2KX3A

The solution structure of the mutant of ubl domain of ublcp1, i5m
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
81
structure length
81
Chain Sequence
MALPMIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVKLGALKLKPNTKIMMMGTREES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the mutant of UBL domain of UBLCP1, I5M
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin-like domain-containing CTD phosphatase 1
total genus 12
structure length 81
sequence length 81
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kx3A00
1NI2A 3RCZA 1GJZA 4FA6A 2LVOA 3B1LX 4W9EA 5E6NA 3TBLD 4GXBA 1XT9B 2K8HA 1NBFC 3H9DA 5D94A 2ZCBA 4LJOB 2GOWA 2O6VD 3NZUA 4ANVA 3UIPB 3M3JA 2OOBB 3U8ZA 1KLVA 1MG8A 2CR5A 5EDSA 2RSUA 2NBVB 2WWZA 2HD5B 2M8SA 3H7PA 5CHFA 3V62A 3R3MA 2LD9A 4MH0E 3CSFA 3IHPC 5C23A 2KWCA 2ASQA 4JQWC 2REXA 1OQYA 2D2QA 4ZRJA 4F8CB 1ZKHA 1Z5SB 4HXDA 3OLMD 1WR6E 4BFRA 5BO4B 2GBRA 2A4ZA 4W9HA 4WJQA 2ZZPB 2YLMA 2RR9A 4DHZE 1LM8B 2KVRA 3TMPB 2KTRB 2LI5A 4F1SA 1YQBA 1YD8U 2G45B 2BKRB 1YX5B 4XC2A 2LUEA 3PPAA 2O2VB 4KSKC 4FBJB 2D10A 3DVGY 4W9LA 2N9XA 3ZLZA 4A3OA 1P98A 2O6VA 3L16A 2KLCA 3LDZE 4HCPB 3M63B 5JHAA 4DHJB 4IM0A 1V2YA 2KDFB 3ZVVA 4CYEA 2DYOA 3LJ3A 2LASA 2GBNA 1Y8RC 2K8CA 2KJHB 4BOZB 2D07B 3IVFA 4PS8A 4PYUA 2KWUB 2XEWA 3ENEA 5DPTA 2JZZA 2LGXA 1WXVA 3IFWB 1WGRA 3L0WB 4IWQA 4CHKA 4AWJA 2JPHA 3MTNB 3ZDTA 4MEMA 5DPRA 3X23A 2DHZA 2NBUA 3SD5A 3PGEA 4GU2A 3IBEA 3ONSA 2BGFA 2D3GA 2A5UA 2M1MA 3I3TB 5AEKB 4B95A 3CSTA 2KTFA 1IPGA 3ZDMC 4KDLB 2MBEA 4G11A 3N32A 3ZTDA 2MP2B 3QARA 3UQAA 1OEYA 4LDTD 3U30A 3V60A 3OJ4B 1P3QU 3QC8B 2J0KA 2K25A 2KDBA 5HKHA 1V86A 2C60A 1WXSA 2J0MA 3AULA 4PYZA 3RUIB 2FIDA 4ZYNA 1FXTB 4GB9A 4TUUA 3VXWA 2DX5B 4RMAA 1HE8A 1V81A 1OGWA 2AL6A 2AL3A 4M8MA 4X57B 4KZCA 4LJPB 3DQVA 3ZRCA 4B6WA 2I1JA 2BWFA 3APCA 1LXDA 1WJ6A 2KD0A 1UH6A 2IO0B 2C7HA 2MCNB 3A4SC 1TGZB 2GBKA 2PE9A 3WIMA 2IZVB 3ML9A 3TCAA 4NNJB 2LGDA 4DHZB 4BOSC 3ALBA 4AOFA 3EC8A 2MBBB 3T9LA 3W1YA 3DDCB 3VHTC 2NS5A 1L2NA 1AARA 3ZRFA 5C1ZA 4EFOA 2N7EA 1WM2A 3WALA 1I35A 4MSQB 1A5RA 4OVVA 1TZ1A 2FCSA 1XQQA 2LRWA 1P9DU 3TL5A 1IYFA 2PPHA 2KDEB 3ZNHB 2XK5A 1X1MA 1WRDB 1V6EA 2IYDB 1KJTA 1V5OA 2HE7A 2N9EB 2CU1A 3PHWB 4W9JA 1ISNA 1YX6B 4II3B 2DZKA 2C9WB 5DPSA 4ZRKA 3EECA 4KDIC 3PLUA 2KC1A 3KVFB 2BF8B 1WMHA 4E74A 3B0AA 3ML8A 2ZVOA 4MJSA 3QWZB 4A3PA 3QQ8B 3QK0A 3RT3B 4B9KA 3PT2B 4II2B 4G3XB 4J6IA 3VFKA 1K8RB 1RAXA 4GDLB 4W9CA 4BKSD 4BKTA 2L8JA 3H6NA 1LQBA 5G2NA 4EOYA 2YVCA 1BT0A 2DZMA 5J17A 2KFJA 2KFKA 3WAMA 4KIKB 1WY8A 2ZNVC 1S3SG 4MDKE 5CHWA 2ZJDA 4GIVA 5DPWA 3KUZA 3KH0A 2XBBC 1WJUA 2KLGA 4CO7A 2GBJA 4FN2A 2M17A 2BPSA 1RRBA 3R7QA 1WYWB 4ZDVA 3VUYA 1UD7A 2LVPA 4K7WA 3UQBA 4HDQA 1WX8A 3HK0A 2KJRA 1UBQA 2J0JA 4BVUC 2FNJB 2MLBA 5LXIB 3H7PB 1V9JA 1UBIA 2KANA 3A9JB 2L7RA 4ZRIA 4GMVA 3KW5B 4WAAA 2FCMA 2RGFA 4GN1A 1WX7A 1WM3A 1WIAA 3S2AA 3T8MA 3CF6E 4BKSA 4K81A 2WX1A 1J19A 2RPQA 4URKA 5CTRC 4ANXA 1C3TA 5CHVC 2D11A 2CS4A 4M8NA 4WJNA 5DCNA 3VUWA 2R2OA 3DBRI 1VCBA 2O2VA 5IA7A 2J7QB 2MRPA 1NDDA 3Q3JA 4HCNB 4AJYB 2DZJA 2IO2B 1R4MI 2WYQA 5TR5A 3QHTA 3APDA 3ZNGC 4HPLB 2EMSA 1WF9A 4RM9A 3ZUNA 3R7RA 4LCDE 4JIOU 2B3AA 3ZNID 4MSMB 2EMTA 4NQLB 1M94A 3UGBB 1H8CA 2LJ5A 2VRRB 4AUQC 3WAOA 4HVBA 2FAZA 2ZPYA 4HJKA 3HM6X 1L7YA 2JY6A 2BYFA 4EEWA 2BYEA 3UINB 2KJ6A 3DOWA 2JRHA 4RM8A 4TV3A 2UWQA 4TQ1A 4WWOA 3KYCD 4WQOB 3QX1A 4MGZE 1ZW7A 4JL9A 2L3ZA 2UYZB 2C7NB 3CMMB 4FADA 2LVQA 3DVGX 3OJ3A 1SIFA 4FJYA 3WANA 3IG3A 1I42A 1IP9A 2IO1B 2KZRA 2MP2A 3VH3B 3ZTCA 3ECIA 2BKFA 2L05A 3M95A 1UGMA 1V49A 3HIZA 2N9PC 2JWZA 1EF1A 2IY1B 4HK2A 3KYDD 3RULA 2JZ3B 3PRMB 3V6EB 2K6QA 3VUXA 4KSLC 1WR1A 3DBLI 3O65B 5E6OA 1Q1OA 2DENB 3DBHI 2CKHB 4FJVB 2MBHA 1WFYA 3VTWA 3A9JA 2L0TA 4FULA 3KUCB 1ZGUB 3VTVA 3W1SA 4HPMB 4I6LB 2JRIB 3MJWA 3AU4A 3AXCA 1TTNA 1Q5WB 2HTHA 1VD2A 3DPDA 3DBSA 1PQSA 3C0RB 2JVCA 3PHXB 3SDLC 2ZPNA 3A9KA 4IM3A 2CHXA 2MX2A 4HLEA 1G6JA 3RD2A 2W9NA 4NAWB 2IBIB 4WWNA 1E8YA 4MELA 1RLFA 4PS3A 2FUHB 3GZNI 4I6PA 4PS7A 5LLIA 2DYMA 2ZCCA 4GDKB 2V4LA 2NVUI 4DHJD 3NZSA 2PJHA 4IW0A 3VH4B 1D3ZA 2LWPA 1LFDA 2K8BA 3K9OB 5D7GA 1P0RA 1V80A 2KQSA 2L76A 3A1QA 3RZWC 1WMHB 2CHZA 4ANWA 1SE9A 1U4AA 3P2BA 1WX9A 2L0FA 2V3SA 4FHJA 4W9FA 3PVLA 3HM3A 1T0YA 2DAJA 2ZVNA 1YIWA 3PRZA 4MJSB 4K1RB 3PRPB 2RD0A 3DVNU 1OTRB 2AWTA 4FLHA 4KIKA 1JRUA 4NAWA 2PE6B 5J2RA 4G50A 4KV2A 3QA8A 4GOCA 3NOBA 4DDID 1XD3B 3DCGA 2MQJA 1WZ0A 2WDTB 2KHWB 2Z59B 1GG3A 4WJOA 5G55A 1CMXB 4F7ZA 2LGYA 2KOXA 2N4FA 3U7DA 5GMVA 3QJZA 5KHOA 1KOTA 2MWSB 2LXCA 3PTFC 4W9GA 1E8ZA 2JXXA 4K7UA 2K39A 4W9DA 2KNBA 1EF5A 3WA0A 4E71A 3L10B 4GGQA 5L95C 3VQIA 1GC6A 2KX3A 5JH5C 3JSVB 4MM3A 3QCAA 3NY5A 4XZ4A 1QZEA 5J18A 4ICUA 2KKCA 2JUOA 1OEYJ 3V6CB 3KUDB 2LZ6A 4DXAB 3SHQA 1YJ1A 2GMIC 4IUMB 3ZO5B 2MW5A 4NJ6A 2NR2A 4DWFA 2MA9B 3RZFA 1E5WA 2WX0A 1GUAB 2CHWA 2NCNA 4BKGA 4XX5A 1WJNA 4KZ0A 4NJ7A 1KM7A 1Z2MA 4G0NB 3PS6A 1UZXB 1EUVB 5FR6A 3ZIMA 3L17A 5AZGA 2NBWB 2K6DB 4LDTB 3K9PB 2JF5A 3JSVA 2AYOB 2KMAA 2KFKB 3ZKJC 4IM2A 3UF8A 1E8WA 2O6VB 1R4NI 1WZ3A 2KWVB 4EZKA 2AEHA 3QAQA 3PV1A 1UELA 4ICVA 3JVZX 1WGGA 2KK8A 2PEAA 2IY0B 2V1YA 3Q3FA 2KDIA 1WH3A 4JGHB 3N30A 1WJ4A 2NPTA 4P7IA 1WGYA 3NS8A 2Z0DB 1RFAA 2G3QB 2HJ8A 3L13A 2JT4B 4KVGB 3VDZA 4GSWA 4MGKE 4GDKA 4EUTA 1WGDA 2KN5A 4M0WB 2C7MB 2KC2A 3M62B 4NQKE 1Q0WB 2MSED 4YL8A 2FCQA 4NPNA 3A1QB 2L00B 2BYVE 3BY4B 4WJPA 2MBQA 4MGIE 3APFA 2KX0A 3EFUA 2N1VA 3OAWA 1EO6A 3VAWA 2ZEQA 3W1SC 4ASWC 1WXAA 2KQ7A 2FIFA 1F9JA 2C5LC 2K1FA 3NHEB 4TQ0A 5D2MB 5L83A 3HHMA 2KTRA 3D32A 4GDLA 2I1KA 3A9KB 3TJPA 1WE7A 2KO3A 3L08A 5KHQA 4MGYE 1SGHA 3BINA 3ZNZB 5E6PA 4K7SA 4HDOA 4FHKA 2EKEC 2GBMA 2LRUA 1J8CA 4WWPA 2QHOA 3UIOB 2M0XA 2DAFA 3A33B 4BBNC 3JYUA 1E7VA 2LXAA 5AZFA 1GNUA 3X0WA 4DDGD 4DK5A 4I6NB 5D6JB 4IC7B 5IAAC 1WXMA 3VVWB 3TIXA 4W9KA 1E7UA 2ZNVB 2MBOA 4AP4C 4EZLA 3N3KB 3AI5A 3PZDA 1TBEA 4JLCA 4HWIB 3R66C 4E3CA 3PLVA 2DYBA 4BBNF 1S1QB 2IO3B 3AU5A 1J0GA 3H7SA 1P1AA 3MHSD 2G4SA 2KMCA 1V5TA 3B08A 4A20A 5JHBA 5LXHA 5JZEB 2N7DA 2XK5B 3A4RA 3DVNV 2KXJA 3JW0X 2Y5BB 4N9F4 3RYTA 4EZJA 3PREA 1WI0A 3EHVA 4EKUA 1E8XA 3H1UA 4IWPA 3VTUA 3WAPA 1WE6A 3GOEA 5CX3A 4ANUA 1GC7A 3QIJA 4TKNA 1WGHA 4FJZA 3SU8X 4OVUA 2R2QA 3L54A 2NPTB 1E90A 2N1WA 4IWOA 3PSEB 4AJWA 2FCNA 4NY0A 2OJRA 3V61A 4W9IA 3ZW3A 2M4NA 4DBGA 2BWES 4IG7B 1H4RA 1C1YB 5AZHA 2Z0EB 2DZIA 2G4DB
chains in the Genus database with same CATH superfamily
4FA6A 4RFBA 4W9EA 1XT9B 4LJOB 3GP7A 3NZUA 3UIPB 3M3JA 4JWSC 1C4PA 1MG8A 2CR5A 2RSUA 2WWZA 2HD5B 2M8SA 3IT6B 5CHFA 1N62A 3CSFA 4ZRJA 2V4IB 4JQWC 4F8CB 4ZHPA 2MJDA 5FR3A 4HXDA 5IOIA 5BYQA 4W9HA 4WJQA 1LM8B 4KX6B 1YQBA 3PPAA 2O2VB 3HVZA 3RN9C 2D10A 2O6VA 2KLCA 1FXAA 2B76B 4DHJB 3ZVVA 4CYEA 2DYOA 1FNVA 1Y8RC 2K8CA 2KJHB 2D07B 2W3SA 3BK2A 3IVFA 4PS8A 4PYUA 4AQ7A 2XEWA 1N5WA 1WXVA 2WU2B 1I4PA 3IFWB 2IGDA 1QLBB 1TS5A 3MTNB 3V3XA 3ZDTA 4M0WA 4MEMA 2DHZA 3PGEA 4GU2A 1JWUD 3ONSA 2BGFA 5H8YE 1GAQB 4KDLB 1OEYA 3V60A 3DWMA 1TYGB 3QC8B 1P3QU 1SBBB 2JSVX 3VR9B 2C60A 1PDXA 2FIDA 5D3IB 4ZYNA 3AEAB 3NVYA 4TUUA 3VXWA 4C80A 4RMAA 4PK1A 1V81A 1OGWA 2AL6A 4M8MA 4X57B 4KZCA 3DQVA 1JALA 2KD0A 2IO0B 2C7HA 2MCNB 1XCQL 3ML9A 3ALBA 3P63A 1FIQA 3MC0B 2AQ2B 3DDCB 1I7HA 1JRPA 2NS5A 1FD6A 1WM2A 2BQQA 1X1MA 1V6EA 1V5OA 2CU1A 1L4ZB 2KMMA 4II3B 2DZKA 5DPSA 3EECA 3KVFB 2ZVOA 3RT3B 1C79A 4B9KA 4J6IA 3VFKA 1RAXA 1GB1A 1LQBA 3SFEB 1BT0A 5J17A 4ARCA 2KFKA 4BZAA 2PMVA 1RYJA 2ZJDA 3KWVA 3KUZA 4YXDB 3AE6B 2KLGA 2BPSA 2JU6X 1WYWB 3AB5A 3VUYA 5TSSA 3UQBA 2J0JA 1GB4A 2FNJB 2MLBA 1K51A 4ZRIA 4GN1A 2X8XX 1WM3A 1WIAA 1CJEA 3GE8C 2WHIA 4MT5A 2RPQA 2W54A 5T8IA 4S0RA 1HZ6A 4ANXA 2WXOA 2D11A 2CS4A 4M8NA 2E3TA 3DBRI 2O2VA 4AJYB 1F0ZA 3VR8B 3DWGC 2DZJA 3GZNB 1MI0A 2WLBA 1V1PB 3QHTA 1J7AA 2KWDA 5D3DA 1RWSA 3SEBA 4JIOU 3ZNID 1MFWA 4US8A 1ROEA 1T0QC 4NJCA 3WAOA 4HVBA 2FAZA 4O1NA 1L7YA 2M19A 2BYFA 2PTLA 4WWOA 3KYCD 4JL9A 2UYZB 4RF0A 1ZUD2 3TEWA 1JQ4A 1UGMA 1Q10A 1XLQA 2JZ3B 2K6QA 3O65B 3W5VB 2DENB 2CJOA 4FJVB 2MBHA 1WFYA 2LGIA 2L0TA 4YSZB 4FULA 2DBYA 4CQNA 4I6LB 1ESFA 3MJWA 2QCZA 1KLGD 3ZJUA 3AXCA 1TTNA 1VRAB 3C0RB 3AV8A 2MX2A 3PZ7A 3RNBC 1PFDA 3I5JC 1E8YA 4PS7A 2V3NA 1T0SC 3RMKC 1FO4A 4IW0A 5D7GA 1EWCA 2KQSA 3IT4B 2D3CA 1U4AA 3P2BA 1QT9A 3PVLA 2ZVNA 2K22A 2R61A 2VZKD 2RD0A 1D5ZC 1OTRB 5J2RA 4GOCA 2WDVB 4LNFA 2Z59B 1QOFA 4P16A 4WJOA 1GG3A 5G55A 2N4FA 5IKCM 4PT5A 4W9GA 1E8ZA 1FMAD 2JXXA 5GXGB 2K39A 1R4MB 2KNBA 4KKIA 4M01A 4HEA1 5JXVA 2L52A 2PW9A 2LZ6A 3KUDB 4DXAB 5E6JA 3SHQA 1T3QA 2MW5A 4OZCA 4DWFA 1YJJA 2MA9B 1GUAB 4NJ7A 1EUVB 5FR6A 3ZIMA 2JWUA 4LDTB 1B9RA 3AEFB 3TSSA 2WXIA 2AYOB 3ZKJC 1R7SA 1IGDA 4LNIA 1C77A 1UELA 1TS3A 1WGGA 2IY0B 2KDIA 4JGHB 2AQ1B 3NS8A 1RFAA 2JT4B 1JWSD 3VDZA 2Y3AA 4M0WB 3M62B 3MJ5A 4YL8A 2FCQA 5HFYA 1ET6A 1N61A 4WJPA 1NEKB 2MBQA 3OG5A 3OAWA 2KQ7A 1F9JA 3ETRA 5D2MB 3L4PA 5L83A 2J4XA 2WNMA 3TJPA 3ZJTA 1TT5B 3DHHC 1OFFA 3BVGA 1I4XA 1L0XB 2EKEC 2GBMA 2LRUA 3NZ3A 3UIOB 3A33B 4R3DA 2INCC 5AZFA 4DDGD 3VVWB 1I4RA 4DXFA 3TIXA 2MBOA 2NTSA 3AI5A 3N3KB 1A70A 3P4QB 3PZDA 3R66C 1J0GA 2LEKA 2GLSA 3MHSD 5JHBA 3B08A 4A20A 5LXHA 4GLSC 3DVNV 3JW0X 4N9F4 3RYTA 4EZJA 1FFVA 3H1UA 3N9YC 3VTUA 3WAPA 4UDUC 5CX3A 1TY2A 1QILA 1PGAA 3PSEB 4NY0A 2OJRA 3V61A 4IG7B 2WXGA 2DZIA 1VLBA 1MPEA 1WGKA 2LVOA 3B1LX 4IOIE 5E6NA 2K8HA 5FKAC 3J9CA 5EE9A 3VRAB 2UU7A 3ZXRA 5EDSA 2NBVB 3Q8FA 3AE2B 1SE4A 2WXMA 3IHPC 2REXA 1OQYA 4YTNB 1KF6B 3I63C 1ZKHA 1MJDA 4BFRA 2BS2B 2GBRA 2DLBA 2A4ZA 4FXCA 2ZZPB 4YTMB 2RR9A 2OJWA 3EUB2 3TMPB 2LI5A 1YD8U 4XC2A 4W9LA 2N9XA 1HZ5A 1M4VA 2SEBD 3M63B 2FBWB 2ICIA 2KWUB 2L32A 5HI1A 2LGXA 1CK1A 4IWQA 4AWJA 5FK9C 2HJ1A 4HKZE 2GI9A 2NBUA 4LNKA 1FCCC 2ZW0A 5AEKB 1QOAA 4B95A 3CSTA 3DBLB 1IPGA 3ZDMC 2MBEA 2QMTA 3ZTDA 2MP2B 4LDTD 3U30A 3OJ4B 2K25A 1K53A 3AULA 4PYZA 1I4HA 4GB9A 2BB5A 2K9XA 1HE8A 2KDMA 3ZRCA 1SF0A 4LJPB 2BWFA 1DOIA 3R8BA 2GBKA 3TCAA 4NNJB 1ZXIA 4BOSC 4AOFA 3EC8A 2MBBB 4YSYB 3BYTB 3VHTC 3AH7A 1AARA 3ZXVA 3TL5A 2KDEB 3ZNHB 1WRDB 2IYDB 2WS3B 2RDGA 4A9AA 1ISNA 3NVVA 1JCKB 2C9WB 3CIRB 1SE2A 2E6XA 1D5XC 1WMHA 2BF8B 4HPPA 4E74A 4Q2JA 3QQ8B 4NZLB 4GDLB 1QKZA 2L8JA 3Q3MC 1MG4A 4EOYA 3ZJVA 2YVCA 3I9V1 3WAMA 4KIKB 1WY8A 3LXFA 5CHWA 5DPWA 4GIVA 2OHFA 3KH0A 1WJUA 5BMIA 1KH0A 1SJHD 2D3BA 2MJ3A 3HK0A 2KJRA 4YT0B 4BVUC 1YN4A 1TJEA 4GMVA 2ONQA 3AE8B 2QJLA 2PIAA 3P4SB 3T8MA 3Q3NC 3U2SC 1VZ8A 4K81A 2WX1A 4URKA 5CTRC 2JYEA 1JWAD 2R2OA 4RGMA 1VCBA 3Q3JA 4S17A 1R4MI 2X38A 4LTUA 3APDA 5G5GA 1WF9A 3ZUNA 4H2AA 1P7FA 3FILA 2B3AA 4MSMB 5BMHA 2VH2A 1H8CA 2LJ5A 4QAYA 4HJKA 2JZPA 3HM6X 1XF5L 2BYEA 4RM8A 4WQOB 3HUIA 4ZYSA 4M00A 4LLGM 2LVQA 2GRIA 3OJ3A 1SIFA 4FJYA 3WANA 3IG3A 2IO1B 2MP2A 1SIJA 3ZTCA 2L05A 3ZYYX 1QOGA 1V49A 4LNNA 2JWZA 3U7ZA 2MH7A 3RULA 3MC9A 3V6EB 1SE3A 2WXRA 3VUXA 1ZXHA 1WR1A 1FXIA 5E6OA 2W82A 2N9LA 4XGAB 4EE2A 1C9FA 3NVWA 4J3OD 1XLPA 1MHXA 4WH4A 2J53A 1Q5WB 1XLNA 2HTHA 2AQ3B 1PQSA 3PHXB 2JVCA 4IM3A 4HLEA 2W9NA 1FRDA 4MELA 2RDBC 2FUHB 3LYYA 4GDKB 3IXSA 2BS3B 1D3ZA 4L2YA 5C2TB 2K8BA 3A1QA 3B2GA 3RZWC 1WMHB 1AYFA 1UF0A 4ANWA 1SE9A 1FNWA 4W9FA 4MJSB 3BVMA 4K1RB 1SXTA 3DVNU 4KIKA 4FLHA 1JRUA 2K0PA 3E9SA 3FC4A 2MQJA 3KQ4A 4WQMA 1R4NB 2LGYA 1KOTA 4P1BC 5BYSA 1KTKA 1VZ6A 4K7UA 1F52A 4W9DA 1EF5A 3AE1B 3L10B 1KLUD 3VQIA 3QCAA 1QZEA 5J18A 3GB1A 4L23A 2QEJC 2Q5WD 4WAFA 1CQVA 1VJKA 2ACZB 3RNEC 3EFCA 4TMAB 1J7CA 2WXLA 1XXGA 2M0AA 2CHWA 3P42A 4N59A 4G0NB 1Z2MA 3PS6A 1V8CA 4A6QA 2KMAA 2KFKB 4IM2A 1E8WA 1WZ3A 2KWVB 2QC8A 2AEHA 2IGGA 3JVZX 2PEAA 4YTPB 3MHZA 1HA5A 1WGYA 2BT6A 4C7YA 2G3QB 4KVGB 4MGKE 1JW9D 1YJIA 2KN5A 1L0YB 4NQKE 3VRBB 1E10A 2L00B 3BY4B 1L5PA 1EO6A 4JPSA 2FIFA 4TQ0A 2K1FA 3NHEB 2SAKA 2KTRA 3D32A 3AE4B 2CU3A 2KO3A 3L08A 5KHQA 3ZNZB 5E6PA 1PUTA 2J42A 4FHKA 1UGJA 1YNTE 1E7VA 1YMHE 3TEXA 3X0WA 2TSSA 3B9JA 4I6NB 5D6JB 4ZOHC 2XN9C 2IDYA 1E7UA 2ZNVB 4EZLA 4E3CA 2MJEA 2IO3B 5MPOA 2PKOA 2KXJA 2EKIA 2D3AA 1E8XA 4IWPA 3GOEA 3QIJA 2KT7A 4TKNA 4ZRQA 2INPE 3L54A 1E90A 2N1WA 1XCTL 3HVDA 4KKJA 2PLPA 3ZW3A 2K5PA 1E7PB 1C1YB 4TSSA 1GJZA 1PGXA 4GXBA 5D94A 1NBFC 2GOWA 5EE1A 4HRSA 1DYQA 3BZDB 4N58A 4MH0E 3U8ZA 2KWCA 1Z5SB 3OLMD 1BUIC 2YLMA 4DHZE 2IJ0A 2KVRA 1FFUA 4F1SA 3MFGA 2BKRB 1YX5B 4KSKC 3ZLZA 1P98A 3NG0A 3LDZE 4DXGA 4HCPB 5JHAA 2G1EA 3GS2A 1V2YA 2KDFB 2BTEA 3LJ3A 2LASA 2WXFA 2GBNA 4BOZB 3U4EG 2ON8A 1GPXA 4XWWA 5DPTA 3ENEA 4LNOA 3BWUD 3ZGZA 4CHKA 4XYCA 5AUKA 3X23A 3SD5A 1FM0D 3IBEA 1CZPA 4B0EA 4C56C 1UNSA 2D3GA 2A5UA 2M1MA 3Q3OC 3Q69A 2KTFA 3QARA 3DBHB 2I38A 1WSPA 2KDBA 5HKHA 1HQRD 1WXSA 1MHHE 4ZRPA 3RNCC 3RUIB 4WWMA 4WIPA 4NAMA 1TY0A 1FXTB 2JXTA 2AL3A 4B6WA 2I1JA 1UH6A 3A4SC 1V1PA 1WXQA 3U52E 4DHZB 3RFZB 3B2FA 3W1YA 3T9LA 3ZRFA 1I35A 4MSQB 4JE3B 4OVVA 2FCSA 2LRWA 4L1BA 1D5MC 2XK5A 3CWIA 2N9EB 3PHWB 1ZDXA 4A55A 2N7JA 4KDIC 3PLUA 2KC1A 1STEA 4MJSA 4OHJA 3QK0A 4HROA 3PT2B 3AM9A 4II2B 5IN7A 4BKSD 1K8RB 3H6NA 2KFJA 2INDC 1WWTA 2KAJA 4RF1A 2RDHA 1FEHA 1XLOA 2M56B 1T0RC 1RRBA 3R7QA 4ZDVA 1UD7A 2LVPA 4K7WA 1UBQA 3AEDB 1QQRA 3H7PB 3P1MA 2KANA 2D5GA 1PYWD 2L7RA 4WAAA 2FCMA 2RGFA 2WQYB 1WX7A 3BVZA 1IBXB 4D2KA 1J19A 2OEDA 1YQ3B 3FKYA 4USAA 5CHVC 1P7EA 4WJNA 3N20C 3VUWA 5DCNA 2J7QB 3OWEB 1YN5A 2IO2B 4JX1C 2EMSA 4RM9A 4LCDE 1FNUA 1DOXA 1IUEA 1M94A 3UGBB 2VRRB 4AUQC 1UWXA 3UINB 2KJ6A 4TV3A 3NS1A 2UWQA 4TQ1A 3N1XC 3QX1A 1L6UA 1ZW7A 2EELA 4MACA 2C7NB 3CMMB 3DVGX 1I42A 1IP9A 2LUMA 4XE0A 1L6VA 2KZRA 3ECIA 1LO5D 2BKFA 5HG2A 2N9PC 1EF1A 1AWDA 4US9A 2WU5B 4KSLC 3DBLI 3DBHI 3A9JA 1MVKA 2DWQA 1ZGUB 3W1SA 2JRIB 2INNE 1ZOYB 3RNFC 1L0VB 2I2YA 3DBSA 3SDLC 3PZ8A 4XDDA 2WXNA 4NAWB 2W3RA 4WWNA 3RPFC 4PS3A 3GZNI 4I6PA 1B1ZA 2ZCCA 2FUG1 3GE3C 2NVUI 4DHJD 2PJHA 3W9CB 1C4CA 2LWPA 3AE3B 1LFDA 3K9OB 1P0RA 1V80A 2CHZA 2YEPF 2BVCA 1JWBD 1WX9A 2L0FA 2V3SA 4FHJA 3HM3A 1E6EB 2DAJA 1YIWA 1L4DB 3PRPB 4NAWA 2AWTA 1JMLA 2PE6B 1ZPSA 3P4RB 4G50A 2HDEA 3QA8A 3NOBA 4DDID 1XD3B 3DCGA 2WDTB 2KHWB 4AS1A 1FPYA 1TS2A 2QDFA 1HTOA 1ACCA 2KOXA 1VR9A 3U7DA 5KHOA 3MP9A 2MWSB 3PTFC 2LFIA 4MH8A 3WA0A 4E71A 5HHDG 4GGQA 4C7ZA 5L95C 3MC8A 1IBXA 2Y5CA 3JSVB 4MM3A 4XZ4A 3R2IA 1QOBA 2KKCA 1YJ1A 2GMIC 3NJTA 2NR2A 1E5WA 2WX0A 3I57A 4BKGA 4XX5A 1WJNA 1YN3A 1KM7A 1UZXB 4ITKA 1AN8A 3UI3A 2K6DB 4HJGE 2JF5A 3JSVA 4MM3B 3AMZA 2WXJA 3UF8A 1IGCA 1R4NI 4EZKA 2KACA 1KRHA 4ICVA 2V1YA 1I4GA 1HEZE 1WH3A 2RPVA 3N30A 1YQ4B 1WJ4A 1C4AA 4WURA 3C19A 3L13A 4GSWA 4EUTA 4GDKA 3TEZA 5IO9A 1NENB 3A1QB 1SSNA 4MGIE 1ZP0B 3APFA 1BXTA 2KX0A 2PVOD 3EFUA 5G5HA 2YEPB 5C3JB 4ASWC 1WXAA 2C5LC 1HTQA 2I1KA 2WXPA 1V1OA 4MGYE 1SGHA 3BINA 1DOYA 4K7SA 2QHOA 4BBNC 2LXAA 1N5XA 4DK5A 5IAAC 3BYYB 2LHDA 4AP4C 5EE0A 1TBEA 4BBNF 1S1QB 3AU5A 2LMCA 4RH6A 3H7SA 2KMCA 1V5TA 1EU3A 5JZEB 1BMLC 2XK5B 2V0GA 3PREA 4EKUA 1WE6A 1ZDVA 1GC7A 1WGHA 4FJZA 2R2QA 3ZQ4A 2NPTB 1DGJA 4IWOA 2M4NA 3AE5B 2WP9B 5AZHA 1RFKA 1NI2A 3RCZA 3TBLD 3H9DA 2DNFA 2ZCBA 4KGTA 2O6VD 4ANVA 2OOBB 2LHEA 1KLVA 1UUPA 4P6VF 1F1HA 3H7PA 3V62A 3R3MA 2JYTA 2LD9A 5C23A 3WCQA 2ASQA 2D2QA 1FCLA 1WR6E 4YSXB 2KQ4X 5BO4B 1NVID 4YWGG 3FAHA 2KTRB 2G45B 2LUEA 2Y5PA 4FBJB 3DVGY 1F2RI 4A3OA 3L16A 2MHJA 3BIID 4IM0A 2PVGC 2ZW1A 3O13A 1D4BA 2JZZA 1F77A 2V9HA 1WGRA 3L0WB 3P4PB 2JPHA 5IP4D 1WYGA 5DPRA 3HRDD 4IKGA 3RI7C 3DHGC 4OVZA 3I3TB 1NI3A 4C4VA 3LB8C 2BS4B 3T3OA 4G11A 3N32A 3UQAA 2J0KA 1V86A 2J0MA 1C78A 2IPKD 2DX5B 2XNAC 4A90A 3APCA 4C4VB 1LXDA 1WJ6A 4P1CC 5LNK1 1K52A 1T6BX 1TGZB 1NYRA 3WIMA 2PE9A 2IZVB 1XEEA 2NMQA 2LGDA 3H8HA 2Z8LA 1WRIA 3FILB 3T3NA 1SJED 1L2NA 5C1ZA 3V05A 4EFOA 2N7EA 3WALA 3N1YC 1A5RA 1TZ1A 1XQQA 1P9DU 1IYFA 4RGTA 2PPHA 2K3UA 4ARIA 1KJTA 2HE7A 4W9JA 2N9KA 1YX6B 2WXQA 4ZRKA 1C76A 1E9MA 2BW2A 3B0AA 3ML8A 1J7BA 4A3PA 3QWZB 1N6ZA 4G3XB 4BKTA 4W9CA 2QILA 5G2NA 2RMMA 2DZMA 2ZNVC 3DHIC 1S3SG 1VDVA 4MDKE 2XBBC 3RNGC 4CO7A 2GBJA 2G9HD 4FN2A 2M17A 1T5XD 2MEKA 4HDQA 1WX8A 4BAXA 1QF6A 4KGSA 5LXIB 3IAM1 1V9JA 1UBIA 3A9JB 4RNAA 3KW5B 1TKYA 2AX5A 3S2AA 3CF6E 4BKSA 3PO0A 3Q14C 3AE9B 4K3BA 2FE8A 2W55A 1C3TA 1K50A 2KN4A 4LK0M 5IA7A 4HCNB 2MRPA 1NDDA 1ET9A 4XWTA 2NTTA 2WYQA 5TR5A 3ZNGC 4HPLB 1Y56A 3EA6A 4RGNA 3R7RA 3AEGB 1V97A 2EMTA 4NQLB 3IAS1 2ZPYA 4OZBA 1SB3C 3AN1A 2JY6A 2JX5A 2QIEB 4EEWA 3DOWA 2JRHA 5BYRA 4C00A 4MGZE 3Q8BA 4XDCA 1LGRA 2L3ZA 4FADA 3AEEB 1TKEA 3VH3B 3W2DA 3M95A 1JROA 2BB6A 3HIZA 3Q8EA 2IY1B 4HK2A 3KYDD 3DBRB 3PRMB 3URYA 3EGRA 3KLSX 2LGSA 1Q1OA 2CKHB 3VTWA 5I4DA 1VZ7A 4M02A 3KUCB 3VTVA 4HPMB 4N6EB 3AE7B 3AU4A 2L1AA 1VD2A 3DPDA 3NRZA 4A8XC 1ENFA 1RM6C 1HXYD 2ZPNA 3A9KA 2CHXA 1G6JA 3RD2A 2WDRB 1E0ZA 3SR6A 1N60A 2IBIB 1TZOA 1RLFA 1TS4A 5LLIA 2DYMA 2CJNA 4REZA 3NZSA 3VH4B 3W1SC 2KVZA 2N0SB 2L76A 4KGRA 2L83A 1T0YA 3PRZA 4B0MA 3AEBB 3R2TA 4KV2A 3Q8AA 2LJIA 4ZHOA 1WZ0A 4F7ZA 1CMXB 5GMVA 1XO3A 3QJZA 2WXKA 2LXCA 3AECB 1NYQA 4OW0A 2H88B 1FRRA 2QSDA 1GC6A 1I4QA 2KX3A 1SEBD 5JH5C 3NY5A 4OZAA 4ICUA 2JQRB 2VH1A 2JUOA 1OEYJ 3V6CB 2J52A 4IUMB 3ZO5B 4NJ6A 5H92C 3RZFA 2WXHA 5AUIA 3TEYA 4K3CA 2NCNA 3RNAC 4KZ0A 1EWYC 1ZE3D 3Q6BA 3NUHB 1TKGA 1TIFA 3L17A 5AZGA 2NBWB 1EM7A 3K9PB 1OQQA 1KFYB 1OQRA 3Q2AC 2HTME 2O6VB 2IGHA 1AW7A 3QAQA 3PV1A 4RGOS 5BMGA 3Q3FA 2KK8A 3KWLA 2NPTA 4P7IA 2Z0DB 2HJ8A 1WGDA 2C7MB 2KC2A 1Q0WB 2MSED 4NPNA 2H89B 2BYVE 3E56A 1N63A 3C8YA 2N1VA 4JWUC 2KYWA 3SFDB 3VAWA 4HKQA 2ZEQA 3BK1A 1JWMD 3HHMA 4GDLA 3A9KB 1WE7A 1F2RC 5EE3A 2WDQB 1UWMA 4HDOA 2GB1A 2WGSA 2VZKB 1J8CA 4WWPA 2M0XA 2DAFA 3JYUA 3N1ZC 1GNUA 4DQOC 4IC7B 1PGBA 1WXMA 3ABVB 4ACFA 4W9KA 3NVZA 2V3PA 4JLCA 4HWIB 2BYTA 3PLVA 2DYBA 3TUOA 3Q8CA 4RCOA 1P1AA 2G4SA 4IDIA 2N7DA 3A4RA 2Y5BB 1WI0A 1YOVB 3EHVA 4ANUA 3SU8X 2BBCA 4OVUA 3W5UB 1D6EC 4AJWA 2FCNA 1GOZA 4W9IA 1EU4A 4DBGA 2BWES 1H4RA 2Z0EB 2V4LA 2G4DB
chains in the Genus database with same CATH topology
1NI2A 3RCZA 1GJZA 4FA6A 2LVOA 3B1LX 4W9EA 5E6NA 3TBLD 4GXBA 1XT9B 2K8HA 1NBFC 3H9DA 5D94A 2ZCBA 4LJOB 2GOWA 2O6VD 3NZUA 4ANVA 3UIPB 3M3JA 2OOBB 3U8ZA 1KLVA 1MG8A 2CR5A 5EDSA 2RSUA 2NBVB 2WWZA 2HD5B 2M8SA 3H7PA 5CHFA 3V62A 3R3MA 2LD9A 4MH0E 3CSFA 3IHPC 5C23A 2KWCA 2ASQA 4JQWC 2REXA 1OQYA 2D2QA 4ZRJA 4F8CB 1ZKHA 1Z5SB 4HXDA 3OLMD 1WR6E 4BFRA 5BO4B 2GBRA 2A4ZA 4W9HA 4WJQA 2ZZPB 2YLMA 2RR9A 4DHZE 1LM8B 2KVRA 3TMPB 2KTRB 2LI5A 4F1SA 1YQBA 1YD8U 2G45B 2BKRB 1YX5B 4XC2A 2LUEA 3PPAA 2O2VB 4KSKC 4FBJB 2D10A 3DVGY 4W9LA 2N9XA 3ZLZA 4A3OA 1P98A 2O6VA 3L16A 2KLCA 3LDZE 4HCPB 3M63B 5JHAA 4DHJB 4IM0A 1V2YA 2KDFB 3ZVVA 4CYEA 2DYOA 3LJ3A 2LASA 2GBNA 1Y8RC 2K8CA 2KJHB 4BOZB 2D07B 3IVFA 4PS8A 4PYUA 2KWUB 2XEWA 3ENEA 5DPTA 2JZZA 2LGXA 1WXVA 3IFWB 1WGRA 3L0WB 4IWQA 4CHKA 4AWJA 2JPHA 3MTNB 3ZDTA 4MEMA 5DPRA 3X23A 2DHZA 2NBUA 3SD5A 3PGEA 4GU2A 3IBEA 3ONSA 2BGFA 2D3GA 2A5UA 2M1MA 3I3TB 5AEKB 4B95A 3CSTA 2KTFA 1IPGA 3ZDMC 4KDLB 2MBEA 4G11A 3N32A 3ZTDA 2MP2B 3QARA 3UQAA 1OEYA 4LDTD 3U30A 3V60A 3OJ4B 1P3QU 3QC8B 2J0KA 2K25A 2KDBA 5HKHA 1V86A 2C60A 1WXSA 2J0MA 3AULA 4PYZA 3RUIB 2FIDA 4ZYNA 1FXTB 4GB9A 4TUUA 3VXWA 2DX5B 4RMAA 1HE8A 1V81A 1OGWA 2AL6A 2AL3A 4M8MA 4X57B 4KZCA 4LJPB 3DQVA 3ZRCA 4B6WA 2I1JA 2BWFA 3APCA 1LXDA 1WJ6A 2KD0A 1UH6A 2IO0B 2C7HA 2MCNB 3A4SC 1TGZB 2GBKA 2PE9A 3WIMA 2IZVB 3ML9A 3TCAA 4NNJB 2LGDA 4DHZB 4BOSC 3ALBA 4AOFA 3EC8A 2MBBB 3T9LA 3W1YA 3DDCB 3VHTC 2NS5A 1L2NA 1AARA 3ZRFA 5C1ZA 4EFOA 2N7EA 1WM2A 3WALA 1I35A 4MSQB 1A5RA 4OVVA 1TZ1A 2FCSA 1XQQA 2LRWA 1P9DU 3TL5A 1IYFA 2PPHA 2KDEB 3ZNHB 2XK5A 1X1MA 1WRDB 1V6EA 2IYDB 1KJTA 1V5OA 2HE7A 2N9EB 2CU1A 3PHWB 4W9JA 1ISNA 1YX6B 4II3B 2DZKA 2C9WB 5DPSA 4ZRKA 3EECA 4KDIC 3PLUA 2KC1A 3KVFB 2BF8B 1WMHA 4E74A 3B0AA 3ML8A 2ZVOA 4MJSA 3QWZB 4A3PA 3QQ8B 3QK0A 3RT3B 4B9KA 3PT2B 4II2B 4G3XB 4J6IA 3VFKA 1K8RB 1RAXA 4GDLB 4W9CA 4BKSD 4BKTA 2L8JA 3H6NA 1LQBA 5G2NA 4EOYA 2YVCA 1BT0A 2DZMA 5J17A 2KFJA 2KFKA 3WAMA 4KIKB 1WY8A 2ZNVC 1S3SG 4MDKE 5CHWA 2ZJDA 4GIVA 5DPWA 3KUZA 3KH0A 2XBBC 1WJUA 2KLGA 4CO7A 2GBJA 4FN2A 2M17A 2BPSA 1RRBA 3R7QA 1WYWB 4ZDVA 3VUYA 1UD7A 2LVPA 4K7WA 3UQBA 4HDQA 1WX8A 3HK0A 2KJRA 1UBQA 2J0JA 4BVUC 2FNJB 2MLBA 5LXIB 3H7PB 1V9JA 1UBIA 2KANA 3A9JB 2L7RA 4ZRIA 4GMVA 3KW5B 4WAAA 2FCMA 2RGFA 4GN1A 1WX7A 1WM3A 1WIAA 3S2AA 3T8MA 3CF6E 4BKSA 4K81A 2WX1A 1J19A 2RPQA 4URKA 5CTRC 4ANXA 1C3TA 5CHVC 2D11A 2CS4A 4M8NA 4WJNA 5DCNA 3VUWA 2R2OA 3DBRI 1VCBA 2O2VA 5IA7A 2J7QB 2MRPA 1NDDA 3Q3JA 4HCNB 4AJYB 2DZJA 2IO2B 1R4MI 2WYQA 5TR5A 3QHTA 3APDA 3ZNGC 4HPLB 2EMSA 1WF9A 4RM9A 3ZUNA 3R7RA 4LCDE 4JIOU 2B3AA 3ZNID 4MSMB 2EMTA 4NQLB 1M94A 3UGBB 1H8CA 2LJ5A 2VRRB 4AUQC 3WAOA 4HVBA 2FAZA 2ZPYA 4HJKA 3HM6X 1L7YA 2JY6A 2BYFA 4EEWA 2BYEA 3UINB 2KJ6A 3DOWA 2JRHA 4RM8A 4TV3A 2UWQA 4TQ1A 4WWOA 3KYCD 4WQOB 3QX1A 4MGZE 1ZW7A 4JL9A 2L3ZA 2UYZB 2C7NB 3CMMB 4FADA 2LVQA 3DVGX 3OJ3A 1SIFA 4FJYA 3WANA 3IG3A 1I42A 1IP9A 2IO1B 2KZRA 2MP2A 3VH3B 3ZTCA 3ECIA 2BKFA 2L05A 3M95A 1UGMA 1V49A 3HIZA 2N9PC 2JWZA 1EF1A 2IY1B 4HK2A 3KYDD 3RULA 2JZ3B 3PRMB 3V6EB 2K6QA 3VUXA 4KSLC 1WR1A 3DBLI 3O65B 5E6OA 1Q1OA 2DENB 3DBHI 2CKHB 4FJVB 2MBHA 1WFYA 3VTWA 3A9JA 2L0TA 4FULA 3KUCB 1ZGUB 3VTVA 3W1SA 4HPMB 4I6LB 2JRIB 3MJWA 3AU4A 3AXCA 1TTNA 1Q5WB 2HTHA 1VD2A 3DPDA 3DBSA 1PQSA 3C0RB 2JVCA 3PHXB 3SDLC 2ZPNA 3A9KA 4IM3A 2CHXA 2MX2A 4HLEA 1G6JA 3RD2A 2W9NA 4NAWB 2IBIB 4WWNA 1E8YA 4MELA 1RLFA 4PS3A 2FUHB 3GZNI 4I6PA 4PS7A 5LLIA 2DYMA 2ZCCA 4GDKB 2V4LA 2NVUI 4DHJD 3NZSA 2PJHA 4IW0A 3VH4B 1D3ZA 2LWPA 1LFDA 2K8BA 3K9OB 5D7GA 1P0RA 1V80A 2KQSA 2L76A 3A1QA 3RZWC 1WMHB 2CHZA 4ANWA 1SE9A 1U4AA 3P2BA 1WX9A 2L0FA 2V3SA 4FHJA 4W9FA 3PVLA 3HM3A 1T0YA 2DAJA 2ZVNA 1YIWA 3PRZA 4MJSB 4K1RB 3PRPB 2RD0A 3DVNU 1OTRB 2AWTA 4FLHA 4KIKA 1JRUA 4NAWA 2PE6B 5J2RA 4G50A 4KV2A 3QA8A 4GOCA 3NOBA 4DDID 1XD3B 3DCGA 2MQJA 1WZ0A 2WDTB 2KHWB 2Z59B 1GG3A 4WJOA 5G55A 1CMXB 4F7ZA 2LGYA 2KOXA 2N4FA 3U7DA 5GMVA 3QJZA 5KHOA 1KOTA 2MWSB 2LXCA 3PTFC 4W9GA 1E8ZA 2JXXA 4K7UA 2K39A 4W9DA 2KNBA 1EF5A 3WA0A 4E71A 3L10B 4GGQA 5L95C 3VQIA 1GC6A 2KX3A 5JH5C 3JSVB 4MM3A 3QCAA 3NY5A 4XZ4A 1QZEA 5J18A 4ICUA 2KKCA 2JUOA 1OEYJ 3V6CB 3KUDB 2LZ6A 4DXAB 3SHQA 1YJ1A 2GMIC 4IUMB 3ZO5B 2MW5A 4NJ6A 2NR2A 4DWFA 2MA9B 3RZFA 1E5WA 2WX0A 1GUAB 2CHWA 2NCNA 4BKGA 4XX5A 1WJNA 4KZ0A 4NJ7A 1KM7A 1Z2MA 4G0NB 3PS6A 1UZXB 1EUVB 5FR6A 3ZIMA 3L17A 5AZGA 2NBWB 2K6DB 4LDTB 3K9PB 2JF5A 3JSVA 2AYOB 2KMAA 2KFKB 3ZKJC 4IM2A 3UF8A 1E8WA 2O6VB 1R4NI 1WZ3A 2KWVB 4EZKA 2AEHA 3QAQA 3PV1A 1UELA 4ICVA 3JVZX 1WGGA 2KK8A 2PEAA 2IY0B 2V1YA 3Q3FA 2KDIA 1WH3A 4JGHB 3N30A 1WJ4A 2NPTA 4P7IA 1WGYA 3NS8A 2Z0DB 1RFAA 2G3QB 2HJ8A 3L13A 2JT4B 4KVGB 3VDZA 4GSWA 4MGKE 4GDKA 4EUTA 1WGDA 2KN5A 4M0WB 2C7MB 2KC2A 3M62B 4NQKE 1Q0WB 2MSED 4YL8A 2FCQA 4NPNA 3A1QB 2L00B 2BYVE 3BY4B 4WJPA 2MBQA 4MGIE 3APFA 2KX0A 3EFUA 2N1VA 3OAWA 1EO6A 3VAWA 2ZEQA 3W1SC 4ASWC 1WXAA 2KQ7A 2FIFA 1F9JA 2C5LC 2K1FA 3NHEB 4TQ0A 5D2MB 5L83A 3HHMA 2KTRA 3D32A 4GDLA 2I1KA 3A9KB 3TJPA 1WE7A 2KO3A 3L08A 5KHQA 4MGYE 1SGHA 3BINA 3ZNZB 5E6PA 4K7SA 4HDOA 4FHKA 2EKEC 2GBMA 2LRUA 1J8CA 4WWPA 2QHOA 3UIOB 2M0XA 2DAFA 3A33B 4BBNC 3JYUA 1E7VA 2LXAA 5AZFA 1GNUA 3X0WA 4DDGD 4DK5A 4I6NB 5D6JB 4IC7B 5IAAC 1WXMA 3VVWB 3TIXA 4W9KA 1E7UA 2ZNVB 2MBOA 4AP4C 4EZLA 3N3KB 3AI5A 3PZDA 1TBEA 4JLCA 4HWIB 3R66C 4E3CA 3PLVA 2DYBA 4BBNF 1S1QB 2IO3B 3AU5A 1J0GA 3H7SA 1P1AA 3MHSD 2G4SA 2KMCA 1V5TA 3B08A 4A20A 5JHBA 5LXHA 5JZEB 2N7DA 2XK5B 3A4RA 3DVNV 2KXJA 3JW0X 2Y5BB 4N9F4 3RYTA 4EZJA 3PREA 1WI0A 3EHVA 4EKUA 1E8XA 3H1UA 4IWPA 3VTUA 3WAPA 1WE6A 3GOEA 5CX3A 4ANUA 1GC7A 3QIJA 4TKNA 1WGHA 4FJZA 3SU8X 4OVUA 2R2QA 3L54A 2NPTB 1E90A 2N1WA 4IWOA 3PSEB 4AJWA 2FCNA 4NY0A 2OJRA 3V61A 4W9IA 3ZW3A 2M4NA 4DBGA 2BWES 4IG7B 1H4RA 1C1YB 5AZHA 2Z0EB 2DZIA 2G4DB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NI2 A;  3RCZ A;  1GJZ A;  4FA6 A;  2LVO A;  3B1L X;  4W9E A;  5E6N A;  3TBL D;  4GXB A;  1XT9 B;  2K8H A;  1NBF C;  3H9D A;  5D94 A;  2ZCB A;  4LJO B;  2GOW A;  2O6V D;  3NZU A;  4ANV A;  3UIP B;  3M3J A;  2OOB B;  3U8Z A;  1KLV A;  1MG8 A;  2CR5 A;  5EDS A;  2RSU A;  2NBV B;  2WWZ A;  2HD5 B;  2M8S A;  3H7P A;  5CHF A;  3V62 A;  3R3M A;  2LD9 A;  4MH0 E;  3CSF A;  3IHP C;  5C23 A;  2KWC A;  2ASQ A;  4JQW C;  2REX A;  1OQY A;  2D2Q A;  4ZRJ A;  4F8C B;  1ZKH A;  1Z5S B;  4HXD A;  3OLM D;  1WR6 E;  4BFR A;  5BO4 B;  2GBR A;  2A4Z A;  4W9H A;  4WJQ A;  2ZZP B;  2YLM A;  2RR9 A;  4DHZ E;  1LM8 B;  2KVR A;  3TMP B;  2KTR B;  2LI5 A;  4F1S A;  1YQB A;  1YD8 U;  2G45 B;  2BKR B;  1YX5 B;  4XC2 A;  2LUE A;  3PPA A;  2O2V B;  4KSK C;  4FBJ B;  2D10 A;  3DVG Y;  4W9L A;  2N9X A;  3ZLZ A;  4A3O A;  1P98 A;  2O6V A;  3L16 A;  2KLC A;  3LDZ E;  4HCP B;  3M63 B;  5JHA A;  4DHJ B;  4IM0 A;  1V2Y A;  2KDF B;  3ZVV A;  4CYE A;  2DYO A;  3LJ3 A;  2LAS A;  2GBN A;  1Y8R C;  2K8C A;  2KJH B;  4BOZ B;  2D07 B;  3IVF A;  4PS8 A;  4PYU A;  2KWU B;  2XEW A;  3ENE A;  5DPT A;  2JZZ A;  2LGX A;  1WXV A;  3IFW B;  1WGR A;  3L0W B;  4IWQ A;  4CHK A;  4AWJ A;  2JPH A;  3MTN B;  3ZDT A;  4MEM A;  5DPR A;  3X23 A;  2DHZ A;  2NBU A;  3SD5 A;  3PGE A;  4GU2 A;  3IBE A;  3ONS A;  2BGF A;  2D3G A;  2A5U A;  2M1M A;  3I3T B;  5AEK B;  4B95 A;  3CST A;  2KTF A;  1IPG A;  3ZDM C;  4KDL B;  2MBE A;  4G11 A;  3N32 A;  3ZTD A;  2MP2 B;  3QAR A;  3UQA A;  1OEY A;  4LDT D;  3U30 A;  3V60 A;  3OJ4 B;  1P3Q U;  3QC8 B;  2J0K A;  2K25 A;  2KDB A;  5HKH A;  1V86 A;  2C60 A;  1WXS A;  2J0M A;  3AUL A;  4PYZ A;  3RUI B;  2FID A;  4ZYN A;  1FXT B;  4GB9 A;  4TUU A;  3VXW A;  2DX5 B;  4RMA A;  1HE8 A;  1V81 A;  1OGW A;  2AL6 A;  2AL3 A;  4M8M A;  4X57 B;  4KZC A;  4LJP B;  3DQV A;  3ZRC A;  4B6W A;  2I1J A;  2BWF A;  3APC A;  1LXD A;  1WJ6 A;  2KD0 A;  1UH6 A;  2IO0 B;  2C7H A;  2MCN B;  3A4S C;  1TGZ B;  2GBK A;  2PE9 A;  3WIM A;  2IZV B;  3ML9 A;  3TCA A;  4NNJ B;  2LGD A;  4DHZ B;  4BOS C;  3ALB A;  4AOF A;  3EC8 A;  2MBB B;  3T9L A;  3W1Y A;  3DDC B;  3VHT C;  2NS5 A;  1L2N A;  1AAR A;  3ZRF A;  5C1Z A;  4EFO A;  2N7E A;  1WM2 A;  3WAL A;  1I35 A;  4MSQ B;  1A5R A;  4OVV A;  1TZ1 A;  2FCS A;  1XQQ A;  2LRW A;  1P9D U;  3TL5 A;  1IYF A;  2PPH A;  2KDE B;  3ZNH B;  2XK5 A;  1X1M A;  1WRD B;  1V6E A;  2IYD B;  1KJT A;  1V5O A;  2HE7 A;  2N9E B;  2CU1 A;  3PHW B;  4W9J A;  1ISN A;  1YX6 B;  4II3 B;  2DZK A;  2C9W B;  5DPS A;  4ZRK A;  3EEC A;  4KDI C;  3PLU A;  2KC1 A;  3KVF B;  2BF8 B;  1WMH A;  4E74 A;  3B0A A;  3ML8 A;  2ZVO A;  4MJS A;  3QWZ B;  4A3P A;  3QQ8 B;  3QK0 A;  3RT3 B;  4B9K A;  3PT2 B;  4II2 B;  4G3X B;  4J6I A;  3VFK A;  1K8R B;  1RAX A;  4GDL B;  4W9C A;  4BKS D;  4BKT A;  2L8J A;  3H6N A;  1LQB A;  5G2N A;  4EOY A;  2YVC A;  1BT0 A;  2DZM A;  5J17 A;  2KFJ A;  2KFK A;  3WAM A;  4KIK B;  1WY8 A;  2ZNV C;  1S3S G;  4MDK E;  5CHW A;  2ZJD A;  4GIV A;  5DPW A;  3KUZ A;  3KH0 A;  2XBB C;  1WJU A;  2KLG A;  4CO7 A;  2GBJ A;  4FN2 A;  2M17 A;  2BPS A;  1RRB A;  3R7Q A;  1WYW B;  4ZDV A;  3VUY A;  1UD7 A;  2LVP A;  4K7W A;  3UQB A;  4HDQ A;  1WX8 A;  3HK0 A;  2KJR A;  1UBQ A;  2J0J A;  4BVU C;  2FNJ B;  2MLB A;  5LXI B;  3H7P B;  1V9J A;  1UBI A;  2KAN A;  3A9J B;  2L7R A;  4ZRI A;  4GMV A;  3KW5 B;  4WAA A;  2FCM A;  2RGF A;  4GN1 A;  1WX7 A;  1WM3 A;  1WIA A;  3S2A A;  3T8M A;  3CF6 E;  4BKS A;  4K81 A;  2WX1 A;  1J19 A;  2RPQ A;  4URK A;  5CTR C;  4ANX A;  1C3T A;  5CHV C;  2D11 A;  2CS4 A;  4M8N A;  4WJN A;  5DCN A;  3VUW A;  2R2O A;  3DBR I;  1VCB A;  2O2V A;  5IA7 A;  2J7Q B;  2MRP A;  1NDD A;  3Q3J A;  4HCN B;  4AJY B;  2DZJ A;  2IO2 B;  1R4M I;  2WYQ A;  5TR5 A;  3QHT A;  3APD A;  3ZNG C;  4HPL B;  2EMS A;  1WF9 A;  4RM9 A;  3ZUN A;  3R7R A;  4LCD E;  4JIO U;  2B3A A;  3ZNI D;  4MSM B;  2EMT A;  4NQL B;  1M94 A;  3UGB B;  1H8C A;  2LJ5 A;  2VRR B;  4AUQ C;  3WAO A;  4HVB A;  2FAZ A;  2ZPY A;  4HJK A;  3HM6 X;  1L7Y A;  2JY6 A;  2BYF A;  4EEW A;  2BYE A;  3UIN B;  2KJ6 A;  3DOW A;  2JRH A;  4RM8 A;  4TV3 A;  2UWQ A;  4TQ1 A;  4WWO A;  3KYC D;  4WQO B;  3QX1 A;  4MGZ E;  1ZW7 A;  4JL9 A;  2L3Z A;  2UYZ B;  2C7N B;  3CMM B;  4FAD A;  2LVQ A;  3DVG X;  3OJ3 A;  1SIF A;  4FJY A;  3WAN A;  3IG3 A;  1I42 A;  1IP9 A;  2IO1 B;  2KZR A;  2MP2 A;  3VH3 B;  3ZTC A;  3ECI A;  2BKF A;  2L05 A;  3M95 A;  1UGM A;  1V49 A;  3HIZ A;  2N9P C;  2JWZ A;  1EF1 A;  2IY1 B;  4HK2 A;  3KYD D;  3RUL A;  2JZ3 B;  3PRM B;  3V6E B;  2K6Q A;  3VUX A;  4KSL C;  1WR1 A;  3DBL I;  3O65 B;  5E6O A;  1Q1O A;  2DEN B;  3DBH I;  2CKH B;  4FJV B;  2MBH A;  1WFY A;  3VTW A;  3A9J A;  2L0T A;  4FUL A;  3KUC B;  1ZGU B;  3VTV A;  3W1S A;  4HPM B;  4I6L B;  2JRI B;  3MJW A;  3AU4 A;  3AXC A;  1TTN A;  1Q5W B;  2HTH A;  1VD2 A;  3DPD A;  3DBS A;  1PQS A;  3C0R B;  2JVC A;  3PHX B;  3SDL C;  2ZPN A;  3A9K A;  4IM3 A;  2CHX A;  2MX2 A;  4HLE A;  1G6J A;  3RD2 A;  2W9N A;  4NAW B;  2IBI B;  4WWN A;  1E8Y A;  4MEL A;  1RLF A;  4PS3 A;  2FUH B;  3GZN I;  4I6P A;  4PS7 A;  5LLI A;  2DYM A;  2ZCC A;  4GDK B;  2V4L A;  2NVU I;  4DHJ D;  3NZS A;  2PJH A;  4IW0 A;  3VH4 B;  1D3Z A;  2LWP A;  1LFD A;  2K8B A;  3K9O B;  5D7G A;  1P0R A;  1V80 A;  2KQS A;  2L76 A;  3A1Q A;  3RZW C;  1WMH B;  2CHZ A;  4ANW A;  1SE9 A;  1U4A A;  3P2B A;  1WX9 A;  2L0F A;  2V3S A;  4FHJ A;  4W9F A;  3PVL A;  3HM3 A;  1T0Y A;  2DAJ A;  2ZVN A;  1YIW A;  3PRZ A;  4MJS B;  4K1R B;  3PRP B;  2RD0 A;  3DVN U;  1OTR B;  2AWT A;  4FLH A;  4KIK A;  1JRU A;  4NAW A;  2PE6 B;  5J2R A;  4G50 A;  4KV2 A;  3QA8 A;  4GOC A;  3NOB A;  4DDI D;  1XD3 B;  3DCG A;  2MQJ A;  1WZ0 A;  2WDT B;  2KHW B;  2Z59 B;  1GG3 A;  4WJO A;  5G55 A;  1CMX B;  4F7Z A;  2LGY A;  2KOX A;  2N4F A;  3U7D A;  5GMV A;  3QJZ A;  5KHO A;  1KOT A;  2MWS B;  2LXC A;  3PTF C;  4W9G A;  1E8Z A;  2JXX A;  4K7U A;  2K39 A;  4W9D A;  2KNB A;  1EF5 A;  3WA0 A;  4E71 A;  3L10 B;  4GGQ A;  5L95 C;  3VQI A;  1GC6 A;  2KX3 A;  5JH5 C;  3JSV B;  4MM3 A;  3QCA A;  3NY5 A;  4XZ4 A;  1QZE A;  5J18 A;  4ICU A;  2KKC A;  2JUO A;  1OEY J;  3V6C B;  3KUD B;  2LZ6 A;  4DXA B;  3SHQ A;  1YJ1 A;  2GMI C;  4IUM B;  3ZO5 B;  2MW5 A;  4NJ6 A;  2NR2 A;  4DWF A;  2MA9 B;  3RZF A;  1E5W A;  2WX0 A;  1GUA B;  2CHW A;  2NCN A;  4BKG A;  4XX5 A;  1WJN A;  4KZ0 A;  4NJ7 A;  1KM7 A;  1Z2M A;  4G0N B;  3PS6 A;  1UZX B;  1EUV B;  5FR6 A;  3ZIM A;  3L17 A;  5AZG A;  2NBW B;  2K6D B;  4LDT B;  3K9P B;  2JF5 A;  3JSV A;  2AYO B;  2KMA A;  2KFK B;  3ZKJ C;  4IM2 A;  3UF8 A;  1E8W A;  2O6V B;  1R4N I;  1WZ3 A;  2KWV B;  4EZK A;  2AEH A;  3QAQ A;  3PV1 A;  1UEL A;  4ICV A;  3JVZ X;  1WGG A;  2KK8 A;  2PEA A;  2IY0 B;  2V1Y A;  3Q3F A;  2KDI A;  1WH3 A;  4JGH B;  3N30 A;  1WJ4 A;  2NPT A;  4P7I A;  1WGY A;  3NS8 A;  2Z0D B;  1RFA A;  2G3Q B;  2HJ8 A;  3L13 A;  2JT4 B;  4KVG B;  3VDZ A;  4GSW A;  4MGK E;  4GDK A;  4EUT A;  1WGD A;  2KN5 A;  4M0W B;  2C7M B;  2KC2 A;  3M62 B;  4NQK E;  1Q0W B;  2MSE D;  4YL8 A;  2FCQ A;  4NPN A;  3A1Q B;  2L00 B;  2BYV E;  3BY4 B;  4WJP A;  2MBQ A;  4MGI E;  3APF A;  2KX0 A;  3EFU A;  2N1V A;  3OAW A;  1EO6 A;  3VAW A;  2ZEQ A;  3W1S C;  4ASW C;  1WXA A;  2KQ7 A;  2FIF A;  1F9J A;  2C5L C;  2K1F A;  3NHE B;  4TQ0 A;  5D2M B;  5L83 A;  3HHM A;  2KTR A;  3D32 A;  4GDL A;  2I1K A;  3A9K B;  3TJP A;  1WE7 A;  2KO3 A;  3L08 A;  5KHQ A;  4MGY E;  1SGH A;  3BIN A;  3ZNZ B;  5E6P A;  4K7S A;  4HDO A;  4FHK A;  2EKE C;  2GBM A;  2LRU A;  1J8C A;  4WWP A;  2QHO A;  3UIO B;  2M0X A;  2DAF A;  3A33 B;  4BBN C;  3JYU A;  1E7V A;  2LXA A;  5AZF A;  1GNU A;  3X0W A;  4DDG D;  4DK5 A;  4I6N B;  5D6J B;  4IC7 B;  5IAA C;  1WXM A;  3VVW B;  3TIX A;  4W9K A;  1E7U A;  2ZNV B;  2MBO A;  4AP4 C;  4EZL A;  3N3K B;  3AI5 A;  3PZD A;  1TBE A;  4JLC A;  4HWI B;  3R66 C;  4E3C A;  3PLV A;  2DYB A;  4BBN F;  1S1Q B;  2IO3 B;  3AU5 A;  1J0G A;  3H7S A;  1P1A A;  3MHS D;  2G4S A;  2KMC A;  1V5T A;  3B08 A;  4A20 A;  5JHB A;  5LXH A;  5JZE B;  2N7D A;  2XK5 B;  3A4R A;  3DVN V;  2KXJ A;  3JW0 X;  2Y5B B;  4N9F 4;  3RYT A;  4EZJ A;  3PRE A;  1WI0 A;  3EHV A;  4EKU A;  1E8X A;  3H1U A;  4IWP A;  3VTU A;  3WAP A;  1WE6 A;  3GOE A;  5CX3 A;  4ANU A;  1GC7 A;  3QIJ A;  4TKN A;  1WGH A;  4FJZ A;  3SU8 X;  4OVU A;  2R2Q A;  3L54 A;  2NPT B;  1E90 A;  2N1W A;  4IWO A;  3PSE B;  4AJW A;  2FCN A;  4NY0 A;  2OJR A;  3V61 A;  4W9I A;  3ZW3 A;  2M4N A;  4DBG A;  2BWE S;  4IG7 B;  1H4R A;  1C1Y B;  5AZH A;  2Z0E B;  2DZI A;  2G4D B; 
#chains in the Genus database with same CATH topology
 4FA6 A;  4RFB A;  4W9E A;  1XT9 B;  4LJO B;  3GP7 A;  3NZU A;  3UIP B;  3M3J A;  4JWS C;  1C4P A;  1MG8 A;  2CR5 A;  2RSU A;  2WWZ A;  2HD5 B;  2M8S A;  3IT6 B;  5CHF A;  1N62 A;  3CSF A;  4ZRJ A;  2V4I B;  4JQW C;  4F8C B;  4ZHP A;  2MJD A;  5FR3 A;  4HXD A;  5IOI A;  5BYQ A;  4W9H A;  4WJQ A;  1LM8 B;  4KX6 B;  1YQB A;  3PPA A;  2O2V B;  3HVZ A;  3RN9 C;  2D10 A;  2O6V A;  2KLC A;  1FXA A;  2B76 B;  4DHJ B;  3ZVV A;  4CYE A;  2DYO A;  1FNV A;  1Y8R C;  2K8C A;  2KJH B;  2D07 B;  2W3S A;  3BK2 A;  3IVF A;  4PS8 A;  4PYU A;  4AQ7 A;  2XEW A;  1N5W A;  1WXV A;  2WU2 B;  1I4P A;  3IFW B;  2IGD A;  1QLB B;  1TS5 A;  3MTN B;  3V3X A;  3ZDT A;  4M0W A;  4MEM A;  2DHZ A;  3PGE A;  4GU2 A;  1JWU D;  3ONS A;  2BGF A;  5H8Y E;  1GAQ B;  4KDL B;  1OEY A;  3V60 A;  3DWM A;  1TYG B;  3QC8 B;  1P3Q U;  1SBB B;  2JSV X;  3VR9 B;  2C60 A;  1PDX A;  2FID A;  5D3I B;  4ZYN A;  3AEA B;  3NVY A;  4TUU A;  3VXW A;  4C80 A;  4RMA A;  4PK1 A;  1V81 A;  1OGW A;  2AL6 A;  4M8M A;  4X57 B;  4KZC A;  3DQV A;  1JAL A;  2KD0 A;  2IO0 B;  2C7H A;  2MCN B;  1XCQ L;  3ML9 A;  3ALB A;  3P63 A;  1FIQ A;  3MC0 B;  2AQ2 B;  3DDC B;  1I7H A;  1JRP A;  2NS5 A;  1FD6 A;  1WM2 A;  2BQQ A;  1X1M A;  1V6E A;  1V5O A;  2CU1 A;  1L4Z B;  2KMM A;  4II3 B;  2DZK A;  5DPS A;  3EEC A;  3KVF B;  2ZVO A;  3RT3 B;  1C79 A;  4B9K A;  4J6I A;  3VFK A;  1RAX A;  1GB1 A;  1LQB A;  3SFE B;  1BT0 A;  5J17 A;  4ARC A;  2KFK A;  4BZA A;  2PMV A;  1RYJ A;  2ZJD A;  3KWV A;  3KUZ A;  4YXD B;  3AE6 B;  2KLG A;  2BPS A;  2JU6 X;  1WYW B;  3AB5 A;  3VUY A;  5TSS A;  3UQB A;  2J0J A;  1GB4 A;  2FNJ B;  2MLB A;  1K51 A;  4ZRI A;  4GN1 A;  2X8X X;  1WM3 A;  1WIA A;  1CJE A;  3GE8 C;  2WHI A;  4MT5 A;  2RPQ A;  2W54 A;  5T8I A;  4S0R A;  1HZ6 A;  4ANX A;  2WXO A;  2D11 A;  2CS4 A;  4M8N A;  2E3T A;  3DBR I;  2O2V A;  4AJY B;  1F0Z A;  3VR8 B;  3DWG C;  2DZJ A;  3GZN B;  1MI0 A;  2WLB A;  1V1P B;  3QHT A;  1J7A A;  2KWD A;  5D3D A;  1RWS A;  3SEB A;  4JIO U;  3ZNI D;  1MFW A;  4US8 A;  1ROE A;  1T0Q C;  4NJC A;  3WAO A;  4HVB A;  2FAZ A;  4O1N A;  1L7Y A;  2M19 A;  2BYF A;  2PTL A;  4WWO A;  3KYC D;  4JL9 A;  2UYZ B;  4RF0 A;  1ZUD 2;  3TEW A;  1JQ4 A;  1UGM A;  1Q10 A;  1XLQ A;  2JZ3 B;  2K6Q A;  3O65 B;  3W5V B;  2DEN B;  2CJO A;  4FJV B;  2MBH A;  1WFY A;  2LGI A;  2L0T A;  4YSZ B;  4FUL A;  2DBY A;  4CQN A;  4I6L B;  1ESF A;  3MJW A;  2QCZ A;  1KLG D;  3ZJU A;  3AXC A;  1TTN A;  1VRA B;  3C0R B;  3AV8 A;  2MX2 A;  3PZ7 A;  3RNB C;  1PFD A;  3I5J C;  1E8Y A;  4PS7 A;  2V3N A;  1T0S C;  3RMK C;  1FO4 A;  4IW0 A;  5D7G A;  1EWC A;  2KQS A;  3IT4 B;  2D3C A;  1U4A A;  3P2B A;  1QT9 A;  3PVL A;  2ZVN A;  2K22 A;  2R61 A;  2VZK D;  2RD0 A;  1D5Z C;  1OTR B;  5J2R A;  4GOC A;  2WDV B;  4LNF A;  2Z59 B;  1QOF A;  4P16 A;  4WJO A;  1GG3 A;  5G55 A;  2N4F A;  5IKC M;  4PT5 A;  4W9G A;  1E8Z A;  1FMA D;  2JXX A;  5GXG B;  2K39 A;  1R4M B;  2KNB A;  4KKI A;  4M01 A;  4HEA 1;  5JXV A;  2L52 A;  2PW9 A;  2LZ6 A;  3KUD B;  4DXA B;  5E6J A;  3SHQ A;  1T3Q A;  2MW5 A;  4OZC A;  4DWF A;  1YJJ A;  2MA9 B;  1GUA B;  4NJ7 A;  1EUV B;  5FR6 A;  3ZIM A;  2JWU A;  4LDT B;  1B9R A;  3AEF B;  3TSS A;  2WXI A;  2AYO B;  3ZKJ C;  1R7S A;  1IGD A;  4LNI A;  1C77 A;  1UEL A;  1TS3 A;  1WGG A;  2IY0 B;  2KDI A;  4JGH B;  2AQ1 B;  3NS8 A;  1RFA A;  2JT4 B;  1JWS D;  3VDZ A;  2Y3A A;  4M0W B;  3M62 B;  3MJ5 A;  4YL8 A;  2FCQ A;  5HFY A;  1ET6 A;  1N61 A;  4WJP A;  1NEK B;  2MBQ A;  3OG5 A;  3OAW A;  2KQ7 A;  1F9J A;  3ETR A;  5D2M B;  3L4P A;  5L83 A;  2J4X A;  2WNM A;  3TJP A;  3ZJT A;  1TT5 B;  3DHH C;  1OFF A;  3BVG A;  1I4X A;  1L0X B;  2EKE C;  2GBM A;  2LRU A;  3NZ3 A;  3UIO B;  3A33 B;  4R3D A;  2INC C;  5AZF A;  4DDG D;  3VVW B;  1I4R A;  4DXF A;  3TIX A;  2MBO A;  2NTS A;  3AI5 A;  3N3K B;  1A70 A;  3P4Q B;  3PZD A;  3R66 C;  1J0G A;  2LEK A;  2GLS A;  3MHS D;  5JHB A;  3B08 A;  4A20 A;  5LXH A;  4GLS C;  3DVN V;  3JW0 X;  4N9F 4;  3RYT A;  4EZJ A;  1FFV A;  3H1U A;  3N9Y C;  3VTU A;  3WAP A;  4UDU C;  5CX3 A;  1TY2 A;  1QIL A;  1PGA A;  3PSE B;  4NY0 A;  2OJR A;  3V61 A;  4IG7 B;  2WXG A;  2DZI A;  1VLB A;  1MPE A;  1WGK A;  2LVO A;  3B1L X;  4IOI E;  5E6N A;  2K8H A;  5FKA C;  3J9C A;  5EE9 A;  3VRA B;  2UU7 A;  3ZXR A;  5EDS A;  2NBV B;  3Q8F A;  3AE2 B;  1SE4 A;  2WXM A;  3IHP C;  2REX A;  1OQY A;  4YTN B;  1KF6 B;  3I63 C;  1ZKH A;  1MJD A;  4BFR A;  2BS2 B;  2GBR A;  2DLB A;  2A4Z A;  4FXC A;  2ZZP B;  4YTM B;  2RR9 A;  2OJW A;  3EUB 2;  3TMP B;  2LI5 A;  1YD8 U;  4XC2 A;  4W9L A;  2N9X A;  1HZ5 A;  1M4V A;  2SEB D;  3M63 B;  2FBW B;  2ICI A;  2KWU B;  2L32 A;  5HI1 A;  2LGX A;  1CK1 A;  4IWQ A;  4AWJ A;  5FK9 C;  2HJ1 A;  4HKZ E;  2GI9 A;  2NBU A;  4LNK A;  1FCC C;  2ZW0 A;  5AEK B;  1QOA A;  4B95 A;  3CST A;  3DBL B;  1IPG A;  3ZDM C;  2MBE A;  2QMT A;  3ZTD A;  2MP2 B;  4LDT D;  3U30 A;  3OJ4 B;  2K25 A;  1K53 A;  3AUL A;  4PYZ A;  1I4H A;  4GB9 A;  2BB5 A;  2K9X A;  1HE8 A;  2KDM A;  3ZRC A;  1SF0 A;  4LJP B;  2BWF A;  1DOI A;  3R8B A;  2GBK A;  3TCA A;  4NNJ B;  1ZXI A;  4BOS C;  4AOF A;  3EC8 A;  2MBB B;  4YSY B;  3BYT B;  3VHT C;  3AH7 A;  1AAR A;  3ZXV A;  3TL5 A;  2KDE B;  3ZNH B;  1WRD B;  2IYD B;  2WS3 B;  2RDG A;  4A9A A;  1ISN A;  3NVV A;  1JCK B;  2C9W B;  3CIR B;  1SE2 A;  2E6X A;  1D5X C;  1WMH A;  2BF8 B;  4HPP A;  4E74 A;  4Q2J A;  3QQ8 B;  4NZL B;  4GDL B;  1QKZ A;  2L8J A;  3Q3M C;  1MG4 A;  4EOY A;  3ZJV A;  2YVC A;  3I9V 1;  3WAM A;  4KIK B;  1WY8 A;  3LXF A;  5CHW A;  5DPW A;  4GIV A;  2OHF A;  3KH0 A;  1WJU A;  5BMI A;  1KH0 A;  1SJH D;  2D3B A;  2MJ3 A;  3HK0 A;  2KJR A;  4YT0 B;  4BVU C;  1YN4 A;  1TJE A;  4GMV A;  2ONQ A;  3AE8 B;  2QJL A;  2PIA A;  3P4S B;  3T8M A;  3Q3N C;  3U2S C;  1VZ8 A;  4K81 A;  2WX1 A;  4URK A;  5CTR C;  2JYE A;  1JWA D;  2R2O A;  4RGM A;  1VCB A;  3Q3J A;  4S17 A;  1R4M I;  2X38 A;  4LTU A;  3APD A;  5G5G A;  1WF9 A;  3ZUN A;  4H2A A;  1P7F A;  3FIL A;  2B3A A;  4MSM B;  5BMH A;  2VH2 A;  1H8C A;  2LJ5 A;  4QAY A;  4HJK A;  2JZP A;  3HM6 X;  1XF5 L;  2BYE A;  4RM8 A;  4WQO B;  3HUI A;  4ZYS A;  4M00 A;  4LLG M;  2LVQ A;  2GRI A;  3OJ3 A;  1SIF A;  4FJY A;  3WAN A;  3IG3 A;  2IO1 B;  2MP2 A;  1SIJ A;  3ZTC A;  2L05 A;  3ZYY X;  1QOG A;  1V49 A;  4LNN A;  2JWZ A;  3U7Z A;  2MH7 A;  3RUL A;  3MC9 A;  3V6E B;  1SE3 A;  2WXR A;  3VUX A;  1ZXH A;  1WR1 A;  1FXI A;  5E6O A;  2W82 A;  2N9L A;  4XGA B;  4EE2 A;  1C9F A;  3NVW A;  4J3O D;  1XLP A;  1MHX A;  4WH4 A;  2J53 A;  1Q5W B;  1XLN A;  2HTH A;  2AQ3 B;  1PQS A;  3PHX B;  2JVC A;  4IM3 A;  4HLE A;  2W9N A;  1FRD A;  4MEL A;  2RDB C;  2FUH B;  3LYY A;  4GDK B;  3IXS A;  2BS3 B;  1D3Z A;  4L2Y A;  5C2T B;  2K8B A;  3A1Q A;  3B2G A;  3RZW C;  1WMH B;  1AYF A;  1UF0 A;  4ANW A;  1SE9 A;  1FNW A;  4W9F A;  4MJS B;  3BVM A;  4K1R B;  1SXT A;  3DVN U;  4KIK A;  4FLH A;  1JRU A;  2K0P A;  3E9S A;  3FC4 A;  2MQJ A;  3KQ4 A;  4WQM A;  1R4N B;  2LGY A;  1KOT A;  4P1B C;  5BYS A;  1KTK A;  1VZ6 A;  4K7U A;  1F52 A;  4W9D A;  1EF5 A;  3AE1 B;  3L10 B;  1KLU D;  3VQI A;  3QCA A;  1QZE A;  5J18 A;  3GB1 A;  4L23 A;  2QEJ C;  2Q5W D;  4WAF A;  1CQV A;  1VJK A;  2ACZ B;  3RNE C;  3EFC A;  4TMA B;  1J7C A;  2WXL A;  1XXG A;  2M0A A;  2CHW A;  3P42 A;  4N59 A;  4G0N B;  1Z2M A;  3PS6 A;  1V8C A;  4A6Q A;  2KMA A;  2KFK B;  4IM2 A;  1E8W A;  1WZ3 A;  2KWV B;  2QC8 A;  2AEH A;  2IGG A;  3JVZ X;  2PEA A;  4YTP B;  3MHZ A;  1HA5 A;  1WGY A;  2BT6 A;  4C7Y A;  2G3Q B;  4KVG B;  4MGK E;  1JW9 D;  1YJI A;  2KN5 A;  1L0Y B;  4NQK E;  3VRB B;  1E10 A;  2L00 B;  3BY4 B;  1L5P A;  1EO6 A;  4JPS A;  2FIF A;  4TQ0 A;  2K1F A;  3NHE B;  2SAK A;  2KTR A;  3D32 A;  3AE4 B;  2CU3 A;  2KO3 A;  3L08 A;  5KHQ A;  3ZNZ B;  5E6P A;  1PUT A;  2J42 A;  4FHK A;  1UGJ A;  1YNT E;  1E7V A;  1YMH E;  3TEX A;  3X0W A;  2TSS A;  3B9J A;  4I6N B;  5D6J B;  4ZOH C;  2XN9 C;  2IDY A;  1E7U A;  2ZNV B;  4EZL A;  4E3C A;  2MJE A;  2IO3 B;  5MPO A;  2PKO A;  2KXJ A;  2EKI A;  2D3A A;  1E8X A;  4IWP A;  3GOE A;  3QIJ A;  2KT7 A;  4TKN A;  4ZRQ A;  2INP E;  3L54 A;  1E90 A;  2N1W A;  1XCT L;  3HVD A;  4KKJ A;  2PLP A;  3ZW3 A;  2K5P A;  1E7P B;  1C1Y B;  4TSS A;  1GJZ A;  1PGX A;  4GXB A;  5D94 A;  1NBF C;  2GOW A;  5EE1 A;  4HRS A;  1DYQ A;  3BZD B;  4N58 A;  4MH0 E;  3U8Z A;  2KWC A;  1Z5S B;  3OLM D;  1BUI C;  2YLM A;  4DHZ E;  2IJ0 A;  2KVR A;  1FFU A;  4F1S A;  3MFG A;  2BKR B;  1YX5 B;  4KSK C;  3ZLZ A;  1P98 A;  3NG0 A;  3LDZ E;  4DXG A;  4HCP B;  5JHA A;  2G1E A;  3GS2 A;  1V2Y A;  2KDF B;  2BTE A;  3LJ3 A;  2LAS A;  2WXF A;  2GBN A;  4BOZ B;  3U4E G;  2ON8 A;  1GPX A;  4XWW A;  5DPT A;  3ENE A;  4LNO A;  3BWU D;  3ZGZ A;  4CHK A;  4XYC A;  5AUK A;  3X23 A;  3SD5 A;  1FM0 D;  3IBE A;  1CZP A;  4B0E A;  4C56 C;  1UNS A;  2D3G A;  2A5U A;  2M1M A;  3Q3O C;  3Q69 A;  2KTF A;  3QAR A;  3DBH B;  2I38 A;  1WSP A;  2KDB A;  5HKH A;  1HQR D;  1WXS A;  1MHH E;  4ZRP A;  3RNC C;  3RUI B;  4WWM A;  4WIP A;  4NAM A;  1TY0 A;  1FXT B;  2JXT A;  2AL3 A;  4B6W A;  2I1J A;  1UH6 A;  3A4S C;  1V1P A;  1WXQ A;  3U52 E;  4DHZ B;  3RFZ B;  3B2F A;  3W1Y A;  3T9L A;  3ZRF A;  1I35 A;  4MSQ B;  4JE3 B;  4OVV A;  2FCS A;  2LRW A;  4L1B A;  1D5M C;  2XK5 A;  3CWI A;  2N9E B;  3PHW B;  1ZDX A;  4A55 A;  2N7J A;  4KDI C;  3PLU A;  2KC1 A;  1STE A;  4MJS A;  4OHJ A;  3QK0 A;  4HRO A;  3PT2 B;  3AM9 A;  4II2 B;  5IN7 A;  4BKS D;  1K8R B;  3H6N A;  2KFJ A;  2IND C;  1WWT A;  2KAJ A;  4RF1 A;  2RDH A;  1FEH A;  1XLO A;  2M56 B;  1T0R C;  1RRB A;  3R7Q A;  4ZDV A;  1UD7 A;  2LVP A;  4K7W A;  1UBQ A;  3AED B;  1QQR A;  3H7P B;  3P1M A;  2KAN A;  2D5G A;  1PYW D;  2L7R A;  4WAA A;  2FCM A;  2RGF A;  2WQY B;  1WX7 A;  3BVZ A;  1IBX B;  4D2K A;  1J19 A;  2OED A;  1YQ3 B;  3FKY A;  4USA A;  5CHV C;  1P7E A;  4WJN A;  3N20 C;  3VUW A;  5DCN A;  2J7Q B;  3OWE B;  1YN5 A;  2IO2 B;  4JX1 C;  2EMS A;  4RM9 A;  4LCD E;  1FNU A;  1DOX A;  1IUE A;  1M94 A;  3UGB B;  2VRR B;  4AUQ C;  1UWX A;  3UIN B;  2KJ6 A;  4TV3 A;  3NS1 A;  2UWQ A;  4TQ1 A;  3N1X C;  3QX1 A;  1L6U A;  1ZW7 A;  2EEL A;  4MAC A;  2C7N B;  3CMM B;  3DVG X;  1I42 A;  1IP9 A;  2LUM A;  4XE0 A;  1L6V A;  2KZR A;  3ECI A;  1LO5 D;  2BKF A;  5HG2 A;  2N9P C;  1EF1 A;  1AWD A;  4US9 A;  2WU5 B;  4KSL C;  3DBL I;  3DBH I;  3A9J A;  1MVK A;  2DWQ A;  1ZGU B;  3W1S A;  2JRI B;  2INN E;  1ZOY B;  3RNF C;  1L0V B;  2I2Y A;  3DBS A;  3SDL C;  3PZ8 A;  4XDD A;  2WXN A;  4NAW B;  2W3R A;  4WWN A;  3RPF C;  4PS3 A;  3GZN I;  4I6P A;  1B1Z A;  2ZCC A;  2FUG 1;  3GE3 C;  2NVU I;  4DHJ D;  2PJH A;  3W9C B;  1C4C A;  2LWP A;  3AE3 B;  1LFD A;  3K9O B;  1P0R A;  1V80 A;  2CHZ A;  2YEP F;  2BVC A;  1JWB D;  1WX9 A;  2L0F A;  2V3S A;  4FHJ A;  3HM3 A;  1E6E B;  2DAJ A;  1YIW A;  1L4D B;  3PRP B;  4NAW A;  2AWT A;  1JML A;  2PE6 B;  1ZPS A;  3P4R B;  4G50 A;  2HDE A;  3QA8 A;  3NOB A;  4DDI D;  1XD3 B;  3DCG A;  2WDT B;  2KHW B;  4AS1 A;  1FPY A;  1TS2 A;  2QDF A;  1HTO A;  1ACC A;  2KOX A;  1VR9 A;  3U7D A;  5KHO A;  3MP9 A;  2MWS B;  3PTF C;  2LFI A;  4MH8 A;  3WA0 A;  4E71 A;  5HHD G;  4GGQ A;  4C7Z A;  5L95 C;  3MC8 A;  1IBX A;  2Y5C A;  3JSV B;  4MM3 A;  4XZ4 A;  3R2I A;  1QOB A;  2KKC A;  1YJ1 A;  2GMI C;  3NJT A;  2NR2 A;  1E5W A;  2WX0 A;  3I57 A;  4BKG A;  4XX5 A;  1WJN A;  1YN3 A;  1KM7 A;  1UZX B;  4ITK A;  1AN8 A;  3UI3 A;  2K6D B;  4HJG E;  2JF5 A;  3JSV A;  4MM3 B;  3AMZ A;  2WXJ A;  3UF8 A;  1IGC A;  1R4N I;  4EZK A;  2KAC A;  1KRH A;  4ICV A;  2V1Y A;  1I4G A;  1HEZ E;  1WH3 A;  2RPV A;  3N30 A;  1YQ4 B;  1WJ4 A;  1C4A A;  4WUR A;  3C19 A;  3L13 A;  4GSW A;  4EUT A;  4GDK A;  3TEZ A;  5IO9 A;  1NEN B;  3A1Q B;  1SSN A;  4MGI E;  1ZP0 B;  3APF A;  1BXT A;  2KX0 A;  2PVO D;  3EFU A;  5G5H A;  2YEP B;  5C3J B;  4ASW C;  1WXA A;  2C5L C;  1HTQ A;  2I1K A;  2WXP A;  1V1O A;  4MGY E;  1SGH A;  3BIN A;  1DOY A;  4K7S A;  2QHO A;  4BBN C;  2LXA A;  1N5X A;  4DK5 A;  5IAA C;  3BYY B;  2LHD A;  4AP4 C;  5EE0 A;  1TBE A;  4BBN F;  1S1Q B;  3AU5 A;  2LMC A;  4RH6 A;  3H7S A;  2KMC A;  1V5T A;  1EU3 A;  5JZE B;  1BML C;  2XK5 B;  2V0G A;  3PRE A;  4EKU A;  1WE6 A;  1ZDV A;  1GC7 A;  1WGH A;  4FJZ A;  2R2Q A;  3ZQ4 A;  2NPT B;  1DGJ A;  4IWO A;  2M4N A;  3AE5 B;  2WP9 B;  5AZH A;  1RFK A;  1NI2 A;  3RCZ A;  3TBL D;  3H9D A;  2DNF A;  2ZCB A;  4KGT A;  2O6V D;  4ANV A;  2OOB B;  2LHE A;  1KLV A;  1UUP A;  4P6V F;  1F1H A;  3H7P A;  3V62 A;  3R3M A;  2JYT A;  2LD9 A;  5C23 A;  3WCQ A;  2ASQ A;  2D2Q A;  1FCL A;  1WR6 E;  4YSX B;  2KQ4 X;  5BO4 B;  1NVI D;  4YWG G;  3FAH A;  2KTR B;  2G45 B;  2LUE A;  2Y5P A;  4FBJ B;  3DVG Y;  1F2R I;  4A3O A;  3L16 A;  2MHJ A;  3BII D;  4IM0 A;  2PVG C;  2ZW1 A;  3O13 A;  1D4B A;  2JZZ A;  1F77 A;  2V9H A;  1WGR A;  3L0W B;  3P4P B;  2JPH A;  5IP4 D;  1WYG A;  5DPR A;  3HRD D;  4IKG A;  3RI7 C;  3DHG C;  4OVZ A;  3I3T B;  1NI3 A;  4C4V A;  3LB8 C;  2BS4 B;  3T3O A;  4G11 A;  3N32 A;  3UQA A;  2J0K A;  1V86 A;  2J0M A;  1C78 A;  2IPK D;  2DX5 B;  2XNA C;  4A90 A;  3APC A;  4C4V B;  1LXD A;  1WJ6 A;  4P1C C;  5LNK 1;  1K52 A;  1T6B X;  1TGZ B;  1NYR A;  3WIM A;  2PE9 A;  2IZV B;  1XEE A;  2NMQ A;  2LGD A;  3H8H A;  2Z8L A;  1WRI A;  3FIL B;  3T3N A;  1SJE D;  1L2N A;  5C1Z A;  3V05 A;  4EFO A;  2N7E A;  3WAL A;  3N1Y C;  1A5R A;  1TZ1 A;  1XQQ A;  1P9D U;  1IYF A;  4RGT A;  2PPH A;  2K3U A;  4ARI A;  1KJT A;  2HE7 A;  4W9J A;  2N9K A;  1YX6 B;  2WXQ A;  4ZRK A;  1C76 A;  1E9M A;  2BW2 A;  3B0A A;  3ML8 A;  1J7B A;  4A3P A;  3QWZ B;  1N6Z A;  4G3X B;  4BKT A;  4W9C A;  2QIL A;  5G2N A;  2RMM A;  2DZM A;  2ZNV C;  3DHI C;  1S3S G;  1VDV A;  4MDK E;  2XBB C;  3RNG C;  4CO7 A;  2GBJ A;  2G9H D;  4FN2 A;  2M17 A;  1T5X D;  2MEK A;  4HDQ A;  1WX8 A;  4BAX A;  1QF6 A;  4KGS A;  5LXI B;  3IAM 1;  1V9J A;  1UBI A;  3A9J B;  4RNA A;  3KW5 B;  1TKY A;  2AX5 A;  3S2A A;  3CF6 E;  4BKS A;  3PO0 A;  3Q14 C;  3AE9 B;  4K3B A;  2FE8 A;  2W55 A;  1C3T A;  1K50 A;  2KN4 A;  4LK0 M;  5IA7 A;  4HCN B;  2MRP A;  1NDD A;  1ET9 A;  4XWT A;  2NTT A;  2WYQ A;  5TR5 A;  3ZNG C;  4HPL B;  1Y56 A;  3EA6 A;  4RGN A;  3R7R A;  3AEG B;  1V97 A;  2EMT A;  4NQL B;  3IAS 1;  2ZPY A;  4OZB A;  1SB3 C;  3AN1 A;  2JY6 A;  2JX5 A;  2QIE B;  4EEW A;  3DOW A;  2JRH A;  5BYR A;  4C00 A;  4MGZ E;  3Q8B A;  4XDC A;  1LGR A;  2L3Z A;  4FAD A;  3AEE B;  1TKE A;  3VH3 B;  3W2D A;  3M95 A;  1JRO A;  2BB6 A;  3HIZ A;  3Q8E A;  2IY1 B;  4HK2 A;  3KYD D;  3DBR B;  3PRM B;  3URY A;  3EGR A;  3KLS X;  2LGS A;  1Q1O A;  2CKH B;  3VTW A;  5I4D A;  1VZ7 A;  4M02 A;  3KUC B;  3VTV A;  4HPM B;  4N6E B;  3AE7 B;  3AU4 A;  2L1A A;  1VD2 A;  3DPD A;  3NRZ A;  4A8X C;  1ENF A;  1RM6 C;  1HXY D;  2ZPN A;  3A9K A;  2CHX A;  1G6J A;  3RD2 A;  2WDR B;  1E0Z A;  3SR6 A;  1N60 A;  2IBI B;  1TZO A;  1RLF A;  1TS4 A;  5LLI A;  2DYM A;  2CJN A;  4REZ A;  3NZS A;  3VH4 B;  3W1S C;  2KVZ A;  2N0S B;  2L76 A;  4KGR A;  2L83 A;  1T0Y A;  3PRZ A;  4B0M A;  3AEB B;  3R2T A;  4KV2 A;  3Q8A A;  2LJI A;  4ZHO A;  1WZ0 A;  4F7Z A;  1CMX B;  5GMV A;  1XO3 A;  3QJZ A;  2WXK A;  2LXC A;  3AEC B;  1NYQ A;  4OW0 A;  2H88 B;  1FRR A;  2QSD A;  1GC6 A;  1I4Q A;  2KX3 A;  1SEB D;  5JH5 C;  3NY5 A;  4OZA A;  4ICU A;  2JQR B;  2VH1 A;  2JUO A;  1OEY J;  3V6C B;  2J52 A;  4IUM B;  3ZO5 B;  4NJ6 A;  5H92 C;  3RZF A;  2WXH A;  5AUI A;  3TEY A;  4K3C A;  2NCN A;  3RNA C;  4KZ0 A;  1EWY C;  1ZE3 D;  3Q6B A;  3NUH B;  1TKG A;  1TIF A;  3L17 A;  5AZG A;  2NBW B;  1EM7 A;  3K9P B;  1OQQ A;  1KFY B;  1OQR A;  3Q2A C;  2HTM E;  2O6V B;  2IGH A;  1AW7 A;  3QAQ A;  3PV1 A;  4RGO S;  5BMG A;  3Q3F A;  2KK8 A;  3KWL A;  2NPT A;  4P7I A;  2Z0D B;  2HJ8 A;  1WGD A;  2C7M B;  2KC2 A;  1Q0W B;  2MSE D;  4NPN A;  2H89 B;  2BYV E;  3E56 A;  1N63 A;  3C8Y A;  2N1V A;  4JWU C;  2KYW A;  3SFD B;  3VAW A;  4HKQ A;  2ZEQ A;  3BK1 A;  1JWM D;  3HHM A;  4GDL A;  3A9K B;  1WE7 A;  1F2R C;  5EE3 A;  2WDQ B;  1UWM A;  4HDO A;  2GB1 A;  2WGS A;  2VZK B;  1J8C A;  4WWP A;  2M0X A;  2DAF A;  3JYU A;  3N1Z C;  1GNU A;  4DQO C;  4IC7 B;  1PGB A;  1WXM A;  3ABV B;  4ACF A;  4W9K A;  3NVZ A;  2V3P A;  4JLC A;  4HWI B;  2BYT A;  3PLV A;  2DYB A;  3TUO A;  3Q8C A;  4RCO A;  1P1A A;  2G4S A;  4IDI A;  2N7D A;  3A4R A;  2Y5B B;  1WI0 A;  1YOV B;  3EHV A;  4ANU A;  3SU8 X;  2BBC A;  4OVU A;  3W5U B;  1D6E C;  4AJW A;  2FCN A;  1GOZ A;  4W9I A;  1EU4 A;  4DBG A;  2BWE S;  1H4R A;  2Z0E B;  2V4L A;  2G4D B; 
#chains in the Genus database with same CATH homology
 1NI2 A;  3RCZ A;  1GJZ A;  4FA6 A;  2LVO A;  3B1L X;  4W9E A;  5E6N A;  3TBL D;  4GXB A;  1XT9 B;  2K8H A;  1NBF C;  3H9D A;  5D94 A;  2ZCB A;  4LJO B;  2GOW A;  2O6V D;  3NZU A;  4ANV A;  3UIP B;  3M3J A;  2OOB B;  3U8Z A;  1KLV A;  1MG8 A;  2CR5 A;  5EDS A;  2RSU A;  2NBV B;  2WWZ A;  2HD5 B;  2M8S A;  3H7P A;  5CHF A;  3V62 A;  3R3M A;  2LD9 A;  4MH0 E;  3CSF A;  3IHP C;  5C23 A;  2KWC A;  2ASQ A;  4JQW C;  2REX A;  1OQY A;  2D2Q A;  4ZRJ A;  4F8C B;  1ZKH A;  1Z5S B;  4HXD A;  3OLM D;  1WR6 E;  4BFR A;  5BO4 B;  2GBR A;  2A4Z A;  4W9H A;  4WJQ A;  2ZZP B;  2YLM A;  2RR9 A;  4DHZ E;  1LM8 B;  2KVR A;  3TMP B;  2KTR B;  2LI5 A;  4F1S A;  1YQB A;  1YD8 U;  2G45 B;  2BKR B;  1YX5 B;  4XC2 A;  2LUE A;  3PPA A;  2O2V B;  4KSK C;  4FBJ B;  2D10 A;  3DVG Y;  4W9L A;  2N9X A;  3ZLZ A;  4A3O A;  1P98 A;  2O6V A;  3L16 A;  2KLC A;  3LDZ E;  4HCP B;  3M63 B;  5JHA A;  4DHJ B;  4IM0 A;  1V2Y A;  2KDF B;  3ZVV A;  4CYE A;  2DYO A;  3LJ3 A;  2LAS A;  2GBN A;  1Y8R C;  2K8C A;  2KJH B;  4BOZ B;  2D07 B;  3IVF A;  4PS8 A;  4PYU A;  2KWU B;  2XEW A;  3ENE A;  5DPT A;  2JZZ A;  2LGX A;  1WXV A;  3IFW B;  1WGR A;  3L0W B;  4IWQ A;  4CHK A;  4AWJ A;  2JPH A;  3MTN B;  3ZDT A;  4MEM A;  5DPR A;  3X23 A;  2DHZ A;  2NBU A;  3SD5 A;  3PGE A;  4GU2 A;  3IBE A;  3ONS A;  2BGF A;  2D3G A;  2A5U A;  2M1M A;  3I3T B;  5AEK B;  4B95 A;  3CST A;  2KTF A;  1IPG A;  3ZDM C;  4KDL B;  2MBE A;  4G11 A;  3N32 A;  3ZTD A;  2MP2 B;  3QAR A;  3UQA A;  1OEY A;  4LDT D;  3U30 A;  3V60 A;  3OJ4 B;  1P3Q U;  3QC8 B;  2J0K A;  2K25 A;  2KDB A;  5HKH A;  1V86 A;  2C60 A;  1WXS A;  2J0M A;  3AUL A;  4PYZ A;  3RUI B;  2FID A;  4ZYN A;  1FXT B;  4GB9 A;  4TUU A;  3VXW A;  2DX5 B;  4RMA A;  1HE8 A;  1V81 A;  1OGW A;  2AL6 A;  2AL3 A;  4M8M A;  4X57 B;  4KZC A;  4LJP B;  3DQV A;  3ZRC A;  4B6W A;  2I1J A;  2BWF A;  3APC A;  1LXD A;  1WJ6 A;  2KD0 A;  1UH6 A;  2IO0 B;  2C7H A;  2MCN B;  3A4S C;  1TGZ B;  2GBK A;  2PE9 A;  3WIM A;  2IZV B;  3ML9 A;  3TCA A;  4NNJ B;  2LGD A;  4DHZ B;  4BOS C;  3ALB A;  4AOF A;  3EC8 A;  2MBB B;  3T9L A;  3W1Y A;  3DDC B;  3VHT C;  2NS5 A;  1L2N A;  1AAR A;  3ZRF A;  5C1Z A;  4EFO A;  2N7E A;  1WM2 A;  3WAL A;  1I35 A;  4MSQ B;  1A5R A;  4OVV A;  1TZ1 A;  2FCS A;  1XQQ A;  2LRW A;  1P9D U;  3TL5 A;  1IYF A;  2PPH A;  2KDE B;  3ZNH B;  2XK5 A;  1X1M A;  1WRD B;  1V6E A;  2IYD B;  1KJT A;  1V5O A;  2HE7 A;  2N9E B;  2CU1 A;  3PHW B;  4W9J A;  1ISN A;  1YX6 B;  4II3 B;  2DZK A;  2C9W B;  5DPS A;  4ZRK A;  3EEC A;  4KDI C;  3PLU A;  2KC1 A;  3KVF B;  2BF8 B;  1WMH A;  4E74 A;  3B0A A;  3ML8 A;  2ZVO A;  4MJS A;  3QWZ B;  4A3P A;  3QQ8 B;  3QK0 A;  3RT3 B;  4B9K A;  3PT2 B;  4II2 B;  4G3X B;  4J6I A;  3VFK A;  1K8R B;  1RAX A;  4GDL B;  4W9C A;  4BKS D;  4BKT A;  2L8J A;  3H6N A;  1LQB A;  5G2N A;  4EOY A;  2YVC A;  1BT0 A;  2DZM A;  5J17 A;  2KFJ A;  2KFK A;  3WAM A;  4KIK B;  1WY8 A;  2ZNV C;  1S3S G;  4MDK E;  5CHW A;  2ZJD A;  4GIV A;  5DPW A;  3KUZ A;  3KH0 A;  2XBB C;  1WJU A;  2KLG A;  4CO7 A;  2GBJ A;  4FN2 A;  2M17 A;  2BPS A;  1RRB A;  3R7Q A;  1WYW B;  4ZDV A;  3VUY A;  1UD7 A;  2LVP A;  4K7W A;  3UQB A;  4HDQ A;  1WX8 A;  3HK0 A;  2KJR A;  1UBQ A;  2J0J A;  4BVU C;  2FNJ B;  2MLB A;  5LXI B;  3H7P B;  1V9J A;  1UBI A;  2KAN A;  3A9J B;  2L7R A;  4ZRI A;  4GMV A;  3KW5 B;  4WAA A;  2FCM A;  2RGF A;  4GN1 A;  1WX7 A;  1WM3 A;  1WIA A;  3S2A A;  3T8M A;  3CF6 E;  4BKS A;  4K81 A;  2WX1 A;  1J19 A;  2RPQ A;  4URK A;  5CTR C;  4ANX A;  1C3T A;  5CHV C;  2D11 A;  2CS4 A;  4M8N A;  4WJN A;  5DCN A;  3VUW A;  2R2O A;  3DBR I;  1VCB A;  2O2V A;  5IA7 A;  2J7Q B;  2MRP A;  1NDD A;  3Q3J A;  4HCN B;  4AJY B;  2DZJ A;  2IO2 B;  1R4M I;  2WYQ A;  5TR5 A;  3QHT A;  3APD A;  3ZNG C;  4HPL B;  2EMS A;  1WF9 A;  4RM9 A;  3ZUN A;  3R7R A;  4LCD E;  4JIO U;  2B3A A;  3ZNI D;  4MSM B;  2EMT A;  4NQL B;  1M94 A;  3UGB B;  1H8C A;  2LJ5 A;  2VRR B;  4AUQ C;  3WAO A;  4HVB A;  2FAZ A;  2ZPY A;  4HJK A;  3HM6 X;  1L7Y A;  2JY6 A;  2BYF A;  4EEW A;  2BYE A;  3UIN B;  2KJ6 A;  3DOW A;  2JRH A;  4RM8 A;  4TV3 A;  2UWQ A;  4TQ1 A;  4WWO A;  3KYC D;  4WQO B;  3QX1 A;  4MGZ E;  1ZW7 A;  4JL9 A;  2L3Z A;  2UYZ B;  2C7N B;  3CMM B;  4FAD A;  2LVQ A;  3DVG X;  3OJ3 A;  1SIF A;  4FJY A;  3WAN A;  3IG3 A;  1I42 A;  1IP9 A;  2IO1 B;  2KZR A;  2MP2 A;  3VH3 B;  3ZTC A;  3ECI A;  2BKF A;  2L05 A;  3M95 A;  1UGM A;  1V49 A;  3HIZ A;  2N9P C;  2JWZ A;  1EF1 A;  2IY1 B;  4HK2 A;  3KYD D;  3RUL A;  2JZ3 B;  3PRM B;  3V6E B;  2K6Q A;  3VUX A;  4KSL C;  1WR1 A;  3DBL I;  3O65 B;  5E6O A;  1Q1O A;  2DEN B;  3DBH I;  2CKH B;  4FJV B;  2MBH A;  1WFY A;  3VTW A;  3A9J A;  2L0T A;  4FUL A;  3KUC B;  1ZGU B;  3VTV A;  3W1S A;  4HPM B;  4I6L B;  2JRI B;  3MJW A;  3AU4 A;  3AXC A;  1TTN A;  1Q5W B;  2HTH A;  1VD2 A;  3DPD A;  3DBS A;  1PQS A;  3C0R B;  2JVC A;  3PHX B;  3SDL C;  2ZPN A;  3A9K A;  4IM3 A;  2CHX A;  2MX2 A;  4HLE A;  1G6J A;  3RD2 A;  2W9N A;  4NAW B;  2IBI B;  4WWN A;  1E8Y A;  4MEL A;  1RLF A;  4PS3 A;  2FUH B;  3GZN I;  4I6P A;  4PS7 A;  5LLI A;  2DYM A;  2ZCC A;  4GDK B;  2V4L A;  2NVU I;  4DHJ D;  3NZS A;  2PJH A;  4IW0 A;  3VH4 B;  1D3Z A;  2LWP A;  1LFD A;  2K8B A;  3K9O B;  5D7G A;  1P0R A;  1V80 A;  2KQS A;  2L76 A;  3A1Q A;  3RZW C;  1WMH B;  2CHZ A;  4ANW A;  1SE9 A;  1U4A A;  3P2B A;  1WX9 A;  2L0F A;  2V3S A;  4FHJ A;  4W9F A;  3PVL A;  3HM3 A;  1T0Y A;  2DAJ A;  2ZVN A;  1YIW A;  3PRZ A;  4MJS B;  4K1R B;  3PRP B;  2RD0 A;  3DVN U;  1OTR B;  2AWT A;  4FLH A;  4KIK A;  1JRU A;  4NAW A;  2PE6 B;  5J2R A;  4G50 A;  4KV2 A;  3QA8 A;  4GOC A;  3NOB A;  4DDI D;  1XD3 B;  3DCG A;  2MQJ A;  1WZ0 A;  2WDT B;  2KHW B;  2Z59 B;  1GG3 A;  4WJO A;  5G55 A;  1CMX B;  4F7Z A;  2LGY A;  2KOX A;  2N4F A;  3U7D A;  5GMV A;  3QJZ A;  5KHO A;  1KOT A;  2MWS B;  2LXC A;  3PTF C;  4W9G A;  1E8Z A;  2JXX A;  4K7U A;  2K39 A;  4W9D A;  2KNB A;  1EF5 A;  3WA0 A;  4E71 A;  3L10 B;  4GGQ A;  5L95 C;  3VQI A;  1GC6 A;  2KX3 A;  5JH5 C;  3JSV B;  4MM3 A;  3QCA A;  3NY5 A;  4XZ4 A;  1QZE A;  5J18 A;  4ICU A;  2KKC A;  2JUO A;  1OEY J;  3V6C B;  3KUD B;  2LZ6 A;  4DXA B;  3SHQ A;  1YJ1 A;  2GMI C;  4IUM B;  3ZO5 B;  2MW5 A;  4NJ6 A;  2NR2 A;  4DWF A;  2MA9 B;  3RZF A;  1E5W A;  2WX0 A;  1GUA B;  2CHW A;  2NCN A;  4BKG A;  4XX5 A;  1WJN A;  4KZ0 A;  4NJ7 A;  1KM7 A;  1Z2M A;  4G0N B;  3PS6 A;  1UZX B;  1EUV B;  5FR6 A;  3ZIM A;  3L17 A;  5AZG A;  2NBW B;  2K6D B;  4LDT B;  3K9P B;  2JF5 A;  3JSV A;  2AYO B;  2KMA A;  2KFK B;  3ZKJ C;  4IM2 A;  3UF8 A;  1E8W A;  2O6V B;  1R4N I;  1WZ3 A;  2KWV B;  4EZK A;  2AEH A;  3QAQ A;  3PV1 A;  1UEL A;  4ICV A;  3JVZ X;  1WGG A;  2KK8 A;  2PEA A;  2IY0 B;  2V1Y A;  3Q3F A;  2KDI A;  1WH3 A;  4JGH B;  3N30 A;  1WJ4 A;  2NPT A;  4P7I A;  1WGY A;  3NS8 A;  2Z0D B;  1RFA A;  2G3Q B;  2HJ8 A;  3L13 A;  2JT4 B;  4KVG B;  3VDZ A;  4GSW A;  4MGK E;  4GDK A;  4EUT A;  1WGD A;  2KN5 A;  4M0W B;  2C7M B;  2KC2 A;  3M62 B;  4NQK E;  1Q0W B;  2MSE D;  4YL8 A;  2FCQ A;  4NPN A;  3A1Q B;  2L00 B;  2BYV E;  3BY4 B;  4WJP A;  2MBQ A;  4MGI E;  3APF A;  2KX0 A;  3EFU A;  2N1V A;  3OAW A;  1EO6 A;  3VAW A;  2ZEQ A;  3W1S C;  4ASW C;  1WXA A;  2KQ7 A;  2FIF A;  1F9J A;  2C5L C;  2K1F A;  3NHE B;  4TQ0 A;  5D2M B;  5L83 A;  3HHM A;  2KTR A;  3D32 A;  4GDL A;  2I1K A;  3A9K B;  3TJP A;  1WE7 A;  2KO3 A;  3L08 A;  5KHQ A;  4MGY E;  1SGH A;  3BIN A;  3ZNZ B;  5E6P A;  4K7S A;  4HDO A;  4FHK A;  2EKE C;  2GBM A;  2LRU A;  1J8C A;  4WWP A;  2QHO A;  3UIO B;  2M0X A;  2DAF A;  3A33 B;  4BBN C;  3JYU A;  1E7V A;  2LXA A;  5AZF A;  1GNU A;  3X0W A;  4DDG D;  4DK5 A;  4I6N B;  5D6J B;  4IC7 B;  5IAA C;  1WXM A;  3VVW B;  3TIX A;  4W9K A;  1E7U A;  2ZNV B;  2MBO A;  4AP4 C;  4EZL A;  3N3K B;  3AI5 A;  3PZD A;  1TBE A;  4JLC A;  4HWI B;  3R66 C;  4E3C A;  3PLV A;  2DYB A;  4BBN F;  1S1Q B;  2IO3 B;  3AU5 A;  1J0G A;  3H7S A;  1P1A A;  3MHS D;  2G4S A;  2KMC A;  1V5T A;  3B08 A;  4A20 A;  5JHB A;  5LXH A;  5JZE B;  2N7D A;  2XK5 B;  3A4R A;  3DVN V;  2KXJ A;  3JW0 X;  2Y5B B;  4N9F 4;  3RYT A;  4EZJ A;  3PRE A;  1WI0 A;  3EHV A;  4EKU A;  1E8X A;  3H1U A;  4IWP A;  3VTU A;  3WAP A;  1WE6 A;  3GOE A;  5CX3 A;  4ANU A;  1GC7 A;  3QIJ A;  4TKN A;  1WGH A;  4FJZ A;  3SU8 X;  4OVU A;  2R2Q A;  3L54 A;  2NPT B;  1E90 A;  2N1W A;  4IWO A;  3PSE B;  4AJW A;  2FCN A;  4NY0 A;  2OJR A;  3V61 A;  4W9I A;  3ZW3 A;  2M4N A;  4DBG A;  2BWE S;  4IG7 B;  1H4R A;  1C1Y B;  5AZH A;  2Z0E B;  2DZI A;  2G4D B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...