2KX3A

The solution structure of the mutant of ubl domain of ublcp1, i5m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
b'MALPMIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
publication title The solution structure of the mutant of UBL domain of UBLCP1, I5M
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 12
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kx3A00
2GBNA 5CX3A 2KQSA 3KUZA 3L13A 2M1MA 3BINA 5CHVC 3DCGA 2JRHA 3KUDB 4WWNA 1T0YA 4IM3A 1CMXB 1WE6A 1WZ0A 3MJWA 2NCNA 3SD5A 4ANXA 5LXIB 2G4SA 1V9JA 3UQAA 3VTWA 2AL6A 2KVRA 2KWCA 2PJHA 1YX6B 2N9XA 4MGKE 3QIJA 3VUWA 4DHZB 4HCNB 2NBVB 4EZJA 1V86A 2AWTA 3K9PB 3WIMA 2RSUA 2DAFA 3B0AA 3OAWA 4KDLB 3R7QA 4HXDA 2LRUA 2FCNA 3APFA 3ZTCA 1I42A 3A4SC 4PS7A 4PS3A 5DPTA 2GBRA 3DBRI 4ANVA 1E8XA 3HHMA 3VUXA 3NHEB 1EF1A 3TBLD 2DZIA 4JL9A 3TJPA 1C1YB 2NR2A 1GUAB 1V6EA 4AP4C 2J0MA 4K7WA 3KYCD 3ZLZA 4I6LB 3UQBA 4A3OA 5JH5C 2FIDA 2QHOA 2LVPA 4IUMB 2KX3A 2UWQA 2HTHA 3QCAA 4URKA 3H9DA 2V3SA 4OVVA 3QK0A 2KDIA 3QHTA 3MTNB 4GDLB 4BKSD 3IHPC 1E7UA 2EMSA 2HE7A 1PQSA 4XX5A 3EHVA 2MWSB 2OJRA 4G0NB 2A5UA 1GC6A 2G4DB 4MJSB 4II3B 3VUYA 3DVGY 3ML8A 2FCQA 2KMAA 4HJKA 1WGRA 4K1RB 1V2YA 3UIPB 4CO7A 3LJ3A 2K6DB 3PT2B 2JZZA 3QQ8B 4JQWC 3PVLA 4KDIC 2M4NA 5J18A 5LLIA 1A5RA 3IVFA 2MW5A 3A9JA 2JY6A 1RLFA 4W9CA 3ZNHB 2LVQA 4HDOA 2PEAA 1GJZA 2K25A 5L83A 1E8YA 4OVUA 2AL3A 4MSMB 4BVUC 1SE9A 2PE9A 3N3KB 3H6NA 4FA6A 4XC2A 4GU2A 3WAPA 4IM2A 3OJ3A 2IY1B 2D07B 3AI5A 3H7PA 3IBEA 4EZLA 2A4ZA 4DDGD 3VTVA 3RYTA 2NS5A 2AEHA 1E8WA 4ZRKA 2LWPA 5DCNA 3Q3JA 2BYVE 1EO6A 4GDKB 3T9LA 3W1YA 4BFRA 2JPHA 1WGYA 2KFKB 4MGIE 2FCSA 4DDID 2MA9B 2O6VA 2XK5A 1KLVA 2LJ5A 3PRPB 3ECIA 2NPTA 3A1QB 2EKEC 4GOCA 2L8JA 1P1AA 1WMHB 3Q3FA 2KOXA 4MGZE 2IBIB 3UINB 3OJ4B 2DX5B 5D7GA 3QWZB 1WJUA 1RRBA 2M17A 3NS8A 2JRIB 3NY5A 3JSVB 3EC8A 3ZRCA 4ANWA 4A3PA 3EECA 4IWPA 1WXSA 4II2B 1YD8U 2NVUI 4WJPA 2DYMA 1Q0WB 2N1VA 3PV1A 2LGXA 4WQOB 3PGEA 2RPQA 2IO2B 5G55A 2BPSA 4DK5A 2GOWA 4FN2A 1YQBA 1OGWA 3PHXB 3DQVA 3R66C 1TTNA 2KN5A 2ASQA 2BGFA 2PE6B 2KTRA 4DBGA 2VRRB 3JSVA 1V49A 4FADA 2JXXA 4W9JA 4BBNC 2C5LC 1TGZB 1E5WA 1WYWB 4WWPA 2KXJA 4MH0E 3VAWA 3TMPB 1P3QU 1LM8B 2C7NB 3EFUA 2MX2A 1YIWA 2LGYA 2MP2A 3IG3A 5DPSA 1WXAA 2D3GA 2MBEA 2MSED 3H1UA 3PPAA 2RD0A 4NJ6A 3ZUNA 4LDTB 4F7ZA 1V5TA 1XD3B 2B3AA 2J7QB 2D11A 1UH6A 2L00B 2L0TA 2LXCA 2JWZA 2N7EA 2PPHA 2R2QA 2LRWA 2Z0DB 3R3MA 3ZRFA 2V4LA 2WX0A 3T8MA 4FJVB 2L76A 2CHXA 1GC7A 1EF5A 3CF6E 1VD2A 4B95A 4BOSC 3VHTC 3DBHI 3S2AA 2KK8A 2LD9A 4E3CA 1UD7A 3HM3A 4LCDE 4RM8A 4CYEA 3ZIMA 1UELA 2JUOA 2KZRA 4X57B 1YJ1A 2I1JA 3DVNU 2JVCA 4DXAB 1C3TA 3APCA 3PLVA 3PRMB 4B6WA 2FNJB 2IYDB 1L2NA 1IP9A 3HIZA 3V62A 2D2QA 2LVOA 3RT3B 2LUEA 1J19A 3ZNZB 3L0WB 4FBJB 4IWOA 2DENB 3QX1A 3ZTDA 1WGDA 2J0JA 2LASA 2KHWB 4W9FA 2G3QB 5BO4B 3A33B 2IZVB 2ZEQA 2MBOA 5CHWA 4JGHB 5FR6A 4KSKC 2RR9A 2BF8B 4PYUA 2FAZA 2CS4A 3A9JB 2MRPA 2ZVOA 2ZVNA 4G50A 5LXHA 5DPWA 3VQIA 4WJQA 4DHJB 3W1SC 1OTRB 1LQBA 2K1FA 4KV2A 2C7MB 4J6IA 4G11A 3WALA 3PTFC 3P2BA 1WX9A 3AU4A 3B1LX 1ZGUB 2GMIC 3QJZA 1WM3A 4W9GA 1ZKHA 3C0RB 2WYQA 4F1SA 4FJZA 4MM3A 1WJNA 2BWES 5J17A 5E6OA 3U7DA 1G6JA 3HK0A 3V6CB 4ANUA 4DHZE 3H7PB 2D10A 4GGQA 4HVBA 5HKHA 1WFYA 2L05A 2LZ6A 3JVZX 3N30A 1V80A 4KZCA 3ALBA 1LXDA 4WJOA 1JRUA 4ZRIA 2KJHB 1M94A 4TV3A 2DZJA 4NQKE 3V6EB 2N1WA 3NOBA 2BKRB 3PLUA 2O6VB 4EUTA 2XK5B 2NPTB 4HLEA 4KVGB 4KIKA 3RD2A 3ZVVA 1I35A 4ICVA 4LJOB 1TZ1A 4K7SA 2UYZB 3KYDD 4LDTD 2CHZA 4EKUA 3PS6A 2WWZA 4BOZB 4K81A 2K8BA 1E7VA 3AXCA 1WGGA 5KHOA 1WH3A 1P98A 3WA0A 3RULA 2KLGA 2K6QA 4KSLC 3U30A 4WJNA 1WM2A 4GSWA 3SU8X 5JZEB 4KZ0A 5E6PA 1WZ3A 2ZPNA 4W9KA 2I1KA 2J0KA 4K7UA 2KWUB 3M95A 4GMVA 3RZWC 5CHFA 5E6NA 2KDEB 2K39A 2KMCA 4GXBA 4NJ7A 2KTRB 1KM7A 2L3ZA 1WJ4A 3TIXA 3CSTA 2KDFB 1XQQA 1TBEA 1Z2MA 1Q5WB 3KVFB 2ZNVC 1LFDA 2MP2B 3QAQA 1HE8A 3QARA 3MHSD 4DWFA 4FHJA 3ML9A 1OEYA 2ZJDA 4ICUA 3N32A 2FUHB 4FULA 1U4AA 2DZKA 2LGDA 2M0XA 4P7IA 1WX7A 3DBLI 4IM0A 3UGBB 1EUVB 2WDTB 3W1SA 3ZKJC 3PRZA 4MDKE 4GIVA 2MQJA 4IW0A 2V1YA 1GNUA 2CKHB 4MSQB 1UBQA 2DZMA 4MGYE 4JIOU 3RUIB 5TR5A 4EEWA 5D2MB 1AARA 3DOWA 2DYOA 5J2RA 1RFAA 4NAWA 4MEMA 1S1QB 2ZPYA 4ZDVA 4BKGA 1V5OA 2R2OA 1NBFC 3V60A 2XEWA 3DVGX 1J8CA 3ONSA 1UBIA 3ZDTA 3L16A 2LXAA 3UF8A 4BKSA 5EDSA 1L7YA 4PYZA 1IPGA 3KUCB 2KLCA 3ZDMC 2JT4B 2IO1B 4TQ1A 3NZSA 2CR5A 5GMVA 2N4FA 1F9JA 2DYBA 2REXA 3R7RA 2YLMA 5AZGA 2K8CA 2GBKA 2YVCA 3VDZA 4B9KA 4N9F4 5JHBA 1GG3A 3L17A 1D3ZA 1P9DU 3AULA 2JZ3B 2IO3B 1XT9B 1H8CA 3UIOB 3VH4B 2AYOB 1Y8RC 2L0FA 3A9KB 2ZNVB 2KANA 2CU1A 4AJWA 2N7DA 4FLHA 2KD0A 2O2VA 4HPMB 4CHKA 5IAAC 4AJYB 3KW5B 4FHKA 3VH3B 2MLBA 2MCNB 4HK2A 3ZNID 4HDQA 1OQYA 2DAJA 3APDA 3M3JA 4GN1A 1FXTB 3D32A 3L54A 3O65B 2KWVB 4I6NB 4NY0A 2NBUA 2MBQA 3CSFA 1Z5SB 1WGHA 2BYEA 3VTUA 3HM6X 4W9LA 1WI0A 3A9KA 3QA8A 2KNBA 3QC8B 1S3SG 3B08A 3VFKA 3X0WA 2GBJA 2FCMA 4A20A 1UGMA 2KDBA 1WR1A 2Z0EB 2C7HA 4IC7B 4AOFA 4KIKB 3LDZE 3RCZA 1Q1OA 2EMTA 3M62B 2CHWA 2ZCCA 1K8RB 2GBMA 2NBWB 2N9PC 2LI5A 2M8SA 4ASWC 3L08A 3DBSA 1BT0A 3VXWA 5AZHA 5C23A 3H7SA 2W9NA 3JYUA 4M8NA 3KH0A 2FIFA 4RMAA 3SDLC 1ISNA 2C9WB 4HCPB 2HD5B 2KKCA 2IY0B 3IFWB 4E71A 5IA7A 4BKTA 4FJYA 4GB9A 1YX5B 3K9OB 1QZEA 3A4RA 4XZ4A 2KC2A 4TQ0A 2ZCBA 1KJTA 4W9DA 1V81A 4AUQC 3U8ZA 2MBBB 2ZZPB 4GDLA 4TKNA 4NNJB 4EOYA 4W9IA 1SGHA 4MJSA 1WJ6A 2MBHA 1NDDA 1WXMA 3WANA 4I6PA 3PSEB 3L10B 1H4RA 2RGFA 2K8HA 2Z59B 4PS8A 2HJ8A 3DDCB 2WX1A 4EZKA 1E90A 3WAMA 4WAAA 1E8ZA 3DVNV 5D94A 3SHQA 2C60A 1J0GA 1WR6E 2G45B 1WF9A 4NAWB 3NZUA 3TL5A 5KHQA 3V61A 1X1MA 1WE7A 2KQ7A 2KTFA 1NI2A 3ZW3A 1WXVA 5JHAA 4IWQA 2XBBC 3ZNGC 2BYFA 3X23A 4BBNF 2KC1A 3I3TB 1WRDB 1IYFA 4M8MA 1WY8A 1WIAA 4ZRJA 1VCBA 3M63B 3PZDA 4EFOA 4W9HA 3AU5A 5CTRC 1UZXB 3VVWB 2BWFA 4WWOA 1R4MI 4DHJD 1MG8A 3CMMB 4M0WB 4NQLB 4GDKA 4IG7B 2KX0A 3PHWB 2BKFA 4G3XB 3ZO5B 1KOTA 2KFKA 1ZW7A 4NPNA 1SIFA 2IO0B 4TUUA 3A1QA 2L7RA 3OLMD 1WMHA 2KJRA 3WAOA 4HWIB 1RAXA 4F8CB 2KFJA 5AEKB 3GOEA 5G2NA 2Y5BB 5D6JB 4YL8A 5C1ZA 4LJPB 2KJ6A 2JF5A 2KO3A 3GZNI 2O2VB 5AZFA 4ZYNA 4AWJA 2OOBB 4W9EA 4E74A 1R4NI 4HPLB 2DHZA 4JLCA 3BY4B 1P0RA 2O6VD 4MELA 4RM9A 3JW0X 2N9EB 3TCAA 5L95C 1OEYJ 3PREA 5DPRA 3RZFA 1WX8A 3DPDA 3ENEA
chains in the Genus database with same CATH superfamily
1GAQB 2KQSA 3R2IA 4IM3A 1GPXA 2G4SA 1WRIA 4DHZB 1FXAA 1YX6B 3VRBB 1JRPA 2BBCA 4LNNA 2QC8A 2DAFA 4HXDA 1MJDA 2PMVA 4KKJA 5IN7A 1EWYC 3HHMA 2QCZA 3TBLD 1IGDA 3FILB 2WXHA 1AN8A 2J0MA 3KYCD 4A3OA 5JH5C 4XWWA 2KX3A 4YTPB 3H9DA 4OVVA 4GDLB 3MTNB 4MACA 2HE7A 3EHVA 2MWSB 4G0NB 3ABVB 2A5UA 1GC6A 1HZ5A 4MJSB 4II3B 3RN9C 3DVGY 3ML8A 4M02A 1YQ3B 3PVLA 5IO9A 1A5RA 2MW5A 2QIEB 3A9JA 2JY6A 4YTNB 3ZNHB 2LVQA 4HDOA 2K25A 4WIPA 3H8HA 2AL3A 1L5PA 2MJ3A 2J53A 1VJKA 4YT0B 2BS2B 1WXQA 1A70A 3H6NA 4NZLB 1WGKA 4D2KA 2VH2A 2IY1B 4A6QA 3VTVA 3RYTA 2NS5A 2OEDA 5DCNA 2BYVE 1IUEA 2JPHA 4MGIE 1YOVB 1FRRA 2XK5A 2LJ5A 4F8CB 3ECIA 3A1QB 1WMHB 3Q3FA 2KOXA 3UINB 4XGAB 4ARIA 2WGSA 2JRIB 3JSVB 1YD8U 3Q2AC 2DYMA 2EKIA 5G55A 1SJHD 2GOWA 3P1MA 2ASQA 2WQYB 4FADA 2JXXA 4BBNC 1TGZB 1NYQA 4WWPA 3HUIA 3AMZA 1L0YB 2LGYA 2TSSA 2MSED 1TKEA 4F7ZA 1UH6A 4LJPB 4KZCA 3ZRFA 2R2QA 1L6VA 3R3MA 2LRWA 3T8MA 4FJVB 1E7PB 3CF6E 1GC7A 3KLSX 1VD2A 4B95A 3KQ4A 2DWQA 4KGTA 3S2AA 3ZQ4A 1FNWA 1UD7A 4LNKA 2FBWB 3DBRB 1UELA 2JUOA 4X57B 2PTLA 1C3TA 3APCA 2INNE 1L2NA 4LTUA 3RT3B 1J19A 1HZ6A 3ZTDA 2J0JA 2G3QB 3A33B 2FE8A 2IZVB 2ZEQA 5FR6A 3MC9A 4KSKC 4XE0A 4DXGA 2MRPA 2MJEA 3AEFB 5DPWA 4DHJB 4RF1A 1QQRA 1XF5L 1TKGA 3AEBB 3B1LX 1C77A 1WM3A 2WXPA 4F1SA 2BWES 3HK0A 4K3BA 2AX5A 3OWEB 3B9JA 2LZ6A 3JVZX 3URYA 1J7BA 4ZRIA 4A9AA 2O6VB 2Y5PA 4HLEA 4ICVA 4K7SA 3KYDD 4BZAA 3PS6A 4DXFA 4BOZB 2K8BA 2J42A 4KSLC 4L1BA 4WJNA 1WM2A 3SU8X 1WZ3A 5E6JA 3M95A 4GMVA 4XYCA 4NJ7A 5GXGB 1KM7A 2GB1A 4LK0M 1WJ4A 3RNCC 3TIXA 1XQQA 1Z2MA 1Q5WB 1TY0A 3KVFB 1HE8A 3MHSD 4FHJA 1CJEA 2ZJDA 3DBLB 4ICUA 3LXFA 3N32A 2FUHB 4FULA 2LGDA 1WX7A 4LNIA 5LNK1 4IM0A 1EUVB 1Q10A 2BS3B 4US8A 2WDTB 3ZKJC 1F0ZA 4AQ7A 4MSQB 5TR5A 5D2MB 3DOWA 5J2RA 2M19A 4NAWA 4MEMA 4ZDVA 1YN4A 2DLBA 2JX5A 2QJLA 3AE6B 2R2OA 2NTTA 1NBFC 2LMCA 3GE8C 2W55A 3ONSA 3DBHB 1UBIA 2VZKD 2Y5CA 3ZDTA 4BKSA 2IDYA 5EDSA 1L7YA 1HEZE 1I4PA 4USAA 1TIFA 2WXOA 1ZXIA 3TEWA 2CR5A 5GMVA 2N4FA 3N1YC 1F9JA 1NEKB 1JROA 1QKZA 1BXTA 4B9KA 2JZ3B 1H8CA 3VH4B 2AYOB 2CU1A 2IGGA 5IP4D 3ZGZA 2N7DA 2PW9A 5AUKA 2O2VA 3ZJTA 3U2SC 5FK9C 4HK2A 4MM3B 3M3JA 2SEBD 3D32A 2KWVB 2NBUA 2MBQA 3VTUA 4RGOS 2VH1A 1WI0A 3A9KA 1YNTE 1S3SG 3B08A 3VFKA 1UGMA 2KDBA 1WR1A 2C7HA 3DHGC 4KIKB 3N1XC 2ZCCA 1MVKA 4ZRQA 1V8CA 2NBWB 4ZYSA 2WLBA 4RGTA 5C23A 4A55A 1QF6A 1ZXHA 1XCTL 3KH0A 2FIFA 4HCPB 3R8BA 1UWMA 2KKCA 4E71A 1QOBA 5IA7A 4GB9A 1YX5B 1UWXA 1TS5A 3A4RA 3AH7A 1E6EB 3RI7C 1MG4A 4AUQC 3U8ZA 2ZZPB 4FXCA 4TKNA 5IOIA 2MBHA 1NDDA 1C78A 3WANA 3L10B 2Y3AA 1K52A 3VR8B 1E90A 1JQ4A 5D94A 3SHQA 2WXMA 1YN3A 2GLSA 3TEZA 4RGMA 1NI2A 4YXDB 1KFYB 4JWSC 2ICIA 3Q3OC 2QMTA 4EFOA 3AU5A 5CTRC 3VVWB 4WWOA 1MG8A 4GDKA 2KX0A 5BYQA 4NPNA 1ZW7A 2JYEA 1F2RI 2MH7A 4M0WA 2L7RA 4UDUC 5EE9A 4YL8A 2JF5A 4P1CC 4AWJA 4W9EA 4E74A 3DHHC 1HTQA 2V3NA 2N9EB 5DPRA 3RZFA 4W9CA 3MJWA 3NVWA 5LXIB 1JWAD 5CX3A 3AN1A 3SEBA 3BYTB 2M1MA 2B76B 1FRDA 4BAXA 2JRHA 3L4PA 4WWNA 3SD5A 2WDRB 2KVRA 2D5GA 3ZJVA 2NBVB 1V86A 5G5HA 1TJEA 3A4SC 5DPTA 1IBXA 2GBRA 3E9SA 4ANVA 1JWBD 1RYJA 3RMKC 4JL9A 1C1YB 1V6EA 4K7WA 1LGRA 2QHOA 1F52A 2LVPA 4IUMB 1MHXA 4URKA 1ZDXA 2N9LA 2V3SA 4RFBA 3QK0A 2KDIA 4YTMB 4BKSD 3IHPC 2EMSA 4XX5A 1PQSA 1TS2A 4HROA 3VUYA 1KF6B 3DWGC 2G4DB 1ZP0B 2FCQA 2KYWA 3KWLA 4K1RB 4XDCA 3UIPB 1PGAA 4L23A 1L4ZB 2M4NA 3P63A 4KDIC 5J18A 3IVFA 3BK2A 5L83A 4OVUA 3IT6B 3ZJUA 3BVGA 1QOAA 4MSMB 2PE9A 4FA6A 4IOIE 3EA6A 2I38A 1UNSA 1FCCC 2AEHA 4ZRKA 2LWPA 2KVZA 1EO6A 3T9LA 3V05A 3W1YA 5D3DA 4BFRA 2KFKB 2MA9B 1KLVA 3N1ZC 4ZRPA 2NPTA 2DX5B 4GLSC 3QWZB 1WJUA 1WWTA 1RRBA 3NY5A 1C4CA 4A3PA 4NJCA 4HPPA 1XLPA 3UI3A 4IWPA 1XLOA 2OJWA 4WJPA 1FNUA 1YJJA 5EE3A 3OG5A 1Q0WB 2JU6X 3PGEA 2RPQA 2BPSA 1YQBA 3J9CA 3NRZA 3PHXB 1TTNA 1XXGA 2KN5A 3GZNB 4RCOA 1V49A 1I4QA 2C5LC 4WQMA 3VAWA 2KT7A 2C7NB 3Q3NC 3IG3A 2M0AA 1SE4A 2V3PA 3NZ3A 4KX6B 1V5TA 1XD3B 3GB1A 2LXCA 1FEHA 2PPHA 5D3IB 2WXQA 2L76A 2CHXA 5C2TB 2K9XA 2KN4A 2QILA 5MPOA 1C9FA 4LCDE 4RM8A 1SB3C 2R61A 4CYEA 1F1HA 3KWVA 1N61A 4M01A 3DVNU 3EGRA 3PRMB 4J3OD 4HJGE 1AYFA 2D2QA 3ZNZB 3L0WB 3O13A 4FBJB 2MHJA 4IWOA 5BYRA 5BO4B 2LASA 2KHWB 3LYYA 4N6EB 4IKGA 2KAJA 2BF8B 2H89B 2FAZA 2CS4A 1PGBA 5LXHA 4YSZB 3W1SC 2K1FA 2JXTA 1N6ZA 1PGXA 4KV2A 4J6IA 2CJNA 3AU4A 4ZHOA 1ZGUB 2GMIC 1WJNA 3U7DA 5FKAC 4ANUA 4DHZE 3H7PB 4GGQA 5HKHA 1WFYA 1LXDA 4WJOA 2DZJA 3V6EB 3FKYA 2E6XA 2IGHA 3HRDD 4ITKA 2WHIA 4LNFA 4TMAB 1TZ1A 2UYZB 4LDTD 2CHZA 2WWZA 4P1BC 1D4BA 1E7VA 4LLGM 5KHOA 2QDFA 3WA0A 2K6QA 3U30A 3CIRB 2WU5B 5E6PA 2I2YA 2LHDA 2J0KA 2KWUB 2DBYA 2KTRB 2L3ZA 1QLBB 1FMAD 1SIJA 1NENB 3SFDB 2AQ2B 1V97A 1LFDA 2MP2B 4DWFA 4RGNA 3AV8A 1NYRA 2WDQB 4P7IA 5JXVA 1PFDA 1TZOA 1D5ZC 2DZMA 1CQVA 4EEWA 1N63A 2KQ4X 1RFAA 3IT4B 1S1QB 2ZPYA 1GOZA 4BKGA 1V5OA 1E10A 3DVGX 1K50A 1QOGA 3BZDB 1VZ7A 3P42A 3KUCB 1L0VB 2IO1B 4TQ1A 3NZSA 3N20C 2DYBA 2K0PA 3R7RA 4N59A 1STEA 2YLMA 2K8CA 2GBKA 3VDZA 5JHBA 1ZDVA 2CU3A 3I63C 3A9KB 2ZNVB 3RNGC 4HPMB 5G5GA 1T0RC 3KW5B 4FHKA 2KMMA 2MCNB 1YMHE 3ZNID 1OQYA 2DAJA 1JCKB 3RNFC 1VDVA 2D3BA 1ZUD2 3CSFA 1WGHA 2BYEA 4W9LA 1KLUD 2KNBA 1XO3A 1V1PB 4YSXB 3NS1A 3VRAB 1J7CA 3X0WA 2GBJA 2INDC 4DQOC 4R3DA 3LDZE 1L6UA 1Q1OA 3M62B 2CHWA 2ON8A 4ASWC 4RH6A 3DBSA 1ZPSA 1RM6C 3JYUA 3FILA 4US9A 2HD5B 4P6VF 2IY0B 4FJYA 3K9OB 4WWMA 3AECB 1N62A 1V81A 4W9DA 2L32A 1FXIA 3GP7A 2MBBB 4GDLA 2WXIA 2PKOA 1B1ZA 3MFGA 4EOYA 1DOIA 1SGHA 4MJSA 4WH4A 4QAYA 1WXMA 4I6PA 1D5MC 2RGFA 2Z59B 1L0XB 1VZ8A 2KWDA 3DDCB 4EZKA 1MPEA 3AE7B 3WAMA 4WAAA 2Z8LA 1J0GA 2G45B 5HI1A 2RDBC 1CK1A 5TSSA 5KHQA 1X1MA 2KQ7A 3ZW3A 2ZW0A 4IWQA 4Q2JA 5HFYA 2KC1A 2N7JA 1IYFA 4M8MA 3NG0A 2WXRA 1WIAA 3ZXVA 3PZDA 4NQLB 4IG7B 5HHDG 2BKFA 3AEGB 1MFWA 1KOTA 5BMIA 3VR9B 1SIFA 2IO0B 1NVID 3A1QA 1WMHA 3N9YC 1DOXA 2CJOA 5AEKB 1DGJA 3GOEA 2Y5BB 5D6JB 1B9RA 1E0ZA 5AZFA 5EE1A 2OOBB 1R4NI 4OVZA 1TY2A 1JW9D 4RM9A 3TCAA 5L95C 1WX8A 3ENEA 2GBNA 3KUZA 5CHVC 3DCGA 3KUDB 1T0YA 3MP9A 1CMXB 4ANXA 3RPFC 3VTWA 3IAM1 2AL6A 2N9XA 4MGKE 3QIJA 4C4VB 3K9PB 3WIMA 2RSUA 2IGDA 3OAWA 3R7QA 2LRUA 3HVZA 2FCNA 3APFA 3ZTCA 1JALA 3DBRI 1VZ6A 3NHEB 3PZ8A 2DZIA 1LO5D 3TJPA 4ZHPA 3DWMA 3UQBA 2FIDA 3NVZA 2HTHA 1GB1A 3EUB2 1TS4A 3BWUD 3ZYYX 2RPVA 1WGRA 3LJ3A 2K6DB 5FR3A 5LLIA 1BMLC 4ARCA 1EU3A 3Q8AA 1E8YA 3C8YA 3FAHA 4BVUC 1R7SA 5H92C 1SE9A 4GU2A 4XDDA 3WAPA 4IM2A 2QEJC 2D07B 2JQRB 3AI5A 2XNAC 1QOFA 3Q3JA 2FCSA 2O6VA 1P1AA 2IBIB 5D7GA 4HKQA 2M17A 3AEEB 3NS8A 2JSVX 1YQ4B 3AEDB 3ZRCA 3EC8A 2BB6A 1WXSA 1PDXA 3PV1A 3P4RB 2LGXA 1HXYD 4WQOB 2IO2B 1FPYA 2UU7A 1XLQA 3PZ7A 1Y56A 1C76A 1RWSA 2VRRB 4W9JA 1WYWB 1E5WA 2WXNA 3TMPB 1T0QC 2KDMA 2MBEA 3PPAA 2RD0A 2PVGC 2B3AA 2J7QB 4O1NA 2D11A 2L00B 2JWZA 2Z0DB 3IAS1 2V4LA 2WX0A 1EF5A 3DBHI 4MT5A 2D3CA 3CWIA 3Q8CA 2N0SB 2LD9A 3AE4B 3HM3A 1SXTA 3ZIMA 2KZRA 2L83A 1EWCA 1C79A 4DXAB 1T0SC 2V4IB 4B6WA 3HIZA 1E9MA 5AUIA 2LUEA 3PO0A 3TEYA 4MH8A 1OFFA 3QX1A 1FFUA 4W9FA 3RNAC 4C80A 3I5JC 2MEKA 1JWUD 5CHWA 3MC8A 4PYUA 3A9JB 2ZVNA 4G50A 2ACZB 3VQIA 4WJQA 1OTRB 1LQBA 3PTFC 1F77A 3U52E 3R2TA 3V3XA 4W9GA 1ZKHA 2WYQA 3HVDA 4MM3A 5E6OA 2VZKB 2K5PA 3V6CB 4EE2A 2D10A 4HVBA 1TYGB 3N30A 1SF0A 4ACFA 1V80A 4S0RA 4WURA 4NQKE 2N1WA 2GRIA 3PLUA 1EU4A 2XK5B 4KIKA 3ZVVA 2QSDA 2JWUA 4LJOB 2W54A 1T3QA 3I9V1 2YEPF 1TT5B 3AXCA 1WGGA 1DYQA 3AE5B 4KZ0A 4W9KA 2I1KA 1N5XA 4C7YA 1FD6A 4K7UA 5CHFA 4PK1A 2KDEB 2K39A 2KMCA 4XWTA 3NUHB 2KDFB 1TBEA 4N58A 2ZNVC 3QARA 3ML9A 1PUTA 2DZKA 4H2AA 3PRZA 4GIVA 2JYTA 1RFKA 4IW0A 1GNUA 4MGYE 4K3CA 3W5UB 1FCLA 1SJED 4OZBA 1J7AA 2K3UA 3T3OA 1L4DB 3MC0B 1J8CA 3L16A 2LXAA 3UF8A 3W5VB 1IPGA 1I4XA 2KLCA 2JT4B 2LUMA 5AZGA 2YVCA 3I57A 3TUOA 1CZPA 4PT5A 5IKCM 1P9DU 3NJTA 3AULA 1XT9B 3UIOB 1FIQA 1T6BX 2L0FA 4AJWA 5H8YE 2KD0A 4CHKA 5IAAC 3VH3B 3T3NA 1ET6A 1FM0D 2LGIA 1QILA 3APDA 1FXTB 3L54A 3BIID 4NY0A 1Z5SB 2BYTA 3HM6X 2IPKD 1BUIC 3QC8B 1FFVA 2FCMA 5T8IA 4A20A 2Z0EB 1XEEA 4IC7B 1AWDA 3RCZA 2EMTA 5BYSA 1IGCA 1C4PA 2M8SA 2J4XA 3L08A 3U7ZA 2M56B 3C19A 1BT0A 2K22A 5AZHA 2INCC 3Q3MC 1ISNA 2C9WB 1F2RC 3IFWB 4BKTA 3NVYA 1QZEA 4XZ4A 2ZCBA 1KJTA 4P16A 3P4QB 4OZCA 2WS3B 4NNJB 4W9IA 1H4RA 2K8HA 4PS8A 2LFIA 2WX1A 4L2YA 1E8ZA 2C60A 2BS4B 3GS2A 4KKIA 1HTOA 4NAWB 4OHJA 2LGSA 2KTFA 2XBBC 3ZNGC 2BYFA 4BBNF 4ZRJA 3M63B 4W9HA 1UZXB 1R4MI 1SEBD 1I4HA 2G1EA 3PHWB 2BVCA 2KFKA 2WXJA 3MHZA 2W82A 4TUUA 3OLMD 2LJIA 2HJ1A 1FO4A 2J52A 1SBBB 2KFJA 4HRSA 3AE3B 5G2NA 1R4NB 2RDGA 2KJ6A 3GZNI 1N60A 2O2VB 3SR6A 1HA5A 1P0RA 4MELA 3JW0X 1OEYJ 3DPDA 2ONQA 2W3SA 4C56C 3L13A 3BINA 2XN9C 2X38A 1PYWD 1WE6A 1WZ0A 2YEPB 2NCNA 2WU2B 3RNEC 2AQ1B 1V9JA 3UQAA 3VUWA 2KWCA 2PJHA 4EZJA 2WNMA 3W2DA 4HCNB 5EE0A 2AWTA 2BQQA 3B0AA 3E56A 4KDLB 1I42A 1I4GA 4PS7A 4PS3A 1E8XA 1KRHA 3VUXA 1EF1A 1ZOYB 2NR2A 3AEAB 1ZE3D 1GUAB 4AP4C 1DOYA 2HTME 3ZLZA 4RNAA 4I6LB 2UWQA 3QCAA 2IJ0A 3QHTA 1E7UA 1TKYA 2OJRA 2KMAA 4HJKA 1V2YA 4CO7A 3PT2B 2JZZA 3QQ8B 4JQWC 3B2FA 5BMHA 1RLFA 2PEAA 1GJZA 1V1OA 2FUG1 2WP9B 3TEXA 2PLPA 3AE8B 1KLGD 2WXFA 3N3KB 4XC2A 3OJ3A 3H7PA 3IBEA 4EZLA 2A4ZA 4NAMA 4DDGD 5BMGA 3Q14C 2V9HA 3Q8FA 1E8WA 3RNBC 4GDKB 4B0MA 1WGYA 4DDID 4GOCA 3PRPB 4M0WB 2EKEC 4MGZE 2L8JA 1M4VA 3OJ4B 3B2GA 2G9HD 4ANWA 3EECA 4WAFA 3IXSA 4II2B 3EFCA 2NVUI 2PIAA 4C00A 2N1VA 4JPSA 1P7EA 4DK5A 4FN2A 1OGWA 1WSPA 3DQVA 3R66C 2GI9A 2BGFA 2PE6B 2KTRA 4DBGA 3JSVA 2BT6A 3AM9A 2KXJA 4MH0E 1P3QU 1LM8B 3EFUA 2MX2A 1YIWA 2MP2A 2SAKA 5DPSA 1WXAA 2D3GA 1UUPA 1VR9A 3H1UA 4NJ6A 3ZUNA 4LDTB 1GB4A 4KGSA 2N7EA 2L0TA 1VLBA 1IBXB 2BB5A 4KGRA 4B0EA 1NI3A 4BOSC 3VHTC 1SE2A 2KK8A 5I4DA 4E3CA 1UF0A 1QT9A 1VRAB 1XCQL 1YJ1A 2I1JA 4HEA1 1P7FA 2JVCA 1HQRD 3PLVA 2FNJB 2IYDB 3ZXRA 3V62A 2LVOA 2E3TA 3P4SB 1SE3A 1MHHE 2DENB 1WGDA 3FC4A 2NTSA 2H88B 2MBOA 2WXKA 1OQRA 1ENFA 4JGHB 2RR9A 2ZVOA 2Q5WD 3BVMA 3Q6BA 4ZOHC 2BW2A 3W9CB 2C7MB 3AE1B 4G11A 3WALA 3P2BA 1WX9A 3QJZA 5C3JB 3C0RB 3WCQA 5J17A 4FJZA 4OW0A 1G6JA 1K51A 2RMMA 3BVZA 3AE9B 1MI0A 1YN5A 2L05A 3TSSA 3ALBA 1JRUA 1V1PA 1M94A 2KJHB 4HKZE 2WDVB 4TV3A 4S17A 3NOBA 2BKRB 4EUTA 2NPTB 2HDEA 4KVGB 3RD2A 1I35A 3AB5A 4EKUA 4K81A 2LHEA 1C4AA 2NMQA 2PVOD 2D3AA 2LEKA 1WH3A 1P98A 1XLNA 3RULA 2KLGA 3Q8BA 4GSWA 5JZEB 2ZPNA 1T5XD 3RZWC 5E6NA 3Q69A 4GXBA 4JE3B 1KH0A 4OZAA 3GE3C 3CSTA 4RF0A 2OHFA 4IDIA 3QAQA 1OEYA 1U4AA 2M0XA 3DBLI 5HG2A 3UGBB 2L1AA 3W1SA 4MDKE 2MQJA 2V1YA 1D5XC 2CKHB 1IP9A 1UBQA 3RUIB 4JIOU 1AARA 2DYOA 1D6EC 1JWMD 2DNFA 3Q8EA 3DHIC 4CQNA 3V60A 2XEWA 2EELA 1OQQA 4TSSA 4PYZA 3ZDMC 1UGJA 2BTEA 2REXA 4JWUC 4N9F4 1FNVA 1GG3A 3L17A 1D3ZA 1KTKA 2IO3B 2WXLA 2INPE 3LB8C 1Y8RC 3BK1A 1ET9A 2N9KA 2KANA 4FLHA 4AJYB 4A8XC 2MLBA 2KACA 1ESFA 4HDQA 3SFEB 2ZW1A 4GN1A 3AE2B 2V0GA 3O65B 4I6NB 1WYGA 3QA8A 1I4RA 2RDHA 1JWSD 4AOFA 1K8RB 2GBMA 4C4VA 2N9PC 4YSYB 2LI5A 3P4PB 4REZA 3VXWA 3ETRA 3NVVA 4YWGG 1ACCA 2W9NA 3H7SA 4JX1C 4M8NA 4RMAA 3SDLC 1YJIA 4A90A 1AW7A 3U4EG 2KC2A 4TQ0A 1ROEA 2X8XX 4AS1A 1WJ6A 3BYYB 3PSEB 2HJ8A 2AQ3B 3MJ5A 3DVNV 1WR6E 1JMLA 1WF9A 2W3RA 3NZUA 3TL5A 3V61A 1WE7A 1WXVA 2L52A 5JHAA 1EM7A 1K53A 3X23A 1N5WA 3I3TB 1WRDB 1R4MB 1WY8A 3RFZB 1VCBA 2WXGA 2BWFA 4DHJD 3CMMB 4G3XB 3ZO5B 1SSNA 2KJRA 3WAOA 4HWIB 1RAXA 4M00A 5C1ZA 1TS3A 2KO3A 4ZYNA 2JZPA 4C7ZA 4HPLB 2MJDA 2DHZA 4JLCA 3BY4B 1I7HA 2O6VD 4LNOA 3PREA
chains in the Genus database with same CATH topology
2GBNA 5CX3A 2KQSA 3KUZA 3L13A 2M1MA 3BINA 5CHVC 3DCGA 2JRHA 3KUDB 4WWNA 1T0YA 4IM3A 1CMXB 1WE6A 1WZ0A 3MJWA 2NCNA 3SD5A 4ANXA 5LXIB 2G4SA 1V9JA 3UQAA 3VTWA 2AL6A 2KVRA 2KWCA 2PJHA 1YX6B 2N9XA 4MGKE 3QIJA 3VUWA 4DHZB 4HCNB 2NBVB 4EZJA 1V86A 2AWTA 3K9PB 3WIMA 2RSUA 2DAFA 3B0AA 3OAWA 4KDLB 3R7QA 4HXDA 2LRUA 2FCNA 3APFA 3ZTCA 1I42A 3A4SC 4PS7A 4PS3A 5DPTA 2GBRA 3DBRI 4ANVA 1E8XA 3HHMA 3VUXA 3NHEB 1EF1A 3TBLD 2DZIA 4JL9A 3TJPA 1C1YB 2NR2A 1GUAB 1V6EA 4AP4C 2J0MA 4K7WA 3KYCD 3ZLZA 4I6LB 3UQBA 4A3OA 5JH5C 2FIDA 2QHOA 2LVPA 4IUMB 2KX3A 2UWQA 2HTHA 3QCAA 4URKA 3H9DA 2V3SA 4OVVA 3QK0A 2KDIA 3QHTA 3MTNB 4GDLB 4BKSD 3IHPC 1E7UA 2EMSA 2HE7A 1PQSA 4XX5A 3EHVA 2MWSB 2OJRA 4G0NB 2A5UA 1GC6A 2G4DB 4MJSB 4II3B 3VUYA 3DVGY 3ML8A 2FCQA 2KMAA 4HJKA 1WGRA 4K1RB 1V2YA 3UIPB 4CO7A 3LJ3A 2K6DB 3PT2B 2JZZA 3QQ8B 4JQWC 3PVLA 4KDIC 2M4NA 5J18A 5LLIA 1A5RA 3IVFA 2MW5A 3A9JA 2JY6A 1RLFA 4W9CA 3ZNHB 2LVQA 4HDOA 2PEAA 1GJZA 2K25A 5L83A 1E8YA 4OVUA 2AL3A 4MSMB 4BVUC 1SE9A 2PE9A 3N3KB 3H6NA 4FA6A 4XC2A 4GU2A 3WAPA 4IM2A 3OJ3A 2IY1B 2D07B 3AI5A 3H7PA 3IBEA 4EZLA 2A4ZA 4DDGD 3VTVA 3RYTA 2NS5A 2AEHA 1E8WA 4ZRKA 2LWPA 5DCNA 3Q3JA 2BYVE 1EO6A 4GDKB 3T9LA 3W1YA 4BFRA 2JPHA 1WGYA 2KFKB 4MGIE 2FCSA 4DDID 2MA9B 2O6VA 2XK5A 1KLVA 2LJ5A 3PRPB 3ECIA 2NPTA 3A1QB 2EKEC 4GOCA 2L8JA 1P1AA 1WMHB 3Q3FA 2KOXA 4MGZE 2IBIB 3UINB 3OJ4B 2DX5B 5D7GA 3QWZB 1WJUA 1RRBA 2M17A 3NS8A 2JRIB 3NY5A 3JSVB 3EC8A 3ZRCA 4ANWA 4A3PA 3EECA 4IWPA 1WXSA 4II2B 1YD8U 2NVUI 4WJPA 2DYMA 1Q0WB 2N1VA 3PV1A 2LGXA 4WQOB 3PGEA 2RPQA 2IO2B 5G55A 2BPSA 4DK5A 2GOWA 4FN2A 1YQBA 1OGWA 3PHXB 3DQVA 3R66C 1TTNA 2KN5A 2ASQA 2BGFA 2PE6B 2KTRA 4DBGA 2VRRB 3JSVA 1V49A 4FADA 2JXXA 4W9JA 4BBNC 2C5LC 1TGZB 1E5WA 1WYWB 4WWPA 2KXJA 4MH0E 3VAWA 3TMPB 1P3QU 1LM8B 2C7NB 3EFUA 2MX2A 1YIWA 2LGYA 2MP2A 3IG3A 5DPSA 1WXAA 2D3GA 2MBEA 2MSED 3H1UA 3PPAA 2RD0A 4NJ6A 3ZUNA 4LDTB 4F7ZA 1V5TA 1XD3B 2B3AA 2J7QB 2D11A 1UH6A 2L00B 2L0TA 2LXCA 2JWZA 2N7EA 2PPHA 2R2QA 2LRWA 2Z0DB 3R3MA 3ZRFA 2V4LA 2WX0A 3T8MA 4FJVB 2L76A 2CHXA 1GC7A 1EF5A 3CF6E 1VD2A 4B95A 4BOSC 3VHTC 3DBHI 3S2AA 2KK8A 2LD9A 4E3CA 1UD7A 3HM3A 4LCDE 4RM8A 4CYEA 3ZIMA 1UELA 2JUOA 2KZRA 4X57B 1YJ1A 2I1JA 3DVNU 2JVCA 4DXAB 1C3TA 3APCA 3PLVA 3PRMB 4B6WA 2FNJB 2IYDB 1L2NA 1IP9A 3HIZA 3V62A 2D2QA 2LVOA 3RT3B 2LUEA 1J19A 3ZNZB 3L0WB 4FBJB 4IWOA 2DENB 3QX1A 3ZTDA 1WGDA 2J0JA 2LASA 2KHWB 4W9FA 2G3QB 5BO4B 3A33B 2IZVB 2ZEQA 2MBOA 5CHWA 4JGHB 5FR6A 4KSKC 2RR9A 2BF8B 4PYUA 2FAZA 2CS4A 3A9JB 2MRPA 2ZVOA 2ZVNA 4G50A 5LXHA 5DPWA 3VQIA 4WJQA 4DHJB 3W1SC 1OTRB 1LQBA 2K1FA 4KV2A 2C7MB 4J6IA 4G11A 3WALA 3PTFC 3P2BA 1WX9A 3AU4A 3B1LX 1ZGUB 2GMIC 3QJZA 1WM3A 4W9GA 1ZKHA 3C0RB 2WYQA 4F1SA 4FJZA 4MM3A 1WJNA 2BWES 5J17A 5E6OA 3U7DA 1G6JA 3HK0A 3V6CB 4ANUA 4DHZE 3H7PB 2D10A 4GGQA 4HVBA 5HKHA 1WFYA 2L05A 2LZ6A 3JVZX 3N30A 1V80A 4KZCA 3ALBA 1LXDA 4WJOA 1JRUA 4ZRIA 2KJHB 1M94A 4TV3A 2DZJA 4NQKE 3V6EB 2N1WA 3NOBA 2BKRB 3PLUA 2O6VB 4EUTA 2XK5B 2NPTB 4HLEA 4KVGB 4KIKA 3RD2A 3ZVVA 1I35A 4ICVA 4LJOB 1TZ1A 4K7SA 2UYZB 3KYDD 4LDTD 2CHZA 4EKUA 3PS6A 2WWZA 4BOZB 4K81A 2K8BA 1E7VA 3AXCA 1WGGA 5KHOA 1WH3A 1P98A 3WA0A 3RULA 2KLGA 2K6QA 4KSLC 3U30A 4WJNA 1WM2A 4GSWA 3SU8X 5JZEB 4KZ0A 5E6PA 1WZ3A 2ZPNA 4W9KA 2I1KA 2J0KA 4K7UA 2KWUB 3M95A 4GMVA 3RZWC 5CHFA 5E6NA 2KDEB 2K39A 2KMCA 4GXBA 4NJ7A 2KTRB 1KM7A 2L3ZA 1WJ4A 3TIXA 3CSTA 2KDFB 1XQQA 1TBEA 1Z2MA 1Q5WB 3KVFB 2ZNVC 1LFDA 2MP2B 3QAQA 1HE8A 3QARA 3MHSD 4DWFA 4FHJA 3ML9A 1OEYA 2ZJDA 4ICUA 3N32A 2FUHB 4FULA 1U4AA 2DZKA 2LGDA 2M0XA 4P7IA 1WX7A 3DBLI 4IM0A 3UGBB 1EUVB 2WDTB 3W1SA 3ZKJC 3PRZA 4MDKE 4GIVA 2MQJA 4IW0A 2V1YA 1GNUA 2CKHB 4MSQB 1UBQA 2DZMA 4MGYE 4JIOU 3RUIB 5TR5A 4EEWA 5D2MB 1AARA 3DOWA 2DYOA 5J2RA 1RFAA 4NAWA 4MEMA 1S1QB 2ZPYA 4ZDVA 4BKGA 1V5OA 2R2OA 1NBFC 3V60A 2XEWA 3DVGX 1J8CA 3ONSA 1UBIA 3ZDTA 3L16A 2LXAA 3UF8A 4BKSA 5EDSA 1L7YA 4PYZA 1IPGA 3KUCB 2KLCA 3ZDMC 2JT4B 2IO1B 4TQ1A 3NZSA 2CR5A 5GMVA 2N4FA 1F9JA 2DYBA 2REXA 3R7RA 2YLMA 5AZGA 2K8CA 2GBKA 2YVCA 3VDZA 4B9KA 4N9F4 5JHBA 1GG3A 3L17A 1D3ZA 1P9DU 3AULA 2JZ3B 2IO3B 1XT9B 1H8CA 3UIOB 3VH4B 2AYOB 1Y8RC 2L0FA 3A9KB 2ZNVB 2KANA 2CU1A 4AJWA 2N7DA 4FLHA 2KD0A 2O2VA 4HPMB 4CHKA 5IAAC 4AJYB 3KW5B 4FHKA 3VH3B 2MLBA 2MCNB 4HK2A 3ZNID 4HDQA 1OQYA 2DAJA 3APDA 3M3JA 4GN1A 1FXTB 3D32A 3L54A 3O65B 2KWVB 4I6NB 4NY0A 2NBUA 2MBQA 3CSFA 1Z5SB 1WGHA 2BYEA 3VTUA 3HM6X 4W9LA 1WI0A 3A9KA 3QA8A 2KNBA 3QC8B 1S3SG 3B08A 3VFKA 3X0WA 2GBJA 2FCMA 4A20A 1UGMA 2KDBA 1WR1A 2Z0EB 2C7HA 4IC7B 4AOFA 4KIKB 3LDZE 3RCZA 1Q1OA 2EMTA 3M62B 2CHWA 2ZCCA 1K8RB 2GBMA 2NBWB 2N9PC 2LI5A 2M8SA 4ASWC 3L08A 3DBSA 1BT0A 3VXWA 5AZHA 5C23A 3H7SA 2W9NA 3JYUA 4M8NA 3KH0A 2FIFA 4RMAA 3SDLC 1ISNA 2C9WB 4HCPB 2HD5B 2KKCA 2IY0B 3IFWB 4E71A 5IA7A 4BKTA 4FJYA 4GB9A 1YX5B 3K9OB 1QZEA 3A4RA 4XZ4A 2KC2A 4TQ0A 2ZCBA 1KJTA 4W9DA 1V81A 4AUQC 3U8ZA 2MBBB 2ZZPB 4GDLA 4TKNA 4NNJB 4EOYA 4W9IA 1SGHA 4MJSA 1WJ6A 2MBHA 1NDDA 1WXMA 3WANA 4I6PA 3PSEB 3L10B 1H4RA 2RGFA 2K8HA 2Z59B 4PS8A 2HJ8A 3DDCB 2WX1A 4EZKA 1E90A 3WAMA 4WAAA 1E8ZA 3DVNV 5D94A 3SHQA 2C60A 1J0GA 1WR6E 2G45B 1WF9A 4NAWB 3NZUA 3TL5A 5KHQA 3V61A 1X1MA 1WE7A 2KQ7A 2KTFA 1NI2A 3ZW3A 1WXVA 5JHAA 4IWQA 2XBBC 3ZNGC 2BYFA 3X23A 4BBNF 2KC1A 3I3TB 1WRDB 1IYFA 4M8MA 1WY8A 1WIAA 4ZRJA 1VCBA 3M63B 3PZDA 4EFOA 4W9HA 3AU5A 5CTRC 1UZXB 3VVWB 2BWFA 4WWOA 1R4MI 4DHJD 1MG8A 3CMMB 4M0WB 4NQLB 4GDKA 4IG7B 2KX0A 3PHWB 2BKFA 4G3XB 3ZO5B 1KOTA 2KFKA 1ZW7A 4NPNA 1SIFA 2IO0B 4TUUA 3A1QA 2L7RA 3OLMD 1WMHA 2KJRA 3WAOA 4HWIB 1RAXA 4F8CB 2KFJA 5AEKB 3GOEA 5G2NA 2Y5BB 5D6JB 4YL8A 5C1ZA 4LJPB 2KJ6A 2JF5A 2KO3A 3GZNI 2O2VB 5AZFA 4ZYNA 4AWJA 2OOBB 4W9EA 4E74A 1R4NI 4HPLB 2DHZA 4JLCA 3BY4B 1P0RA 2O6VD 4MELA 4RM9A 3JW0X 2N9EB 3TCAA 5L95C 1OEYJ 3PREA 5DPRA 3RZFA 1WX8A 3DPDA 3ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBN A;  5CX3 A;  2KQS A;  3KUZ A;  3L13 A;  2M1M A;  3BIN A;  5CHV C;  3DCG A;  2JRH A;  3KUD B;  4WWN A;  1T0Y A;  4IM3 A;  1CMX B;  1WE6 A;  1WZ0 A;  3MJW A;  2NCN A;  3SD5 A;  4ANX A;  5LXI B;  2G4S A;  1V9J A;  3UQA A;  3VTW A;  2AL6 A;  2KVR A;  2KWC A;  2PJH A;  1YX6 B;  2N9X A;  4MGK E;  3QIJ A;  3VUW A;  4DHZ B;  4HCN B;  2NBV B;  4EZJ A;  1V86 A;  2AWT A;  3K9P B;  3WIM A;  2RSU A;  2DAF A;  3B0A A;  3OAW A;  4KDL B;  3R7Q A;  4HXD A;  2LRU A;  2FCN A;  3APF A;  3ZTC A;  1I42 A;  3A4S C;  4PS7 A;  4PS3 A;  5DPT A;  2GBR A;  3DBR I;  4ANV A;  1E8X A;  3HHM A;  3VUX A;  3NHE B;  1EF1 A;  3TBL D;  2DZI A;  4JL9 A;  3TJP A;  1C1Y B;  2NR2 A;  1GUA B;  1V6E A;  4AP4 C;  2J0M A;  4K7W A;  3KYC D;  3ZLZ A;  4I6L B;  3UQB A;  4A3O A;  5JH5 C;  2FID A;  2QHO A;  2LVP A;  4IUM B;  2KX3 A;  2UWQ A;  2HTH A;  3QCA A;  4URK A;  3H9D A;  2V3S A;  4OVV A;  3QK0 A;  2KDI A;  3QHT A;  3MTN B;  4GDL B;  4BKS D;  3IHP C;  1E7U A;  2EMS A;  2HE7 A;  1PQS A;  4XX5 A;  3EHV A;  2MWS B;  2OJR A;  4G0N B;  2A5U A;  1GC6 A;  2G4D B;  4MJS B;  4II3 B;  3VUY A;  3DVG Y;  3ML8 A;  2FCQ A;  2KMA A;  4HJK A;  1WGR A;  4K1R B;  1V2Y A;  3UIP B;  4CO7 A;  3LJ3 A;  2K6D B;  3PT2 B;  2JZZ A;  3QQ8 B;  4JQW C;  3PVL A;  4KDI C;  2M4N A;  5J18 A;  5LLI A;  1A5R A;  3IVF A;  2MW5 A;  3A9J A;  2JY6 A;  1RLF A;  4W9C A;  3ZNH B;  2LVQ A;  4HDO A;  2PEA A;  1GJZ A;  2K25 A;  5L83 A;  1E8Y A;  4OVU A;  2AL3 A;  4MSM B;  4BVU C;  1SE9 A;  2PE9 A;  3N3K B;  3H6N A;  4FA6 A;  4XC2 A;  4GU2 A;  3WAP A;  4IM2 A;  3OJ3 A;  2IY1 B;  2D07 B;  3AI5 A;  3H7P A;  3IBE A;  4EZL A;  2A4Z A;  4DDG D;  3VTV A;  3RYT A;  2NS5 A;  2AEH A;  1E8W A;  4ZRK A;  2LWP A;  5DCN A;  3Q3J A;  2BYV E;  1EO6 A;  4GDK B;  3T9L A;  3W1Y A;  4BFR A;  2JPH A;  1WGY A;  2KFK B;  4MGI E;  2FCS A;  4DDI D;  2MA9 B;  2O6V A;  2XK5 A;  1KLV A;  2LJ5 A;  3PRP B;  3ECI A;  2NPT A;  3A1Q B;  2EKE C;  4GOC A;  2L8J A;  1P1A A;  1WMH B;  3Q3F A;  2KOX A;  4MGZ E;  2IBI B;  3UIN B;  3OJ4 B;  2DX5 B;  5D7G A;  3QWZ B;  1WJU A;  1RRB A;  2M17 A;  3NS8 A;  2JRI B;  3NY5 A;  3JSV B;  3EC8 A;  3ZRC A;  4ANW A;  4A3P A;  3EEC A;  4IWP A;  1WXS A;  4II2 B;  1YD8 U;  2NVU I;  4WJP A;  2DYM A;  1Q0W B;  2N1V A;  3PV1 A;  2LGX A;  4WQO B;  3PGE A;  2RPQ A;  2IO2 B;  5G55 A;  2BPS A;  4DK5 A;  2GOW A;  4FN2 A;  1YQB A;  1OGW A;  3PHX B;  3DQV A;  3R66 C;  1TTN A;  2KN5 A;  2ASQ A;  2BGF A;  2PE6 B;  2KTR A;  4DBG A;  2VRR B;  3JSV A;  1V49 A;  4FAD A;  2JXX A;  4W9J A;  4BBN C;  2C5L C;  1TGZ B;  1E5W A;  1WYW B;  4WWP A;  2KXJ A;  4MH0 E;  3VAW A;  3TMP B;  1P3Q U;  1LM8 B;  2C7N B;  3EFU A;  2MX2 A;  1YIW A;  2LGY A;  2MP2 A;  3IG3 A;  5DPS A;  1WXA A;  2D3G A;  2MBE A;  2MSE D;  3H1U A;  3PPA A;  2RD0 A;  4NJ6 A;  3ZUN A;  4LDT B;  4F7Z A;  1V5T A;  1XD3 B;  2B3A A;  2J7Q B;  2D11 A;  1UH6 A;  2L00 B;  2L0T A;  2LXC A;  2JWZ A;  2N7E A;  2PPH A;  2R2Q A;  2LRW A;  2Z0D B;  3R3M A;  3ZRF A;  2V4L A;  2WX0 A;  3T8M A;  4FJV B;  2L76 A;  2CHX A;  1GC7 A;  1EF5 A;  3CF6 E;  1VD2 A;  4B95 A;  4BOS C;  3VHT C;  3DBH I;  3S2A A;  2KK8 A;  2LD9 A;  4E3C A;  1UD7 A;  3HM3 A;  4LCD E;  4RM8 A;  4CYE A;  3ZIM A;  1UEL A;  2JUO A;  2KZR A;  4X57 B;  1YJ1 A;  2I1J A;  3DVN U;  2JVC A;  4DXA B;  1C3T A;  3APC A;  3PLV A;  3PRM B;  4B6W A;  2FNJ B;  2IYD B;  1L2N A;  1IP9 A;  3HIZ A;  3V62 A;  2D2Q A;  2LVO A;  3RT3 B;  2LUE A;  1J19 A;  3ZNZ B;  3L0W B;  4FBJ B;  4IWO A;  2DEN B;  3QX1 A;  3ZTD A;  1WGD A;  2J0J A;  2LAS A;  2KHW B;  4W9F A;  2G3Q B;  5BO4 B;  3A33 B;  2IZV B;  2ZEQ A;  2MBO A;  5CHW A;  4JGH B;  5FR6 A;  4KSK C;  2RR9 A;  2BF8 B;  4PYU A;  2FAZ A;  2CS4 A;  3A9J B;  2MRP A;  2ZVO A;  2ZVN A;  4G50 A;  5LXH A;  5DPW A;  3VQI A;  4WJQ A;  4DHJ B;  3W1S C;  1OTR B;  1LQB A;  2K1F A;  4KV2 A;  2C7M B;  4J6I A;  4G11 A;  3WAL A;  3PTF C;  3P2B A;  1WX9 A;  3AU4 A;  3B1L X;  1ZGU B;  2GMI C;  3QJZ A;  1WM3 A;  4W9G A;  1ZKH A;  3C0R B;  2WYQ A;  4F1S A;  4FJZ A;  4MM3 A;  1WJN A;  2BWE S;  5J17 A;  5E6O A;  3U7D A;  1G6J A;  3HK0 A;  3V6C B;  4ANU A;  4DHZ E;  3H7P B;  2D10 A;  4GGQ A;  4HVB A;  5HKH A;  1WFY A;  2L05 A;  2LZ6 A;  3JVZ X;  3N30 A;  1V80 A;  4KZC A;  3ALB A;  1LXD A;  4WJO A;  1JRU A;  4ZRI A;  2KJH B;  1M94 A;  4TV3 A;  2DZJ A;  4NQK E;  3V6E B;  2N1W A;  3NOB A;  2BKR B;  3PLU A;  2O6V B;  4EUT A;  2XK5 B;  2NPT B;  4HLE A;  4KVG B;  4KIK A;  3RD2 A;  3ZVV A;  1I35 A;  4ICV A;  4LJO B;  1TZ1 A;  4K7S A;  2UYZ B;  3KYD D;  4LDT D;  2CHZ A;  4EKU A;  3PS6 A;  2WWZ A;  4BOZ B;  4K81 A;  2K8B A;  1E7V A;  3AXC A;  1WGG A;  5KHO A;  1WH3 A;  1P98 A;  3WA0 A;  3RUL A;  2KLG A;  2K6Q A;  4KSL C;  3U30 A;  4WJN A;  1WM2 A;  4GSW A;  3SU8 X;  5JZE B;  4KZ0 A;  5E6P A;  1WZ3 A;  2ZPN A;  4W9K A;  2I1K A;  2J0K A;  4K7U A;  2KWU B;  3M95 A;  4GMV A;  3RZW C;  5CHF A;  5E6N A;  2KDE B;  2K39 A;  2KMC A;  4GXB A;  4NJ7 A;  2KTR B;  1KM7 A;  2L3Z A;  1WJ4 A;  3TIX A;  3CST A;  2KDF B;  1XQQ A;  1TBE A;  1Z2M A;  1Q5W B;  3KVF B;  2ZNV C;  1LFD A;  2MP2 B;  3QAQ A;  1HE8 A;  3QAR A;  3MHS D;  4DWF A;  4FHJ A;  3ML9 A;  1OEY A;  2ZJD A;  4ICU A;  3N32 A;  2FUH B;  4FUL A;  1U4A A;  2DZK A;  2LGD A;  2M0X A;  4P7I A;  1WX7 A;  3DBL I;  4IM0 A;  3UGB B;  1EUV B;  2WDT B;  3W1S A;  3ZKJ C;  3PRZ A;  4MDK E;  4GIV A;  2MQJ A;  4IW0 A;  2V1Y A;  1GNU A;  2CKH B;  4MSQ B;  1UBQ A;  2DZM A;  4MGY E;  4JIO U;  3RUI B;  5TR5 A;  4EEW A;  5D2M B;  1AAR A;  3DOW A;  2DYO A;  5J2R A;  1RFA A;  4NAW A;  4MEM A;  1S1Q B;  2ZPY A;  4ZDV A;  4BKG A;  1V5O A;  2R2O A;  1NBF C;  3V60 A;  2XEW A;  3DVG X;  1J8C A;  3ONS A;  1UBI A;  3ZDT A;  3L16 A;  2LXA A;  3UF8 A;  4BKS A;  5EDS A;  1L7Y A;  4PYZ A;  1IPG A;  3KUC B;  2KLC A;  3ZDM C;  2JT4 B;  2IO1 B;  4TQ1 A;  3NZS A;  2CR5 A;  5GMV A;  2N4F A;  1F9J A;  2DYB A;  2REX A;  3R7R A;  2YLM A;  5AZG A;  2K8C A;  2GBK A;  2YVC A;  3VDZ A;  4B9K A;  4N9F 4;  5JHB A;  1GG3 A;  3L17 A;  1D3Z A;  1P9D U;  3AUL A;  2JZ3 B;  2IO3 B;  1XT9 B;  1H8C A;  3UIO B;  3VH4 B;  2AYO B;  1Y8R C;  2L0F A;  3A9K B;  2ZNV B;  2KAN A;  2CU1 A;  4AJW A;  2N7D A;  4FLH A;  2KD0 A;  2O2V A;  4HPM B;  4CHK A;  5IAA C;  4AJY B;  3KW5 B;  4FHK A;  3VH3 B;  2MLB A;  2MCN B;  4HK2 A;  3ZNI D;  4HDQ A;  1OQY A;  2DAJ A;  3APD A;  3M3J A;  4GN1 A;  1FXT B;  3D32 A;  3L54 A;  3O65 B;  2KWV B;  4I6N B;  4NY0 A;  2NBU A;  2MBQ A;  3CSF A;  1Z5S B;  1WGH A;  2BYE A;  3VTU A;  3HM6 X;  4W9L A;  1WI0 A;  3A9K A;  3QA8 A;  2KNB A;  3QC8 B;  1S3S G;  3B08 A;  3VFK A;  3X0W A;  2GBJ A;  2FCM A;  4A20 A;  1UGM A;  2KDB A;  1WR1 A;  2Z0E B;  2C7H A;  4IC7 B;  4AOF A;  4KIK B;  3LDZ E;  3RCZ A;  1Q1O A;  2EMT A;  3M62 B;  2CHW A;  2ZCC A;  1K8R B;  2GBM A;  2NBW B;  2N9P C;  2LI5 A;  2M8S A;  4ASW C;  3L08 A;  3DBS A;  1BT0 A;  3VXW A;  5AZH A;  5C23 A;  3H7S A;  2W9N A;  3JYU A;  4M8N A;  3KH0 A;  2FIF A;  4RMA A;  3SDL C;  1ISN A;  2C9W B;  4HCP B;  2HD5 B;  2KKC A;  2IY0 B;  3IFW B;  4E71 A;  5IA7 A;  4BKT A;  4FJY A;  4GB9 A;  1YX5 B;  3K9O B;  1QZE A;  3A4R A;  4XZ4 A;  2KC2 A;  4TQ0 A;  2ZCB A;  1KJT A;  4W9D A;  1V81 A;  4AUQ C;  3U8Z A;  2MBB B;  2ZZP B;  4GDL A;  4TKN A;  4NNJ B;  4EOY A;  4W9I A;  1SGH A;  4MJS A;  1WJ6 A;  2MBH A;  1NDD A;  1WXM A;  3WAN A;  4I6P A;  3PSE B;  3L10 B;  1H4R A;  2RGF A;  2K8H A;  2Z59 B;  4PS8 A;  2HJ8 A;  3DDC B;  2WX1 A;  4EZK A;  1E90 A;  3WAM A;  4WAA A;  1E8Z A;  3DVN V;  5D94 A;  3SHQ A;  2C60 A;  1J0G A;  1WR6 E;  2G45 B;  1WF9 A;  4NAW B;  3NZU A;  3TL5 A;  5KHQ A;  3V61 A;  1X1M A;  1WE7 A;  2KQ7 A;  2KTF A;  1NI2 A;  3ZW3 A;  1WXV A;  5JHA A;  4IWQ A;  2XBB C;  3ZNG C;  2BYF A;  3X23 A;  4BBN F;  2KC1 A;  3I3T B;  1WRD B;  1IYF A;  4M8M A;  1WY8 A;  1WIA A;  4ZRJ A;  1VCB A;  3M63 B;  3PZD A;  4EFO A;  4W9H A;  3AU5 A;  5CTR C;  1UZX B;  3VVW B;  2BWF A;  4WWO A;  1R4M I;  4DHJ D;  1MG8 A;  3CMM B;  4M0W B;  4NQL B;  4GDK A;  4IG7 B;  2KX0 A;  3PHW B;  2BKF A;  4G3X B;  3ZO5 B;  1KOT A;  2KFK A;  1ZW7 A;  4NPN A;  1SIF A;  2IO0 B;  4TUU A;  3A1Q A;  2L7R A;  3OLM D;  1WMH A;  2KJR A;  3WAO A;  4HWI B;  1RAX A;  4F8C B;  2KFJ A;  5AEK B;  3GOE A;  5G2N A;  2Y5B B;  5D6J B;  4YL8 A;  5C1Z A;  4LJP B;  2KJ6 A;  2JF5 A;  2KO3 A;  3GZN I;  2O2V B;  5AZF A;  4ZYN A;  4AWJ A;  2OOB B;  4W9E A;  4E74 A;  1R4N I;  4HPL B;  2DHZ A;  4JLC A;  3BY4 B;  1P0R A;  2O6V D;  4MEL A;  4RM9 A;  3JW0 X;  2N9E B;  3TCA A;  5L95 C;  1OEY J;  3PRE A;  5DPR A;  3RZF A;  1WX8 A;  3DPD A;  3ENE A; 
#chains in the Genus database with same CATH topology
 1GAQ B;  2KQS A;  3R2I A;  4IM3 A;  1GPX A;  2G4S A;  1WRI A;  4DHZ B;  1FXA A;  1YX6 B;  3VRB B;  1JRP A;  2BBC A;  4LNN A;  2QC8 A;  2DAF A;  4HXD A;  1MJD A;  2PMV A;  4KKJ A;  5IN7 A;  1EWY C;  3HHM A;  2QCZ A;  3TBL D;  1IGD A;  3FIL B;  2WXH A;  1AN8 A;  2J0M A;  3KYC D;  4A3O A;  5JH5 C;  4XWW A;  2KX3 A;  4YTP B;  3H9D A;  4OVV A;  4GDL B;  3MTN B;  4MAC A;  2HE7 A;  3EHV A;  2MWS B;  4G0N B;  3ABV B;  2A5U A;  1GC6 A;  1HZ5 A;  4MJS B;  4II3 B;  3RN9 C;  3DVG Y;  3ML8 A;  4M02 A;  1YQ3 B;  3PVL A;  5IO9 A;  1A5R A;  2MW5 A;  2QIE B;  3A9J A;  2JY6 A;  4YTN B;  3ZNH B;  2LVQ A;  4HDO A;  2K25 A;  4WIP A;  3H8H A;  2AL3 A;  1L5P A;  2MJ3 A;  2J53 A;  1VJK A;  4YT0 B;  2BS2 B;  1WXQ A;  1A70 A;  3H6N A;  4NZL B;  1WGK A;  4D2K A;  2VH2 A;  2IY1 B;  4A6Q A;  3VTV A;  3RYT A;  2NS5 A;  2OED A;  5DCN A;  2BYV E;  1IUE A;  2JPH A;  4MGI E;  1YOV B;  1FRR A;  2XK5 A;  2LJ5 A;  4F8C B;  3ECI A;  3A1Q B;  1WMH B;  3Q3F A;  2KOX A;  3UIN B;  4XGA B;  4ARI A;  2WGS A;  2JRI B;  3JSV B;  1YD8 U;  3Q2A C;  2DYM A;  2EKI A;  5G55 A;  1SJH D;  2GOW A;  3P1M A;  2ASQ A;  2WQY B;  4FAD A;  2JXX A;  4BBN C;  1TGZ B;  1NYQ A;  4WWP A;  3HUI A;  3AMZ A;  1L0Y B;  2LGY A;  2TSS A;  2MSE D;  1TKE A;  4F7Z A;  1UH6 A;  4LJP B;  4KZC A;  3ZRF A;  2R2Q A;  1L6V A;  3R3M A;  2LRW A;  3T8M A;  4FJV B;  1E7P B;  3CF6 E;  1GC7 A;  3KLS X;  1VD2 A;  4B95 A;  3KQ4 A;  2DWQ A;  4KGT A;  3S2A A;  3ZQ4 A;  1FNW A;  1UD7 A;  4LNK A;  2FBW B;  3DBR B;  1UEL A;  2JUO A;  4X57 B;  2PTL A;  1C3T A;  3APC A;  2INN E;  1L2N A;  4LTU A;  3RT3 B;  1J19 A;  1HZ6 A;  3ZTD A;  2J0J A;  2G3Q B;  3A33 B;  2FE8 A;  2IZV B;  2ZEQ A;  5FR6 A;  3MC9 A;  4KSK C;  4XE0 A;  4DXG A;  2MRP A;  2MJE A;  3AEF B;  5DPW A;  4DHJ B;  4RF1 A;  1QQR A;  1XF5 L;  1TKG A;  3AEB B;  3B1L X;  1C77 A;  1WM3 A;  2WXP A;  4F1S A;  2BWE S;  3HK0 A;  4K3B A;  2AX5 A;  3OWE B;  3B9J A;  2LZ6 A;  3JVZ X;  3URY A;  1J7B A;  4ZRI A;  4A9A A;  2O6V B;  2Y5P A;  4HLE A;  4ICV A;  4K7S A;  3KYD D;  4BZA A;  3PS6 A;  4DXF A;  4BOZ B;  2K8B A;  2J42 A;  4KSL C;  4L1B A;  4WJN A;  1WM2 A;  3SU8 X;  1WZ3 A;  5E6J A;  3M95 A;  4GMV A;  4XYC A;  4NJ7 A;  5GXG B;  1KM7 A;  2GB1 A;  4LK0 M;  1WJ4 A;  3RNC C;  3TIX A;  1XQQ A;  1Z2M A;  1Q5W B;  1TY0 A;  3KVF B;  1HE8 A;  3MHS D;  4FHJ A;  1CJE A;  2ZJD A;  3DBL B;  4ICU A;  3LXF A;  3N32 A;  2FUH B;  4FUL A;  2LGD A;  1WX7 A;  4LNI A;  5LNK 1;  4IM0 A;  1EUV B;  1Q10 A;  2BS3 B;  4US8 A;  2WDT B;  3ZKJ C;  1F0Z A;  4AQ7 A;  4MSQ B;  5TR5 A;  5D2M B;  3DOW A;  5J2R A;  2M19 A;  4NAW A;  4MEM A;  4ZDV A;  1YN4 A;  2DLB A;  2JX5 A;  2QJL A;  3AE6 B;  2R2O A;  2NTT A;  1NBF C;  2LMC A;  3GE8 C;  2W55 A;  3ONS A;  3DBH B;  1UBI A;  2VZK D;  2Y5C A;  3ZDT A;  4BKS A;  2IDY A;  5EDS A;  1L7Y A;  1HEZ E;  1I4P A;  4USA A;  1TIF A;  2WXO A;  1ZXI A;  3TEW A;  2CR5 A;  5GMV A;  2N4F A;  3N1Y C;  1F9J A;  1NEK B;  1JRO A;  1QKZ A;  1BXT A;  4B9K A;  2JZ3 B;  1H8C A;  3VH4 B;  2AYO B;  2CU1 A;  2IGG A;  5IP4 D;  3ZGZ A;  2N7D A;  2PW9 A;  5AUK A;  2O2V A;  3ZJT A;  3U2S C;  5FK9 C;  4HK2 A;  4MM3 B;  3M3J A;  2SEB D;  3D32 A;  2KWV B;  2NBU A;  2MBQ A;  3VTU A;  4RGO S;  2VH1 A;  1WI0 A;  3A9K A;  1YNT E;  1S3S G;  3B08 A;  3VFK A;  1UGM A;  2KDB A;  1WR1 A;  2C7H A;  3DHG C;  4KIK B;  3N1X C;  2ZCC A;  1MVK A;  4ZRQ A;  1V8C A;  2NBW B;  4ZYS A;  2WLB A;  4RGT A;  5C23 A;  4A55 A;  1QF6 A;  1ZXH A;  1XCT L;  3KH0 A;  2FIF A;  4HCP B;  3R8B A;  1UWM A;  2KKC A;  4E71 A;  1QOB A;  5IA7 A;  4GB9 A;  1YX5 B;  1UWX A;  1TS5 A;  3A4R A;  3AH7 A;  1E6E B;  3RI7 C;  1MG4 A;  4AUQ C;  3U8Z A;  2ZZP B;  4FXC A;  4TKN A;  5IOI A;  2MBH A;  1NDD A;  1C78 A;  3WAN A;  3L10 B;  2Y3A A;  1K52 A;  3VR8 B;  1E90 A;  1JQ4 A;  5D94 A;  3SHQ A;  2WXM A;  1YN3 A;  2GLS A;  3TEZ A;  4RGM A;  1NI2 A;  4YXD B;  1KFY B;  4JWS C;  2ICI A;  3Q3O C;  2QMT A;  4EFO A;  3AU5 A;  5CTR C;  3VVW B;  4WWO A;  1MG8 A;  4GDK A;  2KX0 A;  5BYQ A;  4NPN A;  1ZW7 A;  2JYE A;  1F2R I;  2MH7 A;  4M0W A;  2L7R A;  4UDU C;  5EE9 A;  4YL8 A;  2JF5 A;  4P1C C;  4AWJ A;  4W9E A;  4E74 A;  3DHH C;  1HTQ A;  2V3N A;  2N9E B;  5DPR A;  3RZF A;  4W9C A;  3MJW A;  3NVW A;  5LXI B;  1JWA D;  5CX3 A;  3AN1 A;  3SEB A;  3BYT B;  2M1M A;  2B76 B;  1FRD A;  4BAX A;  2JRH A;  3L4P A;  4WWN A;  3SD5 A;  2WDR B;  2KVR A;  2D5G A;  3ZJV A;  2NBV B;  1V86 A;  5G5H A;  1TJE A;  3A4S C;  5DPT A;  1IBX A;  2GBR A;  3E9S A;  4ANV A;  1JWB D;  1RYJ A;  3RMK C;  4JL9 A;  1C1Y B;  1V6E A;  4K7W A;  1LGR A;  2QHO A;  1F52 A;  2LVP A;  4IUM B;  1MHX A;  4URK A;  1ZDX A;  2N9L A;  2V3S A;  4RFB A;  3QK0 A;  2KDI A;  4YTM B;  4BKS D;  3IHP C;  2EMS A;  4XX5 A;  1PQS A;  1TS2 A;  4HRO A;  3VUY A;  1KF6 B;  3DWG C;  2G4D B;  1ZP0 B;  2FCQ A;  2KYW A;  3KWL A;  4K1R B;  4XDC A;  3UIP B;  1PGA A;  4L23 A;  1L4Z B;  2M4N A;  3P63 A;  4KDI C;  5J18 A;  3IVF A;  3BK2 A;  5L83 A;  4OVU A;  3IT6 B;  3ZJU A;  3BVG A;  1QOA A;  4MSM B;  2PE9 A;  4FA6 A;  4IOI E;  3EA6 A;  2I38 A;  1UNS A;  1FCC C;  2AEH A;  4ZRK A;  2LWP A;  2KVZ A;  1EO6 A;  3T9L A;  3V05 A;  3W1Y A;  5D3D A;  4BFR A;  2KFK B;  2MA9 B;  1KLV A;  3N1Z C;  4ZRP A;  2NPT A;  2DX5 B;  4GLS C;  3QWZ B;  1WJU A;  1WWT A;  1RRB A;  3NY5 A;  1C4C A;  4A3P A;  4NJC A;  4HPP A;  1XLP A;  3UI3 A;  4IWP A;  1XLO A;  2OJW A;  4WJP A;  1FNU A;  1YJJ A;  5EE3 A;  3OG5 A;  1Q0W B;  2JU6 X;  3PGE A;  2RPQ A;  2BPS A;  1YQB A;  3J9C A;  3NRZ A;  3PHX B;  1TTN A;  1XXG A;  2KN5 A;  3GZN B;  4RCO A;  1V49 A;  1I4Q A;  2C5L C;  4WQM A;  3VAW A;  2KT7 A;  2C7N B;  3Q3N C;  3IG3 A;  2M0A A;  1SE4 A;  2V3P A;  3NZ3 A;  4KX6 B;  1V5T A;  1XD3 B;  3GB1 A;  2LXC A;  1FEH A;  2PPH A;  5D3I B;  2WXQ A;  2L76 A;  2CHX A;  5C2T B;  2K9X A;  2KN4 A;  2QIL A;  5MPO A;  1C9F A;  4LCD E;  4RM8 A;  1SB3 C;  2R61 A;  4CYE A;  1F1H A;  3KWV A;  1N61 A;  4M01 A;  3DVN U;  3EGR A;  3PRM B;  4J3O D;  4HJG E;  1AYF A;  2D2Q A;  3ZNZ B;  3L0W B;  3O13 A;  4FBJ B;  2MHJ A;  4IWO A;  5BYR A;  5BO4 B;  2LAS A;  2KHW B;  3LYY A;  4N6E B;  4IKG A;  2KAJ A;  2BF8 B;  2H89 B;  2FAZ A;  2CS4 A;  1PGB A;  5LXH A;  4YSZ B;  3W1S C;  2K1F A;  2JXT A;  1N6Z A;  1PGX A;  4KV2 A;  4J6I A;  2CJN A;  3AU4 A;  4ZHO A;  1ZGU B;  2GMI C;  1WJN A;  3U7D A;  5FKA C;  4ANU A;  4DHZ E;  3H7P B;  4GGQ A;  5HKH A;  1WFY A;  1LXD A;  4WJO A;  2DZJ A;  3V6E B;  3FKY A;  2E6X A;  2IGH A;  3HRD D;  4ITK A;  2WHI A;  4LNF A;  4TMA B;  1TZ1 A;  2UYZ B;  4LDT D;  2CHZ A;  2WWZ A;  4P1B C;  1D4B A;  1E7V A;  4LLG M;  5KHO A;  2QDF A;  3WA0 A;  2K6Q A;  3U30 A;  3CIR B;  2WU5 B;  5E6P A;  2I2Y A;  2LHD A;  2J0K A;  2KWU B;  2DBY A;  2KTR B;  2L3Z A;  1QLB B;  1FMA D;  1SIJ A;  1NEN B;  3SFD B;  2AQ2 B;  1V97 A;  1LFD A;  2MP2 B;  4DWF A;  4RGN A;  3AV8 A;  1NYR A;  2WDQ B;  4P7I A;  5JXV A;  1PFD A;  1TZO A;  1D5Z C;  2DZM A;  1CQV A;  4EEW A;  1N63 A;  2KQ4 X;  1RFA A;  3IT4 B;  1S1Q B;  2ZPY A;  1GOZ A;  4BKG A;  1V5O A;  1E10 A;  3DVG X;  1K50 A;  1QOG A;  3BZD B;  1VZ7 A;  3P42 A;  3KUC B;  1L0V B;  2IO1 B;  4TQ1 A;  3NZS A;  3N20 C;  2DYB A;  2K0P A;  3R7R A;  4N59 A;  1STE A;  2YLM A;  2K8C A;  2GBK A;  3VDZ A;  5JHB A;  1ZDV A;  2CU3 A;  3I63 C;  3A9K B;  2ZNV B;  3RNG C;  4HPM B;  5G5G A;  1T0R C;  3KW5 B;  4FHK A;  2KMM A;  2MCN B;  1YMH E;  3ZNI D;  1OQY A;  2DAJ A;  1JCK B;  3RNF C;  1VDV A;  2D3B A;  1ZUD 2;  3CSF A;  1WGH A;  2BYE A;  4W9L A;  1KLU D;  2KNB A;  1XO3 A;  1V1P B;  4YSX B;  3NS1 A;  3VRA B;  1J7C A;  3X0W A;  2GBJ A;  2IND C;  4DQO C;  4R3D A;  3LDZ E;  1L6U A;  1Q1O A;  3M62 B;  2CHW A;  2ON8 A;  4ASW C;  4RH6 A;  3DBS A;  1ZPS A;  1RM6 C;  3JYU A;  3FIL A;  4US9 A;  2HD5 B;  4P6V F;  2IY0 B;  4FJY A;  3K9O B;  4WWM A;  3AEC B;  1N62 A;  1V81 A;  4W9D A;  2L32 A;  1FXI A;  3GP7 A;  2MBB B;  4GDL A;  2WXI A;  2PKO A;  1B1Z A;  3MFG A;  4EOY A;  1DOI A;  1SGH A;  4MJS A;  4WH4 A;  4QAY A;  1WXM A;  4I6P A;  1D5M C;  2RGF A;  2Z59 B;  1L0X B;  1VZ8 A;  2KWD A;  3DDC B;  4EZK A;  1MPE A;  3AE7 B;  3WAM A;  4WAA A;  2Z8L A;  1J0G A;  2G45 B;  5HI1 A;  2RDB C;  1CK1 A;  5TSS A;  5KHQ A;  1X1M A;  2KQ7 A;  3ZW3 A;  2ZW0 A;  4IWQ A;  4Q2J A;  5HFY A;  2KC1 A;  2N7J A;  1IYF A;  4M8M A;  3NG0 A;  2WXR A;  1WIA A;  3ZXV A;  3PZD A;  4NQL B;  4IG7 B;  5HHD G;  2BKF A;  3AEG B;  1MFW A;  1KOT A;  5BMI A;  3VR9 B;  1SIF A;  2IO0 B;  1NVI D;  3A1Q A;  1WMH A;  3N9Y C;  1DOX A;  2CJO A;  5AEK B;  1DGJ A;  3GOE A;  2Y5B B;  5D6J B;  1B9R A;  1E0Z A;  5AZF A;  5EE1 A;  2OOB B;  1R4N I;  4OVZ A;  1TY2 A;  1JW9 D;  4RM9 A;  3TCA A;  5L95 C;  1WX8 A;  3ENE A;  2GBN A;  3KUZ A;  5CHV C;  3DCG A;  3KUD B;  1T0Y A;  3MP9 A;  1CMX B;  4ANX A;  3RPF C;  3VTW A;  3IAM 1;  2AL6 A;  2N9X A;  4MGK E;  3QIJ A;  4C4V B;  3K9P B;  3WIM A;  2RSU A;  2IGD A;  3OAW A;  3R7Q A;  2LRU A;  3HVZ A;  2FCN A;  3APF A;  3ZTC A;  1JAL A;  3DBR I;  1VZ6 A;  3NHE B;  3PZ8 A;  2DZI A;  1LO5 D;  3TJP A;  4ZHP A;  3DWM A;  3UQB A;  2FID A;  3NVZ A;  2HTH A;  1GB1 A;  3EUB 2;  1TS4 A;  3BWU D;  3ZYY X;  2RPV A;  1WGR A;  3LJ3 A;  2K6D B;  5FR3 A;  5LLI A;  1BML C;  4ARC A;  1EU3 A;  3Q8A A;  1E8Y A;  3C8Y A;  3FAH A;  4BVU C;  1R7S A;  5H92 C;  1SE9 A;  4GU2 A;  4XDD A;  3WAP A;  4IM2 A;  2QEJ C;  2D07 B;  2JQR B;  3AI5 A;  2XNA C;  1QOF A;  3Q3J A;  2FCS A;  2O6V A;  1P1A A;  2IBI B;  5D7G A;  4HKQ A;  2M17 A;  3AEE B;  3NS8 A;  2JSV X;  1YQ4 B;  3AED B;  3ZRC A;  3EC8 A;  2BB6 A;  1WXS A;  1PDX A;  3PV1 A;  3P4R B;  2LGX A;  1HXY D;  4WQO B;  2IO2 B;  1FPY A;  2UU7 A;  1XLQ A;  3PZ7 A;  1Y56 A;  1C76 A;  1RWS A;  2VRR B;  4W9J A;  1WYW B;  1E5W A;  2WXN A;  3TMP B;  1T0Q C;  2KDM A;  2MBE A;  3PPA A;  2RD0 A;  2PVG C;  2B3A A;  2J7Q B;  4O1N A;  2D11 A;  2L00 B;  2JWZ A;  2Z0D B;  3IAS 1;  2V4L A;  2WX0 A;  1EF5 A;  3DBH I;  4MT5 A;  2D3C A;  3CWI A;  3Q8C A;  2N0S B;  2LD9 A;  3AE4 B;  3HM3 A;  1SXT A;  3ZIM A;  2KZR A;  2L83 A;  1EWC A;  1C79 A;  4DXA B;  1T0S C;  2V4I B;  4B6W A;  3HIZ A;  1E9M A;  5AUI A;  2LUE A;  3PO0 A;  3TEY A;  4MH8 A;  1OFF A;  3QX1 A;  1FFU A;  4W9F A;  3RNA C;  4C80 A;  3I5J C;  2MEK A;  1JWU D;  5CHW A;  3MC8 A;  4PYU A;  3A9J B;  2ZVN A;  4G50 A;  2ACZ B;  3VQI A;  4WJQ A;  1OTR B;  1LQB A;  3PTF C;  1F77 A;  3U52 E;  3R2T A;  3V3X A;  4W9G A;  1ZKH A;  2WYQ A;  3HVD A;  4MM3 A;  5E6O A;  2VZK B;  2K5P A;  3V6C B;  4EE2 A;  2D10 A;  4HVB A;  1TYG B;  3N30 A;  1SF0 A;  4ACF A;  1V80 A;  4S0R A;  4WUR A;  4NQK E;  2N1W A;  2GRI A;  3PLU A;  1EU4 A;  2XK5 B;  4KIK A;  3ZVV A;  2QSD A;  2JWU A;  4LJO B;  2W54 A;  1T3Q A;  3I9V 1;  2YEP F;  1TT5 B;  3AXC A;  1WGG A;  1DYQ A;  3AE5 B;  4KZ0 A;  4W9K A;  2I1K A;  1N5X A;  4C7Y A;  1FD6 A;  4K7U A;  5CHF A;  4PK1 A;  2KDE B;  2K39 A;  2KMC A;  4XWT A;  3NUH B;  2KDF B;  1TBE A;  4N58 A;  2ZNV C;  3QAR A;  3ML9 A;  1PUT A;  2DZK A;  4H2A A;  3PRZ A;  4GIV A;  2JYT A;  1RFK A;  4IW0 A;  1GNU A;  4MGY E;  4K3C A;  3W5U B;  1FCL A;  1SJE D;  4OZB A;  1J7A A;  2K3U A;  3T3O A;  1L4D B;  3MC0 B;  1J8C A;  3L16 A;  2LXA A;  3UF8 A;  3W5V B;  1IPG A;  1I4X A;  2KLC A;  2JT4 B;  2LUM A;  5AZG A;  2YVC A;  3I57 A;  3TUO A;  1CZP A;  4PT5 A;  5IKC M;  1P9D U;  3NJT A;  3AUL A;  1XT9 B;  3UIO B;  1FIQ A;  1T6B X;  2L0F A;  4AJW A;  5H8Y E;  2KD0 A;  4CHK A;  5IAA C;  3VH3 B;  3T3N A;  1ET6 A;  1FM0 D;  2LGI A;  1QIL A;  3APD A;  1FXT B;  3L54 A;  3BII D;  4NY0 A;  1Z5S B;  2BYT A;  3HM6 X;  2IPK D;  1BUI C;  3QC8 B;  1FFV A;  2FCM A;  5T8I A;  4A20 A;  2Z0E B;  1XEE A;  4IC7 B;  1AWD A;  3RCZ A;  2EMT A;  5BYS A;  1IGC A;  1C4P A;  2M8S A;  2J4X A;  3L08 A;  3U7Z A;  2M56 B;  3C19 A;  1BT0 A;  2K22 A;  5AZH A;  2INC C;  3Q3M C;  1ISN A;  2C9W B;  1F2R C;  3IFW B;  4BKT A;  3NVY A;  1QZE A;  4XZ4 A;  2ZCB A;  1KJT A;  4P16 A;  3P4Q B;  4OZC A;  2WS3 B;  4NNJ B;  4W9I A;  1H4R A;  2K8H A;  4PS8 A;  2LFI A;  2WX1 A;  4L2Y A;  1E8Z A;  2C60 A;  2BS4 B;  3GS2 A;  4KKI A;  1HTO A;  4NAW B;  4OHJ A;  2LGS A;  2KTF A;  2XBB C;  3ZNG C;  2BYF A;  4BBN F;  4ZRJ A;  3M63 B;  4W9H A;  1UZX B;  1R4M I;  1SEB D;  1I4H A;  2G1E A;  3PHW B;  2BVC A;  2KFK A;  2WXJ A;  3MHZ A;  2W82 A;  4TUU A;  3OLM D;  2LJI A;  2HJ1 A;  1FO4 A;  2J52 A;  1SBB B;  2KFJ A;  4HRS A;  3AE3 B;  5G2N A;  1R4N B;  2RDG A;  2KJ6 A;  3GZN I;  1N60 A;  2O2V B;  3SR6 A;  1HA5 A;  1P0R A;  4MEL A;  3JW0 X;  1OEY J;  3DPD A;  2ONQ A;  2W3S A;  4C56 C;  3L13 A;  3BIN A;  2XN9 C;  2X38 A;  1PYW D;  1WE6 A;  1WZ0 A;  2YEP B;  2NCN A;  2WU2 B;  3RNE C;  2AQ1 B;  1V9J A;  3UQA A;  3VUW A;  2KWC A;  2PJH A;  4EZJ A;  2WNM A;  3W2D A;  4HCN B;  5EE0 A;  2AWT A;  2BQQ A;  3B0A A;  3E56 A;  4KDL B;  1I42 A;  1I4G A;  4PS7 A;  4PS3 A;  1E8X A;  1KRH A;  3VUX A;  1EF1 A;  1ZOY B;  2NR2 A;  3AEA B;  1ZE3 D;  1GUA B;  4AP4 C;  1DOY A;  2HTM E;  3ZLZ A;  4RNA A;  4I6L B;  2UWQ A;  3QCA A;  2IJ0 A;  3QHT A;  1E7U A;  1TKY A;  2OJR A;  2KMA A;  4HJK A;  1V2Y A;  4CO7 A;  3PT2 B;  2JZZ A;  3QQ8 B;  4JQW C;  3B2F A;  5BMH A;  1RLF A;  2PEA A;  1GJZ A;  1V1O A;  2FUG 1;  2WP9 B;  3TEX A;  2PLP A;  3AE8 B;  1KLG D;  2WXF A;  3N3K B;  4XC2 A;  3OJ3 A;  3H7P A;  3IBE A;  4EZL A;  2A4Z A;  4NAM A;  4DDG D;  5BMG A;  3Q14 C;  2V9H A;  3Q8F A;  1E8W A;  3RNB C;  4GDK B;  4B0M A;  1WGY A;  4DDI D;  4GOC A;  3PRP B;  4M0W B;  2EKE C;  4MGZ E;  2L8J A;  1M4V A;  3OJ4 B;  3B2G A;  2G9H D;  4ANW A;  3EEC A;  4WAF A;  3IXS A;  4II2 B;  3EFC A;  2NVU I;  2PIA A;  4C00 A;  2N1V A;  4JPS A;  1P7E A;  4DK5 A;  4FN2 A;  1OGW A;  1WSP A;  3DQV A;  3R66 C;  2GI9 A;  2BGF A;  2PE6 B;  2KTR A;  4DBG A;  3JSV A;  2BT6 A;  3AM9 A;  2KXJ A;  4MH0 E;  1P3Q U;  1LM8 B;  3EFU A;  2MX2 A;  1YIW A;  2MP2 A;  2SAK A;  5DPS A;  1WXA A;  2D3G A;  1UUP A;  1VR9 A;  3H1U A;  4NJ6 A;  3ZUN A;  4LDT B;  1GB4 A;  4KGS A;  2N7E A;  2L0T A;  1VLB A;  1IBX B;  2BB5 A;  4KGR A;  4B0E A;  1NI3 A;  4BOS C;  3VHT C;  1SE2 A;  2KK8 A;  5I4D A;  4E3C A;  1UF0 A;  1QT9 A;  1VRA B;  1XCQ L;  1YJ1 A;  2I1J A;  4HEA 1;  1P7F A;  2JVC A;  1HQR D;  3PLV A;  2FNJ B;  2IYD B;  3ZXR A;  3V62 A;  2LVO A;  2E3T A;  3P4S B;  1SE3 A;  1MHH E;  2DEN B;  1WGD A;  3FC4 A;  2NTS A;  2H88 B;  2MBO A;  2WXK A;  1OQR A;  1ENF A;  4JGH B;  2RR9 A;  2ZVO A;  2Q5W D;  3BVM A;  3Q6B A;  4ZOH C;  2BW2 A;  3W9C B;  2C7M B;  3AE1 B;  4G11 A;  3WAL A;  3P2B A;  1WX9 A;  3QJZ A;  5C3J B;  3C0R B;  3WCQ A;  5J17 A;  4FJZ A;  4OW0 A;  1G6J A;  1K51 A;  2RMM A;  3BVZ A;  3AE9 B;  1MI0 A;  1YN5 A;  2L05 A;  3TSS A;  3ALB A;  1JRU A;  1V1P A;  1M94 A;  2KJH B;  4HKZ E;  2WDV B;  4TV3 A;  4S17 A;  3NOB A;  2BKR B;  4EUT A;  2NPT B;  2HDE A;  4KVG B;  3RD2 A;  1I35 A;  3AB5 A;  4EKU A;  4K81 A;  2LHE A;  1C4A A;  2NMQ A;  2PVO D;  2D3A A;  2LEK A;  1WH3 A;  1P98 A;  1XLN A;  3RUL A;  2KLG A;  3Q8B A;  4GSW A;  5JZE B;  2ZPN A;  1T5X D;  3RZW C;  5E6N A;  3Q69 A;  4GXB A;  4JE3 B;  1KH0 A;  4OZA A;  3GE3 C;  3CST A;  4RF0 A;  2OHF A;  4IDI A;  3QAQ A;  1OEY A;  1U4A A;  2M0X A;  3DBL I;  5HG2 A;  3UGB B;  2L1A A;  3W1S A;  4MDK E;  2MQJ A;  2V1Y A;  1D5X C;  2CKH B;  1IP9 A;  1UBQ A;  3RUI B;  4JIO U;  1AAR A;  2DYO A;  1D6E C;  1JWM D;  2DNF A;  3Q8E A;  3DHI C;  4CQN A;  3V60 A;  2XEW A;  2EEL A;  1OQQ A;  4TSS A;  4PYZ A;  3ZDM C;  1UGJ A;  2BTE A;  2REX A;  4JWU C;  4N9F 4;  1FNV A;  1GG3 A;  3L17 A;  1D3Z A;  1KTK A;  2IO3 B;  2WXL A;  2INP E;  3LB8 C;  1Y8R C;  3BK1 A;  1ET9 A;  2N9K A;  2KAN A;  4FLH A;  4AJY B;  4A8X C;  2MLB A;  2KAC A;  1ESF A;  4HDQ A;  3SFE B;  2ZW1 A;  4GN1 A;  3AE2 B;  2V0G A;  3O65 B;  4I6N B;  1WYG A;  3QA8 A;  1I4R A;  2RDH A;  1JWS D;  4AOF A;  1K8R B;  2GBM A;  4C4V A;  2N9P C;  4YSY B;  2LI5 A;  3P4P B;  4REZ A;  3VXW A;  3ETR A;  3NVV A;  4YWG G;  1ACC A;  2W9N A;  3H7S A;  4JX1 C;  4M8N A;  4RMA A;  3SDL C;  1YJI A;  4A90 A;  1AW7 A;  3U4E G;  2KC2 A;  4TQ0 A;  1ROE A;  2X8X X;  4AS1 A;  1WJ6 A;  3BYY B;  3PSE B;  2HJ8 A;  2AQ3 B;  3MJ5 A;  3DVN V;  1WR6 E;  1JML A;  1WF9 A;  2W3R A;  3NZU A;  3TL5 A;  3V61 A;  1WE7 A;  1WXV A;  2L52 A;  5JHA A;  1EM7 A;  1K53 A;  3X23 A;  1N5W A;  3I3T B;  1WRD B;  1R4M B;  1WY8 A;  3RFZ B;  1VCB A;  2WXG A;  2BWF A;  4DHJ D;  3CMM B;  4G3X B;  3ZO5 B;  1SSN A;  2KJR A;  3WAO A;  4HWI B;  1RAX A;  4M00 A;  5C1Z A;  1TS3 A;  2KO3 A;  4ZYN A;  2JZP A;  4C7Z A;  4HPL B;  2MJD A;  2DHZ A;  4JLC A;  3BY4 B;  1I7H A;  2O6V D;  4LNO A;  3PRE A; 
#chains in the Genus database with same CATH homology
 2GBN A;  5CX3 A;  2KQS A;  3KUZ A;  3L13 A;  2M1M A;  3BIN A;  5CHV C;  3DCG A;  2JRH A;  3KUD B;  4WWN A;  1T0Y A;  4IM3 A;  1CMX B;  1WE6 A;  1WZ0 A;  3MJW A;  2NCN A;  3SD5 A;  4ANX A;  5LXI B;  2G4S A;  1V9J A;  3UQA A;  3VTW A;  2AL6 A;  2KVR A;  2KWC A;  2PJH A;  1YX6 B;  2N9X A;  4MGK E;  3QIJ A;  3VUW A;  4DHZ B;  4HCN B;  2NBV B;  4EZJ A;  1V86 A;  2AWT A;  3K9P B;  3WIM A;  2RSU A;  2DAF A;  3B0A A;  3OAW A;  4KDL B;  3R7Q A;  4HXD A;  2LRU A;  2FCN A;  3APF A;  3ZTC A;  1I42 A;  3A4S C;  4PS7 A;  4PS3 A;  5DPT A;  2GBR A;  3DBR I;  4ANV A;  1E8X A;  3HHM A;  3VUX A;  3NHE B;  1EF1 A;  3TBL D;  2DZI A;  4JL9 A;  3TJP A;  1C1Y B;  2NR2 A;  1GUA B;  1V6E A;  4AP4 C;  2J0M A;  4K7W A;  3KYC D;  3ZLZ A;  4I6L B;  3UQB A;  4A3O A;  5JH5 C;  2FID A;  2QHO A;  2LVP A;  4IUM B;  2KX3 A;  2UWQ A;  2HTH A;  3QCA A;  4URK A;  3H9D A;  2V3S A;  4OVV A;  3QK0 A;  2KDI A;  3QHT A;  3MTN B;  4GDL B;  4BKS D;  3IHP C;  1E7U A;  2EMS A;  2HE7 A;  1PQS A;  4XX5 A;  3EHV A;  2MWS B;  2OJR A;  4G0N B;  2A5U A;  1GC6 A;  2G4D B;  4MJS B;  4II3 B;  3VUY A;  3DVG Y;  3ML8 A;  2FCQ A;  2KMA A;  4HJK A;  1WGR A;  4K1R B;  1V2Y A;  3UIP B;  4CO7 A;  3LJ3 A;  2K6D B;  3PT2 B;  2JZZ A;  3QQ8 B;  4JQW C;  3PVL A;  4KDI C;  2M4N A;  5J18 A;  5LLI A;  1A5R A;  3IVF A;  2MW5 A;  3A9J A;  2JY6 A;  1RLF A;  4W9C A;  3ZNH B;  2LVQ A;  4HDO A;  2PEA A;  1GJZ A;  2K25 A;  5L83 A;  1E8Y A;  4OVU A;  2AL3 A;  4MSM B;  4BVU C;  1SE9 A;  2PE9 A;  3N3K B;  3H6N A;  4FA6 A;  4XC2 A;  4GU2 A;  3WAP A;  4IM2 A;  3OJ3 A;  2IY1 B;  2D07 B;  3AI5 A;  3H7P A;  3IBE A;  4EZL A;  2A4Z A;  4DDG D;  3VTV A;  3RYT A;  2NS5 A;  2AEH A;  1E8W A;  4ZRK A;  2LWP A;  5DCN A;  3Q3J A;  2BYV E;  1EO6 A;  4GDK B;  3T9L A;  3W1Y A;  4BFR A;  2JPH A;  1WGY A;  2KFK B;  4MGI E;  2FCS A;  4DDI D;  2MA9 B;  2O6V A;  2XK5 A;  1KLV A;  2LJ5 A;  3PRP B;  3ECI A;  2NPT A;  3A1Q B;  2EKE C;  4GOC A;  2L8J A;  1P1A A;  1WMH B;  3Q3F A;  2KOX A;  4MGZ E;  2IBI B;  3UIN B;  3OJ4 B;  2DX5 B;  5D7G A;  3QWZ B;  1WJU A;  1RRB A;  2M17 A;  3NS8 A;  2JRI B;  3NY5 A;  3JSV B;  3EC8 A;  3ZRC A;  4ANW A;  4A3P A;  3EEC A;  4IWP A;  1WXS A;  4II2 B;  1YD8 U;  2NVU I;  4WJP A;  2DYM A;  1Q0W B;  2N1V A;  3PV1 A;  2LGX A;  4WQO B;  3PGE A;  2RPQ A;  2IO2 B;  5G55 A;  2BPS A;  4DK5 A;  2GOW A;  4FN2 A;  1YQB A;  1OGW A;  3PHX B;  3DQV A;  3R66 C;  1TTN A;  2KN5 A;  2ASQ A;  2BGF A;  2PE6 B;  2KTR A;  4DBG A;  2VRR B;  3JSV A;  1V49 A;  4FAD A;  2JXX A;  4W9J A;  4BBN C;  2C5L C;  1TGZ B;  1E5W A;  1WYW B;  4WWP A;  2KXJ A;  4MH0 E;  3VAW A;  3TMP B;  1P3Q U;  1LM8 B;  2C7N B;  3EFU A;  2MX2 A;  1YIW A;  2LGY A;  2MP2 A;  3IG3 A;  5DPS A;  1WXA A;  2D3G A;  2MBE A;  2MSE D;  3H1U A;  3PPA A;  2RD0 A;  4NJ6 A;  3ZUN A;  4LDT B;  4F7Z A;  1V5T A;  1XD3 B;  2B3A A;  2J7Q B;  2D11 A;  1UH6 A;  2L00 B;  2L0T A;  2LXC A;  2JWZ A;  2N7E A;  2PPH A;  2R2Q A;  2LRW A;  2Z0D B;  3R3M A;  3ZRF A;  2V4L A;  2WX0 A;  3T8M A;  4FJV B;  2L76 A;  2CHX A;  1GC7 A;  1EF5 A;  3CF6 E;  1VD2 A;  4B95 A;  4BOS C;  3VHT C;  3DBH I;  3S2A A;  2KK8 A;  2LD9 A;  4E3C A;  1UD7 A;  3HM3 A;  4LCD E;  4RM8 A;  4CYE A;  3ZIM A;  1UEL A;  2JUO A;  2KZR A;  4X57 B;  1YJ1 A;  2I1J A;  3DVN U;  2JVC A;  4DXA B;  1C3T A;  3APC A;  3PLV A;  3PRM B;  4B6W A;  2FNJ B;  2IYD B;  1L2N A;  1IP9 A;  3HIZ A;  3V62 A;  2D2Q A;  2LVO A;  3RT3 B;  2LUE A;  1J19 A;  3ZNZ B;  3L0W B;  4FBJ B;  4IWO A;  2DEN B;  3QX1 A;  3ZTD A;  1WGD A;  2J0J A;  2LAS A;  2KHW B;  4W9F A;  2G3Q B;  5BO4 B;  3A33 B;  2IZV B;  2ZEQ A;  2MBO A;  5CHW A;  4JGH B;  5FR6 A;  4KSK C;  2RR9 A;  2BF8 B;  4PYU A;  2FAZ A;  2CS4 A;  3A9J B;  2MRP A;  2ZVO A;  2ZVN A;  4G50 A;  5LXH A;  5DPW A;  3VQI A;  4WJQ A;  4DHJ B;  3W1S C;  1OTR B;  1LQB A;  2K1F A;  4KV2 A;  2C7M B;  4J6I A;  4G11 A;  3WAL A;  3PTF C;  3P2B A;  1WX9 A;  3AU4 A;  3B1L X;  1ZGU B;  2GMI C;  3QJZ A;  1WM3 A;  4W9G A;  1ZKH A;  3C0R B;  2WYQ A;  4F1S A;  4FJZ A;  4MM3 A;  1WJN A;  2BWE S;  5J17 A;  5E6O A;  3U7D A;  1G6J A;  3HK0 A;  3V6C B;  4ANU A;  4DHZ E;  3H7P B;  2D10 A;  4GGQ A;  4HVB A;  5HKH A;  1WFY A;  2L05 A;  2LZ6 A;  3JVZ X;  3N30 A;  1V80 A;  4KZC A;  3ALB A;  1LXD A;  4WJO A;  1JRU A;  4ZRI A;  2KJH B;  1M94 A;  4TV3 A;  2DZJ A;  4NQK E;  3V6E B;  2N1W A;  3NOB A;  2BKR B;  3PLU A;  2O6V B;  4EUT A;  2XK5 B;  2NPT B;  4HLE A;  4KVG B;  4KIK A;  3RD2 A;  3ZVV A;  1I35 A;  4ICV A;  4LJO B;  1TZ1 A;  4K7S A;  2UYZ B;  3KYD D;  4LDT D;  2CHZ A;  4EKU A;  3PS6 A;  2WWZ A;  4BOZ B;  4K81 A;  2K8B A;  1E7V A;  3AXC A;  1WGG A;  5KHO A;  1WH3 A;  1P98 A;  3WA0 A;  3RUL A;  2KLG A;  2K6Q A;  4KSL C;  3U30 A;  4WJN A;  1WM2 A;  4GSW A;  3SU8 X;  5JZE B;  4KZ0 A;  5E6P A;  1WZ3 A;  2ZPN A;  4W9K A;  2I1K A;  2J0K A;  4K7U A;  2KWU B;  3M95 A;  4GMV A;  3RZW C;  5CHF A;  5E6N A;  2KDE B;  2K39 A;  2KMC A;  4GXB A;  4NJ7 A;  2KTR B;  1KM7 A;  2L3Z A;  1WJ4 A;  3TIX A;  3CST A;  2KDF B;  1XQQ A;  1TBE A;  1Z2M A;  1Q5W B;  3KVF B;  2ZNV C;  1LFD A;  2MP2 B;  3QAQ A;  1HE8 A;  3QAR A;  3MHS D;  4DWF A;  4FHJ A;  3ML9 A;  1OEY A;  2ZJD A;  4ICU A;  3N32 A;  2FUH B;  4FUL A;  1U4A A;  2DZK A;  2LGD A;  2M0X A;  4P7I A;  1WX7 A;  3DBL I;  4IM0 A;  3UGB B;  1EUV B;  2WDT B;  3W1S A;  3ZKJ C;  3PRZ A;  4MDK E;  4GIV A;  2MQJ A;  4IW0 A;  2V1Y A;  1GNU A;  2CKH B;  4MSQ B;  1UBQ A;  2DZM A;  4MGY E;  4JIO U;  3RUI B;  5TR5 A;  4EEW A;  5D2M B;  1AAR A;  3DOW A;  2DYO A;  5J2R A;  1RFA A;  4NAW A;  4MEM A;  1S1Q B;  2ZPY A;  4ZDV A;  4BKG A;  1V5O A;  2R2O A;  1NBF C;  3V60 A;  2XEW A;  3DVG X;  1J8C A;  3ONS A;  1UBI A;  3ZDT A;  3L16 A;  2LXA A;  3UF8 A;  4BKS A;  5EDS A;  1L7Y A;  4PYZ A;  1IPG A;  3KUC B;  2KLC A;  3ZDM C;  2JT4 B;  2IO1 B;  4TQ1 A;  3NZS A;  2CR5 A;  5GMV A;  2N4F A;  1F9J A;  2DYB A;  2REX A;  3R7R A;  2YLM A;  5AZG A;  2K8C A;  2GBK A;  2YVC A;  3VDZ A;  4B9K A;  4N9F 4;  5JHB A;  1GG3 A;  3L17 A;  1D3Z A;  1P9D U;  3AUL A;  2JZ3 B;  2IO3 B;  1XT9 B;  1H8C A;  3UIO B;  3VH4 B;  2AYO B;  1Y8R C;  2L0F A;  3A9K B;  2ZNV B;  2KAN A;  2CU1 A;  4AJW A;  2N7D A;  4FLH A;  2KD0 A;  2O2V A;  4HPM B;  4CHK A;  5IAA C;  4AJY B;  3KW5 B;  4FHK A;  3VH3 B;  2MLB A;  2MCN B;  4HK2 A;  3ZNI D;  4HDQ A;  1OQY A;  2DAJ A;  3APD A;  3M3J A;  4GN1 A;  1FXT B;  3D32 A;  3L54 A;  3O65 B;  2KWV B;  4I6N B;  4NY0 A;  2NBU A;  2MBQ A;  3CSF A;  1Z5S B;  1WGH A;  2BYE A;  3VTU A;  3HM6 X;  4W9L A;  1WI0 A;  3A9K A;  3QA8 A;  2KNB A;  3QC8 B;  1S3S G;  3B08 A;  3VFK A;  3X0W A;  2GBJ A;  2FCM A;  4A20 A;  1UGM A;  2KDB A;  1WR1 A;  2Z0E B;  2C7H A;  4IC7 B;  4AOF A;  4KIK B;  3LDZ E;  3RCZ A;  1Q1O A;  2EMT A;  3M62 B;  2CHW A;  2ZCC A;  1K8R B;  2GBM A;  2NBW B;  2N9P C;  2LI5 A;  2M8S A;  4ASW C;  3L08 A;  3DBS A;  1BT0 A;  3VXW A;  5AZH A;  5C23 A;  3H7S A;  2W9N A;  3JYU A;  4M8N A;  3KH0 A;  2FIF A;  4RMA A;  3SDL C;  1ISN A;  2C9W B;  4HCP B;  2HD5 B;  2KKC A;  2IY0 B;  3IFW B;  4E71 A;  5IA7 A;  4BKT A;  4FJY A;  4GB9 A;  1YX5 B;  3K9O B;  1QZE A;  3A4R A;  4XZ4 A;  2KC2 A;  4TQ0 A;  2ZCB A;  1KJT A;  4W9D A;  1V81 A;  4AUQ C;  3U8Z A;  2MBB B;  2ZZP B;  4GDL A;  4TKN A;  4NNJ B;  4EOY A;  4W9I A;  1SGH A;  4MJS A;  1WJ6 A;  2MBH A;  1NDD A;  1WXM A;  3WAN A;  4I6P A;  3PSE B;  3L10 B;  1H4R A;  2RGF A;  2K8H A;  2Z59 B;  4PS8 A;  2HJ8 A;  3DDC B;  2WX1 A;  4EZK A;  1E90 A;  3WAM A;  4WAA A;  1E8Z A;  3DVN V;  5D94 A;  3SHQ A;  2C60 A;  1J0G A;  1WR6 E;  2G45 B;  1WF9 A;  4NAW B;  3NZU A;  3TL5 A;  5KHQ A;  3V61 A;  1X1M A;  1WE7 A;  2KQ7 A;  2KTF A;  1NI2 A;  3ZW3 A;  1WXV A;  5JHA A;  4IWQ A;  2XBB C;  3ZNG C;  2BYF A;  3X23 A;  4BBN F;  2KC1 A;  3I3T B;  1WRD B;  1IYF A;  4M8M A;  1WY8 A;  1WIA A;  4ZRJ A;  1VCB A;  3M63 B;  3PZD A;  4EFO A;  4W9H A;  3AU5 A;  5CTR C;  1UZX B;  3VVW B;  2BWF A;  4WWO A;  1R4M I;  4DHJ D;  1MG8 A;  3CMM B;  4M0W B;  4NQL B;  4GDK A;  4IG7 B;  2KX0 A;  3PHW B;  2BKF A;  4G3X B;  3ZO5 B;  1KOT A;  2KFK A;  1ZW7 A;  4NPN A;  1SIF A;  2IO0 B;  4TUU A;  3A1Q A;  2L7R A;  3OLM D;  1WMH A;  2KJR A;  3WAO A;  4HWI B;  1RAX A;  4F8C B;  2KFJ A;  5AEK B;  3GOE A;  5G2N A;  2Y5B B;  5D6J B;  4YL8 A;  5C1Z A;  4LJP B;  2KJ6 A;  2JF5 A;  2KO3 A;  3GZN I;  2O2V B;  5AZF A;  4ZYN A;  4AWJ A;  2OOB B;  4W9E A;  4E74 A;  1R4N I;  4HPL B;  2DHZ A;  4JLC A;  3BY4 B;  1P0R A;  2O6V D;  4MEL A;  4RM9 A;  3JW0 X;  2N9E B;  3TCA A;  5L95 C;  1OEY J;  3PRE A;  5DPR A;  3RZF A;  1WX8 A;  3DPD A;  3ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...