHO A;  5F3J A;  1D1B A;  4PFP A;  5AQT B;  2NW7 A;  3FXD B;  1UUR A;  3PU8 A;  3ZCI A;  5BR8 T;  3CK6 A;  2LSJ A;  4PNI A;  2CXL A;  1NEN A;  2VVS A;  2LT3 A;  2K48 A;  2XQ3 A;  3DP7 A;  4K0U A;  3RQW A;  3VKG A;  1J1J A;  4CN4 A;  2C5I T;  5LBQ B;  3UUN A;  2BBH A;  2HN2 A;  3PV0 F;  4KHZ F;  5HXE A;  2YDR A;  2ES0 A;  3Q5D A;  3R6N A;  5FY7 A;  2AXD S;  2M6B A;  3OPC A;  2QGS A;  5LBM A;  2V5D A;  1I94 T;  3VU7 H;  2UXD T;  3RF1 A;  2VAS A;  4Z90 A;  1O3X A;  3X1D A;  4I50 E;  4GK5 E;  3RIU C;  4EZ4 A;  5AQN B;  4YJ2 E;  3UFE A;  2KND A;  4OYJ A;  4ZXL A;  4IRE A;  4PJM A;  3Q5E A;  4DO0 A;  5JRE A;  4AKR B;  2YU1 A;  4PJL A;  1MIW A;  2OV9 A;  3BQI A;  1D0Y A;  5BMV E;  5LP6 E;  2LHN A;  4YTP A;  3E0Z A;  3P8C D;  2LSK A;  3RPU A;  4DV2 T;  4ZI3 D;  3JAE A;  4IDZ A;  3PUS A;  4AQF A;  4WBN E;  5LG4 A;  5LMU T;  5FP3 A;  2F4V T;  2ODV A;  4JI6 T;  4LFC T;  3UQ4 A;  1ZKE A;  4IDQ A;  3AA0 B;  1HR0 T;  1D1A A;  4DV4 T;  3PUV F;  4EV6 A;  4JI1 T;  2BBJ A;  1X79 A;  1B7T A;  1AJ3 A;  3UUL A;  2CLY B;  4O4L E;  4YSX A;  3J7Y q;  5C2T A;  1XWM A;  3LK3 B;  3EI0 A;  4LML A;  4B6X A;  3HKE E;  2A9U A;  4WW0 A;  4EED A;  1MMD A;  2E8I A;  4B3M T;  2YOE A;  5H6R B;  4X20 E;  3L09 A;  3UU3 A;  5JDG A;  3CIR A;  4CZZ B;  3A8Y C;  3AA7 B;  3IF8 B;  2W63 A;  1CUN A;  4YFS A;  2XHE B;  4I43 B;  1BR1 A;  2A72 A;  5KX5 E;  3ESL A;  4UXN B;  4HWD A;  3ZN1 B;  3V5S A;  4U2Y A;  2LOP A;  5EK3 A;  2JQH A;  2DLR A;  3AAI A;  1D0Z A;  4JI8 T;  2D5U A;  3AA6 B;  2FBW A;  2LSI A;  3SWH A;  3FZK B;  2JQ9 A;  3NRX A;  2WAU A;  1ZOY A;  3CX8 B;  3TLW A;  4FJO A;  4ILU A;  3UTK A;  4JEU B;  2XM1 A;  1UX4 A;  5KMG P;  5CB4 E;  3JC6 C;  4DR3 T;  4GYS A;  4HFC A;  4U7Y A;  3H3M A;  4HTE A;  4H9O C;  2X9H A;  5EK4 A;  3I0O A;  4WNK A;  1MMA A;  5LOV E;  2CXF A;  2X68 A;  4K0K T;  5LJN A;  2PTF A;  3Q5X A;  3E22 E;  2NWB A;  5ETW A;  2YEV C;  1HS7 A;  3NBX X;  3ZPO A;  1SA0 E;  4HFB A;  2E5L T;  4UIG A;  2KIN B;  3OYX A;  4HWC A;  4YJ3 E;  4YSZ A;  4DBQ A;  2V6Y A;  4TUY E;  5HEJ A;  5FVK A;  1MNE A;  4EAH A;  3RC3 A;  3A7M A;  4TWH A;  4QXB B;  4ASK A;  1W0B A;  4WZX A;  2V7I A;  3OBV E;  5AQG B;  4MAL A;  1ZEE A;  2VWA A;  1YQ4 A;  3EDV A;  4OHF A;  4IL4 A;  1SHZ C;  1WCR A;  3VKH A;  5LGT B;  4EXT A;  3FXE B;  4I4T E;  2JQQ A;  1T7S A;  1MIV A;  3KBT A;  4E7S A;  5J0Z A;  4A98 A;  4DV7 T;  2YIN A;  3I9Y A;  4A97 A;  5JDH A;  4H63 V;  3I1A A;  2Q9Q C;  4E7Z A;  3UQ7 A;  2X51 A;  4JLE A;  4JYA T;  2J47 A;  3RYF E;  3AE4 A;  4O2B E;  3ONL C;  1FMV A;  4ZI2 D;  4UVB B;  2BVM A;  2N1G A;  5FY0 A;  2FJB A;  4HWF A;  2ZMA A;  4AKH A;  5JDM A;  1M62 A;  1N32 T;  4B3T T;  1XDO A;  1E2A A;  4DID B;  4IDN A;  2PG8 A;  2FJD A;  2XQ8 A;  3I0Q A;  1WLX A;  2K24 A;  1HCI A;  2X9X A;  3RYC E;  1XNQ T;  2CLY C;  2LM9 A;  4X62 T;  2XQ7 A;  2LHR A;  5ADX L;  1Y64 B;  5E0O A;  1WYC A;  2QRX A;  4YSY A;  1HNW T;  4DR6 T;  3IBP A;  5HCM A;  4CXY A;  2XQA A;  2X0L B;  4AIS A;  4MFR A;  4EZH A;  5M4Y A;  4FI5 A;  4QH5 A;  1ZV4 X;  4ADZ A;  3RHW A;  4NUU A;  3TLV A;  3C4Z A;  4F8H A;  5CGM A;  4DVD A;  3T1Y T;  4KUM B;  2D9D A;  3IEE A;  5LA6 E;  2V6Y B;  1WR6 A;  2LE8 A;  2NW9 A;  5LJM A;  1VCT A;  3AA1 B;  4IIJ E;  3MJX A;  4U33 A;  5AQJ B;  3N2K E;  2X67 A;  3DJB A;  4NXN T;  1HF8 A;  3KBU A;  3AB3 B;  2W0G A;  1KNZ A;  4J2C A;  1QSD A;  4N78 D;  5AQV B;  3T8O A;  3K3Q C;  4X1K E;  2IC6 A;  3NKZ A;  3VHL A;  2H89 A;  1V9D A;  1J5W A;  3ZMT B;  3ZYL A;  4AQF C;  3FBL A;  3HKB E;  2EHO D;  1FMW A;  4YTM A;  4TNV A;  4O8S A;  5L4H A;  2WSS V;  1Y01 A;  1NAF A;  3P50 A;  3ABV A;  1SE7 A;  3EAB A;  4IL9 A;  2KWI B;  2XQ4 A;  3RGL A;  2V26 A;  2B76 A;  1S94 A;  3KDS E;  3UUM A;  1YQ3 A;  5LXT E;  5TAO A;  2X66 A;  5HWY A;  2W67 A;  3MXZ A;  5FY1 A;  2K3W A;  5CA1 E;  4G2A A;  4A5X A;  4U3C A;  2WWV A;  2NTX A;  2UXN B;  3P4W A;  3UU5 A;  3O1I A;  3RRC A;  3BK9 A;  4DV5 T;  3HKC E;  2ZM6 T;  2VUR A;  1HTJ F;  5L3D B;  2XSA A;  1R8I A;  4EIW A;  1HX8 A;  1IBM T;  4EOZ B;  4DV3 T;  1D0X A;  1G8X A;  3ZYM A;  5HEH A;  2VKO A;  3IA3 A;  3EAM A;  2BDE A;  4A56 A;  5AQL B;  4GOU A;  2CXD A;  5LHI B;  2W62 A;  4JEH B;  3C4X A;  3QC9 A;  2H3R A;  5HXC A;  4LF5 T;  2ZM8 A;  5LMN T;  4I0U A;  2XQ9 A;  2XQY A;  1XNR T;  2BKN A;  1YD8 G;  3T1H T;  5JDF A;  4XZC A;  2X0H A;  5FXW A;  4U31 A;  1N34 T;  2LRK A;  2WY2 A;  5ABF B;  3RKO A;  1KNR A;  1XMQ T;  3JAF A;  4QX7 B;  2VB6 A;  1XMO T;  4UR9 A;  2LKG A;  2XSB A;  4LF7 T;  4DMW A;  2V7L A;  5KDM C;  3QOF A;  2W2U A;  4H9R C;  2XJ7 A;  4CQI A;  5FYM A;  3C51 A;  2ACX A;  3AAE B;  4GIW A;  2W4X A;  5L3C B;  4DR7 T;  3U78 A;  4P0B A;  4MBQ A;  1LRZ A;  3CPZ A;  3PUG A;  5A1L A;  3D0T A;  1OWA A;  3RQU A;  4EB6 E;  1UK5 A;  2X9Y A;  4EYY R; 
#chains in the Genus database with same CATH homology
 3NBX X;  4ZI3 C;  3ZPO A;  2K5B B;  1SA0 E;  2VK9 A;  3N9O A;  4PK6 A;  2WBL A;  3HL6 A;  2DCF A;  5HYA A;  2EHO A;  1IJ5 A;  1HFA A;  3PE0 A;  4UIG A;  2KIN B;  5JDN A;  3OYX A;  4MLK A;  5LGN B;  3FB2 A;  4G63 A;  4PAG A;  4OYK A;  2W00 A;  4YJ3 E;  2H7V C;  4DBQ A;  3PDY A;  3DTO A;  4BA9 A;  2XAJ B;  3C98 B;  3LG7 A;  3OKQ A;  3WI3 A;  3SS1 A;  2KWH A;  5C8Y E;  3SRZ A;  4TN7 B;  4TUY E;  1MNE A;  2A3D A;  5HWX A;  1WRD A;  4UV9 B;  2IC9 A;  3EDU A;  4EAH A;  3LK2 B;  3RC3 A;  4M1P A;  2ODU A;  1LVF A;  4PJJ A;  4QXC B;  1MND A;  2PBI A;  3ETV A;  3N2G E;  4QXB B;  4YLH A;  4ASK A;  3N9L A;  4Z8X A;  5J2T E;  2C5J A;  4ISS A;  2JPF A;  1LVK A;  2V7I A;  3OBV E;  5EZY E;  1QUU A;  3J9X 1;  3MKD A;  3PTR B;  3IHR A;  5DJQ C;  3NRY A;  4MAL A;  1ZEE A;  1UX5 A;  2P9B A;  4H9Q C;  2VWA A;  3N9Q A;  5JDL A;  2E9X B;  1BR2 A;  2V7K A;  3AAA B;  3EDV A;  4L9I A;  4OHF A;  3Q5W A;  1SHZ C;  2CCQ A;  4L0R A;  4C90 A;  2MBG A;  3VKH A;  2D2S A;  5FXZ A;  1T98 A;  2NP9 A;  5LGT B;  4EXT A;  3FXE B;  4HGA A;  4DMV A;  2W61 A;  4I4T E;  2JQQ A;  2NTY A;  2YK0 A;  4UF0 B;  2DWK A;  5IHY A;  3KVB A;  2JMK A;  2NOX A;  4QWN B;  5DAB A;  4ZOL E;  1MIV A;  3KBT A;  4E7S A;  3KV6 A;  1NWM X;  3P7I A;  2JJ9 A;  2X9W A;  4YHJ A;  5JRC A;  2JRK A;  4WBO A;  4O4H E;  5EK2 A;  5HXH A;  2YIN A;  3I9Y A;  4IE5 A;  5FMN A;  1LKX A;  4KP3 C;  3FHN A;  5FXX A;  5JDH A;  3O9X A;  4AXP A;  4H63 V;  4EYU A;  3I1A A;  4H9N C;  3CQG B;  2Q9Q C;  1E1H B;  2VKD A;  3ZC0 A;  4X1I E;  2M67 A;  4E7Z A;  2K9A A;  2X51 A;  4JLE A;  3ZLI A;  3ZMV B;  3GN5 B;  2N9D A;  3RYF E;  2LSG A;  3BQL A;  4L5G A;  2WM9 A;  3K8P C;  2HPJ A;  4O2B E;  4ZI2 D;  1FMV A;  4UVB B;  2BVM A;  2N1G A;  5FY0 A;  2V7M A;  5JQG E;  2ZMA A;  5JDQ A;  2BVL A;  3CKD A;  5JDM A;  4AKH A;  1WYB A;  4HN9 A;  3F2E A;  2CA5 A;  3C4W A;  2Q9Q A;  3ZMZ B;  2PG8 A;  2WWU A;  3I0Q A;  1WLX A;  2WMO A;  3SOL A;  3V5U A;  4X1Y E;  2K24 A;  1HCI A;  2X9X A;  3RYC E;  5IYZ E;  3QUJ A;  4IGU A;  2QA7 A;  4BJM A;  2CLY C;  2LM9 A;  3HI2 A;  4AQG A;  5JR9 B;  3ZMU B;  3M65 A;  4HEA A;  3CWZ B;  3ZJ1 A;  3HKD E;  2LHR A;  2XTL A;  2IAK A;  2E9X D;  4IHJ E;  5ADX L;  2LSY A;  2C0S A;  4O4I E;  1YKE B;  4ERR A;  2I59 A;  1Y64 B;  5E0O A;  2D0T A;  4BJN A;  2Q9Q B;  1WYC A;  3N9N A;  3F57 A;  2YU2 A;  4I55 E;  3MK7 C;  2LJL A;  5LGU B;  1HS7 A;  2CM0 A;  4TX5 A;  2B1E A;  3IBP A;  4DBR A;  3KV4 A;  4HFV A;  1MMN A;  3AVS A;  3OJA A;  3CQC B;  2BZB A;  4CXY A;  2VKJ A;  3Q2M A;  4QX8 B;  1U5P A;  2X0L B;  2DHR A;  3PUR A;  1U4Q A;  2Y48 B;  3ANW A;  4MFR A;  2DI4 A;  4KBM B;  4EZH A;  2ZM2 A;  2PJQ A;  4QHO A;  5FXV A;  5F3J A;  3H3A A;  3N9M A;  1D1B A;  4CXX A;  5M4Y A;  4PFP A;  4FI5 A;  4PW8 A;  1ZV4 X;  2NW7 A;  3O4X E;  4ZI7 E;  5F8P A;  4ADZ A;  3FXD B;  4NUU A;  2J1D G;  2EHO B;  4UEM A;  3PU8 A;  3ZCI A;  5H6Q B;  3C4Z A;  3QK6 A;  4XAX B;  2LSJ A;  3PU3 A;  2RA1 A;  4PNI A;  2CXL A;  4DVD A;  3GWH A;  4P0A A;  3CX6 B;  2LT3 A;  4KUM B;  2K48 A;  3ANW B;  4JUY A;  4C91 A;  3CQX C;  3IEE A;  2L9Q A;  3DP7 A;  5LA6 E;  2V7J A;  1WR6 A;  3NZP A;  2VL8 A;  4K0U A;  2LE8 A;  2XAG B;  2NW9 A;  1HG5 A;  4ZS2 A;  5LJM A;  5LYJ E;  4XBF B;  3VKG A;  3AA1 B;  1HG2 A;  4IIJ E;  4ZHQ E;  3CML A;  3MJX A;  5FNV E;  3F31 A;  2C5I T;  5LBQ B;  3N2K E;  2GK9 A;  2L8K A;  4UV8 B;  3UUN A;  2X67 A;  4H9P C;  5HXE A;  2C5K T;  2ES0 A;  3RX6 A;  3R6N A;  3DJB A;  4UVC B;  5FY7 A;  1HF8 A;  4CI2 B;  2SPC A;  3KBU A;  4HKA A;  2KT9 A;  2Q9Q D;  2MOZ A;  4ZS3 A;  4TZ4 C;  3KV5 A;  3AB3 B;  4TV8 E;  3ONX A;  2OA5 A;  2QGS A;  2W0G A;  2XAS B;  5LBM A;  3UT5 E;  1KNZ A;  3VU7 H;  4PJN A;  2HPL A;  3CX7 B;  4J2C A;  3JC6 D;  4MHC A;  2VAS A;  1QSD A;  4N78 D;  2Y6X A;  5DQW A;  3T8O A;  1O3X A;  3K3Q C;  4X1K E;  4AKG A;  1G73 A;  2HH7 A;  2MYS A;  4I50 E;  2IC6 A;  4GK5 E;  3VHL A;  2CWY A;  3U3I A;  4EZ4 A;  1V9D A;  2PFV A;  3KIN B;  3H37 A;  2VKH A;  3GA8 A;  4YJ2 E;  3UFE A;  2KND A;  4OYJ A;  3ZMT B;  4O2A E;  2Z6E A;  3TKL B;  3ZYL A;  1OXZ A;  5JRC B;  4PJM A;  3C64 A;  4AQF C;  4KMC A;  3FBL A;  4DO0 A;  2KZ7 B;  5JRE A;  3HKB E;  4AKR B;  2EHO D;  2YU1 A;  3FBZ A;  5L3E B;  1FMW A;  5DQV A;  4PJL A;  5GON E;  1MIW A;  2V1D B;  4O8S A;  4AKI A;  3BQI A;  3LJC A;  1D0Y A;  5BMV E;  2WSS V;  5LNK A;  5LCY A;  5LP6 E;  1US7 B;  2LHN A;  1NAF A;  2XAF B;  3E0Z A;  3P8C D;  4V1A v;  3ZN0 B;  2LSK A;  3RPU A;  3PUA A;  4ZI3 D;  4IDZ A;  3PUS A;  2KWI B;  4GYR A;  4AQF A;  2MTQ A;  3B13 A;  4EYY R;  4ZI2 C;  4WBN E;  3ZC1 A;  5LG4 A;  3BQK A;  2WMN A;  3EVY A;  2V26 A;  4H9S E;  1S94 A;  3KDS E;  5FP3 A;  3UUM A;  4UVA B;  2CEA A;  5LXT E;  2ODV A;  2KLQ A;  3L3P A;  5TAO A;  3WAK A;  2X66 A;  3C50 A;  5HWY A;  3MXZ A;  3N5L A;  4U74 A;  5LHG B;  1ZKE A;  2JMH A;  3ZYK A;  2DWG A;  3AA0 B;  3Q9D A;  5FY1 A;  1D1A A;  2N2N A;  2DNX A;  2D0U A;  4PK5 A;  4ANJ A;  4TV9 E;  4IE0 A;  3ZCJ A;  5CA1 E;  4G2A A;  1MIY A;  4CXW A;  3RH3 A;  3LBX A;  4IE4 A;  1BR0 A;  1UCU A;  2Y8D A;  2E9X C;  3RC8 A;  1X79 A;  3KV9 A;  2NTX A;  2UXN B;  2ZLY A;  1B7T A;  4F6R C;  3O1I A;  1YW0 A;  4QKN A;  1S35 A;  3BK9 A;  3RRC A;  3UUL A;  5L3B B;  5J2U E;  5L3F B;  1AJ3 A;  1H7C A;  2CLY B;  3HKC E;  4O4L E;  1HTJ F;  5L3D B;  3WAJ A;  1MMG A;  4EIW A;  1YKH B;  1HX8 A;  3J7Y q;  5CA0 E;  4EOZ B;  3LK3 B;  2XAQ B;  3RYH E;  2XUE A;  2E9X A;  2CMR A;  3LBX B;  1D0X A;  4B6X A;  2LEH A;  1G8X A;  3HKE E;  1ZHC A;  5L2L A;  3CVR A;  4WW0 A;  3ZYM A;  2ZM0 A;  2VKO A;  1IJ6 A;  1MMD A;  2E8I A;  2IW5 B;  2BDE A;  3K3O A;  4A56 A;  4UF0 A;  3AVR A;  5J1G A;  5H6R B;  4X20 E;  4P09 A;  3L09 A;  4GOU A;  4IE7 A;  2CXD A;  3RYI E;  3UUX B;  1D1C A;  2L3L A;  3N9P A;  5JDG A;  2W62 A;  5LHI B;  4CZZ B;  4JEH B;  5HAX A;  2CWO A;  3AA7 B;  3IF8 B;  2W63 A;  3C4X A;  2LOS A;  3QC9 A;  1CUN A;  2H3R A;  5HXC A;  2ZM8 A;  2NW8 A;  3LFM A;  4YFS A;  5AFU L;  3N2O A;  2XHE B;  4I43 B;  2XQY A;  1VOM A;  1BR1 A;  2A72 A;  1YD8 G;  3MZK B;  3ZEF B;  5JDF A;  5KX5 E;  3GN5 A;  3ESL A;  4UXN B;  4XZC A;  2RP4 A;  1FEW A;  3ZN1 B;  5FXW A;  3V5S A;  2LOP A;  5EK3 A;  3AAI A;  2DLR A;  4NUV A;  3EUH A;  1D0Z A;  3I9W A;  4QXH B;  5JR9 C;  4CI3 B;  4IST A;  2UXX B;  3E08 A;  2KXP B;  4AKL A;  2D5U A;  3AA6 B;  3RKO A;  2LSI A;  3SWH A;  3NRX A;  3O1J A;  4BAY B;  2WAU A;  4QX7 B;  2VB6 A;  3ZMS B;  1BR4 A;  3CX8 B;  4HE8 A;  3MAC A;  4AI6 A;  2KMF A;  3ETU A;  3O1H A;  4FJO A;  4UEL A;  4ILU A;  2XAH B;  4GK0 E;  4JEU B;  3UTK A;  4CI1 B;  1EZ3 A;  1UX4 A;  3KVA A;  1KK7 A;  5KMG P;  3S4U A;  5CB4 E;  3JC6 C;  1VRB A;  1IZN B;  3A5X A;  5JR9 A;  4DMW A;  3LK4 2;  4GYS A;  2V7L A;  5KDM C;  2H7O A;  4HTE A;  4H9O C;  2X9H A;  5EK4 A;  5JVD E;  3R84 B;  3KFW X;  4H9R C;  3I0O A;  1FIO A;  4WNK A;  4PK4 A;  4U72 A;  1MMA A;  5JH7 E;  5LOV E;  4PFO A;  4CQI A;  5FYM A;  3PUQ A;  3C51 A;  2ACX A;  2CXF A;  2X68 A;  1Z0P A;  3AAE B;  4IE6 A;  4GIW A;  4OK0 A;  3OYZ A;  5L3C B;  3B57 A;  5HXS A;  3MA9 A;  3U78 A;  3HA4 A;  2EHO C;  2CE7 A;  5LJN A;  1IAP A;  4P0B A;  4OFZ A;  4MBQ A;  5HXR A;  1LRZ A;  3CPZ A;  4DND A;  3GMI A;  3Q5X A;  3PUG A;  3W15 B;  5A1L A;  3NZQ A;  4O4J E;  4H63 H;  3D0T A;  1OWA A;  2NWB A;  3E22 E;  2G0U A;  3ZJ2 A;  4EB6 E;  5L3G B;  2A2F X;  3K3N A;  5ETW A;  5LHH B;  3RRW A;  2X9Y A;  2YEV C;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...