2KX6A

Signaling state of photoactive yellow protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
125
structure length
125
Chain Sequence
b'MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
molecule tags Signaling protein
source organism Halorhodospira halophila
publication title The short-lived signaling state of the photoactive yellow protein photoreceptor revealed by combined structural probes.
pubmed doi rcsb
total genus 3
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kx6A00
3NOTC 3H7WB 4XT2B 4EEPA 5HZHA 1XJ6A 1S1YA 4WF0A 1XFNA 2PYRA 2V0WA 3KX0X 4HH3A 5A8BA 3FG8A 2Z6CA 2PR5A 4JGQA 2L4RA 2BASA 4HY8A 5HDSA 1X0OA 3MXQA 3IS2B 3MFXA 5F6AA 1ODVA 1LL8A 3E4PA 3HJKA 5F69A 1S1ZA 3UE6A 3FC7A 3K3CA 5DJUA 4HI4A 3K3DA 5DKKA 2R78A 4H6JB 4K08A 5IS1A 5DKLA 5J7EA 4EQ1A 1N9NA 2K7SA 3IBRA 1BYWA 1T18A 1UGUA 3CLOA 2QJ5A 3RTYA 2QKPA 5HSQA 1DP8A 1WA9A 3NOUC 4HQAA 4I3IA 3ZQ5A 3F1NA 1V9YA 2ZBBA 1P97A 3CWFA 1S67L 4NXBA 4DJ3A 2INWA 3BY9A 3UB9A 4F3LA 1JNUA 4I5SA 1TS8A 1GSXA 1OJ5A 2PHYA 3LIAA 4PKYA 3PYPA 5HWVA 1OJGA 1XFQA 2GJ3A 2JHEA 3OLOA 4L9EA 4R3AA 5AVFA 2VLGA 1N9OA 2M1CA 3MQOA 2VV6A 3NHQA 4HH2A 4HOIA 4WN5A 5IU1A 3LYXA 5TBMB 1KOUA 2WKQA 3MQQA 4GS9B 4L9GA 4WUJA 3UB6A 4M4XA 4B9OA 4DJ2A 3ICYA 4GCZA 3F1NB 3A0SA 1D7EA 1XJ4A 4HJ3A 1D06A 2J80A 3E4OA 3H9WA 1OTDA 4R38A 5G4ZA 4R70A 4HHDA 3LICA 2VEAA 4I38A 3F1PB 1TS0A 3GECA 1XJ3A 4LRZE 2A24A 2L0WA 2JN7A 1OT9A 2D02A 1S66L 4JGOA 5HWTA 3LIEA 4LPZA 2WKRA 3VE3A 3P7NA 3HJIA 2PR6A 4MN5A 5HDDA 2V1BA 1NWZA 3T50A 1LSVA 3VE4A 5J4EA 1GSVA 1N9LA 4GHIB 4LLOB 2QWSA 3LUQA 2Z6DA 2EA9A 1T1BA 4WLAA 4YWZA 1P0ZA 3RH8B 3UB8A 1TS7A 3MR0A 2KX6A 1OTEA 3A0RA 2P7JA 3F1PA 4JGPA 4NXEA 2A24B 3IS2A 3UMEA 2I9VA 2V9AA 3EEHA 3H82A 3PHYA 4H6JA 4HJ4A 4EESA 4EEUA 4RQ9A 2YKHA 4JGRA 5F68A 2PDRA 1OTBA 4WL9A 3NOPC 4HIAA 2KDKA 3LIDA 3E4QA 4E04A 4EETB 2B02A 1T1AA 4GHIA 2D01A 1OT6A 2YKFA 1G28A 1F9IA 3LI8A 2ZOHA 1XJ2A 3C2WA 5HWWA 2L1MA 3LI9A 1T19A 2VV7A 3ULFA 3SW1A 5DJTA 4MN6A 3B33A 1GSWA 3F1OB 3H82B 3LIBA 3BWLA 1T1CA 4KUKA 5KIZA 4PKYG 3UMDA 1LSWA 2QJ7A 3EWKA 3D72A 4HJ6A 1UWNX 2QHKA 3BY8A 4I39A 1MZUA 5J3WA 4BBTA 1F98A 4F3LB 4EXOA 4KQDA 5AVEA 2V1AA 2H28A 1DP6A 3LIFA 4NXGA 2OOLA 4R6LA 5HD5A 3UB7A 2PD8A 1DP9A 1S4SA 2PYPA 1TS6A 1EW0A 2VV8A 4L9FA 2PD7A 3F1OA 5HDCA 4I3AA 5I5LA 1S4RA 1VB6A 4EERA 3H7WA 4XT2A 5HD3A 2V0UA 3VOLA 4BBVA 3NJAA 4EW7A 2OWJA 3GDIA 5F5YA 3C8CA 5G4YA 4LRYC 1DRMA 5TBMA 2OWHA 1OTAA 2CMNA 3CAXA 1LSXA 3MJQA 4GW9A 4GS9A 4HNBA 4HP9A 1OTIA 3A0VA 4HP4A 4I3JA 1UWPX 4LRXC 4NXFA 4BBUA 5EFWA 2W27A 1LT0A 1V9ZA 2W0NA 2WKPA 2ZOIA 3G6OA 1Y28A 4KUOA 2HV1A
chains in the Genus database with same CATH superfamily
3H7WB 3E0YA 4IVKA 2Y2MA 2Z6CA 1BTLA 2L4RA 5EM1A 2ZC4B 1K55C 4QJGA 5F69A 1F2KA 2BTFP 2VX8A 2B5RA 2FZ0A 4KZ9A 2K7SA 3CG5A 4KENB 3UE1A 3WS2A 3NOUC 2XH9A 2OLUA 1TS8A 1OJ5A 5FQIA 3LIAA 2OSUA 1OJGA 1W79A 4KZBA 3CPTB 3UMEA 3MQOA 5TBMB 4HOIA 2ZQCA 2JBFA 4L9GA 3TE8A 3BRMA 4M4XA 3LY3A 4ZBEA 4PM6A 4R70A 2HP6A 2XFSA 4E6WA 1XJ3A 5HWTA 2XSSA 3OOVA 3VV4A 5GLCA 4O7DA 2NUPC 5HDDA 5J4EA 1ZTUA 5HW3A 3Q1FA 1DJBA 1PZOA 1T1BA 1HD8A 3FYZA 4P6ZM 5FAQA 4JGRA 1O7EA 4GD6A 3G2ZA 4E04A 2D01A 5CRFA 1XA1A 3MFDA 4OH0A 2FFYA 2Q9NA 4Y7PA 4X55A 3CI6A 5KIZA 4JF4A 4HJ6A 4AFIA 4BBTA 1DP6A 1XPBA 4ZTKA 1DP9A 4UQIM 3NY4A 5HDCA 3T1RA 5FI6A 1YLZA 3BFGA 1PWCA 5E2EA 3KSFA 1UWPX 4LRXC 3FV7A 1PWDA 1MKIA 2IA2A 4UEYA 5EVIA 4P6BA 4WF0A 3KX0X 3GVBA 4HY8A 2IWBA 1S1ZA 4A5RA 4LV2A 3T12B 1YLWA 3JVVA 4BL3A 4EBNA 1TDLA 2MJ6A 3U2AA 3OCLA 2HJ9C 1O07A 3KSHA 4EQ1A 3IBRA 1FQGA 1PI5A 2VGJA 3O86A 5HSQA 1XA7A 2XRNA 3G35A 3E2KA 3D4FA 1JTGA 3NHQA 4IBRA 4WUJA 4QB8A 2ZMFA 1FSYA 5FQQA 4HEFA 4E3LA 1XP4A 4KZ7A 4Y3IA 4I38A 2DCFA 3N8LA 3ZG9B 4LPZA 3VSLA 3HCYA 2W3EA 1PRQA 2EXBA 5HARA 4EESA 2WK0A 1P0ZA 5EUAA 3S22A 5GL9A 4NK3A 1EWZA 1PYYA 3KSIA 5DTTA 3H82A 1G6AA 3T4OA 1CK3A 4R3BA 4HIAA 2C6WB 2WUQA 3CUEA 1LL9A 4HBTA 5HPIA 3MKEA 3UMDA 1LSWA 4E6XA 3EWKA 3TOIA 3KYQA 1ZG4A 1IYOA 3GV9A 3PBRA 3UB7A 4U0TA 2VV8A 2ZM8A 4S2LA 3NBLA 3ZHHA 3ZDJA 4S2IA 3CAXA 4DXBA 1YKDA 3ZG5A 3HLGA 4I3JA 4O8GA 3OPHA 2VK3A 1LT0A 2PRFA 3FKVA 3Q7ZA 2KOIA 3DTEA 2EFUA 1KVLA 2PU4A 3SS4A 5CXWA 1LL5A 5TJJA 1LL8A 2GNXA 4B4ZA 1KGEA 2P9VA 3BFFA 3PTEA 1FCOA 3EGDC 5DJUA 2ZJ9A 2WADA 2WGIA 2QKPA 4KZ3A 5F1FA 3ZQ5A 2V20A 3CITA 3BY9A 1JNUA 4II7A 3Q81A 1XFQA 4OOLA 3EQUA 3N6IA 3IWIA 1D7EA 3UPOA 4GKUA 3L7HA 1JWPA 4JF5A 4RX2A 1VEUB 3P09A 4CLCC 4S2PA 3W4QA 3EQVA 2Y79A 4GDNA 1C3BA 3M6HA 3MS6A 1N9LA 3VP3A 2Z6DA 1MC0A 4MBFA 4JGPA 2A24B 2M7UA 3GQZA 5C5KA 1RGYA 3E98A 5AJGA 4GHIA 4ZAMA 3ZVTA 2YKFA 4UA6A 5EVID 1OMEA 3BY8A 1YLTA 4JLFA 3N8RA 1PW8A 1BSGA 3R7WB 4K0WA 1D1JA 1YPRA 5E2FA 3UN7A 2W0NA 3EEHA 1XKZA 3NULA 5CERA 3IX3A 3VSKA 5TFQA 3A3JA 1P9RA 5L07A 4XUZA 2E8JA 3PBNA 4HI4A 4Y17A 1QMEA 2R78A 4N9KA 1G68A 1PWGA 4Y15A 4QHCA 1P97A 3CJMA 3UB9A 1J9MA 1GSXA 4IUHA 4NG2A 1L0DA 4B9OA 4DDSA 2JKTI 5FDHA 1LLBA 3E4OA 1OTDA 1W7FA 5GHXA 1M6KA 4PM9A 2D02A 4X1LA 1S66L 3S1YA 3WS1A 2O9CA 4C75A 2H5SA 1NWZA 2VZWA 4LLOB 4LGWA 3SZTA 2G2UA 4G3WA 5CGSA 4KZ8A 3IH9A 5KSHA 3W2ZA 3E4QA 1ONHA 3K2NA 3GTCA 3MXSA 3SW1A 3IF6B 3UPPA 3HLWA 3PR6A 2W3FA 3RXXA 2XGNA 4ETZA 3QP5A 4BMWA 2Y2IA 3QP1A 5LBRA 4X69A 5AVEA 4CQHA 2OOLA 3LR5A 1TS6A 3ISGA 1ERMA 2ZLYA 4QY5A 1K4EA 4GW9A 3DWZA 3MJQA 4IBXA 5HAIA 4GS9A 5FSRA 5DF8A 4BBUA 4NXFA 5AQBA 5FQMA 1S0WA 2EWWA 2PDRA 4LCLA 4EQIA 3MFXA 5DKLA 2ZQ8A 2ZBBA 3C38A 3UE3A 4GZBA 1FCNA 2W3HA 4HH2A 4CLCB 2J3TD 1DJCA 3NCKA 4O0PA 4DJ2A 1XJ4A 4MEZA 3U4LP 1E3UA 2JN7A 4JGOA 5IHVA 5BOHA 3SOIA 2H10A 3HJIA 1G6OA 3UO9A 5EV0A 1TEMA 5IS1A 1U60A 4N92A 1VETA 3IHBA 3MR0A 3MZDA 3A0RA 3F1PA 5DFXA 2V9AA 1LI9A 3NECA 2YKHA 1HVBA 2HP5A 2W1TB 4R4RA 4D2OA 1Y4OA 3MZEA 3C5AA 3B33A 1GSWA 4OQ0A 4OQIA 1MZUA 1NRFA 4EXOA 3IXDA 3JPUA 3IXGA 2Y4AA 5EOOA 2WZZA 4PM8A 5F5YA 3HUOA 1E4DA 4X6TA 4LRYC 4K0XA 4HP9A 2UV0E 3A3DA 1OTIA 4DKIA 2HDUA 2EWVA 4EEPA 5EVIC 4MLLA 4U3TA 3PBTA 4RX3A 4KZ4A 5HDSA 5E43A 4PMAA 4DMZA 1K54A 5HAQA 4U0XA 3T1QB 5I94A 5CHMA 3BW6A 3DTMA 4LCMA 1BZAA 5HPFA 1DP8A 5E2HA 1ZG6A 5GLDA 1E25A 4NXBA 1K6RA 1KE3A 2HDSA 1BLHA 5GHYA 2WAEA 3E2LA 3VFFA 2VV6A 5HWVA 4MBHA 1RCJA 3LYXA 5EECA 4GCZA 4HJ3A 1CJFA 5L2FA 1TS0A 2Y2LA 2PR6A 3O5YA 3G30A 2EX2A 2ZQ7A 2P7JA 1TVFA 1ZC2A 2Y59A 4R23A 4ME4A 4R4SA 5F68A 5EPHA 1G5UA 4IJGA 3LIDA 3BLMA 1OT6A 3EOIA 1G28A 1GA9A 1YM1A 2P08A 5HWWA 3LI9A 1QMFA 2W3DA 4KUKA 3BWLA 4PKYG 4Y0OA 1Z09A 3PXPA 1Q2QA 2ZC7A 4KQDA 4JXSA 1S4SA 4BD1A 2PD7A 3F1OA 4PHTA 3VP0A 2E8IA 3LCEA 1LSXA 4HNBA 1L2SA 3HL9A 4S2NA 5F83A 5A91A 1Y54A 2EX9A 3GR2A 3PAGA 4UQIS 5HZHA 1NRJA 1X0OA 3SH7A 4OOYA 4EV4A 2J7VA 3CHWP 3VP1A 2XD1A 1SKOA 1UGUA 3RTYA 4RYEA 3GSGA 1W8QA 1ESIA 1MWSA 2R9XA 4R3JA 4DJ3A 1L0EA 2INWA 2OAP1 4L9EA 1BLCA 2JC7A 5FQJA 4G3VA 4XUXA 2XR0A 4KZAA 5AQ9A 3C30A 3I7JA 2L0WA 2XD5A 4OLDA 1K57A 3IH8A 2QWSA 4WLAA 3TW8A 3HLCA 3UB8A 3UB5P 2IWDA 2KX6A 3IS2A 4H6JA 4RQ9A 4FCFA 3FPWA 4UHUA 3B47A 2XK1A 1JVJA 4MN6A 3LEZA 4IEDA 3MF0A 1IKGA 5DF7A 3LIFA 5FL3A 5DTSA 3FPVA 4DE3A 1PFLA 3JYIA 4I3AA 3VFHA 1H5XA 1CEGA 3CUEC 5HD3A 1NJ4A 3GDIA 3OPRA 5HX9A 4PM5A 5FI7A 4OKPA 4Q0JA 4EBPA 3NIAA 1TDGA 1KE0A 2WKPA 4FD8A 2HV1A 3LR4A 3NDGA 2XA7M 4FOFA 4NKPA 2ZM2A 3ZVWA 1BLPA 4FUWA 2W1TA 3K3CA 4Q0HA 2XDMA 5JYPA 5EVIB 3IX4A 1IEMA 1K4FA 4JKTA 2Y2HA 4QD4A 2Q0OA 4N9LA 2QJ5A 4R0QA 3HBRA 1CF0A 4E3IA 1NYMA 1ONGA 4GLQA 1PI4A 2M1CA 1K38A 1KOUA 2O9BA 3P01A 3A0SA 1CI8A 1NLZA 2J80A 3H9WA 3Q07A 1KDSA 2LB9A 4DN0A 4MMNA 4JF6A 1NZOA 1KE4A 4DE2A 4E3OA 5JYOA 3IF6C 3SS5A 3PHYA 3KO6A 1MBLA 2ZC3B 3W8KA 3TG9A 4JXGA 1T1AA 3V3SA 3C2WA 2HGVA 4L0LA 3CMZA 3H82B 4F94A 1T1CA 3DTKA 3S7OA 1E3UD 1YLYA 2XFTA 3G4PA 4PAUA 4WEKA 4JBFA 5FATA 5HD5A 3IHAA 1TF1A 4S2KA 1FIKA 2JKGA 4GDBA 4XT2A 5F1GA 3VOLA 3C8CA 1DRMA 1K0KA 5FAPA 1YT4A 2EX8A 3C4PA 2ZOIA 4OPQA 2V0WA 1VHMA 1L0FA 3LFVA 1K55A 2VA0A 3W4PA 1ODVA 3E4PA 5CEDA 3HJKA 2QMIA 3FC7A 1SDNA 4YFMA 2V2FF 1K54C 3N4IA 2PU2A 4K08A 2GDNA 1ZKJA 3SH8A 4OPRA 2M7VA 2A3UA 4BENA 3F1NA 1V9YA 1S67L 1H8MA 2WGWA 4Q0IA 2LB5A 3PYPA 2JKRM 3ZG7B 2VLGA 4WN5A 2ZMVA 3DBAA 3WRTA 3ICYA 4MBKA 3BYDA 5FA7A 4KG5A 3BQAA 1LHYA 3C7UA 5TGFA 3VE3A 2QYBA 4D60A 4BWIA 4ESPA 3VE4A 1STZA 1FCMA 4GB7A 2VGLS 1TS7A 3NI9A 3WS4A 4BL2A 4DXCA 1K56A 3QNCA 4UA7A 4ZJ3A 4EEUA 4BQMA 2Y2PA 4C6YA 4EUZA 4WL9A 2JKFA 4YINA 3ZNTA 3IF6A 1CEFA 5CEBA 2DMWA 3N8SA 5EOEA 2HPBA 1ES3A 1MKMA 4R1GA 2QJ7A 1XGIA 1IYQA 1UWNX 4OP8A 4EUVA 2X02A 4I39A 1F98A 4MCWA 1EW0A 4L9FA 4S2OA 1GCEA 1CQAA 4BBVA 4UA9A 3NJAA 3CPTA 3DWKA 1PW1A 1TD5A 5TBMA 2K31A 1AWIA 3HUNA 4HP4A 4GNUA 4HBUA 3G6OA 2ACGA 4KUOA 3T4QA 5DTKA 1XFNA 1HTZA 3IS2B 5F6AA 3NDEA 4XXRA 1IFQA 4LV3A 4YNRA 5DF9A 3QP4A 1BT5A 4B88A 3ITAA 5CTNA 4HQAA 1HZOA 4WYYA 3MKFA 5DVAA 2GJ3A 1NZUA 5IU1A 2JKRI 3MQQA 4WMCA 5KMWA 3D9YA 1EI5A 1MWUA 3LICA 4LRZE 3MQ0A 1OT9A 3IWQA 3N7WA 4X68A 1VETB 3NC8A 2EA9A 5CX7A 2ZQDA 2WKHA 2K2NA 4E3NA 4ETXA 3SS3A 2P74A 1OTBA 1KDWA 2UWXA 4Y5FA 2WZXA 2ZL1B 1I2SA 1XJ2A 2L1MA 2VV7A 3DTIA 3LIBA 1Z6FA 1BULA 2CC1A 4GN2A 3HLFA 2WGVA 1YMSA 3V5MA 2VKSA 2V1AA 1RGZA 5FAOA 3D3OA 4OOMA 3OCNA 1SKFA 1F5MA 2RCXA 4X1MA 1VB6A 2ZM0A 3O87A 4EERA 3H7WA 3C7VA 4WZ5C 2FH5A 4CJNA 1L3LA 3WRZA 3Q7VB 2OV5A 2W1RA 3LY4A 1XJ6A 2WKEA 3OPLA 3FKWA 5FEGA 4HH3A 3ITBA 1MPLA 2ZMAA 2QZ6A 1JWVA 3S7NA 4X53A 2O99A 3EEAA 1KGGA 1WYBA 3C4OA 2R9WA 3AGEA 5DFYA 1T18A 3CLOA 3T4KA 1N9BA 4I3IA 4S2MA 4BLMA 1W8YA 4Y0TA 3G34A 1I2WA 2G7UA 1GA0A 3OLOA 1XXMA 2HP9A 3ZGAB 2WAFA 3T1SA 4RVAA 3O3VA 2VEAA 2FFFB 4OPYA 4B4XA 1ALQA 4DRTA 3P7NA 5GHZA 4ZJ2A 3UY6A 2V1BA 4QWOA 1LSVA 4S2JA 2HZ5A 1FR1A 1YLPA 1ACFA 1W63M 3ZYTA 3SH9A 3IBJA 4CLCE 5CGWA 5E2GA 4KQOA 4C3QA 1IOUA 3EGXC 4N1XA 2VGLM 4QU3A 5AQAA 2I72A 1F9IA 2ZOHA 4N1HA 5M18A 4Y13A 1BUEA 3GRJA 3M2KA 1ESUA 1MWTA 2PBDP 1RP5A 5EVEA 5HL6A 2H28A 3V3RA 3FZCA 2O0YA 5CGXA 3KYZA 3S4XA 3BFEA 4M3KA 4CPKA 1YQSA 3V50A 4P85A 5FDSA 2JE5A 2PYRA 2BASA 3LEQA 2Y2KA 4Z1WA 2W3GA 3UE6A 4ZDXA 4OPZA 2OAQ1 4FH4A 3G2YA 3K3DA 1DJAA 1BYWA 2HDQA 4GOGA 4WM9A 4K91A 4WZ4A 5A92A 1A0KA 3RXWA 1SHVA 4I5SA 4WZ5A 3A3EA 1OPXA 4PKYA 5AVFA 3WS0A 3ZG0A 2KLIA 4DDYA 2WKQA 4GS9B 4EBLA 2X01A 3B3XA 2G2WA 2V8CA 3LIEA 4JXVA 1NYYA 3HREA 4DE1A 2JKTM 3LUQA 4LFUA 1OTEA 2JCHA 3BFCA 2GZAA 3VOZA 4ZJ1A 4ZRRA 1DY6A 3HLBA 1ES4A 2XQZA 5IT5A 3ULFA 3HUMA 1PZPA 5DJTA 5L09A 5HFOA 3A3FA 5EM0A 2QHKA 1VM1A 3UNWA 2XLNA 3R4KA 2PD8A 3M2JA 4PPRA 5I5LA 1HLUP 3TSGA 5L10A 1WE4A 3KSGA 1LI0A 2ZC5B 3A0VA 2V1ZA 1Q2PA 2P9VB 4NETA 4YOFA 3NOTC 1W63Q 2XF3A 5A8BA 3FG8A 4KZ6A 3MXQA 2VGKA 3LGOA 3LR0A 3M6BA 2WKIA 2BG1A 3OZHA 5DKKA 4WBGA 4EWFA 2ZL1A 5J7EA 4LV1A 2PT7A 1H8ZA 2Y2NA 4JXWA 2VJWA 1FOFA 4F3LA 5CHJA 3VMAA 5CECA 5AQ7A 2Q9MA 2OLVA 1N9OA 4WMCD 5M19A 5J8XA 4O01A 5G18A 4R38A 5G4ZA 3ZG8B 1ES2A 4HHDA 4QPRA 5HL1A 2A24A 4MDZA 4MN5A 3VP2A 3T50A 4GHIB 3QHYA 4JPMA 1VQQA 3B42A 4KZ5A 4IUKA 2ZQ9A 4OONA 2AVXA 2Y55A 4EETB 4LV0A 4EU0A 3T1XA 5F82A 2A49A 1YMXA 2HJEA 3UDIA 4KG6A 1YSPA 1EROA 2Y91A 5FQ9A 3D72A 3VOYA 1PIOA 1XGJA 4X56A 4G3KA 1IYSA 3IQAA 3DW0A 4ID4A 1YSQA 2V0UA 3AGFA 1NXYA 1N4OA 2OWJA 5G4YA 4CLCA 5M1AA 3IXBA 2PAVP 3WWXA 3UDXA 1FR6A 1L0GA 1WYCA 1GHMA 3PBOA 4ARZB 2PR5A 4WELA 3ZFZA 3RJUA 3VP4A 1K25A 2RL3A 1K56D 3LR3A 5FI2A 3QP6A 2HF6A 4CLCD 3AGDA 4BD0A 2QPNA 5EE8A 2PHYA 3OBFA 2B95A 4P0MA 3QP8A 4DF6A 2WYXA 1K57C 1H3QA 5GLAA 5KSCA 5GLBA 2J3WA 3OC2A 5A93A 4UAAA 1GHIA 3RH8B 3A3IA 3BJNA 2I9VA 4HJ4A 1SKOB 2Y2QA 4BJPA 2GX5A 2IWCA 3NOPC 4IHQA 2J8YA 5U47A 1T19A 2PBYA 5FASA 4E3KA 3G31A 1MY8A 3ZNYA 3S7PA 1ZHHB 4H8RA 4MN7A 3IX8A 2O9AA 2PYPA 4Y2FA 3QP2A 3BLSA 1S4RA 1YAXA 3FWLA 4EW7A 3MXRA 3P98A 3R7WA 2OWHA 1OTAA 1J3WA 3GMWA 3HLDA 5EFWA 4B93A 2W27A 3WS5A 2ZC6B 1ERQA 1I5QA 4KQQA 4XT2B 1S1YA 4JGQA 3PBQA 4LENA 4Q8IA 1H0MA 1JWZA 4PM7A 2ZD8A 1N9NA 4E3JA 5A90A 3CWFA 3HLEA 1AXBA 2XROA 2XEPA 2EFXA 2JHEA 4R3AA 4DE0A 1YLJA 2EXAA 4KQRA 3F1NB 4RA7A 1D06A 1M40A 3IXHA 4Y0UA 3F1PB 3GECA 4OQGA 4P87A 4GD8A 2Z2LB 1NY0A 3TJZC 3OPPA 5HAPA 3S7QA 1P9WA 2Z2MB 4S2NC 2ZQAA 3BFDA 2J9PA 2H0TA 3TRCA 4IVIA 4X25A 5EVLA 2V8FA 2B02A 3LI8A 4FSFA 1KVMA 4MNRA 3MSHA 2J3TC 3IWOA 1MWRA 2Y2OA 4F3LB 3UPNA 1KGFA 5FEFA 1W5DA 4NXGA 4FH2A 4R6LA 4QY6A 5MC7A 1JTDA 1BLSA 2Y2GA 3Q7VA 3QNBA 3UDFA 5K5BA 2B18A 1ES5A 3KYEA 1IYPA 2Y8HA 2Y2JA 1SDEA 3MMHA 1GHPA 1SZVA 3V67A 3T4JA 3BQ8A 3IT9A 3LO7A 3Q82A 2XA7S 4H6JB 1PNEA 3HVFA 1S6RA 3DAVA 1WA9A 1CI9A 3O88A 5D3OA 3CZDA 1FSWA 2J9OA 1NLYA 4GJ4A 1FILA 4WEJA 3BM6A 3UB6A 4OLGA 2DNSA 3G32A 4FTXA 5CTMA 1XX2A 2WKRA 3PBSA 2NUTC 3T4TA 3JVUA 2H0YA 2X71A 1GSVA 4NEED 2C5WB 4YWZA 2A2LA 4P6ZS 3BEBA 5CHUA 4HESA 4NXEA 1K6SA 3T4LA 4ARZA 3T4SA 3ZCZA 4Z9QA 2KDKA 1IELA 4OVDA 3IF5A 5FQKA 3L9KA 5KZHA 1SCWA 2WGWB 5L8MA 3F1OB 5TR7A 2DRWA 5J3WA 4KG2A 1IKIA 4OP5A 3MZFA 2HDRA 3UE0A 3W4OA 3RFBA 3V39A 1MXOA 2P04A 4OQHA 1VEUA 4E3MA 2CMNA 1H8YA 2EX6A 1V9ZA 3BECA 3MBZA 2BLSA 3PAEA 1Y28A
chains in the Genus database with same CATH topology
3NOTC 1W63Q 3H7WB 3E0YA 2V0WA 5A8BA 1VHMA 3FG8A 2Z6CA 3LFVA 2L4RA 3MXQA 2VA0A 3MFXA 1ODVA 3E4PA 3HJKA 5F69A 3LR0A 3FC7A 5DKKA 2VX8A 4K08A 5DKLA 2FZ0A 5J7EA 2K7SA 2PT7A 2M7VA 3NOUC 3F1NA 1V9YA 2ZBBA 1S67L 1H8MA 2VJWA 4F3LA 3C38A 1TS8A 1OJ5A 4Q0IA 3LIAA 3UE3A 2LB5A 3PYPA 2JKRM 1OJGA 2VLGA 1N9OA 2W3HA 3MQOA 4HH2A 4WN5A 5TBMB 4HOIA 3UMEA 4CLCB 2ZMVA 2J3TD 4L9GA 3TE8A 3DBAA 4M4XA 4O01A 4O0PA 3ICYA 4DJ2A 1XJ4A 4R38A 5G4ZA 4R70A 4HHDA 4QPRA 3BQAA 1XJ3A 2A24A 2JN7A 2XSSA 3OOVA 4JGOA 5HWTA 3VV4A 3VE3A 2QYBA 2NUPC 3HJIA 1G6OA 4MDZA 4MN5A 5HDDA 3T50A 4BWIA 3VE4A 1STZA 5J4EA 1ZTUA 4GHIB 5IS1A 1T1BA 2VGLS 1TS7A 3MR0A 3A0RA 3F1PA 3B42A 4P6ZM 5DFXA 2V9AA 4IUKA 4EEUA 2YKHA 4JGRA 2W1TB 4WL9A 4E04A 4EETB 2D01A 4EU0A 2DMWA 2HJEA 3B33A 1GSWA 1YSPA 3CI6A 1MKMA 5KIZA 2QJ7A 3D72A 4HJ6A 1UWNX 4EUVA 4AFIA 4I39A 1MZUA 4BBTA 1F98A 4EXOA 4MCWA 1DP6A 1DP9A 4UQIM 4G3KA 1EW0A 4L9FA 5HDCA 4BBVA 1YSQA 2V0UA 3NJAA 2OWJA 5F5YA 5G4YA 1TD5A 4LRYC 5TBMA 4CLCA 2K31A 4HP9A 1OTIA 4HP4A 3KSFA 1UWPX 4LRXC 3G6OA 2IA2A 2EWVA 4KUOA 3T4QA 4EEPA 4UEYA 4WF0A 1XFNA 3KX0X 3PBOA 3PBTA 4ARZB 2PR5A 4WELA 4HY8A 5HDSA 4DMZA 3IS2B 5F6AA 1S1ZA 3LR3A 3JVVA 2MJ6A 1IFQA 4YNRA 5DF9A 3U2AA 3OCLA 2HJ9C 4EQ1A 3BW6A 3KSHA 3IBRA 5HPFA 2HF6A 5HSQA 1DP8A 4HQAA 4NXBA 2XRNA 4CLCD 2PHYA 3OBFA 2GJ3A 5IU1A 2VV6A 3NHQA 2JKRI 5HWVA 3LYXA 3MQQA 4WUJA 2ZMFA 4GCZA 4HJ3A 1H3QA 3LICA 4Y3IA 4I38A 1TS0A 4LRZE 3MQ0A 1OT9A 4LPZA 2J3WA 2PR6A 3OC2A 3HCYA 2W3EA 3O5YA 4EESA 2EA9A 1P0ZA 3RH8B 5CX7A 3BJNA 2P7JA 3KSIA 2I9VA 3H82A 2K2NA 4HJ4A 3T4OA 4ETXA 4ME4A 5F68A 4BJPA 2GX5A 1OTBA 3NOPC 4IJGA 4HIAA 4IHQA 3LIDA 1OT6A 3EOIA 4Y5FA 3CUEA 1G28A 2P08A 1XJ2A 5HWWA 2L1MA 3LI9A 1T19A 2VV7A 2W3DA 3LIBA 4KUKA 3BWLA 5HPIA 4PKYG 3UMDA 1LSWA 3S7PA 3EWKA 3PXPA 1ZHHB 2VKSA 3KYQA 4KQDA 2V1AA 4MN7A 3PBRA 2O9AA 1S4SA 3UB7A 2PYPA 3D3OA 2VV8A 4OOMA 3OCNA 2PD7A 3F1OA 4PHTA 4Y2FA 1F5MA 1S4RA 1VB6A 4EERA 3H7WA 1YAXA 2FH5A 4EW7A 3R7WA 2OWHA 1OTAA 3CAXA 1LSXA 4HNBA 1YKDA 4I3JA 4O8GA 5EFWA 4B93A 2W27A 1LT0A 2W1RA 2KOIA 4UQIS 4XT2B 5HZHA 1XJ6A 1S1YA 1NRJA 4HH3A 4JGQA 3PBQA 1X0OA 5TJJA 1LL8A 2GNXA 5DJUA 3EGDC 3S7NA 2O99A 3EEAA 1N9NA 5DFYA 1T18A 1UGUA 3CLOA 3RTYA 3T4KA 2QKPA 4I3IA 3ZQ5A 3CWFA 4DJ3A 3CITA 2INWA 3BY9A 1JNUA 2OAP1 2XROA 4II7A 1XFQA 2G7UA 2JHEA 3OLOA 4L9EA 4OOLA 3EQUA 4R3AA 4G3VA 3F1NB 1D7EA 1D06A 2VEAA 3F1PB 3C30A 3GECA 2L0WA 4CLCC 3EQVA 2Y79A 3P7NA 3TJZC 2V1BA 1LSVA 1N9LA 2QWSA 2Z6DA 4WLAA 1MC0A 3TW8A 3UB8A 1W63M 2KX6A 4JGPA 3ZYTA 3S7QA 1P9WA 2A24B 3IBJA 2M7UA 3IS2A 4CLCE 4H6JA 4RQ9A 5C5KA 4KQOA 1IOUA 3FPWA 3EGXC 3TRCA 3E98A 5AJGA 2VGLM 2B02A 4GHIA 2YKFA 1F9IA 3LI8A 2ZOHA 3B47A 4FSFA 4MN6A 2J3TC 3MF0A 3BY8A 4F3LB 5HL6A 2H28A 3LIFA 4NXGA 4R6LA 5FL3A 3FPVA 2O0YA 3KYZA 4I3AA 3R7WB 5HD3A 3CUEC 5MC7A 3GDIA 4Q0JA 2W0NA 2WKPA 5K5BA 2B18A 3EEHA 2HV1A 3LR4A 2XA7M 2PYRA 4FOFA 2Y8HA 4NKPA 3MMHA 2BASA 4Z1WA 3V67A 1P9RA 3T4JA 2W1TA 2W3GA 3K3CA 4Q0HA 3UE6A 3BQ8A 3PBNA 4HI4A 2OAQ1 3K3DA 2R78A 2XA7S 4H6JB 1BYWA 2QJ5A 1WA9A 1P97A 3UB9A 1NLYA 4I5SA 1GSXA 1OPXA 4GJ4A 4PKYA 4IUHA 4WEJA 4GLQA 5AVFA 2M1CA 2KLIA 1KOUA 2O9BA 2WKQA 4GS9B 3UB6A 4B9OA 3P01A 2JKTI 1NLZA 3A0SA 2J80A 3H9WA 3E4OA 1OTDA 2LB9A 4DN0A 4MMNA 2D02A 1S66L 3LIEA 2WKRA 3PBSA 2O9CA 2NUTC 3T4TA 3JVUA 1NWZA 1GSVA 2VZWA 4NEED 4LLOB 2JKTM 3LUQA 4YWZA 2A2LA 4G3WA 4P6ZS 4NXEA 1OTEA 3T4LA 4ARZA 2GZAA 3PHYA 5KSHA 3T4SA 3KO6A 3W2ZA 2KDKA 3E4QA 1T1AA 4ZRRA 5IT5A 3K2NA 3C2WA 3SW1A 2HGVA 4L0LA 3ULFA 5DJTA 3H82B 3PR6A 3F1OB 5L8MA 2W3FA 1T1CA 4ETZA 4BMWA 3S7OA 2QHKA 5LBRA 5J3WA 5AVEA 4CQHA 4PAUA 4WEKA 2OOLA 3R4KA 3LR5A 5HD5A 2PD8A 1TF1A 1TS6A 5I5LA 4XT2A 3RFBA 3VOLA 2P04A 3C8CA 1DRMA 4GW9A 2CMNA 3KSGA 3MJQA 4GS9A 3A0VA 4BBUA 4NXFA 1V9ZA 2ZOIA 1Y28A 2EWWA 2PDRA 4YOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOT C;  3H7W B;  4XT2 B;  4EEP A;  5HZH A;  1XJ6 A;  1S1Y A;  4WF0 A;  1XFN A;  2PYR A;  2V0W A;  3KX0 X;  4HH3 A;  5A8B A;  3FG8 A;  2Z6C A;  2PR5 A;  4JGQ A;  2L4R A;  2BAS A;  4HY8 A;  5HDS A;  1X0O A;  3MXQ A;  3IS2 B;  3MFX A;  5F6A A;  1ODV A;  1LL8 A;  3E4P A;  3HJK A;  5F69 A;  1S1Z A;  3UE6 A;  3FC7 A;  3K3C A;  5DJU A;  4HI4 A;  3K3D A;  5DKK A;  2R78 A;  4H6J B;  4K08 A;  5IS1 A;  5DKL A;  5J7E A;  4EQ1 A;  1N9N A;  2K7S A;  3IBR A;  1BYW A;  1T18 A;  1UGU A;  3CLO A;  2QJ5 A;  3RTY A;  2QKP A;  5HSQ A;  1DP8 A;  1WA9 A;  3NOU C;  4HQA A;  4I3I A;  3ZQ5 A;  3F1N A;  1V9Y A;  2ZBB A;  1P97 A;  3CWF A;  1S67 L;  4NXB A;  4DJ3 A;  2INW A;  3BY9 A;  3UB9 A;  4F3L A;  1JNU A;  4I5S A;  1TS8 A;  1GSX A;  1OJ5 A;  2PHY A;  3LIA A;  4PKY A;  3PYP A;  5HWV A;  1OJG A;  1XFQ A;  2GJ3 A;  2JHE A;  3OLO A;  4L9E A;  4R3A A;  5AVF A;  2VLG A;  1N9O A;  2M1C A;  3MQO A;  2VV6 A;  3NHQ A;  4HH2 A;  4HOI A;  4WN5 A;  5IU1 A;  3LYX A;  5TBM B;  1KOU A;  2WKQ A;  3MQQ A;  4GS9 B;  4L9G A;  4WUJ A;  3UB6 A;  4M4X A;  4B9O A;  4DJ2 A;  3ICY A;  4GCZ A;  3F1N B;  3A0S A;  1D7E A;  1XJ4 A;  4HJ3 A;  1D06 A;  2J80 A;  3E4O A;  3H9W A;  1OTD A;  4R38 A;  5G4Z A;  4R70 A;  4HHD A;  3LIC A;  2VEA A;  4I38 A;  3F1P B;  1TS0 A;  3GEC A;  1XJ3 A;  4LRZ E;  2A24 A;  2L0W A;  2JN7 A;  1OT9 A;  2D02 A;  1S66 L;  4JGO A;  5HWT A;  3LIE A;  4LPZ A;  2WKR A;  3VE3 A;  3P7N A;  3HJI A;  2PR6 A;  4MN5 A;  5HDD A;  2V1B A;  1NWZ A;  3T50 A;  1LSV A;  3VE4 A;  5J4E A;  1GSV A;  1N9L A;  4GHI B;  4LLO B;  2QWS A;  3LUQ A;  2Z6D A;  2EA9 A;  1T1B A;  4WLA A;  4YWZ A;  1P0Z A;  3RH8 B;  3UB8 A;  1TS7 A;  3MR0 A;  2KX6 A;  1OTE A;  3A0R A;  2P7J A;  3F1P A;  4JGP A;  4NXE A;  2A24 B;  3IS2 A;  3UME A;  2I9V A;  2V9A A;  3EEH A;  3H82 A;  3PHY A;  4H6J A;  4HJ4 A;  4EES A;  4EEU A;  4RQ9 A;  2YKH A;  4JGR A;  5F68 A;  2PDR A;  1OTB A;  4WL9 A;  3NOP C;  4HIA A;  2KDK A;  3LID A;  3E4Q A;  4E04 A;  4EET B;  2B02 A;  1T1A A;  4GHI A;  2D01 A;  1OT6 A;  2YKF A;  1G28 A;  1F9I A;  3LI8 A;  2ZOH A;  1XJ2 A;  3C2W A;  5HWW A;  2L1M A;  3LI9 A;  1T19 A;  2VV7 A;  3ULF A;  3SW1 A;  5DJT A;  4MN6 A;  3B33 A;  1GSW A;  3F1O B;  3H82 B;  3LIB A;  3BWL A;  1T1C A;  4KUK A;  5KIZ A;  4PKY G;  3UMD A;  1LSW A;  2QJ7 A;  3EWK A;  3D72 A;  4HJ6 A;  1UWN X;  2QHK A;  3BY8 A;  4I39 A;  1MZU A;  5J3W A;  4BBT A;  1F98 A;  4F3L B;  4EXO A;  4KQD A;  5AVE A;  2V1A A;  2H28 A;  1DP6 A;  3LIF A;  4NXG A;  2OOL A;  4R6L A;  5HD5 A;  3UB7 A;  2PD8 A;  1DP9 A;  1S4S A;  2PYP A;  1TS6 A;  1EW0 A;  2VV8 A;  4L9F A;  2PD7 A;  3F1O A;  5HDC A;  4I3A A;  5I5L A;  1S4R A;  1VB6 A;  4EER A;  3H7W A;  4XT2 A;  5HD3 A;  2V0U A;  3VOL A;  4BBV A;  3NJA A;  4EW7 A;  2OWJ A;  3GDI A;  5F5Y A;  3C8C A;  5G4Y A;  4LRY C;  1DRM A;  5TBM A;  2OWH A;  1OTA A;  2CMN A;  3CAX A;  1LSX A;  3MJQ A;  4GW9 A;  4GS9 A;  4HNB A;  4HP9 A;  1OTI A;  3A0V A;  4HP4 A;  4I3J A;  1UWP X;  4LRX C;  4NXF A;  4BBU A;  5EFW A;  2W27 A;  1LT0 A;  1V9Z A;  2W0N A;  2WKP A;  2ZOI A;  3G6O A;  1Y28 A;  4KUO A;  2HV1 A; 
#chains in the Genus database with same CATH topology
 3H7W B;  3E0Y A;  4IVK A;  2Y2M A;  2Z6C A;  1BTL A;  2L4R A;  5EM1 A;  2ZC4 B;  1K55 C;  4QJG A;  5F69 A;  1F2K A;  2BTF P;  2VX8 A;  2B5R A;  2FZ0 A;  4KZ9 A;  2K7S A;  3CG5 A;  4KEN B;  3UE1 A;  3WS2 A;  3NOU C;  2XH9 A;  2OLU A;  1TS8 A;  1OJ5 A;  5FQI A;  3LIA A;  2OSU A;  1OJG A;  1W79 A;  4KZB A;  3CPT B;  3UME A;  3MQO A;  5TBM B;  4HOI A;  2ZQC A;  2JBF A;  4L9G A;  3TE8 A;  3BRM A;  4M4X A;  3LY3 A;  4ZBE A;  4PM6 A;  4R70 A;  2HP6 A;  2XFS A;  4E6W A;  1XJ3 A;  5HWT A;  2XSS A;  3OOV A;  3VV4 A;  5GLC A;  4O7D A;  2NUP C;  5HDD A;  5J4E A;  1ZTU A;  5HW3 A;  3Q1F A;  1DJB A;  1PZO A;  1T1B A;  1HD8 A;  3FYZ A;  4P6Z M;  5FAQ A;  4JGR A;  1O7E A;  4GD6 A;  3G2Z A;  4E04 A;  2D01 A;  5CRF A;  1XA1 A;  3MFD A;  4OH0 A;  2FFY A;  2Q9N A;  4Y7P A;  4X55 A;  3CI6 A;  5KIZ A;  4JF4 A;  4HJ6 A;  4AFI A;  4BBT A;  1DP6 A;  1XPB A;  4ZTK A;  1DP9 A;  4UQI M;  3NY4 A;  5HDC A;  3T1R A;  5FI6 A;  1YLZ A;  3BFG A;  1PWC A;  5E2E A;  3KSF A;  1UWP X;  4LRX C;  3FV7 A;  1PWD A;  1MKI A;  2IA2 A;  4UEY A;  5EVI A;  4P6B A;  4WF0 A;  3KX0 X;  3GVB A;  4HY8 A;  2IWB A;  1S1Z A;  4A5R A;  4LV2 A;  3T12 B;  1YLW A;  3JVV A;  4BL3 A;  4EBN A;  1TDL A;  2MJ6 A;  3U2A A;  3OCL A;  2HJ9 C;  1O07 A;  3KSH A;  4EQ1 A;  3IBR A;  1FQG A;  1PI5 A;  2VGJ A;  3O86 A;  5HSQ A;  1XA7 A;  2XRN A;  3G35 A;  3E2K A;  3D4F A;  1JTG A;  3NHQ A;  4IBR A;  4WUJ A;  4QB8 A;  2ZMF A;  1FSY A;  5FQQ A;  4HEF A;  4E3L A;  1XP4 A;  4KZ7 A;  4Y3I A;  4I38 A;  2DCF A;  3N8L A;  3ZG9 B;  4LPZ A;  3VSL A;  3HCY A;  2W3E A;  1PRQ A;  2EXB A;  5HAR A;  4EES A;  2WK0 A;  1P0Z A;  5EUA A;  3S22 A;  5GL9 A;  4NK3 A;  1EWZ A;  1PYY A;  3KSI A;  5DTT A;  3H82 A;  1G6A A;  3T4O A;  1CK3 A;  4R3B A;  4HIA A;  2C6W B;  2WUQ A;  3CUE A;  1LL9 A;  4HBT A;  5HPI A;  3MKE A;  3UMD A;  1LSW A;  4E6X A;  3EWK A;  3TOI A;  3KYQ A;  1ZG4 A;  1IYO A;  3GV9 A;  3PBR A;  3UB7 A;  4U0T A;  2VV8 A;  2ZM8 A;  4S2L A;  3NBL A;  3ZHH A;  3ZDJ A;  4S2I A;  3CAX A;  4DXB A;  1YKD A;  3ZG5 A;  3HLG A;  4I3J A;  4O8G A;  3OPH A;  2VK3 A;  1LT0 A;  2PRF A;  3FKV A;  3Q7Z A;  2KOI A;  3DTE A;  2EFU A;  1KVL A;  2PU4 A;  3SS4 A;  5CXW A;  1LL5 A;  5TJJ A;  1LL8 A;  2GNX A;  4B4Z A;  1KGE A;  2P9V A;  3BFF A;  3PTE A;  1FCO A;  3EGD C;  5DJU A;  2ZJ9 A;  2WAD A;  2WGI A;  2QKP A;  4KZ3 A;  5F1F A;  3ZQ5 A;  2V20 A;  3CIT A;  3BY9 A;  1JNU A;  4II7 A;  3Q81 A;  1XFQ A;  4OOL A;  3EQU A;  3N6I A;  3IWI A;  1D7E A;  3UPO A;  4GKU A;  3L7H A;  1JWP A;  4JF5 A;  4RX2 A;  1VEU B;  3P09 A;  4CLC C;  4S2P A;  3W4Q A;  3EQV A;  2Y79 A;  4GDN A;  1C3B A;  3M6H A;  3MS6 A;  1N9L A;  3VP3 A;  2Z6D A;  1MC0 A;  4MBF A;  4JGP A;  2A24 B;  2M7U A;  3GQZ A;  5C5K A;  1RGY A;  3E98 A;  5AJG A;  4GHI A;  4ZAM A;  3ZVT A;  2YKF A;  4UA6 A;  5EVI D;  1OME A;  3BY8 A;  1YLT A;  4JLF A;  3N8R A;  1PW8 A;  1BSG A;  3R7W B;  4K0W A;  1D1J A;  1YPR A;  5E2F A;  3UN7 A;  2W0N A;  3EEH A;  1XKZ A;  3NUL A;  5CER A;  3IX3 A;  3VSK A;  5TFQ A;  3A3J A;  1P9R A;  5L07 A;  4XUZ A;  2E8J A;  3PBN A;  4HI4 A;  4Y17 A;  1QME A;  2R78 A;  4N9K A;  1G68 A;  1PWG A;  4Y15 A;  4QHC A;  1P97 A;  3CJM A;  3UB9 A;  1J9M A;  1GSX A;  4IUH A;  4NG2 A;  1L0D A;  4B9O A;  4DDS A;  2JKT I;  5FDH A;  1LLB A;  3E4O A;  1OTD A;  1W7F A;  5GHX A;  1M6K A;  4PM9 A;  2D02 A;  4X1L A;  1S66 L;  3S1Y A;  3WS1 A;  2O9C A;  4C75 A;  2H5S A;  1NWZ A;  2VZW A;  4LLO B;  4LGW A;  3SZT A;  2G2U A;  4G3W A;  5CGS A;  4KZ8 A;  3IH9 A;  5KSH A;  3W2Z A;  3E4Q A;  1ONH A;  3K2N A;  3GTC A;  3MXS A;  3SW1 A;  3IF6 B;  3UPP A;  3HLW A;  3PR6 A;  2W3F A;  3RXX A;  2XGN A;  4ETZ A;  3QP5 A;  4BMW A;  2Y2I A;  3QP1 A;  5LBR A;  4X69 A;  5AVE A;  4CQH A;  2OOL A;  3LR5 A;  1TS6 A;  3ISG A;  1ERM A;  2ZLY A;  4QY5 A;  1K4E A;  4GW9 A;  3DWZ A;  3MJQ A;  4IBX A;  5HAI A;  4GS9 A;  5FSR A;  5DF8 A;  4BBU A;  4NXF A;  5AQB A;  5FQM A;  1S0W A;  2EWW A;  2PDR A;  4LCL A;  4EQI A;  3MFX A;  5DKL A;  2ZQ8 A;  2ZBB A;  3C38 A;  3UE3 A;  4GZB A;  1FCN A;  2W3H A;  4HH2 A;  4CLC B;  2J3T D;  1DJC A;  3NCK A;  4O0P A;  4DJ2 A;  1XJ4 A;  4MEZ A;  3U4L P;  1E3U A;  2JN7 A;  4JGO A;  5IHV A;  5BOH A;  3SOI A;  2H10 A;  3HJI A;  1G6O A;  3UO9 A;  5EV0 A;  1TEM A;  5IS1 A;  1U60 A;  4N92 A;  1VET A;  3IHB A;  3MR0 A;  3MZD A;  3A0R A;  3F1P A;  5DFX A;  2V9A A;  1LI9 A;  3NEC A;  2YKH A;  1HVB A;  2HP5 A;  2W1T B;  4R4R A;  4D2O A;  1Y4O A;  3MZE A;  3C5A A;  3B33 A;  1GSW A;  4OQ0 A;  4OQI A;  1MZU A;  1NRF A;  4EXO A;  3IXD A;  3JPU A;  3IXG A;  2Y4A A;  5EOO A;  2WZZ A;  4PM8 A;  5F5Y A;  3HUO A;  1E4D A;  4X6T A;  4LRY C;  4K0X A;  4HP9 A;  2UV0 E;  3A3D A;  1OTI A;  4DKI A;  2HDU A;  2EWV A;  4EEP A;  5EVI C;  4MLL A;  4U3T A;  3PBT A;  4RX3 A;  4KZ4 A;  5HDS A;  5E43 A;  4PMA A;  4DMZ A;  1K54 A;  5HAQ A;  4U0X A;  3T1Q B;  5I94 A;  5CHM A;  3BW6 A;  3DTM A;  4LCM A;  1BZA A;  5HPF A;  1DP8 A;  5E2H A;  1ZG6 A;  5GLD A;  1E25 A;  4NXB A;  1K6R A;  1KE3 A;  2HDS A;  1BLH A;  5GHY A;  2WAE A;  3E2L A;  3VFF A;  2VV6 A;  5HWV A;  4MBH A;  1RCJ A;  3LYX A;  5EEC A;  4GCZ A;  4HJ3 A;  1CJF A;  5L2F A;  1TS0 A;  2Y2L A;  2PR6 A;  3O5Y A;  3G30 A;  2EX2 A;  2ZQ7 A;  2P7J A;  1TVF A;  1ZC2 A;  2Y59 A;  4R23 A;  4ME4 A;  4R4S A;  5F68 A;  5EPH A;  1G5U A;  4IJG A;  3LID A;  3BLM A;  1OT6 A;  3EOI A;  1G28 A;  1GA9 A;  1YM1 A;  2P08 A;  5HWW A;  3LI9 A;  1QMF A;  2W3D A;  4KUK A;  3BWL A;  4PKY G;  4Y0O A;  1Z09 A;  3PXP A;  1Q2Q A;  2ZC7 A;  4KQD A;  4JXS A;  1S4S A;  4BD1 A;  2PD7 A;  3F1O A;  4PHT A;  3VP0 A;  2E8I A;  3LCE A;  1LSX A;  4HNB A;  1L2S A;  3HL9 A;  4S2N A;  5F83 A;  5A91 A;  1Y54 A;  2EX9 A;  3GR2 A;  3PAG A;  4UQI S;  5HZH A;  1NRJ A;  1X0O A;  3SH7 A;  4OOY A;  4EV4 A;  2J7V A;  3CHW P;  3VP1 A;  2XD1 A;  1SKO A;  1UGU A;  3RTY A;  4RYE A;  3GSG A;  1W8Q A;  1ESI A;  1MWS A;  2R9X A;  4R3J A;  4DJ3 A;  1L0E A;  2INW A;  2OAP 1;  4L9E A;  1BLC A;  2JC7 A;  5FQJ A;  4G3V A;  4XUX A;  2XR0 A;  4KZA A;  5AQ9 A;  3C30 A;  3I7J A;  2L0W A;  2XD5 A;  4OLD A;  1K57 A;  3IH8 A;  2QWS A;  4WLA A;  3TW8 A;  3HLC A;  3UB8 A;  3UB5 P;  2IWD A;  2KX6 A;  3IS2 A;  4H6J A;  4RQ9 A;  4FCF A;  3FPW A;  4UHU A;  3B47 A;  2XK1 A;  1JVJ A;  4MN6 A;  3LEZ A;  4IED A;  3MF0 A;  1IKG A;  5DF7 A;  3LIF A;  5FL3 A;  5DTS A;  3FPV A;  4DE3 A;  1PFL A;  3JYI A;  4I3A A;  3VFH A;  1H5X A;  1CEG A;  3CUE C;  5HD3 A;  1NJ4 A;  3GDI A;  3OPR A;  5HX9 A;  4PM5 A;  5FI7 A;  4OKP A;  4Q0J A;  4EBP A;  3NIA A;  1TDG A;  1KE0 A;  2WKP A;  4FD8 A;  2HV1 A;  3LR4 A;  3NDG A;  2XA7 M;  4FOF A;  4NKP A;  2ZM2 A;  3ZVW A;  1BLP A;  4FUW A;  2W1T A;  3K3C A;  4Q0H A;  2XDM A;  5JYP A;  5EVI B;  3IX4 A;  1IEM A;  1K4F A;  4JKT A;  2Y2H A;  4QD4 A;  2Q0O A;  4N9L A;  2QJ5 A;  4R0Q A;  3HBR A;  1CF0 A;  4E3I A;  1NYM A;  1ONG A;  4GLQ A;  1PI4 A;  2M1C A;  1K38 A;  1KOU A;  2O9B A;  3P01 A;  3A0S A;  1CI8 A;  1NLZ A;  2J80 A;  3H9W A;  3Q07 A;  1KDS A;  2LB9 A;  4DN0 A;  4MMN A;  4JF6 A;  1NZO A;  1KE4 A;  4DE2 A;  4E3O A;  5JYO A;  3IF6 C;  3SS5 A;  3PHY A;  3KO6 A;  1MBL A;  2ZC3 B;  3W8K A;  3TG9 A;  4JXG A;  1T1A A;  3V3S A;  3C2W A;  2HGV A;  4L0L A;  3CMZ A;  3H82 B;  4F94 A;  1T1C A;  3DTK A;  3S7O A;  1E3U D;  1YLY A;  2XFT A;  3G4P A;  4PAU A;  4WEK A;  4JBF A;  5FAT A;  5HD5 A;  3IHA A;  1TF1 A;  4S2K A;  1FIK A;  2JKG A;  4GDB A;  4XT2 A;  5F1G A;  3VOL A;  3C8C A;  1DRM A;  1K0K A;  5FAP A;  1YT4 A;  2EX8 A;  3C4P A;  2ZOI A;  4OPQ A;  2V0W A;  1VHM A;  1L0F A;  3LFV A;  1K55 A;  2VA0 A;  3W4P A;  1ODV A;  3E4P A;  5CED A;  3HJK A;  2QMI A;  3FC7 A;  1SDN A;  4YFM A;  2V2F F;  1K54 C;  3N4I A;  2PU2 A;  4K08 A;  2GDN A;  1ZKJ A;  3SH8 A;  4OPR A;  2M7V A;  2A3U A;  4BEN A;  3F1N A;  1V9Y A;  1S67 L;  1H8M A;  2WGW A;  4Q0I A;  2LB5 A;  3PYP A;  2JKR M;  3ZG7 B;  2VLG A;  4WN5 A;  2ZMV A;  3DBA A;  3WRT A;  3ICY A;  4MBK A;  3BYD A;  5FA7 A;  4KG5 A;  3BQA A;  1LHY A;  3C7U A;  5TGF A;  3VE3 A;  2QYB A;  4D60 A;  4BWI A;  4ESP A;  3VE4 A;  1STZ A;  1FCM A;  4GB7 A;  2VGL S;  1TS7 A;  3NI9 A;  3WS4 A;  4BL2 A;  4DXC A;  1K56 A;  3QNC A;  4UA7 A;  4ZJ3 A;  4EEU A;  4BQM A;  2Y2P A;  4C6Y A;  4EUZ A;  4WL9 A;  2JKF A;  4YIN A;  3ZNT A;  3IF6 A;  1CEF A;  5CEB A;  2DMW A;  3N8S A;  5EOE A;  2HPB A;  1ES3 A;  1MKM A;  4R1G A;  2QJ7 A;  1XGI A;  1IYQ A;  1UWN X;  4OP8 A;  4EUV A;  2X02 A;  4I39 A;  1F98 A;  4MCW A;  1EW0 A;  4L9F A;  4S2O A;  1GCE A;  1CQA A;  4BBV A;  4UA9 A;  3NJA A;  3CPT A;  3DWK A;  1PW1 A;  1TD5 A;  5TBM A;  2K31 A;  1AWI A;  3HUN A;  4HP4 A;  4GNU A;  4HBU A;  3G6O A;  2ACG A;  4KUO A;  3T4Q A;  5DTK A;  1XFN A;  1HTZ A;  3IS2 B;  5F6A A;  3NDE A;  4XXR A;  1IFQ A;  4LV3 A;  4YNR A;  5DF9 A;  3QP4 A;  1BT5 A;  4B88 A;  3ITA A;  5CTN A;  4HQA A;  1HZO A;  4WYY A;  3MKF A;  5DVA A;  2GJ3 A;  1NZU A;  5IU1 A;  2JKR I;  3MQQ A;  4WMC A;  5KMW A;  3D9Y A;  1EI5 A;  1MWU A;  3LIC A;  4LRZ E;  3MQ0 A;  1OT9 A;  3IWQ A;  3N7W A;  4X68 A;  1VET B;  3NC8 A;  2EA9 A;  5CX7 A;  2ZQD A;  2WKH A;  2K2N A;  4E3N A;  4ETX A;  3SS3 A;  2P74 A;  1OTB A;  1KDW A;  2UWX A;  4Y5F A;  2WZX A;  2ZL1 B;  1I2S A;  1XJ2 A;  2L1M A;  2VV7 A;  3DTI A;  3LIB A;  1Z6F A;  1BUL A;  2CC1 A;  4GN2 A;  3HLF A;  2WGV A;  1YMS A;  3V5M A;  2VKS A;  2V1A A;  1RGZ A;  5FAO A;  3D3O A;  4OOM A;  3OCN A;  1SKF A;  1F5M A;  2RCX A;  4X1M A;  1VB6 A;  2ZM0 A;  3O87 A;  4EER A;  3H7W A;  3C7V A;  4WZ5 C;  2FH5 A;  4CJN A;  1L3L A;  3WRZ A;  3Q7V B;  2OV5 A;  2W1R A;  3LY4 A;  1XJ6 A;  2WKE A;  3OPL A;  3FKW A;  5FEG A;  4HH3 A;  3ITB A;  1MPL A;  2ZMA A;  2QZ6 A;  1JWV A;  3S7N A;  4X53 A;  2O99 A;  3EEA A;  1KGG A;  1WYB A;  3C4O A;  2R9W A;  3AGE A;  5DFY A;  1T18 A;  3CLO A;  3T4K A;  1N9B A;  4I3I A;  4S2M A;  4BLM A;  1W8Y A;  4Y0T A;  3G34 A;  1I2W A;  2G7U A;  1GA0 A;  3OLO A;  1XXM A;  2HP9 A;  3ZGA B;  2WAF A;  3T1S A;  4RVA A;  3O3V A;  2VEA A;  2FFF B;  4OPY A;  4B4X A;  1ALQ A;  4DRT A;  3P7N A;  5GHZ A;  4ZJ2 A;  3UY6 A;  2V1B A;  4QWO A;  1LSV A;  4S2J A;  2HZ5 A;  1FR1 A;  1YLP A;  1ACF A;  1W63 M;  3ZYT A;  3SH9 A;  3IBJ A;  4CLC E;  5CGW A;  5E2G A;  4KQO A;  4C3Q A;  1IOU A;  3EGX C;  4N1X A;  2VGL M;  4QU3 A;  5AQA A;  2I72 A;  1F9I A;  2ZOH A;  4N1H A;  5M18 A;  4Y13 A;  1BUE A;  3GRJ A;  3M2K A;  1ESU A;  1MWT A;  2PBD P;  1RP5 A;  5EVE A;  5HL6 A;  2H28 A;  3V3R A;  3FZC A;  2O0Y A;  5CGX A;  3KYZ A;  3S4X A;  3BFE A;  4M3K A;  4CPK A;  1YQS A;  3V50 A;  4P85 A;  5FDS A;  2JE5 A;  2PYR A;  2BAS A;  3LEQ A;  2Y2K A;  4Z1W A;  2W3G A;  3UE6 A;  4ZDX A;  4OPZ A;  2OAQ 1;  4FH4 A;  3G2Y A;  3K3D A;  1DJA A;  1BYW A;  2HDQ A;  4GOG A;  4WM9 A;  4K91 A;  4WZ4 A;  5A92 A;  1A0K A;  3RXW A;  1SHV A;  4I5S A;  4WZ5 A;  3A3E A;  1OPX A;  4PKY A;  5AVF A;  3WS0 A;  3ZG0 A;  2KLI A;  4DDY A;  2WKQ A;  4GS9 B;  4EBL A;  2X01 A;  3B3X A;  2G2W A;  2V8C A;  3LIE A;  4JXV A;  1NYY A;  3HRE A;  4DE1 A;  2JKT M;  3LUQ A;  4LFU A;  1OTE A;  2JCH A;  3BFC A;  2GZA A;  3VOZ A;  4ZJ1 A;  4ZRR A;  1DY6 A;  3HLB A;  1ES4 A;  2XQZ A;  5IT5 A;  3ULF A;  3HUM A;  1PZP A;  5DJT A;  5L09 A;  5HFO A;  3A3F A;  5EM0 A;  2QHK A;  1VM1 A;  3UNW A;  2XLN A;  3R4K A;  2PD8 A;  3M2J A;  4PPR A;  5I5L A;  1HLU P;  3TSG A;  5L10 A;  1WE4 A;  3KSG A;  1LI0 A;  2ZC5 B;  3A0V A;  2V1Z A;  1Q2P A;  2P9V B;  4NET A;  4YOF A;  3NOT C;  1W63 Q;  2XF3 A;  5A8B A;  3FG8 A;  4KZ6 A;  3MXQ A;  2VGK A;  3LGO A;  3LR0 A;  3M6B A;  2WKI A;  2BG1 A;  3OZH A;  5DKK A;  4WBG A;  4EWF A;  2ZL1 A;  5J7E A;  4LV1 A;  2PT7 A;  1H8Z A;  2Y2N A;  4JXW A;  2VJW A;  1FOF A;  4F3L A;  5CHJ A;  3VMA A;  5CEC A;  5AQ7 A;  2Q9M A;  2OLV A;  1N9O A;  4WMC D;  5M19 A;  5J8X A;  4O01 A;  5G18 A;  4R38 A;  5G4Z A;  3ZG8 B;  1ES2 A;  4HHD A;  4QPR A;  5HL1 A;  2A24 A;  4MDZ A;  4MN5 A;  3VP2 A;  3T50 A;  4GHI B;  3QHY A;  4JPM A;  1VQQ A;  3B42 A;  4KZ5 A;  4IUK A;  2ZQ9 A;  4OON A;  2AVX A;  2Y55 A;  4EET B;  4LV0 A;  4EU0 A;  3T1X A;  5F82 A;  2A49 A;  1YMX A;  2HJE A;  3UDI A;  4KG6 A;  1YSP A;  1ERO A;  2Y91 A;  5FQ9 A;  3D72 A;  3VOY A;  1PIO A;  1XGJ A;  4X56 A;  4G3K A;  1IYS A;  3IQA A;  3DW0 A;  4ID4 A;  1YSQ A;  2V0U A;  3AGF A;  1NXY A;  1N4O A;  2OWJ A;  5G4Y A;  4CLC A;  5M1A A;  3IXB A;  2PAV P;  3WWX A;  3UDX A;  1FR6 A;  1L0G A;  1WYC A;  1GHM A;  3PBO A;  4ARZ B;  2PR5 A;  4WEL A;  3ZFZ A;  3RJU A;  3VP4 A;  1K25 A;  2RL3 A;  1K56 D;  3LR3 A;  5FI2 A;  3QP6 A;  2HF6 A;  4CLC D;  3AGD A;  4BD0 A;  2QPN A;  5EE8 A;  2PHY A;  3OBF A;  2B95 A;  4P0M A;  3QP8 A;  4DF6 A;  2WYX A;  1K57 C;  1H3Q A;  5GLA A;  5KSC A;  5GLB A;  2J3W A;  3OC2 A;  5A93 A;  4UAA A;  1GHI A;  3RH8 B;  3A3I A;  3BJN A;  2I9V A;  4HJ4 A;  1SKO B;  2Y2Q A;  4BJP A;  2GX5 A;  2IWC A;  3NOP C;  4IHQ A;  2J8Y A;  5U47 A;  1T19 A;  2PBY A;  5FAS A;  4E3K A;  3G31 A;  1MY8 A;  3ZNY A;  3S7P A;  1ZHH B;  4H8R A;  4MN7 A;  3IX8 A;  2O9A A;  2PYP A;  4Y2F A;  3QP2 A;  3BLS A;  1S4R A;  1YAX A;  3FWL A;  4EW7 A;  3MXR A;  3P98 A;  3R7W A;  2OWH A;  1OTA A;  1J3W A;  3GMW A;  3HLD A;  5EFW A;  4B93 A;  2W27 A;  3WS5 A;  2ZC6 B;  1ERQ A;  1I5Q A;  4KQQ A;  4XT2 B;  1S1Y A;  4JGQ A;  3PBQ A;  4LEN A;  4Q8I A;  1H0M A;  1JWZ A;  4PM7 A;  2ZD8 A;  1N9N A;  4E3J A;  5A90 A;  3CWF A;  3HLE A;  1AXB A;  2XRO A;  2XEP A;  2EFX A;  2JHE A;  4R3A A;  4DE0 A;  1YLJ A;  2EXA A;  4KQR A;  3F1N B;  4RA7 A;  1D06 A;  1M40 A;  3IXH A;  4Y0U A;  3F1P B;  3GEC A;  4OQG A;  4P87 A;  4GD8 A;  2Z2L B;  1NY0 A;  3TJZ C;  3OPP A;  5HAP A;  3S7Q A;  1P9W A;  2Z2M B;  4S2N C;  2ZQA A;  3BFD A;  2J9P A;  2H0T A;  3TRC A;  4IVI A;  4X25 A;  5EVL A;  2V8F A;  2B02 A;  3LI8 A;  4FSF A;  1KVM A;  4MNR A;  3MSH A;  2J3T C;  3IWO A;  1MWR A;  2Y2O A;  4F3L B;  3UPN A;  1KGF A;  5FEF A;  1W5D A;  4NXG A;  4FH2 A;  4R6L A;  4QY6 A;  5MC7 A;  1JTD A;  1BLS A;  2Y2G A;  3Q7V A;  3QNB A;  3UDF A;  5K5B A;  2B18 A;  1ES5 A;  3KYE A;  1IYP A;  2Y8H A;  2Y2J A;  1SDE A;  3MMH A;  1GHP A;  1SZV A;  3V67 A;  3T4J A;  3BQ8 A;  3IT9 A;  3LO7 A;  3Q82 A;  2XA7 S;  4H6J B;  1PNE A;  3HVF A;  1S6R A;  3DAV A;  1WA9 A;  1CI9 A;  3O88 A;  5D3O A;  3CZD A;  1FSW A;  2J9O A;  1NLY A;  4GJ4 A;  1FIL A;  4WEJ A;  3BM6 A;  3UB6 A;  4OLG A;  2DNS A;  3G32 A;  4FTX A;  5CTM A;  1XX2 A;  2WKR A;  3PBS A;  2NUT C;  3T4T A;  3JVU A;  2H0Y A;  2X71 A;  1GSV A;  4NEE D;  2C5W B;  4YWZ A;  2A2L A;  4P6Z S;  3BEB A;  5CHU A;  4HES A;  4NXE A;  1K6S A;  3T4L A;  4ARZ A;  3T4S A;  3ZCZ A;  4Z9Q A;  2KDK A;  1IEL A;  4OVD A;  3IF5 A;  5FQK A;  3L9K A;  5KZH A;  1SCW A;  2WGW B;  5L8M A;  3F1O B;  5TR7 A;  2DRW A;  5J3W A;  4KG2 A;  1IKI A;  4OP5 A;  3MZF A;  2HDR A;  3UE0 A;  3W4O A;  3RFB A;  3V39 A;  1MXO A;  2P04 A;  4OQH A;  1VEU A;  4E3M A;  2CMN A;  1H8Y A;  2EX6 A;  1V9Z A;  3BEC A;  3MBZ A;  2BLS A;  3PAE A;  1Y28 A; 
#chains in the Genus database with same CATH homology
 3NOT C;  1W63 Q;  3H7W B;  3E0Y A;  2V0W A;  5A8B A;  1VHM A;  3FG8 A;  2Z6C A;  3LFV A;  2L4R A;  3MXQ A;  2VA0 A;  3MFX A;  1ODV A;  3E4P A;  3HJK A;  5F69 A;  3LR0 A;  3FC7 A;  5DKK A;  2VX8 A;  4K08 A;  5DKL A;  2FZ0 A;  5J7E A;  2K7S A;  2PT7 A;  2M7V A;  3NOU C;  3F1N A;  1V9Y A;  2ZBB A;  1S67 L;  1H8M A;  2VJW A;  4F3L A;  3C38 A;  1TS8 A;  1OJ5 A;  4Q0I A;  3LIA A;  3UE3 A;  2LB5 A;  3PYP A;  2JKR M;  1OJG A;  2VLG A;  1N9O A;  2W3H A;  3MQO A;  4HH2 A;  4WN5 A;  5TBM B;  4HOI A;  3UME A;  4CLC B;  2ZMV A;  2J3T D;  4L9G A;  3TE8 A;  3DBA A;  4M4X A;  4O01 A;  4O0P A;  3ICY A;  4DJ2 A;  1XJ4 A;  4R38 A;  5G4Z A;  4R70 A;  4HHD A;  4QPR A;  3BQA A;  1XJ3 A;  2A24 A;  2JN7 A;  2XSS A;  3OOV A;  4JGO A;  5HWT A;  3VV4 A;  3VE3 A;  2QYB A;  2NUP C;  3HJI A;  1G6O A;  4MDZ A;  4MN5 A;  5HDD A;  3T50 A;  4BWI A;  3VE4 A;  1STZ A;  5J4E A;  1ZTU A;  4GHI B;  5IS1 A;  1T1B A;  2VGL S;  1TS7 A;  3MR0 A;  3A0R A;  3F1P A;  3B42 A;  4P6Z M;  5DFX A;  2V9A A;  4IUK A;  4EEU A;  2YKH A;  4JGR A;  2W1T B;  4WL9 A;  4E04 A;  4EET B;  2D01 A;  4EU0 A;  2DMW A;  2HJE A;  3B33 A;  1GSW A;  1YSP A;  3CI6 A;  1MKM A;  5KIZ A;  2QJ7 A;  3D72 A;  4HJ6 A;  1UWN X;  4EUV A;  4AFI A;  4I39 A;  1MZU A;  4BBT A;  1F98 A;  4EXO A;  4MCW A;  1DP6 A;  1DP9 A;  4UQI M;  4G3K A;  1EW0 A;  4L9F A;  5HDC A;  4BBV A;  1YSQ A;  2V0U A;  3NJA A;  2OWJ A;  5F5Y A;  5G4Y A;  1TD5 A;  4LRY C;  5TBM A;  4CLC A;  2K31 A;  4HP9 A;  1OTI A;  4HP4 A;  3KSF A;  1UWP X;  4LRX C;  3G6O A;  2IA2 A;  2EWV A;  4KUO A;  3T4Q A;  4EEP A;  4UEY A;  4WF0 A;  1XFN A;  3KX0 X;  3PBO A;  3PBT A;  4ARZ B;  2PR5 A;  4WEL A;  4HY8 A;  5HDS A;  4DMZ A;  3IS2 B;  5F6A A;  1S1Z A;  3LR3 A;  3JVV A;  2MJ6 A;  1IFQ A;  4YNR A;  5DF9 A;  3U2A A;  3OCL A;  2HJ9 C;  4EQ1 A;  3BW6 A;  3KSH A;  3IBR A;  5HPF A;  2HF6 A;  5HSQ A;  1DP8 A;  4HQA A;  4NXB A;  2XRN A;  4CLC D;  2PHY A;  3OBF A;  2GJ3 A;  5IU1 A;  2VV6 A;  3NHQ A;  2JKR I;  5HWV A;  3LYX A;  3MQQ A;  4WUJ A;  2ZMF A;  4GCZ A;  4HJ3 A;  1H3Q A;  3LIC A;  4Y3I A;  4I38 A;  1TS0 A;  4LRZ E;  3MQ0 A;  1OT9 A;  4LPZ A;  2J3W A;  2PR6 A;  3OC2 A;  3HCY A;  2W3E A;  3O5Y A;  4EES A;  2EA9 A;  1P0Z A;  3RH8 B;  5CX7 A;  3BJN A;  2P7J A;  3KSI A;  2I9V A;  3H82 A;  2K2N A;  4HJ4 A;  3T4O A;  4ETX A;  4ME4 A;  5F68 A;  4BJP A;  2GX5 A;  1OTB A;  3NOP C;  4IJG A;  4HIA A;  4IHQ A;  3LID A;  1OT6 A;  3EOI A;  4Y5F A;  3CUE A;  1G28 A;  2P08 A;  1XJ2 A;  5HWW A;  2L1M A;  3LI9 A;  1T19 A;  2VV7 A;  2W3D A;  3LIB A;  4KUK A;  3BWL A;  5HPI A;  4PKY G;  3UMD A;  1LSW A;  3S7P A;  3EWK A;  3PXP A;  1ZHH B;  2VKS A;  3KYQ A;  4KQD A;  2V1A A;  4MN7 A;  3PBR A;  2O9A A;  1S4S A;  3UB7 A;  2PYP A;  3D3O A;  2VV8 A;  4OOM A;  3OCN A;  2PD7 A;  3F1O A;  4PHT A;  4Y2F A;  1F5M A;  1S4R A;  1VB6 A;  4EER A;  3H7W A;  1YAX A;  2FH5 A;  4EW7 A;  3R7W A;  2OWH A;  1OTA A;  3CAX A;  1LSX A;  4HNB A;  1YKD A;  4I3J A;  4O8G A;  5EFW A;  4B93 A;  2W27 A;  1LT0 A;  2W1R A;  2KOI A;  4UQI S;  4XT2 B;  5HZH A;  1XJ6 A;  1S1Y A;  1NRJ A;  4HH3 A;  4JGQ A;  3PBQ A;  1X0O A;  5TJJ A;  1LL8 A;  2GNX A;  5DJU A;  3EGD C;  3S7N A;  2O99 A;  3EEA A;  1N9N A;  5DFY A;  1T18 A;  1UGU A;  3CLO A;  3RTY A;  3T4K A;  2QKP A;  4I3I A;  3ZQ5 A;  3CWF A;  4DJ3 A;  3CIT A;  2INW A;  3BY9 A;  1JNU A;  2OAP 1;  2XRO A;  4II7 A;  1XFQ A;  2G7U A;  2JHE A;  3OLO A;  4L9E A;  4OOL A;  3EQU A;  4R3A A;  4G3V A;  3F1N B;  1D7E A;  1D06 A;  2VEA A;  3F1P B;  3C30 A;  3GEC A;  2L0W A;  4CLC C;  3EQV A;  2Y79 A;  3P7N A;  3TJZ C;  2V1B A;  1LSV A;  1N9L A;  2QWS A;  2Z6D A;  4WLA A;  1MC0 A;  3TW8 A;  3UB8 A;  1W63 M;  2KX6 A;  4JGP A;  3ZYT A;  3S7Q A;  1P9W A;  2A24 B;  3IBJ A;  2M7U A;  3IS2 A;  4CLC E;  4H6J A;  4RQ9 A;  5C5K A;  4KQO A;  1IOU A;  3FPW A;  3EGX C;  3TRC A;  3E98 A;  5AJG A;  2VGL M;  2B02 A;  4GHI A;  2YKF A;  1F9I A;  3LI8 A;  2ZOH A;  3B47 A;  4FSF A;  4MN6 A;  2J3T C;  3MF0 A;  3BY8 A;  4F3L B;  5HL6 A;  2H28 A;  3LIF A;  4NXG A;  4R6L A;  5FL3 A;  3FPV A;  2O0Y A;  3KYZ A;  4I3A A;  3R7W B;  5HD3 A;  3CUE C;  5MC7 A;  3GDI A;  4Q0J A;  2W0N A;  2WKP A;  5K5B A;  2B18 A;  3EEH A;  2HV1 A;  3LR4 A;  2XA7 M;  2PYR A;  4FOF A;  2Y8H A;  4NKP A;  3MMH A;  2BAS A;  4Z1W A;  3V67 A;  1P9R A;  3T4J A;  2W1T A;  2W3G A;  3K3C A;  4Q0H A;  3UE6 A;  3BQ8 A;  3PBN A;  4HI4 A;  2OAQ 1;  3K3D A;  2R78 A;  2XA7 S;  4H6J B;  1BYW A;  2QJ5 A;  1WA9 A;  1P97 A;  3UB9 A;  1NLY A;  4I5S A;  1GSX A;  1OPX A;  4GJ4 A;  4PKY A;  4IUH A;  4WEJ A;  4GLQ A;  5AVF A;  2M1C A;  2KLI A;  1KOU A;  2O9B A;  2WKQ A;  4GS9 B;  3UB6 A;  4B9O A;  3P01 A;  2JKT I;  1NLZ A;  3A0S A;  2J80 A;  3H9W A;  3E4O A;  1OTD A;  2LB9 A;  4DN0 A;  4MMN A;  2D02 A;  1S66 L;  3LIE A;  2WKR A;  3PBS A;  2O9C A;  2NUT C;  3T4T A;  3JVU A;  1NWZ A;  1GSV A;  2VZW A;  4NEE D;  4LLO B;  2JKT M;  3LUQ A;  4YWZ A;  2A2L A;  4G3W A;  4P6Z S;  4NXE A;  1OTE A;  3T4L A;  4ARZ A;  2GZA A;  3PHY A;  5KSH A;  3T4S A;  3KO6 A;  3W2Z A;  2KDK A;  3E4Q A;  1T1A A;  4ZRR A;  5IT5 A;  3K2N A;  3C2W A;  3SW1 A;  2HGV A;  4L0L A;  3ULF A;  5DJT A;  3H82 B;  3PR6 A;  3F1O B;  5L8M A;  2W3F A;  1T1C A;  4ETZ A;  4BMW A;  3S7O A;  2QHK A;  5LBR A;  5J3W A;  5AVE A;  4CQH A;  4PAU A;  4WEK A;  2OOL A;  3R4K A;  3LR5 A;  5HD5 A;  2PD8 A;  1TF1 A;  1TS6 A;  5I5L A;  4XT2 A;  3RFB A;  3VOL A;  2P04 A;  3C8C A;  1DRM A;  4GW9 A;  2CMN A;  3KSG A;  3MJQ A;  4GS9 A;  3A0V A;  4BBU A;  4NXF A;  1V9Z A;  2ZOI A;  1Y28 A;  2EWW A;  2PDR A;  4YOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...