2KX3A

The solution structure of the mutant of ubl domain of ublcp1, i5m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
MALPMIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the mutant of UBL domain of UBLCP1, I5M
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
total genus 12
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kx3A00
3TL5A 1BT0A 2FNJB 1FXTB 4IWQA 4MDKE 3ZVVA 2KWVB 2JRHA 3L54A 3KVFB 1JRUA 4F8CB 2PEAA 3T9LA 3ZDTA 2JY6A 1GC6A 2KWCA 3PRZA 2BYFA 4M8NA 2CR5A 2JPHA 4PYZA 3OJ3A 2AWTA 2JXXA 4BVUC 3RUIB 2LVQA 5IAAC 5G2NA 3VTVA 4XC2A 4WAAA 1Q1OA 2K6QA 3X23A 2WDTB 1WGHA 2ZCBA 4W9JA 2DHZA 4JL9A 2YVCA 4KZCA 4NPNA 1P9DU 5CTRC 4LDTB 2LRWA 4GSWA 4GU2A 3WA0A 2HE7A 3DPDA 4FA6A 2G3QB 2MW5A 5AZFA 4W9GA 2MBHA 3A33B 1R4NI 3MHSD 3R7RA 4ANVA 4KVGB 2KN5A 2KQ7A 1WR6E 4M8MA 4NQLB 5D94A 3VH4B 2LXAA 4DXAB 1WH3A 3WAPA 2NVUI 2LZ6A 3A9JA 3NY5A 4MGKE 1H4RA 3H7PA 4MSMB 2ZNVB 4ZDVA 2K8CA 2AL6A 2WYQA 5LXIB 3KUZA 1Z5SB 2Y5BB 3IG3A 4HXDA 4I6LB 4FJVB 3QK0A 4NAWA 5D6JB 3RZFA 5JHBA 1V6EA 2C7NB 2RSUA 3H6NA 3DVGY 3C0RB 4IG7B 2KVRA 2RR9A 3PHXB 4HK2A 4BKSA 3UGBB 2BWFA 2GOWA 3A9KA 1WJUA 2M8SA 2Z0EB 3APCA 4WWNA 4ZYNA 4CYEA 2BKRB 5FR6A 1E7VA 2RPQA 5KHQA 3QC8B 5D7GA 2OOBB 4GDKA 2IO2B 5AEKB 2BF8B 3LDZE 4KSLC 3ZO5B 4PS8A 1WM3A 4WJPA 1U4AA 2N9XA 3M62B 4TQ0A 3PV1A 2O6VD 1E8WA 4JLCA 1WJ4A 2W9NA 1HE8A 1WZ0A 4WJOA 2KWUB 4HJKA 1V2YA 4AJYB 1UGMA 4NY0A 3AU5A 4F1SA 3NS8A 2M17A 4E3CA 4ICVA 2HTHA 2K39A 4NNJB 3NHEB 4GGQA 4DK5A 1UD7A 4G11A 1WRDB 1VD2A 4LJOB 3U30A 4BBNC 4W9FA 3ONSA 4II2B 1J0GA 2DAFA 3PTFC 2IBIB 2C7MB 2J7QB 3ENEA 1E8ZA 5GMVA 4FHJA 2KK8A 4LJPB 1V9JA 2LXCA 3R3MA 2BWES 3B08A 3PRPB 4YL8A 2KFKB 3HM3A 4ZRJA 2LGXA 3ZNGC 1OEYA 3P2BA 4FULA 3L0WB 3RZWC 2L0FA 1J8CA 1OQYA 3A4RA 5DPTA 2JZZA 2KHWB 4DBGA 4WWOA 2DZIA 2KX3A 2JUOA 1WMHB 2KZRA 3APFA 1GJZA 1WYWB 4ZRKA 1T0YA 4KDLB 1KLVA 5CHWA 1R4MI 2LWPA 2MX2A 2PE9A 3M3JA 2LJ5A 2C5LC 4KDIC 3RCZA 3VUXA 4NJ6A 3QHTA 3QX1A 3ZNZB 2LGYA 1E5WA 1XD3B 3V60A 4ANXA 2JF5A 2MP2B 3TJPA 2LGDA 3UF8A 2YLMA 4FADA 2FAZA 2PE6B 1WR1A 3VQIA 3EFUA 2GBRA 2KTFA 2KKCA 3PSEB 1V5TA 2AYOB 4GOCA 1WE7A 4KIKB 4G3XB 1Q0WB 3ZW3A 1F9JA 2KTRA 5BO4B 2MWSB 1KOTA 3VXWA 3HM6X 3EHVA 3QWZB 2BGFA 4MEMA 2KDBA 3WAMA 4HLEA 5E6PA 3QAQA 2HJ8A 4JQWC 1Q5WB 2DYOA 3U8ZA 2FCMA 3ZKJC 4NJ7A 4KIKA 3OJ4B 2LVOA 1ZKHA 4GDKB 3RYTA 3ZNID 4MELA 5KHOA 1WXSA 2B3AA 3KUDB 2MSED 3IFWB 2M1MA 2AEHA 2N7EA 4EOYA 2DZKA 3A4SC 3SHQA 1WM2A 3PVLA 5CHVC 2XBBC 3WANA 4BKTA 2I1KA 1WF9A 4LDTD 3QIJA 5J17A 2BKFA 4AP4C 2R2OA 2N7DA 1P98A 1VCBA 2IO0B 1WX7A 2WWZA 2O6VA 1C3TA 3VVWB 3O65B 5E6OA 4W9CA 2KLCA 1LQBA 2UWQA 4W9LA 1PQSA 2K8BA 3B0AA 1WZ3A 3ML9A 4HDOA 4JIOU 1WMHA 2CS4A 3AI5A 4W9IA 4X57B 3SD5A 2N4FA 2N1VA 3ZDMC 4BKSD 3WALA 2IZVB 2R2QA 4NQKE 3SDLC 3PPAA 4A3OA 3S2AA 3ZIMA 2LVPA 2ZVNA 4W9EA 3TCAA 2KJRA 2ZZPB 3N30A 3ALBA 2CHXA 1GUAB 2BYVE 2NS5A 1LFDA 3A1QB 3ZLZA 3ZTDA 2ZVOA 3VH3B 3BINA 3PT2B 2IO3B 1WJ6A 2DAJA 2REXA 3M63B 3U7DA 4AJWA 4ANUA 5EDSA 3SU8X 4B9KA 4HCPB 2D3GA 2NBVB 2D11A 3ML8A 2A4ZA 5DPRA 1MG8A 4MJSB 2GBJA 2O6VB 3L13A 2BPSA 2KJHB 2XK5A 3DOWA 2D2QA 2KDIA 2LASA 4OVVA 5L95C 4DHZE 3UIPB 2J0JA 4GDLB 2V4LA 3KYCD 4N9F4 3JVZX 5CX3A 1CMXB 4A3PA 3MJWA 1XT9B 2KNBA 3VTWA 3W1SC 2ZPNA 2K1FA 3UQBA 1P0RA 1D3ZA 4TV3A 2V1YA 2L8JA 2V3SA 1WGGA 2PJHA 3L08A 3L17A 5DPWA 4OVUA 4EZLA 4K81A 1E8XA 2KMCA 3BY4B 2N1WA 3VDZA 2EMSA 4CHKA 4ZRIA 1NBFC 3DBLI 3TIXA 4BOZB 5C1ZA 4DWFA 4PS7A 1I42A 4FN2A 4RM9A 2ZCCA 4NAWB 3PHWB 4CO7A 3H7SA 2O2VA 3WIMA 4J6IA 2K25A 1SIFA 2CHZA 1WGDA 4EEWA 4K7WA 2WX0A 3A9KB 3H7PB 4P7IA 4AOFA 3PGEA 3V61A 1TBEA 4EKUA 2MP2A 3ZUNA 3KYDD 1WXVA 1SE9A 1UH6A 2FCSA 2OJRA 3B1LX 1ZW7A 4XX5A 3ZRFA 2C7HA 1X1MA 3DVNU 5LLIA 3L10B 2LI5A 3CF6E 1C1YB 3VUWA 2N9EB 1M94A 2MA9B 1RAXA 2FIFA 3UQAA 3V6CB 5JHAA 3KH0A 3QCAA 1QZEA 5DCNA 2KO3A 2GBNA 2LUEA 3CMMB 1YQBA 4EZJA 3A9JB 1E8YA 2LD9A 3NZUA 2DX5B 1LXDA 2KANA 3T8MA 1RFAA 1S3SG 3K9PB 4KZ0A 3ZNHB 4G50A 3VAWA 2XEWA 1V80A 4EFOA 2G45B 4HDQA 4HVBA 1XQQA 2DZJA 3Q3JA 1RRBA 1A5RA 5L83A 4FLHA 5CHFA 1WJNA 2J0MA 4W9KA 4EUTA 4DDGD 2RGFA 3JW0X 2IO1B 3W1SA 4IM2A 3OLMD 5AZHA 4GMVA 1UZXB 2MCNB 4I6NB 3IVFA 1V86A 2L7RA 2M4NA 5LXHA 5TR5A 1IYFA 3PRMB 2EKEC 4PYUA 1V5OA 3VUYA 4EZKA 1TTNA 3M95A 1YX6B 4JGHB 2K6DB 4II3B 2IY0B 1I35A 5G55A 4ASWC 3D32A 1WE6A 3QA8A 4KSKC 2DYMA 4WWPA 2JT4B 2MBOA 2XK5B 3ZTCA 2MRPA 4MJSA 3UIOB 2QHOA 2NPTB 4BBNF 3JYUA 2NBWB 2CHWA 1SGHA 1UELA 2GBKA 1WGYA 3APDA 3N3KB 1YJ1A 3KUCB 3OAWA 1P1AA 1LM8B 2DZMA 3Q3FA 4MH0E 2NBUA 3PLUA 3VTUA 2NR2A 3EECA 2UYZB 2CKHB 3A1QA 3HIZA 3TMPB 2JZ3B 3PS6A 4IWPA 3DBHI 3HK0A 2CU1A 4GXBA 2L3ZA 1WXAA 1J19A 5J18A 4TQ1A 2L0TA 1WXMA 2FCQA 2MBQA 2RD0A 4HPLB 1WIAA 5J2RA 2HD5B 4IM3A 2JRIB 3V6EB 4A20A 4IW0A 4MGZE 1EO6A 1P3QU 2AL3A 2KC2A 1EF5A 1GC7A 2MBBB 2K8HA 3DBRI 4B95A 2KFKA 4MM3A 3VHTC 3GZNI 4E71A 2KOXA 3R66C 3CSFA 1IPGA 2NCNA 1NI2A 2KDFB 4HPMB 3TBLD 2FUHB 3QJZA 1TGZB 3NZSA 1WY8A 2FCNA 2IYDB 1UBQA 2LRUA 1OTRB 3DQVA 1E90A 3AULA 3X0WA 1Y8RC 3LJ3A 5E6NA 3AXCA 3CSTA 2M0XA 2KJ6A 3I3TB 2MQJA 3K9OB 4K7UA 1WI0A 4GB9A 2MBEA 2VRRB 4XZ4A 3PLVA 1YD8U 3H1UA 2Z0DB 3N32A 1G6JA 4DDID 2A5UA 3VFKA 4FJZA 2C9WB 4K1RB 4WJQA 3H9DA 3IBEA 4RMAA 4PS3A 2G4SA 3DDCB 4FBJB 2L00B 2ZJDA 1ISNA 2KTRB 4RM8A 4FHKA 4DHJB 4KV2A 1RLFA 4MGIE 3W1YA 1L7YA 3UINB 4IC7B 3RULA 4DHJD 3QQ8B 1ZGUB 5JZEB 4M0WB 2EMTA 4HCNB 3QARA 3L16A 4ICUA 2JWZA 2JVCA 5DPSA 4B6WA 4WJNA 3AU4A 2KMAA 4GDLA 1L2NA 1WFYA 3DVNV 1OEYJ 1OGWA 4LCDE 4MSQB 5HKHA 2DENB 3MTNB 2MLBA 3DVGX 1EF1A 4WQOB 4F7ZA 1TZ1A 5IA7A 2DYBA 3V62A 2D10A 4TUUA 2PPHA 3JSVB 4I6PA 3NOBA 4BOSC 4HWIB 1Z2MA 4IUMB 1NDDA 2WX1A 2D07B 4AUQC 4G0NB 2C60A 4AWJA 4URKA 4TKNA 2L76A 2KXJA 4IWOA 2KLGA 4W9HA 3WAOA 3HHMA 2KC1A 1H8CA 2KFJA 2FIDA 4W9DA 2G4DB 2N9PC 5C23A 2Z59B 3ECIA 2KDEB 1IP9A 3EC8A 1YIWA 4DHZB 1V81A 1V49A 2KD0A 3JSVA 3PREA 3R7QA 4BFRA 5AZGA 3DCGA 1KM7A 1KJTA 1WGRA 2BYEA 1WX9A 3RD2A 2ZEQA 2O2VB 4K7SA 1E7UA 2GMIC 4IM0A 3ZRCA 2ASQA 3RT3B 2ZPYA 2I1JA 4FJYA 4ANWA 3IHPC 1GG3A 2IY1B 1K8RB 5D2MB 4GN1A 5JH5C 3PZDA 1GNUA 2KX0A 4GIVA 4BKGA 3DBSA 1EUVB 1S1QB 1UBIA 2J0KA 1WX8A 3GOEA 4E74A 1YX5B 2ZNVC 4MGYE 2KQSA 1AARA 2L05A 2NPTA 2GBMA 3KW5B
chains in the Genus database with same CATH superfamily
3BYYB 5I4DA 2KQ4X 2KWVB 3GB1A 3KVFB 3ZDTA 2JY6A 4JE3B 4M8NA 2CR5A 2AWTA 3VTVA 3DBRB 4WAAA 1Q1OA 4XC2A 2WDTB 1WGHA 4W9JA 2YVCA 3ETRA 4NPNA 5EE3A 2SAKA 1TS3A 4RGNA 2AQ3B 3WA0A 3DPDA 4KGRA 4FA6A 2G3QB 2MW5A 4C00A 3EUB2 4W9GA 3HUIA 1YN4A 1PYWD 1R4NI 1WR6E 1I4PA 4NQLB 2QC8A 3BK2A 3GS2A 2NVUI 1PFDA 4MGKE 4P1CC 2Z8LA 3H7PA 4MSMB 2ZNVB 4ZDVA 4EE2A 2AL6A 2ON8A 2QEJC 4LNOA 5JHBA 3RZFA 4FJVB 3QK0A 3TEYA 2RSUA 1L5PA 2V0GA 4BKSA 5BMHA 4ZYNA 2AQ1B 3DHGC 4CYEA 4LNFA 2GB1A 1ZXIA 2BF8B 3LDZE 3ZO5B 4XGAB 4TQ0A 1E8WA 2W9NA 4P1BC 2IGDA 4NY0A 2K9XA 2M17A 4ICVA 4IKGA 4GGQA 1WRDB 3U30A 3GE8C 1JALA 3ENEA 5GMVA 4M00A 4FHJA 2KK8A 1V9JA 2M0AA 1FCCC 2MHJA 2LGXA 1J8CA 1OQYA 1J7BA 2KHWB 5HFYA 4WWOA 1TT5B 2DBYA 1RWSA 1GJZA 1E9MA 1T0YA 1TS4A 2BT6A 4KDLB 1MVKA 1R4MI 1LGRA 3RCZA 2CJOA 3QHTA 3QX1A 1E5WA 1KLGD 3RI7C 2MP2B 2LGDA 3UF8A 1WR1A 1I4RA 2J53A 4RNAA 1D5XC 1DGJA 3PSEB 2AYOB 3AE8B 4GOCA 4KIKB 3W5UB 1KOTA 5TSSA 1FFUA 3TSSA 4MEMA 5E6PA 2HJ8A 1Q5WB 1JQ4A 2WXNA 3U8ZA 4KIKA 1ZKHA 3EFCA 3R2TA 4XDCA 2MSED 2AEHA 1P7FA 2N7EA 1KH0A 3A4SC 3SHQA 4ZHOA 3PVLA 3AB5A 4BKTA 3TUOA 3QIJA 5J17A 4AP4C 1FM0D 1N6ZA 1P98A 1VCBA 2WWZA 1WX7A 2O6VA 3VVWB 2WHIA 1C4CA 2KLCA 1LQBA 3AN1A 2UWQA 3ML9A 4BAXA 2MH7A 2RMMA 4X57B 4L23A 2N4FA 1PGAA 4LK0M 2N1VA 3WALA 1JWUD 4H2AA 2IZVB 4NQKE 2INCC 3SFDB 1C77A 1ZUD2 2KJRA 3N30A 2NS5A 2IO3B 2REXA 2IGHA 3SU8X 1MPEA 2A4ZA 2TSSA 4LTUA 1F52A 2GBJA 3BZDB 3V3XA 3KLSX 4MT5A 5L95C 3P4QB 4N9F4 1BMLC 1NYQA 1CMXB 3MJWA 3W1SC 1D3ZA 2V3SA 3L17A 5DPWA 3BY4B 4QAYA 3VDZA 4XE0A 3AE6B 4ZRIA 5G5GA 5C1ZA 3RPFC 4PS7A 4RM9A 2JWUA 4CQNA 3IXSA 4YTMB 1WWTA 4J6IA 4K7WA 3A9KB 4EKUA 1V8CA 2OJRA 3ZYYX 1F1HA 3MJ5A 2PVGC 2PMVA 2I2YA 4YSXB 2LI5A 2DWQA 2KDMA 4Q2JA 3VUWA 1DYQA 3NRZA 1RAXA 3UQAA 5JHAA 3GP7A 5DCNA 3CMMB 4RFBA 1YQBA 5BMGA 2JZPA 3A9JB 1E8YA 3NZUA 4NZLB 1LXDA 3T8MA 1EWYC 1QT9A 3K9PB 4KZ0A 3ZNHB 4G50A 2G45B 2PW9A 4HVBA 2LHDA 5L83A 4US8A 4IOIE 3B2GA 3OLMD 3P4SB 2MCNB 4I6NB 1TYGB 1V86A 4WH4A 3PO0A 3M95A 2PVOD 2K6DB 2DYMA 3MC0B 4WWPA 2JT4B 3ZTCA 1PUTA 2NPTB 1D4BA 2CHWA 1YJ1A 1P1AA 3MP9A 4N58A 2NR2A 5E6JA 4IWPA 1E6EB 5J2RA 2HD5B 4IM3A 2AL3A 1JCKB 1EF5A 1GC7A 1YN5A 2K22A 1TS5A 3DBRI 4B95A 2N9KA 2KFKA 4E71A 2KOXA 1IPGA 2N0SB 2KDFB 1I4HA 1WY8A 1UBQA 1OTRB 3AH7A 3DBLB 1R4NB 4C80A 4L2YA 5E6NA 2KJ6A 3I3TB 1WI0A 2H88B 2VRRB 3PLVA 4OW0A 1FEHA 2QMTA 1V1OA 2A5UA 3VFKA 2C9WB 4K1RB 4WJQA 3H9DA 4RMAA 2G4SA 1RFKA 2IDYA 4KV2A 1RLFA 4MGIE 1FNUA 4D2KA 4XYCA 1L7YA 1YQ4B 1IGDA 3VR8B 5H8YE 2EMTA 3QARA 1DOIA 3L16A 2G1EA 4WJNA 1PGXA 1L2NA 1WFYA 1OEYJ 1B1ZA 2DENB 2MLBA 5G5HA 3V62A 3BVMA 1T0RC 2BW2A 3NVYA 2D07B 4AUQC 4RGOS 2KN4A 2L52A 3MC8A 2KXJA 4IWOA 2KLGA 2KC1A 2YEPF 2KWDA 5IOIA 1L0XB 4HROA 1V49A 2WLBA 2KD0A 3R7QA 4BFRA 1KJTA 2O2VB 1IUEA 4K7SA 2FBWB 1I4XA 3ZRCA 2ASQA 2I1JA 4YTNB 3IHPC 5D2MB 1T5XD 3DBSA 3PZ7A 1S1QB 4MGYE 2L05A 3KW5B 3TL5A 4J3OD 2BB5A 5IN7A 2PEAA 1MG4A 1GC6A 2KWCA 1IBXA 1Y56A 2JPHA 2JXXA 5IAAC 5G2NA 3X23A 2K6QA 1FRDA 5CTRC 4LDTB 2LRWA 4GSWA 4GU2A 2HE7A 2W82A 3R7RA 1ET6A 4ANVA 4M8MA 1GPXA 1XCTL 2D3CA 3VH4B 1WH3A 3WAPA 3FC4A 2LZ6A 1VZ6A 1H4RA 4A8XC 2K8CA 2WYQA 1Z5SB 3IG3A 4I6LB 5D6JB 3C0RB 3MHZA 2RR9A 1FNWA 3UGBB 3AEFB 1XO3A 1B9RA 1WJUA 2AX5A 2Z0EB 3HVZA 4M0WA 2JU6X 4DQOC 1J7CA 4P6VF 1JROA 4KSLC 1FNVA 5GXGB 4PS8A 2N9XA 1QOAA 3PV1A 2LFIA 2O6VD 3P63A 1WYGA 2QSDA 4DXFA 2KWUB 1ZE3D 3KWLA 3AU5A 4F1SA 3TEWA 2PTLA 4DK5A 4BBNC 4II2B 4XWTA 1L4DB 2DAFA 4ITKA 2KAJA 2D3BA 2C7MB 2GI9A 1UWMA 1HQRD 1YOVB 3SR6A 2LXCA 1YQ3B 1BUIC 3PRPB 1XLQA 1BXTA 3P2BA 4FULA 3RZWC 3L0WB 1YJJA 3A4RA 1FFVA 1WMHB 2MEKA 2LWPA 2LJ5A 2GRIA 4MACA 1V97A 4K3CA 4FADA 2FAZA 3EFUA 2MJEA 4OZCA 2D3AA 2KKCA 1WE7A 4G3XB 1F9JA 2KTRA 1ACCA 2BGFA 3ABVB 4HLEA 4AQ7A 4O1NA 2FCMA 2WXJA 5BYSA 3OJ4B 2LVOA 3I9V1 1AWDA 3OWEB 2DZKA 1RM6C 1WM2A 2WQYB 1WF9A 1EWCA 4LDTD 2BKFA 5H92C 2R2OA 3N1ZC 2IO0B 1YNTE 2LEKA 3C8YA 4TMAB 1YN3A 1WMHA 2CS4A 4L1BA 4WAFA 1D5ZC 3SDLC 2HJ1A 4A3OA 3Q8EA 2ZVNA 3ZIMA 3TCAA 3ALBA 2CHXA 3ZLZA 2E3TA 4YXDB 1L6VA 2DAJA 3IAM1 4HRSA 2D3GA 2D11A 2WDVB 5DPRA 2WXQA 2O6VB 3BIID 2XK5A 2D2QA 2LASA 4OVVA 4R3DA 4DHZE 3KYCD 1XT9B 2KNBA 4HKZE 2ZPNA 3UQBA 1P0RA 1E8XA 1SF0A 3HVDA 2ONQA 2EMSA 4FN2A 2VZKD 1KFYB 4NAWB 3WIMA 1SIFA 1ENFA 2CHZA 2DLBA 4A6QA 4P7IA 4AOFA 3PGEA 3V61A 1TBEA 5LNK1 2MP2A 1FD6A 4XX5A 3B1LX 2FCSA 1N62A 2C7HA 3CF6E 2KYWA 2WU5B 3ZXVA 3QCAA 5AUIA 2KO3A 4EZJA 2EELA 2Q5WD 2LD9A 2DX5B 2KANA 3BYTB 3Q6BA 1RFAA 1S3SG 1I4GA 1K51A 1V80A 4EFOA 3OG5A 4HDQA 1QF6A 1RRBA 4FLHA 1UF0A 5CHFA 1F0ZA 1SSNA 3JW0X 2IO1B 2FE8A 1ZDVA 4KGTA 1UZXB 2B76B 3PRMB 3VUYA 1TTNA 1YX6B 1F2RI 4JX1C 1I35A 2IY0B 5BMIA 5G55A 2OHFA 1K52A 3JYUA 1SGHA 2J42A 2E6XA 3OAWA 1FIQA 2DZMA 1CJEA 1TJEA 4ARCA 2NBUA 3Q2AC 3VTUA 4S17A 3RNFC 2CKHB 2KACA 3A1QA 1NEKB 2JZ3B 3PS6A 3DBHI 1MI0A 3L4PA 1VR9A 3I63C 2FCQA 2MBQA 4GLSC 2K0PA 3V6EB 4IW0A 1EO6A 1P3QU 2K8HA 2BS4B 3VHTC 1JMLA 1NI2A 2NCNA 3UI3A 1TGZB 2FCNA 4IDIA 5FKAC 2LRUA 3GE3C 3X0WA 3AEBB 3LJ3A 1R7SA 2INNE 3AXCA 2M0XA 1HZ6A 1L0VB 2K3UA 4ZRPA 2V9HA 3P4RB 2MBEA 3H1UA 1PGBA 1JWAD 1VLBA 4B0MA 3T3OA 1SXTA 3DDCB 4FBJB 3W9CB 1ISNA 4FHKA 3Q8CA 3UINB 4IC7B 4DHJD 4HCNB 4ICUA 5DPSA 2WGSA 4B6WA 4GDLA 3BVGA 2BS2B 1OGWA 2H89B 4NAMA 3MTNB 3DVGX 4WQOB 1VZ8A 1TIFA 2DYBA 4TUUA 2PPHA 4C4VA 5C2TB 4URKA 2L76A 4RF1A 1XLNA 4W9HA 2BB6A 2KFJA 4W9DA 2WXHA 5C23A 2Z59B 1Q10A 3MFGA 4DHZB 3LYYA 1QLBB 2BYEA 1EM7A 3RD2A 2ZEQA 1QOBA 4A90A 1E7UA 4HKQA 2BS3B 4FJYA 2ZW0A 4ANWA 4GN1A 5JH5C 3PZDA 1GNUA 3C19A 1UBIA 2J0KA 3GOEA 1YX5B 4US9A 2ZNVC 4A55A 1AARA 2NPTA 2KVZA 1CZPA 3B2FA 1FXTB 2JYEA 1T0SC 3ZVVA 2JRHA 3T9LA 3PRZA 2BYFA 1M4VA 4BVUC 4RF0A 2LVQA 3RUIB 3WCQA 2DHZA 3NVZA 4JL9A 1P9DU 4OZAA 5AZFA 3AEEB 2WXOA 4KVGB 2KQ7A 2LXAA 1WSPA 4DXAB 2CJNA 3A9JA 5EE1A 3H8HA 2XNAC 3ZJTA 3KUZA 5MPOA 1T0QC 4XDDA 4IG7B 4HK2A 5C3JB 2BWFA 2GOWA 3A9KA 4JPSA 2M8SA 2WDQB 3APCA 4WWNA 2XN9C 4TSSA 1E7VA 2IPKD 2RPQA 5KHQA 3QC8B 2M56B 4GDKA 2IJ0A 1XLPA 4WJPA 1U4AA 3M62B 1TKGA 1RYJA 2PKOA 1HE8A 1WZ0A 4WJOA 4AJYB 1UGMA 1KLUD 2QILA 3NS8A 2HTHA 3Q3MC 2K39A 4NNJB 4G11A 4LJOB 1VD2A 4W9FA 2IBIB 3U52E 2J7QB 1E8ZA 1XF5L 2BWES 2WXKA 3BK1A 4YL8A 2KFKB 3HM3A 3ZNGC 1OEYA 2VZKB 2L0FA 3R2IA 5DPTA 3AE2B 2JZZA 4BZAA 2DZIA 2JUOA 1V1PA 4WQMA 3APFA 4ZRKA 3N1YC 4HJGE 2QJLA 2PE9A 3M3JA 2C5LC 4KDIC 1XLOA 2LUMA 3ZNZB 2LGYA 3RNEC 1SB3C 3RFZB 1XD3B 3V60A 1SJHD 2YLMA 3CWIA 2PE6B 3B9JA 1CQVA 3ZW3A 5BO4B 3VXWA 1P7EA 3HM6X 3EHVA 3QWZB 3U4EG 1FPYA 3AE9B 3QAQA 1AN8A 2DYOA 5EE9A 3ZKJC 2Y3AA 4ZHPA 5KHOA 3KUDB 3IFWB 2M1MA 4ZOHC 4KKJA 2XBBC 1UGJA 4USAA 3N20C 4M02A 3KWVA 3U7ZA 1KF6B 3ZJVA 2X38A 4W9CA 5E6OA 5BYRA 2QIEB 4ACFA 1PQSA 2K8BA 1WZ3A 3R8BA 3AI5A 4BKSD 1J7AA 1DOXA 2R2QA 1HTQA 3S2AA 3ZJUA 4W9EA 1GUAB 2BYVE 3A1QB 1LFDA 1SE2A 1CK1A 2ZVOA 3VH3B 3BINA 1QOFA 1WJ6A 3Q3OC 3M63B 3U7DA 4AJWA 4ANUA 4HCPB 2WNMA 2NBVB 3ML8A 4UDUC 3FILB 3Q8BA 3NVVA 1MG8A 4MJSB 2KJHB 1WXQA 3Q14C 1ESFA 3DOWA 3UIPB 4GDLB 2V4LA 3JVZX 1XCQL 4A3PA 3VTWA 2JYTA 1ZOYB 1C78A 2ACZB 2V1YA 2L8JA 1YJIA 1WGGA 2PLPA 1C4PA 2QDFA 4CHKA 4KGSA 1NBFC 3AE7B 2HTME 3RNAC 1VDVA 1I42A 2BTEA 5D3DA 3PHWB 1K53A 3H7SA 2O2VA 1MFWA 2K25A 3RNBC 4EEWA 4N59A 5AUKA 3H7PB 3AE5B 4LLGM 1OQQA 1WXVA 2RDGA 1UH6A 1SBBB 4ARIA 3DVNU 4YSZB 3E9SA 2EKIA 1M94A 1E7PB 4PT5A 3DHIC 2LUEA 2GBNA 3RMKC 3PZ8A 1AW7A 4LNNA 1SIJA 2LMCA 3Q8FA 2L83A 1MHHE 2XEWA 1AYFA 1NI3A 1TS2A 1ZDXA 2JSVX 1FCLA 4WIPA 2DZJA 3Q3JA 1A5RA 4MH8A 1WJNA 2J0MA 4W9KA 5BYQA 4DDGD 3W1SA 4IM2A 5AZHA 3ZQ4A 2RDHA 4GMVA 2LJIA 2M4NA 5TR5A 1IYFA 4PYUA 1ZPSA 1V5OA 2X8XX 5FK9C 2MJ3A 2XK5B 2MRPA 3UIOB 2NBWB 5IKCM 1UELA 2GBKA 1WGYA 1LM8B 3Q3FA 1OQRA 2Y5CA 2RPVA 1YMHE 2NMQA 3PLUA 3EECA 3HIZA 3TMPB 2OEDA 3U2SC 1WXAA 1OFFA 4KKIA 3O13A 2L0TA 1WXMA 2RD0A 4HPLB 2JRIB 2BVCA 5EE0A 4MGZE 1SJED 4MM3A 2KT7A 3GZNI 3R66C 3QJZA 3NZSA 4XWWA 1KRHA 3DQVA 1E90A 3AULA 4C4VB 1Y8RC 3CSTA 2LGSA 2Y5PA 4GB9A 4JWSC 4XZ4A 1YD8U 1N5XA 1IBXB 1QILA 4FJZA 3Q69A 3IBEA 4PK1A 3AE1B 2L00B 2KTRB 3FAHA 3W1YA 2HDEA 4WWMA 1GB4A 3RULA 1STEA 4ZYSA 1VJKA 1EU3A 2GLSA 1I7HA 1IGCA 3AM9A 2AQ2B 1ZP0B 2JVCA 2JWZA 2VH1A 2KMAA 4MSQB 5HKHA 4RGMA 4NJCA 5IA7A 1TZ1A 3BVZA 3P42A 4C56C 4N6EB 4AS1A 3JSVB 3W2DA 4I6PA 4BOSC 4HWIB 1Z2MA 2WX1A 2C60A 1L4ZB 4TKNA 3P4PB 1QOGA 1H8CA 2LGIA 4OVZA 3ECIA 2KDEB 4DXGA 3EC8A 1V81A 3JSVA 4JWUC 1JWMD 3DCGA 1KM7A 1WX9A 3VR9B 2GMIC 1ROEA 1FMAD 2IY1B 4C7YA 1K8RB 1FXIA 1GOZA 2KX0A 4BKGA 1EUVB 3IT6B 1ZXHA 1E10A 1WX8A 3NZ3A 4E74A 1SE3A 5HHDG 2GBMA 2INPE 1BT0A 2FNJB 4IWQA 4MDKE 3L54A 1JRUA 4F8CB 2VH2A 4PYZA 3OJ3A 4K3BA 1F2RC 2ZCBA 3FILA 3I57A 1F77A 4KZCA 1JWSD 4LNKA 2MBHA 3A33B 3MHSD 2KN5A 5D94A 1C79A 3BWUD 3NY5A 2NTSA 1N63A 1TKEA 1E0ZA 5LXIB 4YT0B 2Y5BB 4HXDA 4NAWA 2BYTA 1V6EA 2C7NB 3H6NA 4HPPA 3DVGY 3T3NA 2KVRA 3PHXB 3DHHC 2BKRB 4HEA1 5FR6A 5D7GA 2OOBB 2IO2B 5AEKB 2M19A 2W3SA 1WM3A 2LHEA 4JLCA 3EA6A 1WJ4A 4HJKA 1V2YA 2QCZA 4E3CA 1EU4A 3NHEB 1UD7A 1FO4A 3ONSA 1J0GA 5D3IB 2N7JA 3PTFC 4LJPB 3VRAB 4RGTA 2WP9B 3R3MA 3B08A 2WXMA 4ZRJA 3LXFA 1UNSA 3J9CA 4DBGA 1V1PB 2KX3A 2KZRA 1WYWB 1UUPA 1KLVA 5CHWA 2FUG1 3AV8A 1C9FA 2MX2A 5IP4D 4OHJA 3VUXA 4NJ6A 3Q3NC 4ANXA 2JF5A 2WXIA 3TJPA 3NVWA 5HG2A 3VRBB 3AEGB 3VQIA 2GBRA 2L1AA 2KTFA 1V5TA 1Q0WB 2BQQA 1MHXA 2MWSB 3ZXRA 1HA5A 2KDBA 3WAMA 4JQWC 4NJ7A 4GDKB 2WXLA 3RYTA 3ZNID 4MELA 2BBCA 1WXSA 2B3AA 1XEEA 4WURA 3SEBA 4EOYA 4REZA 5CHVC 2R61A 3E56A 3SFEB 3WANA 2I1KA 1ET9A 2N7DA 1C3TA 2WDRB 3O65B 4ZRQA 4W9LA 3B0AA 4W9IA 4HDOA 4JIOU 3SD5A 3AE4B 4M01A 1N60A 3ZDMC 5HI1A 3PPAA 2LVPA 3NS1A 2DNFA 2ZZPB 1WGKA 3ZTDA 3PT2B 4YSYB 1HTOA 3RN9C 2N9LA 1D6EC 2IGGA 3KQ4A 5EDSA 1TY2A 4B9KA 4YTPB 1NENB 1XXGA 3DBHB 3L13A 2BPSA 2KDIA 1JW9D 2J0JA 1I4QA 5CX3A 3RNCC 3AE3B 4A9AA 2K1FA 1QQRA 4TV3A 5FR3A 3GZNB 2PJHA 3L08A 1K50A 2WU2B 4OVUA 4EZLA 2W3RA 1A70A 4K81A 2KMCA 2N1WA 2ICIA 3DBLI 3TIXA 4BOZB 4DWFA 2MJDA 1TKYA 5JXVA 2ZCCA 1T3QA 1R4MB 4CO7A 2WXRA 1VZ7A 1JRPA 1JWBD 1WRIA 1WGDA 2SEBD 2WX0A 3ZUNA 3KYDD 1SE9A 4YWGG 1ZW7A 3ZRFA 2UU7A 1PDXA 1X1MA 5LLIA 3L10B 1C1YB 1GAQB 2N9EB 1L0YB 2MA9B 2FIFA 2WXFA 1FRRA 2RDBC 2KMMA 3V6CB 1QKZA 3KH0A 1QZEA 2WS3B 3Q8AA 4B0EA 3NG0A 3VAWA 4KX6B 3RNGC 1XQQA 5T8IA 2ZW1A 4EUTA 3DWMA 2RGFA 3IVFA 3TEZA 2L7RA 2JXTA 5LXHA 2EKEC 1N5WA 4RH6A 4EZKA 4JGHB 1L6UA 4II3B 4ASWC 3D32A 2J4XA 1FXAA 1WE6A 3AECB 3QA8A 4KSKC 1HZ5A 4RCOA 2MBOA 1T6BX 2W54A 4MJSA 4C7ZA 2QHOA 4BBNF 2JQRB 2WXGA 3N3KB 3APDA 3KUCB 4MH0E 3HRDD 1TY0A 2V3PA 2UYZB 3AEAB 3V05A 3HK0A 2CU1A 4GXBA 2L3ZA 3AMZA 1HEZE 3P1MA 1VRAB 1J19A 5J18A 4TQ1A 3DWGC 3N1XC 3AEDB 1WIAA 1N61A 3IAS1 4A20A 2KC2A 2MBBB 4FXCA 3CSFA 3TBLD 4HPMB 2FUHB 2IYDB 1NVID 2W55A 4K7UA 3K9OB 2MQJA 3MC9A 1C76A 1LO5D 2INDC 2Z0DB 3N32A 1G6JA 1HXYD 4DDID 2JX5A 2WXPA 2YEPB 4PS3A 1GB1A 4S0RA 2V3NA 3IT4B 3LB8C 1DOYA 2ZJDA 1D5MC 4DHJB 4RM8A 1SEBD 3NUHB 2D5GA 3QQ8B 1ZGUB 2I38A 5JZEB 4M0WB 3I5JC 1MJDA 1C4AA 2NTTA 3AU4A 3NJTA 1SE4A 3DVNV 4LCDE 2G9HD 1EF1A 4F7ZA 2D10A 2OJWA 3EGRA 3NOBA 4IUMB 3TEXA 3FKYA 1NDDA 2PIAA 3URYA 4G0NB 4OZBA 4P16A 4AWJA 5IO9A 1TZOA 3WAOA 3HHMA 4MM3B 3CIRB 2FIDA 2G4DB 1NYRA 2N9PC 2J52A 4LNIA 1IP9A 1YIWA 2V4IB 2L32A 3PREA 1KTKA 5AZGA 3ZGZA 2CU3A 1WGRA 4IM0A 3W5VB 3RT3B 2ZPYA 1GG3A 2K5PA 4GIVA 1UWXA 3N9YC 2KQSA
chains in the Genus database with same CATH topology
3TL5A 1BT0A 2FNJB 1FXTB 4IWQA 4MDKE 3ZVVA 2KWVB 2JRHA 3L54A 3KVFB 1JRUA 4F8CB 2PEAA 3T9LA 3ZDTA 2JY6A 1GC6A 2KWCA 3PRZA 2BYFA 4M8NA 2CR5A 2JPHA 4PYZA 3OJ3A 2AWTA 2JXXA 4BVUC 3RUIB 2LVQA 5IAAC 5G2NA 3VTVA 4XC2A 4WAAA 1Q1OA 2K6QA 3X23A 2WDTB 1WGHA 2ZCBA 4W9JA 2DHZA 4JL9A 2YVCA 4KZCA 4NPNA 1P9DU 5CTRC 4LDTB 2LRWA 4GSWA 4GU2A 3WA0A 2HE7A 3DPDA 4FA6A 2G3QB 2MW5A 5AZFA 4W9GA 2MBHA 3A33B 1R4NI 3MHSD 3R7RA 4ANVA 4KVGB 2KN5A 2KQ7A 1WR6E 4M8MA 4NQLB 5D94A 3VH4B 2LXAA 4DXAB 1WH3A 3WAPA 2NVUI 2LZ6A 3A9JA 3NY5A 4MGKE 1H4RA 3H7PA 4MSMB 2ZNVB 4ZDVA 2K8CA 2AL6A 2WYQA 5LXIB 3KUZA 1Z5SB 2Y5BB 3IG3A 4HXDA 4I6LB 4FJVB 3QK0A 4NAWA 5D6JB 3RZFA 5JHBA 1V6EA 2C7NB 2RSUA 3H6NA 3DVGY 3C0RB 4IG7B 2KVRA 2RR9A 3PHXB 4HK2A 4BKSA 3UGBB 2BWFA 2GOWA 3A9KA 1WJUA 2M8SA 2Z0EB 3APCA 4WWNA 4ZYNA 4CYEA 2BKRB 5FR6A 1E7VA 2RPQA 5KHQA 3QC8B 5D7GA 2OOBB 4GDKA 2IO2B 5AEKB 2BF8B 3LDZE 4KSLC 3ZO5B 4PS8A 1WM3A 4WJPA 1U4AA 2N9XA 3M62B 4TQ0A 3PV1A 2O6VD 1E8WA 4JLCA 1WJ4A 2W9NA 1HE8A 1WZ0A 4WJOA 2KWUB 4HJKA 1V2YA 4AJYB 1UGMA 4NY0A 3AU5A 4F1SA 3NS8A 2M17A 4E3CA 4ICVA 2HTHA 2K39A 4NNJB 3NHEB 4GGQA 4DK5A 1UD7A 4G11A 1WRDB 1VD2A 4LJOB 3U30A 4BBNC 4W9FA 3ONSA 4II2B 1J0GA 2DAFA 3PTFC 2IBIB 2C7MB 2J7QB 3ENEA 1E8ZA 5GMVA 4FHJA 2KK8A 4LJPB 1V9JA 2LXCA 3R3MA 2BWES 3B08A 3PRPB 4YL8A 2KFKB 3HM3A 4ZRJA 2LGXA 3ZNGC 1OEYA 3P2BA 4FULA 3L0WB 3RZWC 2L0FA 1J8CA 1OQYA 3A4RA 5DPTA 2JZZA 2KHWB 4DBGA 4WWOA 2DZIA 2KX3A 2JUOA 1WMHB 2KZRA 3APFA 1GJZA 1WYWB 4ZRKA 1T0YA 4KDLB 1KLVA 5CHWA 1R4MI 2LWPA 2MX2A 2PE9A 3M3JA 2LJ5A 2C5LC 4KDIC 3RCZA 3VUXA 4NJ6A 3QHTA 3QX1A 3ZNZB 2LGYA 1E5WA 1XD3B 3V60A 4ANXA 2JF5A 2MP2B 3TJPA 2LGDA 3UF8A 2YLMA 4FADA 2FAZA 2PE6B 1WR1A 3VQIA 3EFUA 2GBRA 2KTFA 2KKCA 3PSEB 1V5TA 2AYOB 4GOCA 1WE7A 4KIKB 4G3XB 1Q0WB 3ZW3A 1F9JA 2KTRA 5BO4B 2MWSB 1KOTA 3VXWA 3HM6X 3EHVA 3QWZB 2BGFA 4MEMA 2KDBA 3WAMA 4HLEA 5E6PA 3QAQA 2HJ8A 4JQWC 1Q5WB 2DYOA 3U8ZA 2FCMA 3ZKJC 4NJ7A 4KIKA 3OJ4B 2LVOA 1ZKHA 4GDKB 3RYTA 3ZNID 4MELA 5KHOA 1WXSA 2B3AA 3KUDB 2MSED 3IFWB 2M1MA 2AEHA 2N7EA 4EOYA 2DZKA 3A4SC 3SHQA 1WM2A 3PVLA 5CHVC 2XBBC 3WANA 4BKTA 2I1KA 1WF9A 4LDTD 3QIJA 5J17A 2BKFA 4AP4C 2R2OA 2N7DA 1P98A 1VCBA 2IO0B 1WX7A 2WWZA 2O6VA 1C3TA 3VVWB 3O65B 5E6OA 4W9CA 2KLCA 1LQBA 2UWQA 4W9LA 1PQSA 2K8BA 3B0AA 1WZ3A 3ML9A 4HDOA 4JIOU 1WMHA 2CS4A 3AI5A 4W9IA 4X57B 3SD5A 2N4FA 2N1VA 3ZDMC 4BKSD 3WALA 2IZVB 2R2QA 4NQKE 3SDLC 3PPAA 4A3OA 3S2AA 3ZIMA 2LVPA 2ZVNA 4W9EA 3TCAA 2KJRA 2ZZPB 3N30A 3ALBA 2CHXA 1GUAB 2BYVE 2NS5A 1LFDA 3A1QB 3ZLZA 3ZTDA 2ZVOA 3VH3B 3BINA 3PT2B 2IO3B 1WJ6A 2DAJA 2REXA 3M63B 3U7DA 4AJWA 4ANUA 5EDSA 3SU8X 4B9KA 4HCPB 2D3GA 2NBVB 2D11A 3ML8A 2A4ZA 5DPRA 1MG8A 4MJSB 2GBJA 2O6VB 3L13A 2BPSA 2KJHB 2XK5A 3DOWA 2D2QA 2KDIA 2LASA 4OVVA 5L95C 4DHZE 3UIPB 2J0JA 4GDLB 2V4LA 3KYCD 4N9F4 3JVZX 5CX3A 1CMXB 4A3PA 3MJWA 1XT9B 2KNBA 3VTWA 3W1SC 2ZPNA 2K1FA 3UQBA 1P0RA 1D3ZA 4TV3A 2V1YA 2L8JA 2V3SA 1WGGA 2PJHA 3L08A 3L17A 5DPWA 4OVUA 4EZLA 4K81A 1E8XA 2KMCA 3BY4B 2N1WA 3VDZA 2EMSA 4CHKA 4ZRIA 1NBFC 3DBLI 3TIXA 4BOZB 5C1ZA 4DWFA 4PS7A 1I42A 4FN2A 4RM9A 2ZCCA 4NAWB 3PHWB 4CO7A 3H7SA 2O2VA 3WIMA 4J6IA 2K25A 1SIFA 2CHZA 1WGDA 4EEWA 4K7WA 2WX0A 3A9KB 3H7PB 4P7IA 4AOFA 3PGEA 3V61A 1TBEA 4EKUA 2MP2A 3ZUNA 3KYDD 1WXVA 1SE9A 1UH6A 2FCSA 2OJRA 3B1LX 1ZW7A 4XX5A 3ZRFA 2C7HA 1X1MA 3DVNU 5LLIA 3L10B 2LI5A 3CF6E 1C1YB 3VUWA 2N9EB 1M94A 2MA9B 1RAXA 2FIFA 3UQAA 3V6CB 5JHAA 3KH0A 3QCAA 1QZEA 5DCNA 2KO3A 2GBNA 2LUEA 3CMMB 1YQBA 4EZJA 3A9JB 1E8YA 2LD9A 3NZUA 2DX5B 1LXDA 2KANA 3T8MA 1RFAA 1S3SG 3K9PB 4KZ0A 3ZNHB 4G50A 3VAWA 2XEWA 1V80A 4EFOA 2G45B 4HDQA 4HVBA 1XQQA 2DZJA 3Q3JA 1RRBA 1A5RA 5L83A 4FLHA 5CHFA 1WJNA 2J0MA 4W9KA 4EUTA 4DDGD 2RGFA 3JW0X 2IO1B 3W1SA 4IM2A 3OLMD 5AZHA 4GMVA 1UZXB 2MCNB 4I6NB 3IVFA 1V86A 2L7RA 2M4NA 5LXHA 5TR5A 1IYFA 3PRMB 2EKEC 4PYUA 1V5OA 3VUYA 4EZKA 1TTNA 3M95A 1YX6B 4JGHB 2K6DB 4II3B 2IY0B 1I35A 5G55A 4ASWC 3D32A 1WE6A 3QA8A 4KSKC 2DYMA 4WWPA 2JT4B 2MBOA 2XK5B 3ZTCA 2MRPA 4MJSA 3UIOB 2QHOA 2NPTB 4BBNF 3JYUA 2NBWB 2CHWA 1SGHA 1UELA 2GBKA 1WGYA 3APDA 3N3KB 1YJ1A 3KUCB 3OAWA 1P1AA 1LM8B 2DZMA 3Q3FA 4MH0E 2NBUA 3PLUA 3VTUA 2NR2A 3EECA 2UYZB 2CKHB 3A1QA 3HIZA 3TMPB 2JZ3B 3PS6A 4IWPA 3DBHI 3HK0A 2CU1A 4GXBA 2L3ZA 1WXAA 1J19A 5J18A 4TQ1A 2L0TA 1WXMA 2FCQA 2MBQA 2RD0A 4HPLB 1WIAA 5J2RA 2HD5B 4IM3A 2JRIB 3V6EB 4A20A 4IW0A 4MGZE 1EO6A 1P3QU 2AL3A 2KC2A 1EF5A 1GC7A 2MBBB 2K8HA 3DBRI 4B95A 2KFKA 4MM3A 3VHTC 3GZNI 4E71A 2KOXA 3R66C 3CSFA 1IPGA 2NCNA 1NI2A 2KDFB 4HPMB 3TBLD 2FUHB 3QJZA 1TGZB 3NZSA 1WY8A 2FCNA 2IYDB 1UBQA 2LRUA 1OTRB 3DQVA 1E90A 3AULA 3X0WA 1Y8RC 3LJ3A 5E6NA 3AXCA 3CSTA 2M0XA 2KJ6A 3I3TB 2MQJA 3K9OB 4K7UA 1WI0A 4GB9A 2MBEA 2VRRB 4XZ4A 3PLVA 1YD8U 3H1UA 2Z0DB 3N32A 1G6JA 4DDID 2A5UA 3VFKA 4FJZA 2C9WB 4K1RB 4WJQA 3H9DA 3IBEA 4RMAA 4PS3A 2G4SA 3DDCB 4FBJB 2L00B 2ZJDA 1ISNA 2KTRB 4RM8A 4FHKA 4DHJB 4KV2A 1RLFA 4MGIE 3W1YA 1L7YA 3UINB 4IC7B 3RULA 4DHJD 3QQ8B 1ZGUB 5JZEB 4M0WB 2EMTA 4HCNB 3QARA 3L16A 4ICUA 2JWZA 2JVCA 5DPSA 4B6WA 4WJNA 3AU4A 2KMAA 4GDLA 1L2NA 1WFYA 3DVNV 1OEYJ 1OGWA 4LCDE 4MSQB 5HKHA 2DENB 3MTNB 2MLBA 3DVGX 1EF1A 4WQOB 4F7ZA 1TZ1A 5IA7A 2DYBA 3V62A 2D10A 4TUUA 2PPHA 3JSVB 4I6PA 3NOBA 4BOSC 4HWIB 1Z2MA 4IUMB 1NDDA 2WX1A 2D07B 4AUQC 4G0NB 2C60A 4AWJA 4URKA 4TKNA 2L76A 2KXJA 4IWOA 2KLGA 4W9HA 3WAOA 3HHMA 2KC1A 1H8CA 2KFJA 2FIDA 4W9DA 2G4DB 2N9PC 5C23A 2Z59B 3ECIA 2KDEB 1IP9A 3EC8A 1YIWA 4DHZB 1V81A 1V49A 2KD0A 3JSVA 3PREA 3R7QA 4BFRA 5AZGA 3DCGA 1KM7A 1KJTA 1WGRA 2BYEA 1WX9A 3RD2A 2ZEQA 2O2VB 4K7SA 1E7UA 2GMIC 4IM0A 3ZRCA 2ASQA 3RT3B 2ZPYA 2I1JA 4FJYA 4ANWA 3IHPC 1GG3A 2IY1B 1K8RB 5D2MB 4GN1A 5JH5C 3PZDA 1GNUA 2KX0A 4GIVA 4BKGA 3DBSA 1EUVB 1S1QB 1UBIA 2J0KA 1WX8A 3GOEA 4E74A 1YX5B 2ZNVC 4MGYE 2KQSA 1AARA 2L05A 2NPTA 2GBMA 3KW5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TL5 A;  1BT0 A;  2FNJ B;  1FXT B;  4IWQ A;  4MDK E;  3ZVV A;  2KWV B;  2JRH A;  3L54 A;  3KVF B;  1JRU A;  4F8C B;  2PEA A;  3T9L A;  3ZDT A;  2JY6 A;  1GC6 A;  2KWC A;  3PRZ A;  2BYF A;  4M8N A;  2CR5 A;  2JPH A;  4PYZ A;  3OJ3 A;  2AWT A;  2JXX A;  4BVU C;  3RUI B;  2LVQ A;  5IAA C;  5G2N A;  3VTV A;  4XC2 A;  4WAA A;  1Q1O A;  2K6Q A;  3X23 A;  2WDT B;  1WGH A;  2ZCB A;  4W9J A;  2DHZ A;  4JL9 A;  2YVC A;  4KZC A;  4NPN A;  1P9D U;  5CTR C;  4LDT B;  2LRW A;  4GSW A;  4GU2 A;  3WA0 A;  2HE7 A;  3DPD A;  4FA6 A;  2G3Q B;  2MW5 A;  5AZF A;  4W9G A;  2MBH A;  3A33 B;  1R4N I;  3MHS D;  3R7R A;  4ANV A;  4KVG B;  2KN5 A;  2KQ7 A;  1WR6 E;  4M8M A;  4NQL B;  5D94 A;  3VH4 B;  2LXA A;  4DXA B;  1WH3 A;  3WAP A;  2NVU I;  2LZ6 A;  3A9J A;  3NY5 A;  4MGK E;  1H4R A;  3H7P A;  4MSM B;  2ZNV B;  4ZDV A;  2K8C A;  2AL6 A;  2WYQ A;  5LXI B;  3KUZ A;  1Z5S B;  2Y5B B;  3IG3 A;  4HXD A;  4I6L B;  4FJV B;  3QK0 A;  4NAW A;  5D6J B;  3RZF A;  5JHB A;  1V6E A;  2C7N B;  2RSU A;  3H6N A;  3DVG Y;  3C0R B;  4IG7 B;  2KVR A;  2RR9 A;  3PHX B;  4HK2 A;  4BKS A;  3UGB B;  2BWF A;  2GOW A;  3A9K A;  1WJU A;  2M8S A;  2Z0E B;  3APC A;  4WWN A;  4ZYN A;  4CYE A;  2BKR B;  5FR6 A;  1E7V A;  2RPQ A;  5KHQ A;  3QC8 B;  5D7G A;  2OOB B;  4GDK A;  2IO2 B;  5AEK B;  2BF8 B;  3LDZ E;  4KSL C;  3ZO5 B;  4PS8 A;  1WM3 A;  4WJP A;  1U4A A;  2N9X A;  3M62 B;  4TQ0 A;  3PV1 A;  2O6V D;  1E8W A;  4JLC A;  1WJ4 A;  2W9N A;  1HE8 A;  1WZ0 A;  4WJO A;  2KWU B;  4HJK A;  1V2Y A;  4AJY B;  1UGM A;  4NY0 A;  3AU5 A;  4F1S A;  3NS8 A;  2M17 A;  4E3C A;  4ICV A;  2HTH A;  2K39 A;  4NNJ B;  3NHE B;  4GGQ A;  4DK5 A;  1UD7 A;  4G11 A;  1WRD B;  1VD2 A;  4LJO B;  3U30 A;  4BBN C;  4W9F A;  3ONS A;  4II2 B;  1J0G A;  2DAF A;  3PTF C;  2IBI B;  2C7M B;  2J7Q B;  3ENE A;  1E8Z A;  5GMV A;  4FHJ A;  2KK8 A;  4LJP B;  1V9J A;  2LXC A;  3R3M A;  2BWE S;  3B08 A;  3PRP B;  4YL8 A;  2KFK B;  3HM3 A;  4ZRJ A;  2LGX A;  3ZNG C;  1OEY A;  3P2B A;  4FUL A;  3L0W B;  3RZW C;  2L0F A;  1J8C A;  1OQY A;  3A4R A;  5DPT A;  2JZZ A;  2KHW B;  4DBG A;  4WWO A;  2DZI A;  2KX3 A;  2JUO A;  1WMH B;  2KZR A;  3APF A;  1GJZ A;  1WYW B;  4ZRK A;  1T0Y A;  4KDL B;  1KLV A;  5CHW A;  1R4M I;  2LWP A;  2MX2 A;  2PE9 A;  3M3J A;  2LJ5 A;  2C5L C;  4KDI C;  3RCZ A;  3VUX A;  4NJ6 A;  3QHT A;  3QX1 A;  3ZNZ B;  2LGY A;  1E5W A;  1XD3 B;  3V60 A;  4ANX A;  2JF5 A;  2MP2 B;  3TJP A;  2LGD A;  3UF8 A;  2YLM A;  4FAD A;  2FAZ A;  2PE6 B;  1WR1 A;  3VQI A;  3EFU A;  2GBR A;  2KTF A;  2KKC A;  3PSE B;  1V5T A;  2AYO B;  4GOC A;  1WE7 A;  4KIK B;  4G3X B;  1Q0W B;  3ZW3 A;  1F9J A;  2KTR A;  5BO4 B;  2MWS B;  1KOT A;  3VXW A;  3HM6 X;  3EHV A;  3QWZ B;  2BGF A;  4MEM A;  2KDB A;  3WAM A;  4HLE A;  5E6P A;  3QAQ A;  2HJ8 A;  4JQW C;  1Q5W B;  2DYO A;  3U8Z A;  2FCM A;  3ZKJ C;  4NJ7 A;  4KIK A;  3OJ4 B;  2LVO A;  1ZKH A;  4GDK B;  3RYT A;  3ZNI D;  4MEL A;  5KHO A;  1WXS A;  2B3A A;  3KUD B;  2MSE D;  3IFW B;  2M1M A;  2AEH A;  2N7E A;  4EOY A;  2DZK A;  3A4S C;  3SHQ A;  1WM2 A;  3PVL A;  5CHV C;  2XBB C;  3WAN A;  4BKT A;  2I1K A;  1WF9 A;  4LDT D;  3QIJ A;  5J17 A;  2BKF A;  4AP4 C;  2R2O A;  2N7D A;  1P98 A;  1VCB A;  2IO0 B;  1WX7 A;  2WWZ A;  2O6V A;  1C3T A;  3VVW B;  3O65 B;  5E6O A;  4W9C A;  2KLC A;  1LQB A;  2UWQ A;  4W9L A;  1PQS A;  2K8B A;  3B0A A;  1WZ3 A;  3ML9 A;  4HDO A;  4JIO U;  1WMH A;  2CS4 A;  3AI5 A;  4W9I A;  4X57 B;  3SD5 A;  2N4F A;  2N1V A;  3ZDM C;  4BKS D;  3WAL A;  2IZV B;  2R2Q A;  4NQK E;  3SDL C;  3PPA A;  4A3O A;  3S2A A;  3ZIM A;  2LVP A;  2ZVN A;  4W9E A;  3TCA A;  2KJR A;  2ZZP B;  3N30 A;  3ALB A;  2CHX A;  1GUA B;  2BYV E;  2NS5 A;  1LFD A;  3A1Q B;  3ZLZ A;  3ZTD A;  2ZVO A;  3VH3 B;  3BIN A;  3PT2 B;  2IO3 B;  1WJ6 A;  2DAJ A;  2REX A;  3M63 B;  3U7D A;  4AJW A;  4ANU A;  5EDS A;  3SU8 X;  4B9K A;  4HCP B;  2D3G A;  2NBV B;  2D11 A;  3ML8 A;  2A4Z A;  5DPR A;  1MG8 A;  4MJS B;  2GBJ A;  2O6V B;  3L13 A;  2BPS A;  2KJH B;  2XK5 A;  3DOW A;  2D2Q A;  2KDI A;  2LAS A;  4OVV A;  5L95 C;  4DHZ E;  3UIP B;  2J0J A;  4GDL B;  2V4L A;  3KYC D;  4N9F 4;  3JVZ X;  5CX3 A;  1CMX B;  4A3P A;  3MJW A;  1XT9 B;  2KNB A;  3VTW A;  3W1S C;  2ZPN A;  2K1F A;  3UQB A;  1P0R A;  1D3Z A;  4TV3 A;  2V1Y A;  2L8J A;  2V3S A;  1WGG A;  2PJH A;  3L08 A;  3L17 A;  5DPW A;  4OVU A;  4EZL A;  4K81 A;  1E8X A;  2KMC A;  3BY4 B;  2N1W A;  3VDZ A;  2EMS A;  4CHK A;  4ZRI A;  1NBF C;  3DBL I;  3TIX A;  4BOZ B;  5C1Z A;  4DWF A;  4PS7 A;  1I42 A;  4FN2 A;  4RM9 A;  2ZCC A;  4NAW B;  3PHW B;  4CO7 A;  3H7S A;  2O2V A;  3WIM A;  4J6I A;  2K25 A;  1SIF A;  2CHZ A;  1WGD A;  4EEW A;  4K7W A;  2WX0 A;  3A9K B;  3H7P B;  4P7I A;  4AOF A;  3PGE A;  3V61 A;  1TBE A;  4EKU A;  2MP2 A;  3ZUN A;  3KYD D;  1WXV A;  1SE9 A;  1UH6 A;  2FCS A;  2OJR A;  3B1L X;  1ZW7 A;  4XX5 A;  3ZRF A;  2C7H A;  1X1M A;  3DVN U;  5LLI A;  3L10 B;  2LI5 A;  3CF6 E;  1C1Y B;  3VUW A;  2N9E B;  1M94 A;  2MA9 B;  1RAX A;  2FIF A;  3UQA A;  3V6C B;  5JHA A;  3KH0 A;  3QCA A;  1QZE A;  5DCN A;  2KO3 A;  2GBN A;  2LUE A;  3CMM B;  1YQB A;  4EZJ A;  3A9J B;  1E8Y A;  2LD9 A;  3NZU A;  2DX5 B;  1LXD A;  2KAN A;  3T8M A;  1RFA A;  1S3S G;  3K9P B;  4KZ0 A;  3ZNH B;  4G50 A;  3VAW A;  2XEW A;  1V80 A;  4EFO A;  2G45 B;  4HDQ A;  4HVB A;  1XQQ A;  2DZJ A;  3Q3J A;  1RRB A;  1A5R A;  5L83 A;  4FLH A;  5CHF A;  1WJN A;  2J0M A;  4W9K A;  4EUT A;  4DDG D;  2RGF A;  3JW0 X;  2IO1 B;  3W1S A;  4IM2 A;  3OLM D;  5AZH A;  4GMV A;  1UZX B;  2MCN B;  4I6N B;  3IVF A;  1V86 A;  2L7R A;  2M4N A;  5LXH A;  5TR5 A;  1IYF A;  3PRM B;  2EKE C;  4PYU A;  1V5O A;  3VUY A;  4EZK A;  1TTN A;  3M95 A;  1YX6 B;  4JGH B;  2K6D B;  4II3 B;  2IY0 B;  1I35 A;  5G55 A;  4ASW C;  3D32 A;  1WE6 A;  3QA8 A;  4KSK C;  2DYM A;  4WWP A;  2JT4 B;  2MBO A;  2XK5 B;  3ZTC A;  2MRP A;  4MJS A;  3UIO B;  2QHO A;  2NPT B;  4BBN F;  3JYU A;  2NBW B;  2CHW A;  1SGH A;  1UEL A;  2GBK A;  1WGY A;  3APD A;  3N3K B;  1YJ1 A;  3KUC B;  3OAW A;  1P1A A;  1LM8 B;  2DZM A;  3Q3F A;  4MH0 E;  2NBU A;  3PLU A;  3VTU A;  2NR2 A;  3EEC A;  2UYZ B;  2CKH B;  3A1Q A;  3HIZ A;  3TMP B;  2JZ3 B;  3PS6 A;  4IWP A;  3DBH I;  3HK0 A;  2CU1 A;  4GXB A;  2L3Z A;  1WXA A;  1J19 A;  5J18 A;  4TQ1 A;  2L0T A;  1WXM A;  2FCQ A;  2MBQ A;  2RD0 A;  4HPL B;  1WIA A;  5J2R A;  2HD5 B;  4IM3 A;  2JRI B;  3V6E B;  4A20 A;  4IW0 A;  4MGZ E;  1EO6 A;  1P3Q U;  2AL3 A;  2KC2 A;  1EF5 A;  1GC7 A;  2MBB B;  2K8H A;  3DBR I;  4B95 A;  2KFK A;  4MM3 A;  3VHT C;  3GZN I;  4E71 A;  2KOX A;  3R66 C;  3CSF A;  1IPG A;  2NCN A;  1NI2 A;  2KDF B;  4HPM B;  3TBL D;  2FUH B;  3QJZ A;  1TGZ B;  3NZS A;  1WY8 A;  2FCN A;  2IYD B;  1UBQ A;  2LRU A;  1OTR B;  3DQV A;  1E90 A;  3AUL A;  3X0W A;  1Y8R C;  3LJ3 A;  5E6N A;  3AXC A;  3CST A;  2M0X A;  2KJ6 A;  3I3T B;  2MQJ A;  3K9O B;  4K7U A;  1WI0 A;  4GB9 A;  2MBE A;  2VRR B;  4XZ4 A;  3PLV A;  1YD8 U;  3H1U A;  2Z0D B;  3N32 A;  1G6J A;  4DDI D;  2A5U A;  3VFK A;  4FJZ A;  2C9W B;  4K1R B;  4WJQ A;  3H9D A;  3IBE A;  4RMA A;  4PS3 A;  2G4S A;  3DDC B;  4FBJ B;  2L00 B;  2ZJD A;  1ISN A;  2KTR B;  4RM8 A;  4FHK A;  4DHJ B;  4KV2 A;  1RLF A;  4MGI E;  3W1Y A;  1L7Y A;  3UIN B;  4IC7 B;  3RUL A;  4DHJ D;  3QQ8 B;  1ZGU B;  5JZE B;  4M0W B;  2EMT A;  4HCN B;  3QAR A;  3L16 A;  4ICU A;  2JWZ A;  2JVC A;  5DPS A;  4B6W A;  4WJN A;  3AU4 A;  2KMA A;  4GDL A;  1L2N A;  1WFY A;  3DVN V;  1OEY J;  1OGW A;  4LCD E;  4MSQ B;  5HKH A;  2DEN B;  3MTN B;  2MLB A;  3DVG X;  1EF1 A;  4WQO B;  4F7Z A;  1TZ1 A;  5IA7 A;  2DYB A;  3V62 A;  2D10 A;  4TUU A;  2PPH A;  3JSV B;  4I6P A;  3NOB A;  4BOS C;  4HWI B;  1Z2M A;  4IUM B;  1NDD A;  2WX1 A;  2D07 B;  4AUQ C;  4G0N B;  2C60 A;  4AWJ A;  4URK A;  4TKN A;  2L76 A;  2KXJ A;  4IWO A;  2KLG A;  4W9H A;  3WAO A;  3HHM A;  2KC1 A;  1H8C A;  2KFJ A;  2FID A;  4W9D A;  2G4D B;  2N9P C;  5C23 A;  2Z59 B;  3ECI A;  2KDE B;  1IP9 A;  3EC8 A;  1YIW A;  4DHZ B;  1V81 A;  1V49 A;  2KD0 A;  3JSV A;  3PRE A;  3R7Q A;  4BFR A;  5AZG A;  3DCG A;  1KM7 A;  1KJT A;  1WGR A;  2BYE A;  1WX9 A;  3RD2 A;  2ZEQ A;  2O2V B;  4K7S A;  1E7U A;  2GMI C;  4IM0 A;  3ZRC A;  2ASQ A;  3RT3 B;  2ZPY A;  2I1J A;  4FJY A;  4ANW A;  3IHP C;  1GG3 A;  2IY1 B;  1K8R B;  5D2M B;  4GN1 A;  5JH5 C;  3PZD A;  1GNU A;  2KX0 A;  4GIV A;  4BKG A;  3DBS A;  1EUV B;  1S1Q B;  1UBI A;  2J0K A;  1WX8 A;  3GOE A;  4E74 A;  1YX5 B;  2ZNV C;  4MGY E;  2KQS A;  1AAR A;  2L05 A;  2NPT A;  2GBM A;  3KW5 B; 
#chains in the Genus database with same CATH topology
 3BYY B;  5I4D A;  2KQ4 X;  2KWV B;  3GB1 A;  3KVF B;  3ZDT A;  2JY6 A;  4JE3 B;  4M8N A;  2CR5 A;  2AWT A;  3VTV A;  3DBR B;  4WAA A;  1Q1O A;  4XC2 A;  2WDT B;  1WGH A;  4W9J A;  2YVC A;  3ETR A;  4NPN A;  5EE3 A;  2SAK A;  1TS3 A;  4RGN A;  2AQ3 B;  3WA0 A;  3DPD A;  4KGR A;  4FA6 A;  2G3Q B;  2MW5 A;  4C00 A;  3EUB 2;  4W9G A;  3HUI A;  1YN4 A;  1PYW D;  1R4N I;  1WR6 E;  1I4P A;  4NQL B;  2QC8 A;  3BK2 A;  3GS2 A;  2NVU I;  1PFD A;  4MGK E;  4P1C C;  2Z8L A;  3H7P A;  4MSM B;  2ZNV B;  4ZDV A;  4EE2 A;  2AL6 A;  2ON8 A;  2QEJ C;  4LNO A;  5JHB A;  3RZF A;  4FJV B;  3QK0 A;  3TEY A;  2RSU A;  1L5P A;  2V0G A;  4BKS A;  5BMH A;  4ZYN A;  2AQ1 B;  3DHG C;  4CYE A;  4LNF A;  2GB1 A;  1ZXI A;  2BF8 B;  3LDZ E;  3ZO5 B;  4XGA B;  4TQ0 A;  1E8W A;  2W9N A;  4P1B C;  2IGD A;  4NY0 A;  2K9X A;  2M17 A;  4ICV A;  4IKG A;  4GGQ A;  1WRD B;  3U30 A;  3GE8 C;  1JAL A;  3ENE A;  5GMV A;  4M00 A;  4FHJ A;  2KK8 A;  1V9J A;  2M0A A;  1FCC C;  2MHJ A;  2LGX A;  1J8C A;  1OQY A;  1J7B A;  2KHW B;  5HFY A;  4WWO A;  1TT5 B;  2DBY A;  1RWS A;  1GJZ A;  1E9M A;  1T0Y A;  1TS4 A;  2BT6 A;  4KDL B;  1MVK A;  1R4M I;  1LGR A;  3RCZ A;  2CJO A;  3QHT A;  3QX1 A;  1E5W A;  1KLG D;  3RI7 C;  2MP2 B;  2LGD A;  3UF8 A;  1WR1 A;  1I4R A;  2J53 A;  4RNA A;  1D5X C;  1DGJ A;  3PSE B;  2AYO B;  3AE8 B;  4GOC A;  4KIK B;  3W5U B;  1KOT A;  5TSS A;  1FFU A;  3TSS A;  4MEM A;  5E6P A;  2HJ8 A;  1Q5W B;  1JQ4 A;  2WXN A;  3U8Z A;  4KIK A;  1ZKH A;  3EFC A;  3R2T A;  4XDC A;  2MSE D;  2AEH A;  1P7F A;  2N7E A;  1KH0 A;  3A4S C;  3SHQ A;  4ZHO A;  3PVL A;  3AB5 A;  4BKT A;  3TUO A;  3QIJ A;  5J17 A;  4AP4 C;  1FM0 D;  1N6Z A;  1P98 A;  1VCB A;  2WWZ A;  1WX7 A;  2O6V A;  3VVW B;  2WHI A;  1C4C A;  2KLC A;  1LQB A;  3AN1 A;  2UWQ A;  3ML9 A;  4BAX A;  2MH7 A;  2RMM A;  4X57 B;  4L23 A;  2N4F A;  1PGA A;  4LK0 M;  2N1V A;  3WAL A;  1JWU D;  4H2A A;  2IZV B;  4NQK E;  2INC C;  3SFD B;  1C77 A;  1ZUD 2;  2KJR A;  3N30 A;  2NS5 A;  2IO3 B;  2REX A;  2IGH A;  3SU8 X;  1MPE A;  2A4Z A;  2TSS A;  4LTU A;  1F52 A;  2GBJ A;  3BZD B;  3V3X A;  3KLS X;  4MT5 A;  5L95 C;  3P4Q B;  4N9F 4;  1BML C;  1NYQ A;  1CMX B;  3MJW A;  3W1S C;  1D3Z A;  2V3S A;  3L17 A;  5DPW A;  3BY4 B;  4QAY A;  3VDZ A;  4XE0 A;  3AE6 B;  4ZRI A;  5G5G A;  5C1Z A;  3RPF C;  4PS7 A;  4RM9 A;  2JWU A;  4CQN A;  3IXS A;  4YTM B;  1WWT A;  4J6I A;  4K7W A;  3A9K B;  4EKU A;  1V8C A;  2OJR A;  3ZYY X;  1F1H A;  3MJ5 A;  2PVG C;  2PMV A;  2I2Y A;  4YSX B;  2LI5 A;  2DWQ A;  2KDM A;  4Q2J A;  3VUW A;  1DYQ A;  3NRZ A;  1RAX A;  3UQA A;  5JHA A;  3GP7 A;  5DCN A;  3CMM B;  4RFB A;  1YQB A;  5BMG A;  2JZP A;  3A9J B;  1E8Y A;  3NZU A;  4NZL B;  1LXD A;  3T8M A;  1EWY C;  1QT9 A;  3K9P B;  4KZ0 A;  3ZNH B;  4G50 A;  2G45 B;  2PW9 A;  4HVB A;  2LHD A;  5L83 A;  4US8 A;  4IOI E;  3B2G A;  3OLM D;  3P4S B;  2MCN B;  4I6N B;  1TYG B;  1V86 A;  4WH4 A;  3PO0 A;  3M95 A;  2PVO D;  2K6D B;  2DYM A;  3MC0 B;  4WWP A;  2JT4 B;  3ZTC A;  1PUT A;  2NPT B;  1D4B A;  2CHW A;  1YJ1 A;  1P1A A;  3MP9 A;  4N58 A;  2NR2 A;  5E6J A;  4IWP A;  1E6E B;  5J2R A;  2HD5 B;  4IM3 A;  2AL3 A;  1JCK B;  1EF5 A;  1GC7 A;  1YN5 A;  2K22 A;  1TS5 A;  3DBR I;  4B95 A;  2N9K A;  2KFK A;  4E71 A;  2KOX A;  1IPG A;  2N0S B;  2KDF B;  1I4H A;  1WY8 A;  1UBQ A;  1OTR B;  3AH7 A;  3DBL B;  1R4N B;  4C80 A;  4L2Y A;  5E6N A;  2KJ6 A;  3I3T B;  1WI0 A;  2H88 B;  2VRR B;  3PLV A;  4OW0 A;  1FEH A;  2QMT A;  1V1O A;  2A5U A;  3VFK A;  2C9W B;  4K1R B;  4WJQ A;  3H9D A;  4RMA A;  2G4S A;  1RFK A;  2IDY A;  4KV2 A;  1RLF A;  4MGI E;  1FNU A;  4D2K A;  4XYC A;  1L7Y A;  1YQ4 B;  1IGD A;  3VR8 B;  5H8Y E;  2EMT A;  3QAR A;  1DOI A;  3L16 A;  2G1E A;  4WJN A;  1PGX A;  1L2N A;  1WFY A;  1OEY J;  1B1Z A;  2DEN B;  2MLB A;  5G5H A;  3V62 A;  3BVM A;  1T0R C;  2BW2 A;  3NVY A;  2D07 B;  4AUQ C;  4RGO S;  2KN4 A;  2L52 A;  3MC8 A;  2KXJ A;  4IWO A;  2KLG A;  2KC1 A;  2YEP F;  2KWD A;  5IOI A;  1L0X B;  4HRO A;  1V49 A;  2WLB A;  2KD0 A;  3R7Q A;  4BFR A;  1KJT A;  2O2V B;  1IUE A;  4K7S A;  2FBW B;  1I4X A;  3ZRC A;  2ASQ A;  2I1J A;  4YTN B;  3IHP C;  5D2M B;  1T5X D;  3DBS A;  3PZ7 A;  1S1Q B;  4MGY E;  2L05 A;  3KW5 B;  3TL5 A;  4J3O D;  2BB5 A;  5IN7 A;  2PEA A;  1MG4 A;  1GC6 A;  2KWC A;  1IBX A;  1Y56 A;  2JPH A;  2JXX A;  5IAA C;  5G2N A;  3X23 A;  2K6Q A;  1FRD A;  5CTR C;  4LDT B;  2LRW A;  4GSW A;  4GU2 A;  2HE7 A;  2W82 A;  3R7R A;  1ET6 A;  4ANV A;  4M8M A;  1GPX A;  1XCT L;  2D3C A;  3VH4 B;  1WH3 A;  3WAP A;  3FC4 A;  2LZ6 A;  1VZ6 A;  1H4R A;  4A8X C;  2K8C A;  2WYQ A;  1Z5S B;  3IG3 A;  4I6L B;  5D6J B;  3C0R B;  3MHZ A;  2RR9 A;  1FNW A;  3UGB B;  3AEF B;  1XO3 A;  1B9R A;  1WJU A;  2AX5 A;  2Z0E B;  3HVZ A;  4M0W A;  2JU6 X;  4DQO C;  1J7C A;  4P6V F;  1JRO A;  4KSL C;  1FNV A;  5GXG B;  4PS8 A;  2N9X A;  1QOA A;  3PV1 A;  2LFI A;  2O6V D;  3P63 A;  1WYG A;  2QSD A;  4DXF A;  2KWU B;  1ZE3 D;  3KWL A;  3AU5 A;  4F1S A;  3TEW A;  2PTL A;  4DK5 A;  4BBN C;  4II2 B;  4XWT A;  1L4D B;  2DAF A;  4ITK A;  2KAJ A;  2D3B A;  2C7M B;  2GI9 A;  1UWM A;  1HQR D;  1YOV B;  3SR6 A;  2LXC A;  1YQ3 B;  1BUI C;  3PRP B;  1XLQ A;  1BXT A;  3P2B A;  4FUL A;  3RZW C;  3L0W B;  1YJJ A;  3A4R A;  1FFV A;  1WMH B;  2MEK A;  2LWP A;  2LJ5 A;  2GRI A;  4MAC A;  1V97 A;  4K3C A;  4FAD A;  2FAZ A;  3EFU A;  2MJE A;  4OZC A;  2D3A A;  2KKC A;  1WE7 A;  4G3X B;  1F9J A;  2KTR A;  1ACC A;  2BGF A;  3ABV B;  4HLE A;  4AQ7 A;  4O1N A;  2FCM A;  2WXJ A;  5BYS A;  3OJ4 B;  2LVO A;  3I9V 1;  1AWD A;  3OWE B;  2DZK A;  1RM6 C;  1WM2 A;  2WQY B;  1WF9 A;  1EWC A;  4LDT D;  2BKF A;  5H92 C;  2R2O A;  3N1Z C;  2IO0 B;  1YNT E;  2LEK A;  3C8Y A;  4TMA B;  1YN3 A;  1WMH A;  2CS4 A;  4L1B A;  4WAF A;  1D5Z C;  3SDL C;  2HJ1 A;  4A3O A;  3Q8E A;  2ZVN A;  3ZIM A;  3TCA A;  3ALB A;  2CHX A;  3ZLZ A;  2E3T A;  4YXD B;  1L6V A;  2DAJ A;  3IAM 1;  4HRS A;  2D3G A;  2D11 A;  2WDV B;  5DPR A;  2WXQ A;  2O6V B;  3BII D;  2XK5 A;  2D2Q A;  2LAS A;  4OVV A;  4R3D A;  4DHZ E;  3KYC D;  1XT9 B;  2KNB A;  4HKZ E;  2ZPN A;  3UQB A;  1P0R A;  1E8X A;  1SF0 A;  3HVD A;  2ONQ A;  2EMS A;  4FN2 A;  2VZK D;  1KFY B;  4NAW B;  3WIM A;  1SIF A;  1ENF A;  2CHZ A;  2DLB A;  4A6Q A;  4P7I A;  4AOF A;  3PGE A;  3V61 A;  1TBE A;  5LNK 1;  2MP2 A;  1FD6 A;  4XX5 A;  3B1L X;  2FCS A;  1N62 A;  2C7H A;  3CF6 E;  2KYW A;  2WU5 B;  3ZXV A;  3QCA A;  5AUI A;  2KO3 A;  4EZJ A;  2EEL A;  2Q5W D;  2LD9 A;  2DX5 B;  2KAN A;  3BYT B;  3Q6B A;  1RFA A;  1S3S G;  1I4G A;  1K51 A;  1V80 A;  4EFO A;  3OG5 A;  4HDQ A;  1QF6 A;  1RRB A;  4FLH A;  1UF0 A;  5CHF A;  1F0Z A;  1SSN A;  3JW0 X;  2IO1 B;  2FE8 A;  1ZDV A;  4KGT A;  1UZX B;  2B76 B;  3PRM B;  3VUY A;  1TTN A;  1YX6 B;  1F2R I;  4JX1 C;  1I35 A;  2IY0 B;  5BMI A;  5G55 A;  2OHF A;  1K52 A;  3JYU A;  1SGH A;  2J42 A;  2E6X A;  3OAW A;  1FIQ A;  2DZM A;  1CJE A;  1TJE A;  4ARC A;  2NBU A;  3Q2A C;  3VTU A;  4S17 A;  3RNF C;  2CKH B;  2KAC A;  3A1Q A;  1NEK B;  2JZ3 B;  3PS6 A;  3DBH I;  1MI0 A;  3L4P A;  1VR9 A;  3I63 C;  2FCQ A;  2MBQ A;  4GLS C;  2K0P A;  3V6E B;  4IW0 A;  1EO6 A;  1P3Q U;  2K8H A;  2BS4 B;  3VHT C;  1JML A;  1NI2 A;  2NCN A;  3UI3 A;  1TGZ B;  2FCN A;  4IDI A;  5FKA C;  2LRU A;  3GE3 C;  3X0W A;  3AEB B;  3LJ3 A;  1R7S A;  2INN E;  3AXC A;  2M0X A;  1HZ6 A;  1L0V B;  2K3U A;  4ZRP A;  2V9H A;  3P4R B;  2MBE A;  3H1U A;  1PGB A;  1JWA D;  1VLB A;  4B0M A;  3T3O A;  1SXT A;  3DDC B;  4FBJ B;  3W9C B;  1ISN A;  4FHK A;  3Q8C A;  3UIN B;  4IC7 B;  4DHJ D;  4HCN B;  4ICU A;  5DPS A;  2WGS A;  4B6W A;  4GDL A;  3BVG A;  2BS2 B;  1OGW A;  2H89 B;  4NAM A;  3MTN B;  3DVG X;  4WQO B;  1VZ8 A;  1TIF A;  2DYB A;  4TUU A;  2PPH A;  4C4V A;  5C2T B;  4URK A;  2L76 A;  4RF1 A;  1XLN A;  4W9H A;  2BB6 A;  2KFJ A;  4W9D A;  2WXH A;  5C23 A;  2Z59 B;  1Q10 A;  3MFG A;  4DHZ B;  3LYY A;  1QLB B;  2BYE A;  1EM7 A;  3RD2 A;  2ZEQ A;  1QOB A;  4A90 A;  1E7U A;  4HKQ A;  2BS3 B;  4FJY A;  2ZW0 A;  4ANW A;  4GN1 A;  5JH5 C;  3PZD A;  1GNU A;  3C19 A;  1UBI A;  2J0K A;  3GOE A;  1YX5 B;  4US9 A;  2ZNV C;  4A55 A;  1AAR A;  2NPT A;  2KVZ A;  1CZP A;  3B2F A;  1FXT B;  2JYE A;  1T0S C;  3ZVV A;  2JRH A;  3T9L A;  3PRZ A;  2BYF A;  1M4V A;  4BVU C;  4RF0 A;  2LVQ A;  3RUI B;  3WCQ A;  2DHZ A;  3NVZ A;  4JL9 A;  1P9D U;  4OZA A;  5AZF A;  3AEE B;  2WXO A;  4KVG B;  2KQ7 A;  2LXA A;  1WSP A;  4DXA B;  2CJN A;  3A9J A;  5EE1 A;  3H8H A;  2XNA C;  3ZJT A;  3KUZ A;  5MPO A;  1T0Q C;  4XDD A;  4IG7 B;  4HK2 A;  5C3J B;  2BWF A;  2GOW A;  3A9K A;  4JPS A;  2M8S A;  2WDQ B;  3APC A;  4WWN A;  2XN9 C;  4TSS A;  1E7V A;  2IPK D;  2RPQ A;  5KHQ A;  3QC8 B;  2M56 B;  4GDK A;  2IJ0 A;  1XLP A;  4WJP A;  1U4A A;  3M62 B;  1TKG A;  1RYJ A;  2PKO A;  1HE8 A;  1WZ0 A;  4WJO A;  4AJY B;  1UGM A;  1KLU D;  2QIL A;  3NS8 A;  2HTH A;  3Q3M C;  2K39 A;  4NNJ B;  4G11 A;  4LJO B;  1VD2 A;  4W9F A;  2IBI B;  3U52 E;  2J7Q B;  1E8Z A;  1XF5 L;  2BWE S;  2WXK A;  3BK1 A;  4YL8 A;  2KFK B;  3HM3 A;  3ZNG C;  1OEY A;  2VZK B;  2L0F A;  3R2I A;  5DPT A;  3AE2 B;  2JZZ A;  4BZA A;  2DZI A;  2JUO A;  1V1P A;  4WQM A;  3APF A;  4ZRK A;  3N1Y C;  4HJG E;  2QJL A;  2PE9 A;  3M3J A;  2C5L C;  4KDI C;  1XLO A;  2LUM A;  3ZNZ B;  2LGY A;  3RNE C;  1SB3 C;  3RFZ B;  1XD3 B;  3V60 A;  1SJH D;  2YLM A;  3CWI A;  2PE6 B;  3B9J A;  1CQV A;  3ZW3 A;  5BO4 B;  3VXW A;  1P7E A;  3HM6 X;  3EHV A;  3QWZ B;  3U4E G;  1FPY A;  3AE9 B;  3QAQ A;  1AN8 A;  2DYO A;  5EE9 A;  3ZKJ C;  2Y3A A;  4ZHP A;  5KHO A;  3KUD B;  3IFW B;  2M1M A;  4ZOH C;  4KKJ A;  2XBB C;  1UGJ A;  4USA A;  3N20 C;  4M02 A;  3KWV A;  3U7Z A;  1KF6 B;  3ZJV A;  2X38 A;  4W9C A;  5E6O A;  5BYR A;  2QIE B;  4ACF A;  1PQS A;  2K8B A;  1WZ3 A;  3R8B A;  3AI5 A;  4BKS D;  1J7A A;  1DOX A;  2R2Q A;  1HTQ A;  3S2A A;  3ZJU A;  4W9E A;  1GUA B;  2BYV E;  3A1Q B;  1LFD A;  1SE2 A;  1CK1 A;  2ZVO A;  3VH3 B;  3BIN A;  1QOF A;  1WJ6 A;  3Q3O C;  3M63 B;  3U7D A;  4AJW A;  4ANU A;  4HCP B;  2WNM A;  2NBV B;  3ML8 A;  4UDU C;  3FIL B;  3Q8B A;  3NVV A;  1MG8 A;  4MJS B;  2KJH B;  1WXQ A;  3Q14 C;  1ESF A;  3DOW A;  3UIP B;  4GDL B;  2V4L A;  3JVZ X;  1XCQ L;  4A3P A;  3VTW A;  2JYT A;  1ZOY B;  1C78 A;  2ACZ B;  2V1Y A;  2L8J A;  1YJI A;  1WGG A;  2PLP A;  1C4P A;  2QDF A;  4CHK A;  4KGS A;  1NBF C;  3AE7 B;  2HTM E;  3RNA C;  1VDV A;  1I42 A;  2BTE A;  5D3D A;  3PHW B;  1K53 A;  3H7S A;  2O2V A;  1MFW A;  2K25 A;  3RNB C;  4EEW A;  4N59 A;  5AUK A;  3H7P B;  3AE5 B;  4LLG M;  1OQQ A;  1WXV A;  2RDG A;  1UH6 A;  1SBB B;  4ARI A;  3DVN U;  4YSZ B;  3E9S A;  2EKI A;  1M94 A;  1E7P B;  4PT5 A;  3DHI C;  2LUE A;  2GBN A;  3RMK C;  3PZ8 A;  1AW7 A;  4LNN A;  1SIJ A;  2LMC A;  3Q8F A;  2L83 A;  1MHH E;  2XEW A;  1AYF A;  1NI3 A;  1TS2 A;  1ZDX A;  2JSV X;  1FCL A;  4WIP A;  2DZJ A;  3Q3J A;  1A5R A;  4MH8 A;  1WJN A;  2J0M A;  4W9K A;  5BYQ A;  4DDG D;  3W1S A;  4IM2 A;  5AZH A;  3ZQ4 A;  2RDH A;  4GMV A;  2LJI A;  2M4N A;  5TR5 A;  1IYF A;  4PYU A;  1ZPS A;  1V5O A;  2X8X X;  5FK9 C;  2MJ3 A;  2XK5 B;  2MRP A;  3UIO B;  2NBW B;  5IKC M;  1UEL A;  2GBK A;  1WGY A;  1LM8 B;  3Q3F A;  1OQR A;  2Y5C A;  2RPV A;  1YMH E;  2NMQ A;  3PLU A;  3EEC A;  3HIZ A;  3TMP B;  2OED A;  3U2S C;  1WXA A;  1OFF A;  4KKI A;  3O13 A;  2L0T A;  1WXM A;  2RD0 A;  4HPL B;  2JRI B;  2BVC A;  5EE0 A;  4MGZ E;  1SJE D;  4MM3 A;  2KT7 A;  3GZN I;  3R66 C;  3QJZ A;  3NZS A;  4XWW A;  1KRH A;  3DQV A;  1E90 A;  3AUL A;  4C4V B;  1Y8R C;  3CST A;  2LGS A;  2Y5P A;  4GB9 A;  4JWS C;  4XZ4 A;  1YD8 U;  1N5X A;  1IBX B;  1QIL A;  4FJZ A;  3Q69 A;  3IBE A;  4PK1 A;  3AE1 B;  2L00 B;  2KTR B;  3FAH A;  3W1Y A;  2HDE A;  4WWM A;  1GB4 A;  3RUL A;  1STE A;  4ZYS A;  1VJK A;  1EU3 A;  2GLS A;  1I7H A;  1IGC A;  3AM9 A;  2AQ2 B;  1ZP0 B;  2JVC A;  2JWZ A;  2VH1 A;  2KMA A;  4MSQ B;  5HKH A;  4RGM A;  4NJC A;  5IA7 A;  1TZ1 A;  3BVZ A;  3P42 A;  4C56 C;  4N6E B;  4AS1 A;  3JSV B;  3W2D A;  4I6P A;  4BOS C;  4HWI B;  1Z2M A;  2WX1 A;  2C60 A;  1L4Z B;  4TKN A;  3P4P B;  1QOG A;  1H8C A;  2LGI A;  4OVZ A;  3ECI A;  2KDE B;  4DXG A;  3EC8 A;  1V81 A;  3JSV A;  4JWU C;  1JWM D;  3DCG A;  1KM7 A;  1WX9 A;  3VR9 B;  2GMI C;  1ROE A;  1FMA D;  2IY1 B;  4C7Y A;  1K8R B;  1FXI A;  1GOZ A;  2KX0 A;  4BKG A;  1EUV B;  3IT6 B;  1ZXH A;  1E10 A;  1WX8 A;  3NZ3 A;  4E74 A;  1SE3 A;  5HHD G;  2GBM A;  2INP E;  1BT0 A;  2FNJ B;  4IWQ A;  4MDK E;  3L54 A;  1JRU A;  4F8C B;  2VH2 A;  4PYZ A;  3OJ3 A;  4K3B A;  1F2R C;  2ZCB A;  3FIL A;  3I57 A;  1F77 A;  4KZC A;  1JWS D;  4LNK A;  2MBH A;  3A33 B;  3MHS D;  2KN5 A;  5D94 A;  1C79 A;  3BWU D;  3NY5 A;  2NTS A;  1N63 A;  1TKE A;  1E0Z A;  5LXI B;  4YT0 B;  2Y5B B;  4HXD A;  4NAW A;  2BYT A;  1V6E A;  2C7N B;  3H6N A;  4HPP A;  3DVG Y;  3T3N A;  2KVR A;  3PHX B;  3DHH C;  2BKR B;  4HEA 1;  5FR6 A;  5D7G A;  2OOB B;  2IO2 B;  5AEK B;  2M19 A;  2W3S A;  1WM3 A;  2LHE A;  4JLC A;  3EA6 A;  1WJ4 A;  4HJK A;  1V2Y A;  2QCZ A;  4E3C A;  1EU4 A;  3NHE B;  1UD7 A;  1FO4 A;  3ONS A;  1J0G A;  5D3I B;  2N7J A;  3PTF C;  4LJP B;  3VRA B;  4RGT A;  2WP9 B;  3R3M A;  3B08 A;  2WXM A;  4ZRJ A;  3LXF A;  1UNS A;  3J9C A;  4DBG A;  1V1P B;  2KX3 A;  2KZR A;  1WYW B;  1UUP A;  1KLV A;  5CHW A;  2FUG 1;  3AV8 A;  1C9F A;  2MX2 A;  5IP4 D;  4OHJ A;  3VUX A;  4NJ6 A;  3Q3N C;  4ANX A;  2JF5 A;  2WXI A;  3TJP A;  3NVW A;  5HG2 A;  3VRB B;  3AEG B;  3VQI A;  2GBR A;  2L1A A;  2KTF A;  1V5T A;  1Q0W B;  2BQQ A;  1MHX A;  2MWS B;  3ZXR A;  1HA5 A;  2KDB A;  3WAM A;  4JQW C;  4NJ7 A;  4GDK B;  2WXL A;  3RYT A;  3ZNI D;  4MEL A;  2BBC A;  1WXS A;  2B3A A;  1XEE A;  4WUR A;  3SEB A;  4EOY A;  4REZ A;  5CHV C;  2R61 A;  3E56 A;  3SFE B;  3WAN A;  2I1K A;  1ET9 A;  2N7D A;  1C3T A;  2WDR B;  3O65 B;  4ZRQ A;  4W9L A;  3B0A A;  4W9I A;  4HDO A;  4JIO U;  3SD5 A;  3AE4 B;  4M01 A;  1N60 A;  3ZDM C;  5HI1 A;  3PPA A;  2LVP A;  3NS1 A;  2DNF A;  2ZZP B;  1WGK A;  3ZTD A;  3PT2 B;  4YSY B;  1HTO A;  3RN9 C;  2N9L A;  1D6E C;  2IGG A;  3KQ4 A;  5EDS A;  1TY2 A;  4B9K A;  4YTP B;  1NEN B;  1XXG A;  3DBH B;  3L13 A;  2BPS A;  2KDI A;  1JW9 D;  2J0J A;  1I4Q A;  5CX3 A;  3RNC C;  3AE3 B;  4A9A A;  2K1F A;  1QQR A;  4TV3 A;  5FR3 A;  3GZN B;  2PJH A;  3L08 A;  1K50 A;  2WU2 B;  4OVU A;  4EZL A;  2W3R A;  1A70 A;  4K81 A;  2KMC A;  2N1W A;  2ICI A;  3DBL I;  3TIX A;  4BOZ B;  4DWF A;  2MJD A;  1TKY A;  5JXV A;  2ZCC A;  1T3Q A;  1R4M B;  4CO7 A;  2WXR A;  1VZ7 A;  1JRP A;  1JWB D;  1WRI A;  1WGD A;  2SEB D;  2WX0 A;  3ZUN A;  3KYD D;  1SE9 A;  4YWG G;  1ZW7 A;  3ZRF A;  2UU7 A;  1PDX A;  1X1M A;  5LLI A;  3L10 B;  1C1Y B;  1GAQ B;  2N9E B;  1L0Y B;  2MA9 B;  2FIF A;  2WXF A;  1FRR A;  2RDB C;  2KMM A;  3V6C B;  1QKZ A;  3KH0 A;  1QZE A;  2WS3 B;  3Q8A A;  4B0E A;  3NG0 A;  3VAW A;  4KX6 B;  3RNG C;  1XQQ A;  5T8I A;  2ZW1 A;  4EUT A;  3DWM A;  2RGF A;  3IVF A;  3TEZ A;  2L7R A;  2JXT A;  5LXH A;  2EKE C;  1N5W A;  4RH6 A;  4EZK A;  4JGH B;  1L6U A;  4II3 B;  4ASW C;  3D32 A;  2J4X A;  1FXA A;  1WE6 A;  3AEC B;  3QA8 A;  4KSK C;  1HZ5 A;  4RCO A;  2MBO A;  1T6B X;  2W54 A;  4MJS A;  4C7Z A;  2QHO A;  4BBN F;  2JQR B;  2WXG A;  3N3K B;  3APD A;  3KUC B;  4MH0 E;  3HRD D;  1TY0 A;  2V3P A;  2UYZ B;  3AEA B;  3V05 A;  3HK0 A;  2CU1 A;  4GXB A;  2L3Z A;  3AMZ A;  1HEZ E;  3P1M A;  1VRA B;  1J19 A;  5J18 A;  4TQ1 A;  3DWG C;  3N1X C;  3AED B;  1WIA A;  1N61 A;  3IAS 1;  4A20 A;  2KC2 A;  2MBB B;  4FXC A;  3CSF A;  3TBL D;  4HPM B;  2FUH B;  2IYD B;  1NVI D;  2W55 A;  4K7U A;  3K9O B;  2MQJ A;  3MC9 A;  1C76 A;  1LO5 D;  2IND C;  2Z0D B;  3N32 A;  1G6J A;  1HXY D;  4DDI D;  2JX5 A;  2WXP A;  2YEP B;  4PS3 A;  1GB1 A;  4S0R A;  2V3N A;  3IT4 B;  3LB8 C;  1DOY A;  2ZJD A;  1D5M C;  4DHJ B;  4RM8 A;  1SEB D;  3NUH B;  2D5G A;  3QQ8 B;  1ZGU B;  2I38 A;  5JZE B;  4M0W B;  3I5J C;  1MJD A;  1C4A A;  2NTT A;  3AU4 A;  3NJT A;  1SE4 A;  3DVN V;  4LCD E;  2G9H D;  1EF1 A;  4F7Z A;  2D10 A;  2OJW A;  3EGR A;  3NOB A;  4IUM B;  3TEX A;  3FKY A;  1NDD A;  2PIA A;  3URY A;  4G0N B;  4OZB A;  4P16 A;  4AWJ A;  5IO9 A;  1TZO A;  3WAO A;  3HHM A;  4MM3 B;  3CIR B;  2FID A;  2G4D B;  1NYR A;  2N9P C;  2J52 A;  4LNI A;  1IP9 A;  1YIW A;  2V4I B;  2L32 A;  3PRE A;  1KTK A;  5AZG A;  3ZGZ A;  2CU3 A;  1WGR A;  4IM0 A;  3W5V B;  3RT3 B;  2ZPY A;  1GG3 A;  2K5P A;  4GIV A;  1UWX A;  3N9Y C;  2KQS A; 
#chains in the Genus database with same CATH homology
 3TL5 A;  1BT0 A;  2FNJ B;  1FXT B;  4IWQ A;  4MDK E;  3ZVV A;  2KWV B;  2JRH A;  3L54 A;  3KVF B;  1JRU A;  4F8C B;  2PEA A;  3T9L A;  3ZDT A;  2JY6 A;  1GC6 A;  2KWC A;  3PRZ A;  2BYF A;  4M8N A;  2CR5 A;  2JPH A;  4PYZ A;  3OJ3 A;  2AWT A;  2JXX A;  4BVU C;  3RUI B;  2LVQ A;  5IAA C;  5G2N A;  3VTV A;  4XC2 A;  4WAA A;  1Q1O A;  2K6Q A;  3X23 A;  2WDT B;  1WGH A;  2ZCB A;  4W9J A;  2DHZ A;  4JL9 A;  2YVC A;  4KZC A;  4NPN A;  1P9D U;  5CTR C;  4LDT B;  2LRW A;  4GSW A;  4GU2 A;  3WA0 A;  2HE7 A;  3DPD A;  4FA6 A;  2G3Q B;  2MW5 A;  5AZF A;  4W9G A;  2MBH A;  3A33 B;  1R4N I;  3MHS D;  3R7R A;  4ANV A;  4KVG B;  2KN5 A;  2KQ7 A;  1WR6 E;  4M8M A;  4NQL B;  5D94 A;  3VH4 B;  2LXA A;  4DXA B;  1WH3 A;  3WAP A;  2NVU I;  2LZ6 A;  3A9J A;  3NY5 A;  4MGK E;  1H4R A;  3H7P A;  4MSM B;  2ZNV B;  4ZDV A;  2K8C A;  2AL6 A;  2WYQ A;  5LXI B;  3KUZ A;  1Z5S B;  2Y5B B;  3IG3 A;  4HXD A;  4I6L B;  4FJV B;  3QK0 A;  4NAW A;  5D6J B;  3RZF A;  5JHB A;  1V6E A;  2C7N B;  2RSU A;  3H6N A;  3DVG Y;  3C0R B;  4IG7 B;  2KVR A;  2RR9 A;  3PHX B;  4HK2 A;  4BKS A;  3UGB B;  2BWF A;  2GOW A;  3A9K A;  1WJU A;  2M8S A;  2Z0E B;  3APC A;  4WWN A;  4ZYN A;  4CYE A;  2BKR B;  5FR6 A;  1E7V A;  2RPQ A;  5KHQ A;  3QC8 B;  5D7G A;  2OOB B;  4GDK A;  2IO2 B;  5AEK B;  2BF8 B;  3LDZ E;  4KSL C;  3ZO5 B;  4PS8 A;  1WM3 A;  4WJP A;  1U4A A;  2N9X A;  3M62 B;  4TQ0 A;  3PV1 A;  2O6V D;  1E8W A;  4JLC A;  1WJ4 A;  2W9N A;  1HE8 A;  1WZ0 A;  4WJO A;  2KWU B;  4HJK A;  1V2Y A;  4AJY B;  1UGM A;  4NY0 A;  3AU5 A;  4F1S A;  3NS8 A;  2M17 A;  4E3C A;  4ICV A;  2HTH A;  2K39 A;  4NNJ B;  3NHE B;  4GGQ A;  4DK5 A;  1UD7 A;  4G11 A;  1WRD B;  1VD2 A;  4LJO B;  3U30 A;  4BBN C;  4W9F A;  3ONS A;  4II2 B;  1J0G A;  2DAF A;  3PTF C;  2IBI B;  2C7M B;  2J7Q B;  3ENE A;  1E8Z A;  5GMV A;  4FHJ A;  2KK8 A;  4LJP B;  1V9J A;  2LXC A;  3R3M A;  2BWE S;  3B08 A;  3PRP B;  4YL8 A;  2KFK B;  3HM3 A;  4ZRJ A;  2LGX A;  3ZNG C;  1OEY A;  3P2B A;  4FUL A;  3L0W B;  3RZW C;  2L0F A;  1J8C A;  1OQY A;  3A4R A;  5DPT A;  2JZZ A;  2KHW B;  4DBG A;  4WWO A;  2DZI A;  2KX3 A;  2JUO A;  1WMH B;  2KZR A;  3APF A;  1GJZ A;  1WYW B;  4ZRK A;  1T0Y A;  4KDL B;  1KLV A;  5CHW A;  1R4M I;  2LWP A;  2MX2 A;  2PE9 A;  3M3J A;  2LJ5 A;  2C5L C;  4KDI C;  3RCZ A;  3VUX A;  4NJ6 A;  3QHT A;  3QX1 A;  3ZNZ B;  2LGY A;  1E5W A;  1XD3 B;  3V60 A;  4ANX A;  2JF5 A;  2MP2 B;  3TJP A;  2LGD A;  3UF8 A;  2YLM A;  4FAD A;  2FAZ A;  2PE6 B;  1WR1 A;  3VQI A;  3EFU A;  2GBR A;  2KTF A;  2KKC A;  3PSE B;  1V5T A;  2AYO B;  4GOC A;  1WE7 A;  4KIK B;  4G3X B;  1Q0W B;  3ZW3 A;  1F9J A;  2KTR A;  5BO4 B;  2MWS B;  1KOT A;  3VXW A;  3HM6 X;  3EHV A;  3QWZ B;  2BGF A;  4MEM A;  2KDB A;  3WAM A;  4HLE A;  5E6P A;  3QAQ A;  2HJ8 A;  4JQW C;  1Q5W B;  2DYO A;  3U8Z A;  2FCM A;  3ZKJ C;  4NJ7 A;  4KIK A;  3OJ4 B;  2LVO A;  1ZKH A;  4GDK B;  3RYT A;  3ZNI D;  4MEL A;  5KHO A;  1WXS A;  2B3A A;  3KUD B;  2MSE D;  3IFW B;  2M1M A;  2AEH A;  2N7E A;  4EOY A;  2DZK A;  3A4S C;  3SHQ A;  1WM2 A;  3PVL A;  5CHV C;  2XBB C;  3WAN A;  4BKT A;  2I1K A;  1WF9 A;  4LDT D;  3QIJ A;  5J17 A;  2BKF A;  4AP4 C;  2R2O A;  2N7D A;  1P98 A;  1VCB A;  2IO0 B;  1WX7 A;  2WWZ A;  2O6V A;  1C3T A;  3VVW B;  3O65 B;  5E6O A;  4W9C A;  2KLC A;  1LQB A;  2UWQ A;  4W9L A;  1PQS A;  2K8B A;  3B0A A;  1WZ3 A;  3ML9 A;  4HDO A;  4JIO U;  1WMH A;  2CS4 A;  3AI5 A;  4W9I A;  4X57 B;  3SD5 A;  2N4F A;  2N1V A;  3ZDM C;  4BKS D;  3WAL A;  2IZV B;  2R2Q A;  4NQK E;  3SDL C;  3PPA A;  4A3O A;  3S2A A;  3ZIM A;  2LVP A;  2ZVN A;  4W9E A;  3TCA A;  2KJR A;  2ZZP B;  3N30 A;  3ALB A;  2CHX A;  1GUA B;  2BYV E;  2NS5 A;  1LFD A;  3A1Q B;  3ZLZ A;  3ZTD A;  2ZVO A;  3VH3 B;  3BIN A;  3PT2 B;  2IO3 B;  1WJ6 A;  2DAJ A;  2REX A;  3M63 B;  3U7D A;  4AJW A;  4ANU A;  5EDS A;  3SU8 X;  4B9K A;  4HCP B;  2D3G A;  2NBV B;  2D11 A;  3ML8 A;  2A4Z A;  5DPR A;  1MG8 A;  4MJS B;  2GBJ A;  2O6V B;  3L13 A;  2BPS A;  2KJH B;  2XK5 A;  3DOW A;  2D2Q A;  2KDI A;  2LAS A;  4OVV A;  5L95 C;  4DHZ E;  3UIP B;  2J0J A;  4GDL B;  2V4L A;  3KYC D;  4N9F 4;  3JVZ X;  5CX3 A;  1CMX B;  4A3P A;  3MJW A;  1XT9 B;  2KNB A;  3VTW A;  3W1S C;  2ZPN A;  2K1F A;  3UQB A;  1P0R A;  1D3Z A;  4TV3 A;  2V1Y A;  2L8J A;  2V3S A;  1WGG A;  2PJH A;  3L08 A;  3L17 A;  5DPW A;  4OVU A;  4EZL A;  4K81 A;  1E8X A;  2KMC A;  3BY4 B;  2N1W A;  3VDZ A;  2EMS A;  4CHK A;  4ZRI A;  1NBF C;  3DBL I;  3TIX A;  4BOZ B;  5C1Z A;  4DWF A;  4PS7 A;  1I42 A;  4FN2 A;  4RM9 A;  2ZCC A;  4NAW B;  3PHW B;  4CO7 A;  3H7S A;  2O2V A;  3WIM A;  4J6I A;  2K25 A;  1SIF A;  2CHZ A;  1WGD A;  4EEW A;  4K7W A;  2WX0 A;  3A9K B;  3H7P B;  4P7I A;  4AOF A;  3PGE A;  3V61 A;  1TBE A;  4EKU A;  2MP2 A;  3ZUN A;  3KYD D;  1WXV A;  1SE9 A;  1UH6 A;  2FCS A;  2OJR A;  3B1L X;  1ZW7 A;  4XX5 A;  3ZRF A;  2C7H A;  1X1M A;  3DVN U;  5LLI A;  3L10 B;  2LI5 A;  3CF6 E;  1C1Y B;  3VUW A;  2N9E B;  1M94 A;  2MA9 B;  1RAX A;  2FIF A;  3UQA A;  3V6C B;  5JHA A;  3KH0 A;  3QCA A;  1QZE A;  5DCN A;  2KO3 A;  2GBN A;  2LUE A;  3CMM B;  1YQB A;  4EZJ A;  3A9J B;  1E8Y A;  2LD9 A;  3NZU A;  2DX5 B;  1LXD A;  2KAN A;  3T8M A;  1RFA A;  1S3S G;  3K9P B;  4KZ0 A;  3ZNH B;  4G50 A;  3VAW A;  2XEW A;  1V80 A;  4EFO A;  2G45 B;  4HDQ A;  4HVB A;  1XQQ A;  2DZJ A;  3Q3J A;  1RRB A;  1A5R A;  5L83 A;  4FLH A;  5CHF A;  1WJN A;  2J0M A;  4W9K A;  4EUT A;  4DDG D;  2RGF A;  3JW0 X;  2IO1 B;  3W1S A;  4IM2 A;  3OLM D;  5AZH A;  4GMV A;  1UZX B;  2MCN B;  4I6N B;  3IVF A;  1V86 A;  2L7R A;  2M4N A;  5LXH A;  5TR5 A;  1IYF A;  3PRM B;  2EKE C;  4PYU A;  1V5O A;  3VUY A;  4EZK A;  1TTN A;  3M95 A;  1YX6 B;  4JGH B;  2K6D B;  4II3 B;  2IY0 B;  1I35 A;  5G55 A;  4ASW C;  3D32 A;  1WE6 A;  3QA8 A;  4KSK C;  2DYM A;  4WWP A;  2JT4 B;  2MBO A;  2XK5 B;  3ZTC A;  2MRP A;  4MJS A;  3UIO B;  2QHO A;  2NPT B;  4BBN F;  3JYU A;  2NBW B;  2CHW A;  1SGH A;  1UEL A;  2GBK A;  1WGY A;  3APD A;  3N3K B;  1YJ1 A;  3KUC B;  3OAW A;  1P1A A;  1LM8 B;  2DZM A;  3Q3F A;  4MH0 E;  2NBU A;  3PLU A;  3VTU A;  2NR2 A;  3EEC A;  2UYZ B;  2CKH B;  3A1Q A;  3HIZ A;  3TMP B;  2JZ3 B;  3PS6 A;  4IWP A;  3DBH I;  3HK0 A;  2CU1 A;  4GXB A;  2L3Z A;  1WXA A;  1J19 A;  5J18 A;  4TQ1 A;  2L0T A;  1WXM A;  2FCQ A;  2MBQ A;  2RD0 A;  4HPL B;  1WIA A;  5J2R A;  2HD5 B;  4IM3 A;  2JRI B;  3V6E B;  4A20 A;  4IW0 A;  4MGZ E;  1EO6 A;  1P3Q U;  2AL3 A;  2KC2 A;  1EF5 A;  1GC7 A;  2MBB B;  2K8H A;  3DBR I;  4B95 A;  2KFK A;  4MM3 A;  3VHT C;  3GZN I;  4E71 A;  2KOX A;  3R66 C;  3CSF A;  1IPG A;  2NCN A;  1NI2 A;  2KDF B;  4HPM B;  3TBL D;  2FUH B;  3QJZ A;  1TGZ B;  3NZS A;  1WY8 A;  2FCN A;  2IYD B;  1UBQ A;  2LRU A;  1OTR B;  3DQV A;  1E90 A;  3AUL A;  3X0W A;  1Y8R C;  3LJ3 A;  5E6N A;  3AXC A;  3CST A;  2M0X A;  2KJ6 A;  3I3T B;  2MQJ A;  3K9O B;  4K7U A;  1WI0 A;  4GB9 A;  2MBE A;  2VRR B;  4XZ4 A;  3PLV A;  1YD8 U;  3H1U A;  2Z0D B;  3N32 A;  1G6J A;  4DDI D;  2A5U A;  3VFK A;  4FJZ A;  2C9W B;  4K1R B;  4WJQ A;  3H9D A;  3IBE A;  4RMA A;  4PS3 A;  2G4S A;  3DDC B;  4FBJ B;  2L00 B;  2ZJD A;  1ISN A;  2KTR B;  4RM8 A;  4FHK A;  4DHJ B;  4KV2 A;  1RLF A;  4MGI E;  3W1Y A;  1L7Y A;  3UIN B;  4IC7 B;  3RUL A;  4DHJ D;  3QQ8 B;  1ZGU B;  5JZE B;  4M0W B;  2EMT A;  4HCN B;  3QAR A;  3L16 A;  4ICU A;  2JWZ A;  2JVC A;  5DPS A;  4B6W A;  4WJN A;  3AU4 A;  2KMA A;  4GDL A;  1L2N A;  1WFY A;  3DVN V;  1OEY J;  1OGW A;  4LCD E;  4MSQ B;  5HKH A;  2DEN B;  3MTN B;  2MLB A;  3DVG X;  1EF1 A;  4WQO B;  4F7Z A;  1TZ1 A;  5IA7 A;  2DYB A;  3V62 A;  2D10 A;  4TUU A;  2PPH A;  3JSV B;  4I6P A;  3NOB A;  4BOS C;  4HWI B;  1Z2M A;  4IUM B;  1NDD A;  2WX1 A;  2D07 B;  4AUQ C;  4G0N B;  2C60 A;  4AWJ A;  4URK A;  4TKN A;  2L76 A;  2KXJ A;  4IWO A;  2KLG A;  4W9H A;  3WAO A;  3HHM A;  2KC1 A;  1H8C A;  2KFJ A;  2FID A;  4W9D A;  2G4D B;  2N9P C;  5C23 A;  2Z59 B;  3ECI A;  2KDE B;  1IP9 A;  3EC8 A;  1YIW A;  4DHZ B;  1V81 A;  1V49 A;  2KD0 A;  3JSV A;  3PRE A;  3R7Q A;  4BFR A;  5AZG A;  3DCG A;  1KM7 A;  1KJT A;  1WGR A;  2BYE A;  1WX9 A;  3RD2 A;  2ZEQ A;  2O2V B;  4K7S A;  1E7U A;  2GMI C;  4IM0 A;  3ZRC A;  2ASQ A;  3RT3 B;  2ZPY A;  2I1J A;  4FJY A;  4ANW A;  3IHP C;  1GG3 A;  2IY1 B;  1K8R B;  5D2M B;  4GN1 A;  5JH5 C;  3PZD A;  1GNU A;  2KX0 A;  4GIV A;  4BKG A;  3DBS A;  1EUV B;  1S1Q B;  1UBI A;  2J0K A;  1WX8 A;  3GOE A;  4E74 A;  1YX5 B;  2ZNV C;  4MGY E;  2KQS A;  1AAR A;  2L05 A;  2NPT A;  2GBM A;  3KW5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...