2KX6A

Signaling state of photoactive yellow protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
125
structure length
125
Chain Sequence
MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photoactive yellow protein
publication title The short-lived signaling state of the photoactive yellow protein photoreceptor revealed by combined structural probes.
pubmed doi rcsb
source organism Halorhodospira halophila
molecule tags Signaling protein
total genus 3
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00989 PAS PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2kx6A00
4HY8A 4HQAA 4LPZA 3NJAA 3ICYA 2GJ3A 1TS8A 5HD3A 5HWVA 3RH8B 2INWA 1G28A 3CWFA 4GHIA 1OJGA 3UB6A 3RTYA 1F9IA 2YKHA 3OLOA 3HJIA 3VOLA 1OTIA 2VLGA 2VV7A 3UMEA 1N9LA 4KUOA 4JGPA 2PD7A 3H9WA 2JN7A 4F3LA 1N9NA 1S67L 3LIDA 1XFNA 2WKRA 2YKFA 3EWKA 4PKYG 4R3AA 1T1AA 2QJ5A 5HSQA 3PHYA 2ZOHA 1OTAA 5HD5A 5J7EA 1D7EA 2L1MA 1LSXA 2JHEA 2QJ7A 1T1BA 3IS2B 4HI4A 1OTBA 1BYWA 4GHIB 2V1BA 4WL9A 4RQ9A 3LYXA 5F68A 3LUQA 4EEUA 3LI8A 2CMNA 5TBMA 4NXFA 5G4YA 5HZHA 3UB8A 4WLAA 2PYPA 1OTDA 5AVFA 4LRZE 2Z6CA 4HH3A 4F3LB 1GSWA 4NXBA 1TS7A 1MZUA 1V9YA 4EXOA 4DJ3A 4DJ2A 3NOPC 3P7NA 1UGUA 3H7WA 2V0WA 4I3JA 1P97A 2V9AA 4L9EA 3F1OA 2PYRA 2PR6A 1JNUA 4WN5A 1T18A 4HJ3A 1LT0A 2V1AA 3LIAA 3LICA 5IU1A 3ZQ5A 1TS6A 2QHKA 3LI9A 1KOUA 3KX0X 5TBMB 4BBUA 5A8BA 3K3CA 2KX6A 2WKQA 4HJ6A 1VB6A 3F1NB 3FC7A 3B33A 5F69A 3UB9A 2VV8A 3MQQA 3G6OA 3E4QA 3ULFA 4JGQA 4EETB 4EERA 2M1CA 2VEAA 3D72A 3H7WB 1P0ZA 3LIBA 3MFXA 3NOUC 3F1OB 3T50A 4HP4A 3VE4A 5F5YA 3A0RA 4XT2A 1XJ3A 3A0SA 4I3IA 4YWZA 4GW9A 1ODVA 1UWPX 1Y28A 4LLOB 1UWNX 2W0NA 3C2WA 3UB7A 1GSXA 2PD8A 3EEHA 3MJQA 4MN6A 2PR5A 1EW0A 3NHQA 4JGOA 4MN5A 4GS9A 1D06A 1DRMA 5DKLA 4M4XA 4KUKA 4BBTA 5AVEA 2P7JA 2KDKA 4R38A 4EEPA 1T19A 3BY9A 1OT6A 1XFQA 4I39A 5I5LA 3A0VA 3E4OA 2W27A 3CAXA 4L9FA 4XT2B 2A24A 2H28A 2OWHA 3GDIA 4HNBA 5HDSA 4NXEA 3VE3A 4GCZA 4KQDA 2PDRA 1S4RA 2ZOIA 1S4SA 3HJKA 2QWSA 4GS9B 4HJ4A 3SW1A 3MXQA 1T1CA 4HP9A 4HIAA 2OWJA 2R78A 3H82A 3K3DA 2J80A 4BBVA 1GSVA 2EA9A 1S1ZA 4B9OA 1S66L 1DP8A 5HDCA 3BWLA 4H6JA 1TS0A 3E4PA 3IS2A 3FG8A 4R6LA 2D02A 2OOLA 2A24B 2V0UA 4WF0A 3IBRA 3C8CA 2HV1A 4EQ1A 1V9ZA 5EFWA 3PYPA 5HDDA 3MQOA 2WKPA 1LL8A 4EESA 3UMDA 3F1PA 5HWTA 1WA9A 2Z6DA 4E04A 5DKKA 4L9GA 1NWZA 4K08A 2D01A 3H82B 1LSWA 5HWWA 2QKPA 4HHDA 5J4EA 2ZBBA 3GECA 4I3AA 1XJ2A 4H6JB 2K7SA 2BASA 5DJUA 4I5SA 4EW7A 4LRXC 3NOTC 5DJTA 3CLOA 4I38A 4R70A 1DP6A 3F1PB 4HH2A 1XJ4A 3UE6A 2I9VA 1F98A 4HOIA 3F1NA 5KIZA 4LRYC 4WUJA 1DP9A 5J3WA 4NXGA 4JGRA 3LIFA 4PKYA 5F6AA 1LSVA 1OJ5A 2PHYA 1X0OA 3BY8A 1XJ6A 1S1YA 2VV6A 5G4ZA 1OTEA 3MR0A 2B02A 1N9OA 2L0WA 1OT9A 2L4RA 3LIEA 5IS1A
chains in the Genus database with same CATH superfamily
1ESUA 1KVMA 3GVBA 2Q9MA 2XSSA 1H5XA 1FOFA 3PBQA 4LPZA 2ZD8A 1SHVA 3M6HA 4B93A 5IHVA 5E2FA 1TS8A 2P74A 3UN7A 1YSPA 2VGLM 3SH7A 1NJ4A 1MBLA 4IJGA 2GZAA 5FATA 3BEBA 1SDNA 1SKOA 4O0PA 4ZTKA 1U60A 5HARA 2EFUA 2YKHA 1E4DA 1OTIA 5FA7A 3MS6A 2OLUA 2VLGA 2Z2MB 4N9LA 3P98A 1XA1A 3ZFZA 3H9WA 3IT9A 4LCLA 4OPRA 4F3LA 2FZ0A 4QY5A 2JC7A 4WZ4A 1GHIA 1XFNA 2WKRA 4E3KA 4MBFA 5FI6A 4PKYG 4R3AA 3IWQA 4JLFA 3PHYA 3CHWP 2Y2MA 4IBXA 2ZLYA 3OPRA 3FKVA 1D7EA 3KYQA 2JHEA 4GNUA 4E6WA 1SZVA 3C5AA 1YMXA 4CLCE 5EVID 5DFYA 4UQIS 2ZQCA 4DXCA 4X53A 5EVIA 5TBMA 1S6RA 1PZPA 5G4YA 1W8QA 2QPNA 3FPWA 3UB8A 1BZAA 1EWZA 2J3TC 4WLAA 5AVFA 1MXOA 4N92A 2G7UA 4LRZE 1Y54A 3DAVA 5AJGA 2VGKA 1YQSA 4HH3A 1VEUA 1TS7A 3S7OA 2PT7A 4DJ2A 2H10A 3OC2A 2IA2A 3HUNA 1O07A 4IUKA 4PPRA 5L10A 1P97A 4NK3A 4JF6A 4HBUA 1ONGA 4Q0HA 2Y2QA 1T18A 4R4RA 4Y0OA 3TRCA 2VGLS 2P9VA 2WGVA 4NG2A 5HAPA 4Y15A 4BD0A 2QHKA 1PFLA 1PW1A 4MCWA 1CI8A 4BBUA 3T1QB 3K3CA 2OLVA 2KX6A 5EPHA 3V50A 5CRFA 3JPUA 3FC7A 3KSIA 1L3LA 2LB5A 5F69A 3O88A 3OPPA 2EX9A 4P0MA 5DTSA 2J9OA 4CLCB 1I5QA 2PBDP 4K91A 3D72A 3PBTA 1P0ZA 5CHJA 1H8MA 1W7FA 3ZGAB 2J9PA 3ZCZA 5FASA 3M2KA 3WS1A 1NRJA 3IH8A 3HBRA 5A92A 2XGNA 1VHMA 4HP4A 4BENA 2IWCA 4GB7A 1H0MA 3R7WB 3UPNA 3DWKA 2ZC5B 4YNRA 3IHBA 4I3IA 4YWZA 4GW9A 1UWNX 2W0NA 4S2NC 4OH0A 4RYEA 1D1JA 4X6TA 2PR5A 3NHQA 4EBLA 1PWGA 2QYBA 1VETB 5L8MA 4Q8IA 4DXBA 2V8CA 2A2LA 1D06A 1GCEA 4M4XA 5EUAA 1DJBA 5MC7A 5DF9A 1NZUA 3S7PA 4R38A 3IWIA 5F82A 3JVVA 1TDLA 1T19A 2X71A 1L0FA 3NIAA 3CMZA 4KQQA 5D3OA 4KZAA 4ZBEA 4DDYA 4QB8A 4L9FA 3PTEA 1YLJA 3GDIA 4YFMA 1G6OA 4HNBA 3MZFA 1IKGA 2O9BA 3C4PA 3ZG8B 4LV2A 4BQMA 5HDSA 4NXEA 5GL9A 2IWBA 4GCZA 4BMWA 2R9XA 2ZOIA 4E3OA 3HJKA 3TOIA 2I72A 2WUQA 3MXQA 1AXBA 4G3WA 4HIAA 3G4PA 3IF5A 4MN7A 3W4OA 2JKGA 5FQMA 5AQ7A 4S2IA 3IQAA 1K38A 3RJUA 1GSVA 2EA9A 2CC1A 1S66L 2ZQ7A 5EM0A 5HL6A 2ZJ9A 3UO9A 2EX6A 3MXSA 4H6JA 3E4PA 2JKRI 3FZCA 3MMHA 4ZJ3A 3NDGA 2OOLA 1ZHHB 4DE3A 4WELA 4WF0A 4S2JA 4ZJ2A 4ETXA 1OMEA 3HLWA 3HLDA 1W79A 1GA0A 3BFEA 4EESA 3UMDA 4FTXA 1IYQA 3A3IA 3PAEA 4E04A 2H0TA 1ESIA 3KO6A 1F2KA 1TD5A 1PWDA 3CUEC 3ITAA 1YAXA 3ISGA 4E6XA 4WBGA 1N4OA 1HZOA 3ZG9B 3VOYA 3LR4A 2WK0A 4HHDA 2EX2A 1MWUA 2ZBBA 4ME4A 1XJ2A 4NETA 3ZG5A 3EQUA 3N8RA 5CHUA 2VA0A 1SCWA 3NC8A 2XFSA 2K7SA 2ZQ8A 3EGDC 2AVXA 4Q0JA 1CF0A 1OPXA 4P87A 2BASA 2Y2GA 3S7NA 1Z09A 3HCYA 1YT4A 3CLOA 2WYXA 2B95A 1E3UD 1KGGA 3F1PB 3T4SA 1XP4A 4HH2A 1AWIA 1F98A 2VZWA 1E3UA 2O9AA 4LRYC 1MC0A 5FQJA 3UDFA 2JBFA 4JGRA 4DRTA 3DTIA 1LSVA 1YSQA 5K5BA 1PZOA 4JXWA 1X0OA 3BY8A 1XJ6A 3IX8A 1S1YA 4OLDA 1L0EA 1ES4A 4Z1WA 3BYDA 2B02A 5CGSA 3VFHA 1OT9A 1K57A 5AQBA 3LIEA 4HY8A 2ZQDA 4PM6A 1YLZA 4HQAA 2DMWA 4E3LA 2Z2LB 3C30A 3CI6A 3DTEA 4X69A 3ICYA 3SOIA 3IF6A 3NCKA 2Y2PA 3GSGA 4GHIA 3WRTA 1OJGA 3GRJA 4BLMA 3UB6A 1F9IA 3LO7A 2J3WA 1J9MA 4KUOA 1XKZA 3N4IA 2JKFA 4O7DA 2OAQ1 4E3NA 4WMCA 4GZBA 2O0YA 2XF3A 4FH4A 3B47A 4MMNA 2YKFA 3EWKA 2WGIA 3Q82A 2C5WB 1Q2QA 1IKIA 2JKTI 4DE0A 1NZOA 2ZOHA 2XQZA 4JPMA 1ES2A 1P9WA 3SS4A 1KGFA 3S4XA 3KYZA 4X56A 5CX7A 2QJ7A 4HI4A 1OTBA 1W8YA 4N1XA 1BYWA 4WL9A 2HP5A 5E43A 1SKOB 1K57C 1RGYA 3LI8A 4XXRA 2CMNA 3N8SA 4OP5A 3BRMA 4NXFA 5CXWA 4P85A 5HZHA 4MBKA 4M3KA 3RXXA 4EQIA 1ACFA 5TR7A 2Z6CA 4F3LB 3D3OA 1CI9A 3G30A 3PBRA 1H8YA 2IWDA 3P7NA 5DTTA 2V0WA 4L9EA 3A3EA 4N1HA 1L0GA 4NKPA 3PXPA 3BFGA 2V1AA 3LIAA 4UEYA 2J3TD 4RX3A 3ITBA 3VV4A 4EWFA 5HPIA 2NUTC 1FIKA 3ZQ5A 1G6AA 3V3SA 1CEFA 2WAFA 3VP0A 1W5DA 5EVIB 5TBMB 1W63Q 2RL3A 5EVEA 2Y59A 3F1NB 3BLMA 3B33A 3D9YA 3T1SA 1QMEA 1VEUB 4ARZA 3WS4A 3BM6A 3IXBA 3Q81A 2XEPA 3BFCA 3Q07A 3WS0A 2B18A 4GKUA 2Y2JA 4GLQA 4Y13A 3EEAA 4B4XA 3VOZA 1TDGA 3LY3A 4NEED 2P9VB 5F5YA 3CJMA 5FEFA 3A0RA 4LFUA 4OLGA 4XT2A 1XJ3A 3A0SA 2W3DA 4HESA 1ODVA 1Y28A 4EV4A 2V20A 4JXVA 3I7JA 3EEHA 4OQ0A 5TFQA 3MJQA 4MN6A 3S7QA 2XD5A 2Y55A 1YLYA 4MN5A 2OSUA 5DKLA 3QNBA 1GHMA 3GTCA 4BBTA 2WADA 4G3KA 2XA7M 3HLCA 4EEPA 1K25A 1BUEA 1K4FA 1IYSA 5E2HA 3KYEA 4PAUA 3S1YA 4I39A 1NYMA 4GDBA 4L0LA 5I5LA 4DDSA 2J8YA 3V39A 4S2NA 1K54A 1BULA 2W27A 3CAXA 3IXDA 2PU4A 2OWHA 2WAEA 1DY6A 1BTLA 4GJ4A 2FFFB 2JKTM 1NXYA 4PMAA 1LLBA 2MJ6A 4OP8A 5HL1A 2QWSA 5FQKA 4OQHA 3IHAA 4HP9A 1RP5A 1CQAA 2Y4AA 2OWJA 2WGWA 4KENB 3T4TA 3BFFA 3HLBA 4PM9A 3JVUA 3H82A 4BBVA 1S1ZA 4C75A 3PBSA 3T1XA 2Y2OA 3VSKA 5AQ9A 4PHTA 1XPBA 3BWLA 3GR2A 4WM9A 1ERMA 4QPRA 2K31A 3E2LA 3E2KA 5FDSA 2OV5A 4C6YA 2V0UA 2WKEA 3Q7VA 3NECA 1PI5A 1V9ZA 4FD8A 5EFWA 3HLFA 5DF8A 1LL8A 4DN0A 2V8FA 2ZC7A 3G35A 2HGVA 1LI9A 1K54C 4K08A 3T4LA 1XXMA 3MF0A 5E2EA 4ZRRA 3R4KA 3MZEA 4FCFA 2M7VA 5HWWA 5L09A 3MQ0A 5HAQA 2HF6A 2XA7S 3D4FA 3GECA 4RVAA 2KLIA 4UA7A 1MWRA 3QP1A 4H6JB 3OCLA 4OVDA 2PBYA 4HBTA 4RA7A 3TSGA 1Q2PA 1GA9A 4I5SA 5DJUA 2VGJA 4P6ZM 4Y3IA 3CG5A 5DJTA 3C38A 5U47A 3KSFA 3T1RA 4I38A 1PWCA 1XGIA 5L2FA 1XJ4A 1MPLA 2I9VA 4X68A 1LL5A 2V2FF 3CUEA 3SS5A 2RCXA 1ZKJA 3ZYTA 5KIZA 1ES5A 5LBRA 3ZG0A 3RFBA 5KSHA 5J3WA 2W3HA 5F6AA 3VSLA 3T4OA 5GHZA 3O87A 3B42A 3OBFA 4Z9QA 1YLTA 4OQGA 2VV6A 1ZTUA 5DVAA 1N9OA 1N9BA 1NY0A 4BD1A 2L4RA 3EGXC 3V67A 3MFDA 2ZC3B 5IS1A 4OOMA 1IYOA 1WE4A 4ETZA 5EOEA 3EQVA 3NJAA 5FEGA 5HPFA 1FCOA 3UDIA 5HWVA 3LR5A 3RH8B 2INWA 2JE5A 1G68A 3Q1FA 1NYYA 3CWFA 5CGWA 4E3IA 3BJNA 4MNRA 2PU2A 3RTYA 5M19A 2ZL1A 2K2NA 3P01A 2O9CA 2Y91A 2A3UA 1QMFA 2VV7A 1N9LA 1I2SA 3ZVWA 5EV0A 5A93A 2PD7A 3V5MA 3W4QA 5EE8A 5FQ9A 1YLPA 2HDRA 1T1AA 2QJ5A 2HJEA 2W1TA 2Y2HA 5HSQA 3A3FA 1YLWA 1KE4A 5A90A 4CLCC 1OTAA 1VQQA 4P6ZS 5HD5A 3OCNA 3G31A 2HDSA 1T1BA 3IF6B 3IS2B 1EROA 4GHIB 2V1BA 4RQ9A 4UA9A 5F68A 3LUQA 2QMIA 2W1RA 4KG5A 4ID4A 4QHCA 3UB5P 1CJFA 4GD8A 4S2LA 3OZHA 2WZXA 4WZ5C 4UHUA 2BG1A 2ZQAA 1GSWA 4EXOA 4DJ3A 3MKEA 3WWXA 3NOPC 3H7WA 1TVFA 2W3EA 4I3JA 2V9AA 2HDQA 4WEJA 3F1OA 2PYRA 2PR6A 2XH9A 4IEDA 2VX8A 1JNUA 2JCHA 3G34A 4HJ3A 1LT0A 4KZ4A 4IUHA 5IU1A 1HTZA 1ES3A 3A3JA 3LI9A 1KOUA 4KZ6A 1ALQA 2Y2LA 4WEKA 1IEMA 3HL9A 1FILA 5E2GA 3LEZA 2WKQA 1K6RA 4HJ6A 3EOIA 3TJZC 4DE1A 2Q9NA 2Q0OA 3MQQA 1TEMA 1K56D 3PAGA 5FQIA 3ZVTA 2ZM2A 1K0KA 3E4QA 1FCMA 1MWTA 3ULFA 4OKPA 5I94A 5M18A 5KZHA 3AGFA 4U0TA 2M1CA 4KG6A 2VEAA 4O01A 4WYYA 1K56A 3B3XA 4LCMA 3LIBA 3MFXA 3FYZA 5GLAA 4DMZA 3T50A 4XUZA 5C5KA 1KVLA 1M6KA 4XUXA 3VE4A 1PRQA 4BL3A 3M6BA 2XFTA 4LLOB 3BQ8A 4FOFA 4E3MA 5EVLA 2NUPC 1I2WA 4EBNA 2ZMAA 4JF4A 1GSXA 2PD8A 4S2KA 5HFOA 1PW8A 2E8JA 2HP9A 1ERQA 4BWIA 3UE0A 1F5MA 4RX2A 1K55A 4GS9A 4ARZB 3MZDA 3S22A 4UAAA 2W3FA 1DRMA 1S0WA 2DCFA 2P04A 3OPLA 2JKRM 2XK1A 4KUKA 5DTKA 2ZM0A 2UV0E 5JYOA 2G2WA 1SDEA 1GHPA 3BY9A 4CQHA 1OT6A 1G5UA 4GDNA 3NI9A 4B4ZA 4EUZA 3QHYA 5AQAA 3A0VA 4KQRA 2LB9A 2ZMFA 3IWOA 1NLZA 3ZDJA 4IVIA 4XT2B 2A24A 1RGZA 4EBPA 3U4LP 3NY4A 1IYPA 2WKHA 3VE3A 3CPTA 3UNWA 4KQDA 1FSWA 4A5RA 3DTKA 3GQZA 3SW1A 3BFDA 1L2SA 3L7HA 1T1CA 3BQAA 3MXRA 4KG2A 3K3DA 2J80A 4AFIA 4B9OA 4LENA 4OPZA 3CZDA 1YM1A 4S2PA 4F94A 2PRFA 5HDCA 4OQIA 4ZJ1A 1TS0A 4S2MA 4JXSA 1K55C 3FG8A 3C7UA 4R3BA 3NDEA 1J3WA 5FL3A 4BJPA 3IBRA 2UWXA 3C8CA 3N6IA 2HV1A 4EQ1A 2Y2KA 2HP6A 1P9RA 5FAPA 4BL2A 3PYPA 3MQOA 3U2AA 1HD8A 5HWTA 1WA9A 4OOLA 4N9KA 1DJAA 2O99A 5DF7A 3NBLA 5DFXA 1NWZA 2WGWB 5KSCA 2D01A 4CPKA 3H82B 3HUOA 2BTFP 1C3BA 1LSWA 5GHYA 2G2UA 2QKPA 4H8RA 4O8GA 3QP5A 4I3AA 1RCJA 4KZBA 3L9KA 3P09A 1MKMA 1JTDA 1PI4A 3O5YA 1JVJA 1MKIA 3E0YA 4Y0UA 2EFXA 3IH9A 3ZG7B 3Q7VB 4U3TA 4EW7A 2XR0A 2H0YA 4LRXC 5IT5A 4Q0IA 4R70A 3E98A 1DP6A 5TJJA 3UY6A 2A49A 2M7UA 3UE3A 3VFFA 2QZ6A 3WS2A 1ONHA 4HOIA 3F1NA 3FWLA 1DP9A 2VKSA 5HW3A 2GX5A 1NLYA 4NXGA 4ZDXA 4PKYA 2Y2IA 1STZA 2PHYA 4D2OA 1Y4OA 3FV7A 2ACGA 4QU3A 3IX4A 2V1ZA 4KZ5A 5G4ZA 4R23A 3K2NA 5GHXA 3TW8A 3KSHA 3LR0A 1JWVA 1IELA 2VJWA 4QJGA 1PIOA 3PBNA 2DNSA 2C6WB 4GN2A 4MLLA 3BW6A 2GJ3A 3W2ZA 5HD3A 4PM7A 3ZNYA 4R4SA 2X01A 4ZAMA 2W3GA 1G28A 4MDZA 5FI7A 3UPPA 2XRNA 2EXBA 3FKWA 5EOOA 3OLOA 2XLNA 3HJIA 3VOLA 2WKIA 1L0DA 4OOYA 3DW0A 3UMEA 4JGPA 5EVIC 5FQQA 5CEBA 1LL9A 2JN7A 4R0QA 1LHYA 1N9NA 2R9WA 1S67L 2ZC6B 3LIDA 3IXGA 4LGWA 3QNCA 3OPHA 3SH9A 3M2JA 2XDMA 5KMWA 4KZ9A 3G32A 1KDWA 2VK3A 4KQOA 4PM8A 5J7EA 2L1MA 1LSXA 4S2OA 4MEZA 2Y2NA 2DRWA 1KDSA 3LFVA 1KE0A 3LYXA 4EEUA 5GLDA 3TE8A 2ZL1B 3IXHA 5FAQA 1K6SA 3VP3A 3MBZA 4R3JA 4Y2FA 5CTMA 2PYPA 1OTDA 4CLCD 3W4PA 1JWPA 1JTGA 1K4EA 3V3RA 4G3VA 4NXBA 1MZUA 1Z6FA 1V9YA 4Y7PA 4IBRA 3W8KA 4CLCA 1TF1A 1UGUA 2P08A 2W1TB 1YMSA 3ZNTA 1EI5A 4R1GA 3DBAA 3UE1A 1E25A 4WN5A 3WS5A 1BLHA 3R7WA 3G2ZA 1SKFA 3LICA 2J7VA 4PM5A 4JBFA 1TS6A 2EX8A 2HPBA 3KX0X 3Q7ZA 3LY4A 4OPYA 4HEFA 3SZTA 4WZ5A 5A8BA 3NULA 4YINA 5F83A 2EWWA 1VB6A 1XGJA 3GV9A 1VETA 3C7VA 3GMWA 5FSRA 3UB9A 2VV8A 3VMAA 3G6OA 5CTNA 1IFQA 1IOUA 4JGQA 4EETB 4EERA 3H7WB 2HJ9C 5EECA 4K0WA 3IX3A 4ESPA 3NOUC 3F1OB 3G2YA 5HAIA 4X25A 2ZC4B 4UA6A 3T4JA 3PBOA 1MY8A 4CJNA 3PR6A 3HUMA 4JKTA 4EU0A 1WYCA 4C3QA 1KE3A 2X02A 1FQGA 5G18A 4LV0A 2H5SA 4LV1A 1H8ZA 1UWPX 1HVBA 3C2WA 3UB7A 4II7A 3HVFA 4IVKA 4B88A 3AGEA 3T4QA 1EW0A 4KZ7A 5CHMA 4P6BA 2OAP1 5M1AA 5EM1A 2Y8HA 4JGOA 3O3VA 4YOFA 3RXWA 1W63M 3QP4A 3N8LA 3CITA 5AVEA 2P7JA 5CECA 4Y0TA 1XX2A 2BLSA 2KDKA 2ZQ9A 5BOHA 1XFQA 4EUVA 3TG9A 4GD6A 1BSGA 3DTMA 2PAVP 3VP4A 3E4OA 4E3JA 3T4KA 2H28A 3VP2A 3OOVA 1FR1A 4OONA 4KZ8A 1HLUP 5FI2A 3BLSA 2PDRA 1S4RA 3C4OA 1S4SA 2E8IA 1FCNA 5GLBA 4GS9B 4HJ4A 3KSGA 3MKFA 4U0XA 3LEQA 2GDNA 2HZ5A 2R78A 1FSYA 3LR3A 1VM1A 2EXAA 3WRZA 3HREA 4IHQA 1ZG4A 2FH5A 1DP8A 1MWSA 1BT5A 3SS3A 3HLGA 4X1MA 1PYYA 1BLSA 3IS2A 4R6LA 1ZC2A 5CERA 2XD1A 2D02A 1H3QA 2ZMVA 5CGXA 5CEDA 2A24B 1LI0A 2Y79A 4X55A 1CK3A 1JWZA 4K0XA 3FPVA 2KOIA 3A3DA 5A91A 4OPQA 3UPOA 5HDDA 2WKPA 3HLEA 2EWVA 4FSFA 3CPTB 3F1PA 4WMCD 2ZM8A 3T12B 1BLPA 3UDXA 5JYPA 2Z6DA 4Y17A 2WZZA 3AGDA 5DKKA 4FUWA 4L9GA 3SH8A 2GNXA 3QP2A 4FH2A 1CEGA 5GLCA 1M40A 4D60A 5HX9A 1YPRA 4MBHA 1WYBA 4DF6A 3IBJA 1ZG6A 5J4EA 1O7EA 5FDHA 3LCEA 1DJCA 1FR6A 1YKDA 4JF5A 5L07A 1BLCA 5TGFA 1KGEA 5F1GA 1PNEA 2HDUA 4QY6A 3NOTC 4Y5FA 3VP1A 3ZHHA 4GOGA 3MSHA 3LGOA 3O86A 3UE6A 3N7WA 4UQIM 3IF6C 2FFYA 4X1LA 4WUJA 4LV3A 1XA7A 1A0KA 3LIFA 4DE2A 1OJ5A 4QWOA 5J8XA 3QP6A 3DWZA 2B5RA 4JXGA 4KZ3A 3JYIA 1OTEA 1NRFA 3MR0A 5FAOA 3QP8A 2L0WA 4DKIA 2XROA 4QD4A 3BECA 5F1FA
chains in the Genus database with same CATH topology
4HY8A 4HQAA 4OOMA 2DMWA 2XSSA 3PBQA 4LPZA 4ETZA 3C30A 3CI6A 2VJWA 3EQVA 3NJAA 3ICYA 3PBNA 4B93A 3BW6A 2GJ3A 3W2ZA 5HPFA 1TS8A 5HD3A 5HWVA 3LR5A 1YSPA 2INWA 2W3GA 3RH8B 2VGLM 1G28A 3CWFA 4MDZA 2XRNA 3BJNA 4GHIA 4IJGA 2GZAA 3V67A 1OJGA 4O0PA 3UB6A 3RTYA 1F9IA 2YKHA 3OLOA 2K2NA 3P01A 3HJIA 2O9CA 3VOLA 2J3WA 1OTIA 2VLGA 2VV7A 3UMEA 1N9LA 4KUOA 4JGPA 2OAQ1 2PD7A 3H9WA 2JN7A 4F3LA 2O0YA 1N9NA 2FZ0A 1S67L 3LIDA 3B47A 1XFNA 2WKRA 2YKFA 4MMNA 3EWKA 4PKYG 4R3AA 1T1AA 2QJ5A 2JKTI 2HJEA 2W1TA 5HSQA 3PHYA 2ZOHA 4CLCC 4KQOA 1OTAA 1P9WA 4P6ZS 5HD5A 5J7EA 3OCNA 1D7EA 3KYQA 3KYZA 2L1MA 1LSXA 5CX7A 2JHEA 2QJ7A 1T1BA 3IS2B 4HI4A 1OTBA 1BYWA 4GHIB 4CLCE 2V1BA 4WL9A 3LFVA 5DFYA 4RQ9A 3LYXA 4UQIS 5F68A 3LUQA 4EEUA 3LI8A 2CMNA 3TE8A 5TBMA 2W1RA 4NXFA 5G4YA 4Y2FA 5HZHA 3FPWA 3UB8A 2J3TC 4WLAA 2PYPA 1OTDA 5AVFA 2G7UA 4LRZE 5AJGA 4CLCD 2Z6CA 4HH3A 4F3LB 3D3OA 1GSWA 4G3VA 4NXBA 1TS7A 1MZUA 3S7OA 1V9YA 4EXOA 2PT7A 4DJ3A 3PBRA 4DJ2A 3NOPC 3OC2A 4CLCA 1TF1A 2IA2A 3P7NA 1UGUA 2P08A 2W1TB 3H7WA 4IUKA 2V0WA 2W3EA 4I3JA 1P97A 2V9AA 4L9EA 4WEJA 3DBAA 3F1OA 2PYRA 2PR6A 4NKPA 4Q0HA 2VX8A 1JNUA 3PXPA 4WN5A 1T18A 4HJ3A 3TRCA 1LT0A 2V1AA 3LIAA 2VGLS 4UEYA 3R7WA 2J3TD 4IUHA 3VV4A 3LICA 5IU1A 2NUTC 5HPIA 3ZQ5A 1TS6A 2QHKA 3LI9A 1KOUA 3KX0X 4WEKA 4MCWA 5TBMB 4BBUA 5A8BA 3K3CA 1W63Q 2KX6A 2WKQA 4HJ6A 2EWWA 1VB6A 3F1NB 3EOIA 3TJZC 3FC7A 3KSIA 2LB5A 3B33A 5F69A 3UB9A 2VV8A 3MQQA 4ARZA 3G6OA 3E4QA 3ULFA 1IFQA 1IOUA 4CLCB 4JGQA 4EETB 4EERA 2M1CA 2VEAA 3D72A 3H7WB 2HJ9C 4O01A 3PBTA 1P0ZA 1H8MA 3LIBA 3MFXA 3NOUC 3F1OB 2B18A 1NRJA 4DMZA 4GLQA 3T50A 5C5KA 3EEAA 1VHMA 3T4JA 4HP4A 3PBOA 4NEED 3PR6A 3VE4A 3R7WB 4EU0A 5F5YA 3A0RA 4XT2A 1XJ3A 3A0SA 4I3IA 2W3DA 4GW9A 4YNRA 4YWZA 1ODVA 1UWPX 1Y28A 4LLOB 1UWNX 2W0NA 3C2WA 3BQ8A 4FOFA 3UB7A 2NUPC 4II7A 1GSXA 2PD8A 3EEHA 3MJQA 4MN6A 3T4QA 3S7QA 2PR5A 1EW0A 3NHQA 4BWIA 2QYBA 2OAP1 5L8MA 2Y8HA 4JGOA 1F5MA 2A2LA 4MN5A 4YOFA 4GS9A 4ARZB 1D06A 1W63M 2W3FA 1DRMA 2P04A 5DKLA 4M4XA 2JKRM 4KUKA 5MC7A 3CITA 5DF9A 4BBTA 5AVEA 4G3KA 3S7PA 2P7JA 2XA7M 2KDKA 4R38A 4EEPA 3JVVA 1T19A 3BY9A 4CQHA 1OT6A 4PAUA 1XFQA 4EUVA 4I39A 4L0LA 5I5LA 3A0VA 2LB9A 2ZMFA 3E4OA 1NLZA 2W27A 3CAXA 4L9FA 4XT2B 3T4KA 2A24A 2H28A 3OOVA 2OWHA 3GDIA 1G6OA 4HNBA 2O9BA 4GJ4A 5HDSA 2JKTM 4NXEA 3VE3A 4GCZA 4BMWA 4KQDA 2PDRA 1S4RA 2ZOIA 1S4SA 2MJ6A 3HJKA 2QWSA 4GS9B 4HJ4A 3KSGA 3SW1A 3MXQA 1T1CA 4HP9A 4G3WA 4HIAA 3BQAA 2OWJA 4MN7A 3T4TA 2R78A 3JVUA 3H82A 3K3DA 2J80A 3LR3A 4AFIA 4BBVA 1GSVA 1S1ZA 2EA9A 4B9OA 1S66L 3PBSA 4IHQA 2FH5A 5HL6A 1DP8A 4PHTA 5HDCA 3BWLA 4H6JA 1TS0A 3E4PA 3IS2A 3FG8A 4QPRA 2JKRI 2K31A 3MMHA 4R6LA 2D02A 1H3QA 2ZMVA 2OOLA 1ZHHB 5FL3A 2A24B 2V0UA 4WELA 2Y79A 4WF0A 4BJPA 3IBRA 4ETXA 3C8CA 3FPVA 2HV1A 2KOIA 4EQ1A 1P9RA 1V9ZA 5EFWA 3PYPA 5HDDA 3MQOA 2WKPA 1LL8A 4EESA 2EWVA 4DN0A 3UMDA 4FSFA 3F1PA 3U2AA 5HWTA 1WA9A 4OOLA 2Z6DA 4E04A 2O99A 5DKKA 3KO6A 2HGVA 4L9GA 1TD5A 2GNXA 5DFXA 1NWZA 4K08A 2D01A 3CUEC 3T4LA 3MF0A 1YAXA 4ZRRA 3H82B 3R4KA 1LSWA 2M7VA 5HWWA 2QKPA 3MQ0A 2HF6A 2XA7S 3IBJA 3LR4A 4O8GA 4HHDA 5J4EA 2ZBBA 3GECA 4ME4A 4I3AA 2KLIA 1XJ2A 3EQUA 4H6JB 1MKMA 3OCLA 3O5YA 2VA0A 3E0YA 1YKDA 2K7SA 3EGDC 4Q0JA 1OPXA 2BASA 5DJUA 4I5SA 4EW7A 4P6ZM 4Y3IA 3S7NA 4LRXC 5IT5A 3NOTC 3HCYA 5DJTA 3C38A 4Q0IA 3KSFA 4Y5FA 3CLOA 4I38A 4R70A 3E98A 3T4SA 1DP6A 3F1PB 5TJJA 2M7UA 4HH2A 1XJ4A 3UE3A 3UE6A 2I9VA 1F98A 4UQIM 3CUEA 4HOIA 3F1NA 2VZWA 3ZYTA 5KIZA 2O9AA 4LRYC 4WUJA 5LBRA 1DP9A 1MC0A 2VKSA 3RFBA 2GX5A 5KSHA 5J3WA 1NLYA 4NXGA 2W3HA 4JGRA 3LIFA 4PKYA 5F6AA 1LSVA 1OJ5A 1YSQA 1STZA 3T4OA 5K5BA 2PHYA 1X0OA 3B42A 3BY8A 1XJ6A 3OBFA 1S1YA 2VV6A 5G4ZA 1ZTUA 1OTEA 3K2NA 3MR0A 4Z1WA 2B02A 1N9OA 2L0WA 3TW8A 3KSHA 1OT9A 3LR0A 2L4RA 2XROA 3EGXC 3LIEA 5IS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HY8 A;  4HQA A;  4LPZ A;  3NJA A;  3ICY A;  2GJ3 A;  1TS8 A;  5HD3 A;  5HWV A;  3RH8 B;  2INW A;  1G28 A;  3CWF A;  4GHI A;  1OJG A;  3UB6 A;  3RTY A;  1F9I A;  2YKH A;  3OLO A;  3HJI A;  3VOL A;  1OTI A;  2VLG A;  2VV7 A;  3UME A;  1N9L A;  4KUO A;  4JGP A;  2PD7 A;  3H9W A;  2JN7 A;  4F3L A;  1N9N A;  1S67 L;  3LID A;  1XFN A;  2WKR A;  2YKF A;  3EWK A;  4PKY G;  4R3A A;  1T1A A;  2QJ5 A;  5HSQ A;  3PHY A;  2ZOH A;  1OTA A;  5HD5 A;  5J7E A;  1D7E A;  2L1M A;  1LSX A;  2JHE A;  2QJ7 A;  1T1B A;  3IS2 B;  4HI4 A;  1OTB A;  1BYW A;  4GHI B;  2V1B A;  4WL9 A;  4RQ9 A;  3LYX A;  5F68 A;  3LUQ A;  4EEU A;  3LI8 A;  2CMN A;  5TBM A;  4NXF A;  5G4Y A;  5HZH A;  3UB8 A;  4WLA A;  2PYP A;  1OTD A;  5AVF A;  4LRZ E;  2Z6C A;  4HH3 A;  4F3L B;  1GSW A;  4NXB A;  1TS7 A;  1MZU A;  1V9Y A;  4EXO A;  4DJ3 A;  4DJ2 A;  3NOP C;  3P7N A;  1UGU A;  3H7W A;  2V0W A;  4I3J A;  1P97 A;  2V9A A;  4L9E A;  3F1O A;  2PYR A;  2PR6 A;  1JNU A;  4WN5 A;  1T18 A;  4HJ3 A;  1LT0 A;  2V1A A;  3LIA A;  3LIC A;  5IU1 A;  3ZQ5 A;  1TS6 A;  2QHK A;  3LI9 A;  1KOU A;  3KX0 X;  5TBM B;  4BBU A;  5A8B A;  3K3C A;  2KX6 A;  2WKQ A;  4HJ6 A;  1VB6 A;  3F1N B;  3FC7 A;  3B33 A;  5F69 A;  3UB9 A;  2VV8 A;  3MQQ A;  3G6O A;  3E4Q A;  3ULF A;  4JGQ A;  4EET B;  4EER A;  2M1C A;  2VEA A;  3D72 A;  3H7W B;  1P0Z A;  3LIB A;  3MFX A;  3NOU C;  3F1O B;  3T50 A;  4HP4 A;  3VE4 A;  5F5Y A;  3A0R A;  4XT2 A;  1XJ3 A;  3A0S A;  4I3I A;  4YWZ A;  4GW9 A;  1ODV A;  1UWP X;  1Y28 A;  4LLO B;  1UWN X;  2W0N A;  3C2W A;  3UB7 A;  1GSX A;  2PD8 A;  3EEH A;  3MJQ A;  4MN6 A;  2PR5 A;  1EW0 A;  3NHQ A;  4JGO A;  4MN5 A;  4GS9 A;  1D06 A;  1DRM A;  5DKL A;  4M4X A;  4KUK A;  4BBT A;  5AVE A;  2P7J A;  2KDK A;  4R38 A;  4EEP A;  1T19 A;  3BY9 A;  1OT6 A;  1XFQ A;  4I39 A;  5I5L A;  3A0V A;  3E4O A;  2W27 A;  3CAX A;  4L9F A;  4XT2 B;  2A24 A;  2H28 A;  2OWH A;  3GDI A;  4HNB A;  5HDS A;  4NXE A;  3VE3 A;  4GCZ A;  4KQD A;  2PDR A;  1S4R A;  2ZOI A;  1S4S A;  3HJK A;  2QWS A;  4GS9 B;  4HJ4 A;  3SW1 A;  3MXQ A;  1T1C A;  4HP9 A;  4HIA A;  2OWJ A;  2R78 A;  3H82 A;  3K3D A;  2J80 A;  4BBV A;  1GSV A;  2EA9 A;  1S1Z A;  4B9O A;  1S66 L;  1DP8 A;  5HDC A;  3BWL A;  4H6J A;  1TS0 A;  3E4P A;  3IS2 A;  3FG8 A;  4R6L A;  2D02 A;  2OOL A;  2A24 B;  2V0U A;  4WF0 A;  3IBR A;  3C8C A;  2HV1 A;  4EQ1 A;  1V9Z A;  5EFW A;  3PYP A;  5HDD A;  3MQO A;  2WKP A;  1LL8 A;  4EES A;  3UMD A;  3F1P A;  5HWT A;  1WA9 A;  2Z6D A;  4E04 A;  5DKK A;  4L9G A;  1NWZ A;  4K08 A;  2D01 A;  3H82 B;  1LSW A;  5HWW A;  2QKP A;  4HHD A;  5J4E A;  2ZBB A;  3GEC A;  4I3A A;  1XJ2 A;  4H6J B;  2K7S A;  2BAS A;  5DJU A;  4I5S A;  4EW7 A;  4LRX C;  3NOT C;  5DJT A;  3CLO A;  4I38 A;  4R70 A;  1DP6 A;  3F1P B;  4HH2 A;  1XJ4 A;  3UE6 A;  2I9V A;  1F98 A;  4HOI A;  3F1N A;  5KIZ A;  4LRY C;  4WUJ A;  1DP9 A;  5J3W A;  4NXG A;  4JGR A;  3LIF A;  4PKY A;  5F6A A;  1LSV A;  1OJ5 A;  2PHY A;  1X0O A;  3BY8 A;  1XJ6 A;  1S1Y A;  2VV6 A;  5G4Z A;  1OTE A;  3MR0 A;  2B02 A;  1N9O A;  2L0W A;  1OT9 A;  2L4R A;  3LIE A;  5IS1 A; 
#chains in the Genus database with same CATH topology
 1ESU A;  1KVM A;  3GVB A;  2Q9M A;  2XSS A;  1H5X A;  1FOF A;  3PBQ A;  4LPZ A;  2ZD8 A;  1SHV A;  3M6H A;  4B93 A;  5IHV A;  5E2F A;  1TS8 A;  2P74 A;  3UN7 A;  1YSP A;  2VGL M;  3SH7 A;  1NJ4 A;  1MBL A;  4IJG A;  2GZA A;  5FAT A;  3BEB A;  1SDN A;  1SKO A;  4O0P A;  4ZTK A;  1U60 A;  5HAR A;  2EFU A;  2YKH A;  1E4D A;  1OTI A;  5FA7 A;  3MS6 A;  2OLU A;  2VLG A;  2Z2M B;  4N9L A;  3P98 A;  1XA1 A;  3ZFZ A;  3H9W A;  3IT9 A;  4LCL A;  4OPR A;  4F3L A;  2FZ0 A;  4QY5 A;  2JC7 A;  4WZ4 A;  1GHI A;  1XFN A;  2WKR A;  4E3K A;  4MBF A;  5FI6 A;  4PKY G;  4R3A A;  3IWQ A;  4JLF A;  3PHY A;  3CHW P;  2Y2M A;  4IBX A;  2ZLY A;  3OPR A;  3FKV A;  1D7E A;  3KYQ A;  2JHE A;  4GNU A;  4E6W A;  1SZV A;  3C5A A;  1YMX A;  4CLC E;  5EVI D;  5DFY A;  4UQI S;  2ZQC A;  4DXC A;  4X53 A;  5EVI A;  5TBM A;  1S6R A;  1PZP A;  5G4Y A;  1W8Q A;  2QPN A;  3FPW A;  3UB8 A;  1BZA A;  1EWZ A;  2J3T C;  4WLA A;  5AVF A;  1MXO A;  4N92 A;  2G7U A;  4LRZ E;  1Y54 A;  3DAV A;  5AJG A;  2VGK A;  1YQS A;  4HH3 A;  1VEU A;  1TS7 A;  3S7O A;  2PT7 A;  4DJ2 A;  2H10 A;  3OC2 A;  2IA2 A;  3HUN A;  1O07 A;  4IUK A;  4PPR A;  5L10 A;  1P97 A;  4NK3 A;  4JF6 A;  4HBU A;  1ONG A;  4Q0H A;  2Y2Q A;  1T18 A;  4R4R A;  4Y0O A;  3TRC A;  2VGL S;  2P9V A;  2WGV A;  4NG2 A;  5HAP A;  4Y15 A;  4BD0 A;  2QHK A;  1PFL A;  1PW1 A;  4MCW A;  1CI8 A;  4BBU A;  3T1Q B;  3K3C A;  2OLV A;  2KX6 A;  5EPH A;  3V50 A;  5CRF A;  3JPU A;  3FC7 A;  3KSI A;  1L3L A;  2LB5 A;  5F69 A;  3O88 A;  3OPP A;  2EX9 A;  4P0M A;  5DTS A;  2J9O A;  4CLC B;  1I5Q A;  2PBD P;  4K91 A;  3D72 A;  3PBT A;  1P0Z A;  5CHJ A;  1H8M A;  1W7F A;  3ZGA B;  2J9P A;  3ZCZ A;  5FAS A;  3M2K A;  3WS1 A;  1NRJ A;  3IH8 A;  3HBR A;  5A92 A;  2XGN A;  1VHM A;  4HP4 A;  4BEN A;  2IWC A;  4GB7 A;  1H0M A;  3R7W B;  3UPN A;  3DWK A;  2ZC5 B;  4YNR A;  3IHB A;  4I3I A;  4YWZ A;  4GW9 A;  1UWN X;  2W0N A;  4S2N C;  4OH0 A;  4RYE A;  1D1J A;  4X6T A;  2PR5 A;  3NHQ A;  4EBL A;  1PWG A;  2QYB A;  1VET B;  5L8M A;  4Q8I A;  4DXB A;  2V8C A;  2A2L A;  1D06 A;  1GCE A;  4M4X A;  5EUA A;  1DJB A;  5MC7 A;  5DF9 A;  1NZU A;  3S7P A;  4R38 A;  3IWI A;  5F82 A;  3JVV A;  1TDL A;  1T19 A;  2X71 A;  1L0F A;  3NIA A;  3CMZ A;  4KQQ A;  5D3O A;  4KZA A;  4ZBE A;  4DDY A;  4QB8 A;  4L9F A;  3PTE A;  1YLJ A;  3GDI A;  4YFM A;  1G6O A;  4HNB A;  3MZF A;  1IKG A;  2O9B A;  3C4P A;  3ZG8 B;  4LV2 A;  4BQM A;  5HDS A;  4NXE A;  5GL9 A;  2IWB A;  4GCZ A;  4BMW A;  2R9X A;  2ZOI A;  4E3O A;  3HJK A;  3TOI A;  2I72 A;  2WUQ A;  3MXQ A;  1AXB A;  4G3W A;  4HIA A;  3G4P A;  3IF5 A;  4MN7 A;  3W4O A;  2JKG A;  5FQM A;  5AQ7 A;  4S2I A;  3IQA A;  1K38 A;  3RJU A;  1GSV A;  2EA9 A;  2CC1 A;  1S66 L;  2ZQ7 A;  5EM0 A;  5HL6 A;  2ZJ9 A;  3UO9 A;  2EX6 A;  3MXS A;  4H6J A;  3E4P A;  2JKR I;  3FZC A;  3MMH A;  4ZJ3 A;  3NDG A;  2OOL A;  1ZHH B;  4DE3 A;  4WEL A;  4WF0 A;  4S2J A;  4ZJ2 A;  4ETX A;  1OME A;  3HLW A;  3HLD A;  1W79 A;  1GA0 A;  3BFE A;  4EES A;  3UMD A;  4FTX A;  1IYQ A;  3A3I A;  3PAE A;  4E04 A;  2H0T A;  1ESI A;  3KO6 A;  1F2K A;  1TD5 A;  1PWD A;  3CUE C;  3ITA A;  1YAX A;  3ISG A;  4E6X A;  4WBG A;  1N4O A;  1HZO A;  3ZG9 B;  3VOY A;  3LR4 A;  2WK0 A;  4HHD A;  2EX2 A;  1MWU A;  2ZBB A;  4ME4 A;  1XJ2 A;  4NET A;  3ZG5 A;  3EQU A;  3N8R A;  5CHU A;  2VA0 A;  1SCW A;  3NC8 A;  2XFS A;  2K7S A;  2ZQ8 A;  3EGD C;  2AVX A;  4Q0J A;  1CF0 A;  1OPX A;  4P87 A;  2BAS A;  2Y2G A;  3S7N A;  1Z09 A;  3HCY A;  1YT4 A;  3CLO A;  2WYX A;  2B95 A;  1E3U D;  1KGG A;  3F1P B;  3T4S A;  1XP4 A;  4HH2 A;  1AWI A;  1F98 A;  2VZW A;  1E3U A;  2O9A A;  4LRY C;  1MC0 A;  5FQJ A;  3UDF A;  2JBF A;  4JGR A;  4DRT A;  3DTI A;  1LSV A;  1YSQ A;  5K5B A;  1PZO A;  4JXW A;  1X0O A;  3BY8 A;  1XJ6 A;  3IX8 A;  1S1Y A;  4OLD A;  1L0E A;  1ES4 A;  4Z1W A;  3BYD A;  2B02 A;  5CGS A;  3VFH A;  1OT9 A;  1K57 A;  5AQB A;  3LIE A;  4HY8 A;  2ZQD A;  4PM6 A;  1YLZ A;  4HQA A;  2DMW A;  4E3L A;  2Z2L B;  3C30 A;  3CI6 A;  3DTE A;  4X69 A;  3ICY A;  3SOI A;  3IF6 A;  3NCK A;  2Y2P A;  3GSG A;  4GHI A;  3WRT A;  1OJG A;  3GRJ A;  4BLM A;  3UB6 A;  1F9I A;  3LO7 A;  2J3W A;  1J9M A;  4KUO A;  1XKZ A;  3N4I A;  2JKF A;  4O7D A;  2OAQ 1;  4E3N A;  4WMC A;  4GZB A;  2O0Y A;  2XF3 A;  4FH4 A;  3B47 A;  4MMN A;  2YKF A;  3EWK A;  2WGI A;  3Q82 A;  2C5W B;  1Q2Q A;  1IKI A;  2JKT I;  4DE0 A;  1NZO A;  2ZOH A;  2XQZ A;  4JPM A;  1ES2 A;  1P9W A;  3SS4 A;  1KGF A;  3S4X A;  3KYZ A;  4X56 A;  5CX7 A;  2QJ7 A;  4HI4 A;  1OTB A;  1W8Y A;  4N1X A;  1BYW A;  4WL9 A;  2HP5 A;  5E43 A;  1SKO B;  1K57 C;  1RGY A;  3LI8 A;  4XXR A;  2CMN A;  3N8S A;  4OP5 A;  3BRM A;  4NXF A;  5CXW A;  4P85 A;  5HZH A;  4MBK A;  4M3K A;  3RXX A;  4EQI A;  1ACF A;  5TR7 A;  2Z6C A;  4F3L B;  3D3O A;  1CI9 A;  3G30 A;  3PBR A;  1H8Y A;  2IWD A;  3P7N A;  5DTT A;  2V0W A;  4L9E A;  3A3E A;  4N1H A;  1L0G A;  4NKP A;  3PXP A;  3BFG A;  2V1A A;  3LIA A;  4UEY A;  2J3T D;  4RX3 A;  3ITB A;  3VV4 A;  4EWF A;  5HPI A;  2NUT C;  1FIK A;  3ZQ5 A;  1G6A A;  3V3S A;  1CEF A;  2WAF A;  3VP0 A;  1W5D A;  5EVI B;  5TBM B;  1W63 Q;  2RL3 A;  5EVE A;  2Y59 A;  3F1N B;  3BLM A;  3B33 A;  3D9Y A;  3T1S A;  1QME A;  1VEU B;  4ARZ A;  3WS4 A;  3BM6 A;  3IXB A;  3Q81 A;  2XEP A;  3BFC A;  3Q07 A;  3WS0 A;  2B18 A;  4GKU A;  2Y2J A;  4GLQ A;  4Y13 A;  3EEA A;  4B4X A;  3VOZ A;  1TDG A;  3LY3 A;  4NEE D;  2P9V B;  5F5Y A;  3CJM A;  5FEF A;  3A0R A;  4LFU A;  4OLG A;  4XT2 A;  1XJ3 A;  3A0S A;  2W3D A;  4HES A;  1ODV A;  1Y28 A;  4EV4 A;  2V20 A;  4JXV A;  3I7J A;  3EEH A;  4OQ0 A;  5TFQ A;  3MJQ A;  4MN6 A;  3S7Q A;  2XD5 A;  2Y55 A;  1YLY A;  4MN5 A;  2OSU A;  5DKL A;  3QNB A;  1GHM A;  3GTC A;  4BBT A;  2WAD A;  4G3K A;  2XA7 M;  3HLC A;  4EEP A;  1K25 A;  1BUE A;  1K4F A;  1IYS A;  5E2H A;  3KYE A;  4PAU A;  3S1Y A;  4I39 A;  1NYM A;  4GDB A;  4L0L A;  5I5L A;  4DDS A;  2J8Y A;  3V39 A;  4S2N A;  1K54 A;  1BUL A;  2W27 A;  3CAX A;  3IXD A;  2PU4 A;  2OWH A;  2WAE A;  1DY6 A;  1BTL A;  4GJ4 A;  2FFF B;  2JKT M;  1NXY A;  4PMA A;  1LLB A;  2MJ6 A;  4OP8 A;  5HL1 A;  2QWS A;  5FQK A;  4OQH A;  3IHA A;  4HP9 A;  1RP5 A;  1CQA A;  2Y4A A;  2OWJ A;  2WGW A;  4KEN B;  3T4T A;  3BFF A;  3HLB A;  4PM9 A;  3JVU A;  3H82 A;  4BBV A;  1S1Z A;  4C75 A;  3PBS A;  3T1X A;  2Y2O A;  3VSK A;  5AQ9 A;  4PHT A;  1XPB A;  3BWL A;  3GR2 A;  4WM9 A;  1ERM A;  4QPR A;  2K31 A;  3E2L A;  3E2K A;  5FDS A;  2OV5 A;  4C6Y A;  2V0U A;  2WKE A;  3Q7V A;  3NEC A;  1PI5 A;  1V9Z A;  4FD8 A;  5EFW A;  3HLF A;  5DF8 A;  1LL8 A;  4DN0 A;  2V8F A;  2ZC7 A;  3G35 A;  2HGV A;  1LI9 A;  1K54 C;  4K08 A;  3T4L A;  1XXM A;  3MF0 A;  5E2E A;  4ZRR A;  3R4K A;  3MZE A;  4FCF A;  2M7V A;  5HWW A;  5L09 A;  3MQ0 A;  5HAQ A;  2HF6 A;  2XA7 S;  3D4F A;  3GEC A;  4RVA A;  2KLI A;  4UA7 A;  1MWR A;  3QP1 A;  4H6J B;  3OCL A;  4OVD A;  2PBY A;  4HBT A;  4RA7 A;  3TSG A;  1Q2P A;  1GA9 A;  4I5S A;  5DJU A;  2VGJ A;  4P6Z M;  4Y3I A;  3CG5 A;  5DJT A;  3C38 A;  5U47 A;  3KSF A;  3T1R A;  4I38 A;  1PWC A;  1XGI A;  5L2F A;  1XJ4 A;  1MPL A;  2I9V A;  4X68 A;  1LL5 A;  2V2F F;  3CUE A;  3SS5 A;  2RCX A;  1ZKJ A;  3ZYT A;  5KIZ A;  1ES5 A;  5LBR A;  3ZG0 A;  3RFB A;  5KSH A;  5J3W A;  2W3H A;  5F6A A;  3VSL A;  3T4O A;  5GHZ A;  3O87 A;  3B42 A;  3OBF A;  4Z9Q A;  1YLT A;  4OQG A;  2VV6 A;  1ZTU A;  5DVA A;  1N9O A;  1N9B A;  1NY0 A;  4BD1 A;  2L4R A;  3EGX C;  3V67 A;  3MFD A;  2ZC3 B;  5IS1 A;  4OOM A;  1IYO A;  1WE4 A;  4ETZ A;  5EOE A;  3EQV A;  3NJA A;  5FEG A;  5HPF A;  1FCO A;  3UDI A;  5HWV A;  3LR5 A;  3RH8 B;  2INW A;  2JE5 A;  1G68 A;  3Q1F A;  1NYY A;  3CWF A;  5CGW A;  4E3I A;  3BJN A;  4MNR A;  2PU2 A;  3RTY A;  5M19 A;  2ZL1 A;  2K2N A;  3P01 A;  2O9C A;  2Y91 A;  2A3U A;  1QMF A;  2VV7 A;  1N9L A;  1I2S A;  3ZVW A;  5EV0 A;  5A93 A;  2PD7 A;  3V5M A;  3W4Q A;  5EE8 A;  5FQ9 A;  1YLP A;  2HDR A;  1T1A A;  2QJ5 A;  2HJE A;  2W1T A;  2Y2H A;  5HSQ A;  3A3F A;  1YLW A;  1KE4 A;  5A90 A;  4CLC C;  1OTA A;  1VQQ A;  4P6Z S;  5HD5 A;  3OCN A;  3G31 A;  2HDS A;  1T1B A;  3IF6 B;  3IS2 B;  1ERO A;  4GHI B;  2V1B A;  4RQ9 A;  4UA9 A;  5F68 A;  3LUQ A;  2QMI A;  2W1R A;  4KG5 A;  4ID4 A;  4QHC A;  3UB5 P;  1CJF A;  4GD8 A;  4S2L A;  3OZH A;  2WZX A;  4WZ5 C;  4UHU A;  2BG1 A;  2ZQA A;  1GSW A;  4EXO A;  4DJ3 A;  3MKE A;  3WWX A;  3NOP C;  3H7W A;  1TVF A;  2W3E A;  4I3J A;  2V9A A;  2HDQ A;  4WEJ A;  3F1O A;  2PYR A;  2PR6 A;  2XH9 A;  4IED A;  2VX8 A;  1JNU A;  2JCH A;  3G34 A;  4HJ3 A;  1LT0 A;  4KZ4 A;  4IUH A;  5IU1 A;  1HTZ A;  1ES3 A;  3A3J A;  3LI9 A;  1KOU A;  4KZ6 A;  1ALQ A;  2Y2L A;  4WEK A;  1IEM A;  3HL9 A;  1FIL A;  5E2G A;  3LEZ A;  2WKQ A;  1K6R A;  4HJ6 A;  3EOI A;  3TJZ C;  4DE1 A;  2Q9N A;  2Q0O A;  3MQQ A;  1TEM A;  1K56 D;  3PAG A;  5FQI A;  3ZVT A;  2ZM2 A;  1K0K A;  3E4Q A;  1FCM A;  1MWT A;  3ULF A;  4OKP A;  5I94 A;  5M18 A;  5KZH A;  3AGF A;  4U0T A;  2M1C A;  4KG6 A;  2VEA A;  4O01 A;  4WYY A;  1K56 A;  3B3X A;  4LCM A;  3LIB A;  3MFX A;  3FYZ A;  5GLA A;  4DMZ A;  3T50 A;  4XUZ A;  5C5K A;  1KVL A;  1M6K A;  4XUX A;  3VE4 A;  1PRQ A;  4BL3 A;  3M6B A;  2XFT A;  4LLO B;  3BQ8 A;  4FOF A;  4E3M A;  5EVL A;  2NUP C;  1I2W A;  4EBN A;  2ZMA A;  4JF4 A;  1GSX A;  2PD8 A;  4S2K A;  5HFO A;  1PW8 A;  2E8J A;  2HP9 A;  1ERQ A;  4BWI A;  3UE0 A;  1F5M A;  4RX2 A;  1K55 A;  4GS9 A;  4ARZ B;  3MZD A;  3S22 A;  4UAA A;  2W3F A;  1DRM A;  1S0W A;  2DCF A;  2P04 A;  3OPL A;  2JKR M;  2XK1 A;  4KUK A;  5DTK A;  2ZM0 A;  2UV0 E;  5JYO A;  2G2W A;  1SDE A;  1GHP A;  3BY9 A;  4CQH A;  1OT6 A;  1G5U A;  4GDN A;  3NI9 A;  4B4Z A;  4EUZ A;  3QHY A;  5AQA A;  3A0V A;  4KQR A;  2LB9 A;  2ZMF A;  3IWO A;  1NLZ A;  3ZDJ A;  4IVI A;  4XT2 B;  2A24 A;  1RGZ A;  4EBP A;  3U4L P;  3NY4 A;  1IYP A;  2WKH A;  3VE3 A;  3CPT A;  3UNW A;  4KQD A;  1FSW A;  4A5R A;  3DTK A;  3GQZ A;  3SW1 A;  3BFD A;  1L2S A;  3L7H A;  1T1C A;  3BQA A;  3MXR A;  4KG2 A;  3K3D A;  2J80 A;  4AFI A;  4B9O A;  4LEN A;  4OPZ A;  3CZD A;  1YM1 A;  4S2P A;  4F94 A;  2PRF A;  5HDC A;  4OQI A;  4ZJ1 A;  1TS0 A;  4S2M A;  4JXS A;  1K55 C;  3FG8 A;  3C7U A;  4R3B A;  3NDE A;  1J3W A;  5FL3 A;  4BJP A;  3IBR A;  2UWX A;  3C8C A;  3N6I A;  2HV1 A;  4EQ1 A;  2Y2K A;  2HP6 A;  1P9R A;  5FAP A;  4BL2 A;  3PYP A;  3MQO A;  3U2A A;  1HD8 A;  5HWT A;  1WA9 A;  4OOL A;  4N9K A;  1DJA A;  2O99 A;  5DF7 A;  3NBL A;  5DFX A;  1NWZ A;  2WGW B;  5KSC A;  2D01 A;  4CPK A;  3H82 B;  3HUO A;  2BTF P;  1C3B A;  1LSW A;  5GHY A;  2G2U A;  2QKP A;  4H8R A;  4O8G A;  3QP5 A;  4I3A A;  1RCJ A;  4KZB A;  3L9K A;  3P09 A;  1MKM A;  1JTD A;  1PI4 A;  3O5Y A;  1JVJ A;  1MKI A;  3E0Y A;  4Y0U A;  2EFX A;  3IH9 A;  3ZG7 B;  3Q7V B;  4U3T A;  4EW7 A;  2XR0 A;  2H0Y A;  4LRX C;  5IT5 A;  4Q0I A;  4R70 A;  3E98 A;  1DP6 A;  5TJJ A;  3UY6 A;  2A49 A;  2M7U A;  3UE3 A;  3VFF A;  2QZ6 A;  3WS2 A;  1ONH A;  4HOI A;  3F1N A;  3FWL A;  1DP9 A;  2VKS A;  5HW3 A;  2GX5 A;  1NLY A;  4NXG A;  4ZDX A;  4PKY A;  2Y2I A;  1STZ A;  2PHY A;  4D2O A;  1Y4O A;  3FV7 A;  2ACG A;  4QU3 A;  3IX4 A;  2V1Z A;  4KZ5 A;  5G4Z A;  4R23 A;  3K2N A;  5GHX A;  3TW8 A;  3KSH A;  3LR0 A;  1JWV A;  1IEL A;  2VJW A;  4QJG A;  1PIO A;  3PBN A;  2DNS A;  2C6W B;  4GN2 A;  4MLL A;  3BW6 A;  2GJ3 A;  3W2Z A;  5HD3 A;  4PM7 A;  3ZNY A;  4R4S A;  2X01 A;  4ZAM A;  2W3G A;  1G28 A;  4MDZ A;  5FI7 A;  3UPP A;  2XRN A;  2EXB A;  3FKW A;  5EOO A;  3OLO A;  2XLN A;  3HJI A;  3VOL A;  2WKI A;  1L0D A;  4OOY A;  3DW0 A;  3UME A;  4JGP A;  5EVI C;  5FQQ A;  5CEB A;  1LL9 A;  2JN7 A;  4R0Q A;  1LHY A;  1N9N A;  2R9W A;  1S67 L;  2ZC6 B;  3LID A;  3IXG A;  4LGW A;  3QNC A;  3OPH A;  3SH9 A;  3M2J A;  2XDM A;  5KMW A;  4KZ9 A;  3G32 A;  1KDW A;  2VK3 A;  4KQO A;  4PM8 A;  5J7E A;  2L1M A;  1LSX A;  4S2O A;  4MEZ A;  2Y2N A;  2DRW A;  1KDS A;  3LFV A;  1KE0 A;  3LYX A;  4EEU A;  5GLD A;  3TE8 A;  2ZL1 B;  3IXH A;  5FAQ A;  1K6S A;  3VP3 A;  3MBZ A;  4R3J A;  4Y2F A;  5CTM A;  2PYP A;  1OTD A;  4CLC D;  3W4P A;  1JWP A;  1JTG A;  1K4E A;  3V3R A;  4G3V A;  4NXB A;  1MZU A;  1Z6F A;  1V9Y A;  4Y7P A;  4IBR A;  3W8K A;  4CLC A;  1TF1 A;  1UGU A;  2P08 A;  2W1T B;  1YMS A;  3ZNT A;  1EI5 A;  4R1G A;  3DBA A;  3UE1 A;  1E25 A;  4WN5 A;  3WS5 A;  1BLH A;  3R7W A;  3G2Z A;  1SKF A;  3LIC A;  2J7V A;  4PM5 A;  4JBF A;  1TS6 A;  2EX8 A;  2HPB A;  3KX0 X;  3Q7Z A;  3LY4 A;  4OPY A;  4HEF A;  3SZT A;  4WZ5 A;  5A8B A;  3NUL A;  4YIN A;  5F83 A;  2EWW A;  1VB6 A;  1XGJ A;  3GV9 A;  1VET A;  3C7V A;  3GMW A;  5FSR A;  3UB9 A;  2VV8 A;  3VMA A;  3G6O A;  5CTN A;  1IFQ A;  1IOU A;  4JGQ A;  4EET B;  4EER A;  3H7W B;  2HJ9 C;  5EEC A;  4K0W A;  3IX3 A;  4ESP A;  3NOU C;  3F1O B;  3G2Y A;  5HAI A;  4X25 A;  2ZC4 B;  4UA6 A;  3T4J A;  3PBO A;  1MY8 A;  4CJN A;  3PR6 A;  3HUM A;  4JKT A;  4EU0 A;  1WYC A;  4C3Q A;  1KE3 A;  2X02 A;  1FQG A;  5G18 A;  4LV0 A;  2H5S A;  4LV1 A;  1H8Z A;  1UWP X;  1HVB A;  3C2W A;  3UB7 A;  4II7 A;  3HVF A;  4IVK A;  4B88 A;  3AGE A;  3T4Q A;  1EW0 A;  4KZ7 A;  5CHM A;  4P6B A;  2OAP 1;  5M1A A;  5EM1 A;  2Y8H A;  4JGO A;  3O3V A;  4YOF A;  3RXW A;  1W63 M;  3QP4 A;  3N8L A;  3CIT A;  5AVE A;  2P7J A;  5CEC A;  4Y0T A;  1XX2 A;  2BLS A;  2KDK A;  2ZQ9 A;  5BOH A;  1XFQ A;  4EUV A;  3TG9 A;  4GD6 A;  1BSG A;  3DTM A;  2PAV P;  3VP4 A;  3E4O A;  4E3J A;  3T4K A;  2H28 A;  3VP2 A;  3OOV A;  1FR1 A;  4OON A;  4KZ8 A;  1HLU P;  5FI2 A;  3BLS A;  2PDR A;  1S4R A;  3C4O A;  1S4S A;  2E8I A;  1FCN A;  5GLB A;  4GS9 B;  4HJ4 A;  3KSG A;  3MKF A;  4U0X A;  3LEQ A;  2GDN A;  2HZ5 A;  2R78 A;  1FSY A;  3LR3 A;  1VM1 A;  2EXA A;  3WRZ A;  3HRE A;  4IHQ A;  1ZG4 A;  2FH5 A;  1DP8 A;  1MWS A;  1BT5 A;  3SS3 A;  3HLG A;  4X1M A;  1PYY A;  1BLS A;  3IS2 A;  4R6L A;  1ZC2 A;  5CER A;  2XD1 A;  2D02 A;  1H3Q A;  2ZMV A;  5CGX A;  5CED A;  2A24 B;  1LI0 A;  2Y79 A;  4X55 A;  1CK3 A;  1JWZ A;  4K0X A;  3FPV A;  2KOI A;  3A3D A;  5A91 A;  4OPQ A;  3UPO A;  5HDD A;  2WKP A;  3HLE A;  2EWV A;  4FSF A;  3CPT B;  3F1P A;  4WMC D;  2ZM8 A;  3T12 B;  1BLP A;  3UDX A;  5JYP A;  2Z6D A;  4Y17 A;  2WZZ A;  3AGD A;  5DKK A;  4FUW A;  4L9G A;  3SH8 A;  2GNX A;  3QP2 A;  4FH2 A;  1CEG A;  5GLC A;  1M40 A;  4D60 A;  5HX9 A;  1YPR A;  4MBH A;  1WYB A;  4DF6 A;  3IBJ A;  1ZG6 A;  5J4E A;  1O7E A;  5FDH A;  3LCE A;  1DJC A;  1FR6 A;  1YKD A;  4JF5 A;  5L07 A;  1BLC A;  5TGF A;  1KGE A;  5F1G A;  1PNE A;  2HDU A;  4QY6 A;  3NOT C;  4Y5F A;  3VP1 A;  3ZHH A;  4GOG A;  3MSH A;  3LGO A;  3O86 A;  3UE6 A;  3N7W A;  4UQI M;  3IF6 C;  2FFY A;  4X1L A;  4WUJ A;  4LV3 A;  1XA7 A;  1A0K A;  3LIF A;  4DE2 A;  1OJ5 A;  4QWO A;  5J8X A;  3QP6 A;  3DWZ A;  2B5R A;  4JXG A;  4KZ3 A;  3JYI A;  1OTE A;  1NRF A;  3MR0 A;  5FAO A;  3QP8 A;  2L0W A;  4DKI A;  2XRO A;  4QD4 A;  3BEC A;  5F1F A; 
#chains in the Genus database with same CATH homology
 4HY8 A;  4HQA A;  4OOM A;  2DMW A;  2XSS A;  3PBQ A;  4LPZ A;  4ETZ A;  3C30 A;  3CI6 A;  2VJW A;  3EQV A;  3NJA A;  3ICY A;  3PBN A;  4B93 A;  3BW6 A;  2GJ3 A;  3W2Z A;  5HPF A;  1TS8 A;  5HD3 A;  5HWV A;  3LR5 A;  1YSP A;  2INW A;  2W3G A;  3RH8 B;  2VGL M;  1G28 A;  3CWF A;  4MDZ A;  2XRN A;  3BJN A;  4GHI A;  4IJG A;  2GZA A;  3V67 A;  1OJG A;  4O0P A;  3UB6 A;  3RTY A;  1F9I A;  2YKH A;  3OLO A;  2K2N A;  3P01 A;  3HJI A;  2O9C A;  3VOL A;  2J3W A;  1OTI A;  2VLG A;  2VV7 A;  3UME A;  1N9L A;  4KUO A;  4JGP A;  2OAQ 1;  2PD7 A;  3H9W A;  2JN7 A;  4F3L A;  2O0Y A;  1N9N A;  2FZ0 A;  1S67 L;  3LID A;  3B47 A;  1XFN A;  2WKR A;  2YKF A;  4MMN A;  3EWK A;  4PKY G;  4R3A A;  1T1A A;  2QJ5 A;  2JKT I;  2HJE A;  2W1T A;  5HSQ A;  3PHY A;  2ZOH A;  4CLC C;  4KQO A;  1OTA A;  1P9W A;  4P6Z S;  5HD5 A;  5J7E A;  3OCN A;  1D7E A;  3KYQ A;  3KYZ A;  2L1M A;  1LSX A;  5CX7 A;  2JHE A;  2QJ7 A;  1T1B A;  3IS2 B;  4HI4 A;  1OTB A;  1BYW A;  4GHI B;  4CLC E;  2V1B A;  4WL9 A;  3LFV A;  5DFY A;  4RQ9 A;  3LYX A;  4UQI S;  5F68 A;  3LUQ A;  4EEU A;  3LI8 A;  2CMN A;  3TE8 A;  5TBM A;  2W1R A;  4NXF A;  5G4Y A;  4Y2F A;  5HZH A;  3FPW A;  3UB8 A;  2J3T C;  4WLA A;  2PYP A;  1OTD A;  5AVF A;  2G7U A;  4LRZ E;  5AJG A;  4CLC D;  2Z6C A;  4HH3 A;  4F3L B;  3D3O A;  1GSW A;  4G3V A;  4NXB A;  1TS7 A;  1MZU A;  3S7O A;  1V9Y A;  4EXO A;  2PT7 A;  4DJ3 A;  3PBR A;  4DJ2 A;  3NOP C;  3OC2 A;  4CLC A;  1TF1 A;  2IA2 A;  3P7N A;  1UGU A;  2P08 A;  2W1T B;  3H7W A;  4IUK A;  2V0W A;  2W3E A;  4I3J A;  1P97 A;  2V9A A;  4L9E A;  4WEJ A;  3DBA A;  3F1O A;  2PYR A;  2PR6 A;  4NKP A;  4Q0H A;  2VX8 A;  1JNU A;  3PXP A;  4WN5 A;  1T18 A;  4HJ3 A;  3TRC A;  1LT0 A;  2V1A A;  3LIA A;  2VGL S;  4UEY A;  3R7W A;  2J3T D;  4IUH A;  3VV4 A;  3LIC A;  5IU1 A;  2NUT C;  5HPI A;  3ZQ5 A;  1TS6 A;  2QHK A;  3LI9 A;  1KOU A;  3KX0 X;  4WEK A;  4MCW A;  5TBM B;  4BBU A;  5A8B A;  3K3C A;  1W63 Q;  2KX6 A;  2WKQ A;  4HJ6 A;  2EWW A;  1VB6 A;  3F1N B;  3EOI A;  3TJZ C;  3FC7 A;  3KSI A;  2LB5 A;  3B33 A;  5F69 A;  3UB9 A;  2VV8 A;  3MQQ A;  4ARZ A;  3G6O A;  3E4Q A;  3ULF A;  1IFQ A;  1IOU A;  4CLC B;  4JGQ A;  4EET B;  4EER A;  2M1C A;  2VEA A;  3D72 A;  3H7W B;  2HJ9 C;  4O01 A;  3PBT A;  1P0Z A;  1H8M A;  3LIB A;  3MFX A;  3NOU C;  3F1O B;  2B18 A;  1NRJ A;  4DMZ A;  4GLQ A;  3T50 A;  5C5K A;  3EEA A;  1VHM A;  3T4J A;  4HP4 A;  3PBO A;  4NEE D;  3PR6 A;  3VE4 A;  3R7W B;  4EU0 A;  5F5Y A;  3A0R A;  4XT2 A;  1XJ3 A;  3A0S A;  4I3I A;  2W3D A;  4GW9 A;  4YNR A;  4YWZ A;  1ODV A;  1UWP X;  1Y28 A;  4LLO B;  1UWN X;  2W0N A;  3C2W A;  3BQ8 A;  4FOF A;  3UB7 A;  2NUP C;  4II7 A;  1GSX A;  2PD8 A;  3EEH A;  3MJQ A;  4MN6 A;  3T4Q A;  3S7Q A;  2PR5 A;  1EW0 A;  3NHQ A;  4BWI A;  2QYB A;  2OAP 1;  5L8M A;  2Y8H A;  4JGO A;  1F5M A;  2A2L A;  4MN5 A;  4YOF A;  4GS9 A;  4ARZ B;  1D06 A;  1W63 M;  2W3F A;  1DRM A;  2P04 A;  5DKL A;  4M4X A;  2JKR M;  4KUK A;  5MC7 A;  3CIT A;  5DF9 A;  4BBT A;  5AVE A;  4G3K A;  3S7P A;  2P7J A;  2XA7 M;  2KDK A;  4R38 A;  4EEP A;  3JVV A;  1T19 A;  3BY9 A;  4CQH A;  1OT6 A;  4PAU A;  1XFQ A;  4EUV A;  4I39 A;  4L0L A;  5I5L A;  3A0V A;  2LB9 A;  2ZMF A;  3E4O A;  1NLZ A;  2W27 A;  3CAX A;  4L9F A;  4XT2 B;  3T4K A;  2A24 A;  2H28 A;  3OOV A;  2OWH A;  3GDI A;  1G6O A;  4HNB A;  2O9B A;  4GJ4 A;  5HDS A;  2JKT M;  4NXE A;  3VE3 A;  4GCZ A;  4BMW A;  4KQD A;  2PDR A;  1S4R A;  2ZOI A;  1S4S A;  2MJ6 A;  3HJK A;  2QWS A;  4GS9 B;  4HJ4 A;  3KSG A;  3SW1 A;  3MXQ A;  1T1C A;  4HP9 A;  4G3W A;  4HIA A;  3BQA A;  2OWJ A;  4MN7 A;  3T4T A;  2R78 A;  3JVU A;  3H82 A;  3K3D A;  2J80 A;  3LR3 A;  4AFI A;  4BBV A;  1GSV A;  1S1Z A;  2EA9 A;  4B9O A;  1S66 L;  3PBS A;  4IHQ A;  2FH5 A;  5HL6 A;  1DP8 A;  4PHT A;  5HDC A;  3BWL A;  4H6J A;  1TS0 A;  3E4P A;  3IS2 A;  3FG8 A;  4QPR A;  2JKR I;  2K31 A;  3MMH A;  4R6L A;  2D02 A;  1H3Q A;  2ZMV A;  2OOL A;  1ZHH B;  5FL3 A;  2A24 B;  2V0U A;  4WEL A;  2Y79 A;  4WF0 A;  4BJP A;  3IBR A;  4ETX A;  3C8C A;  3FPV A;  2HV1 A;  2KOI A;  4EQ1 A;  1P9R A;  1V9Z A;  5EFW A;  3PYP A;  5HDD A;  3MQO A;  2WKP A;  1LL8 A;  4EES A;  2EWV A;  4DN0 A;  3UMD A;  4FSF A;  3F1P A;  3U2A A;  5HWT A;  1WA9 A;  4OOL A;  2Z6D A;  4E04 A;  2O99 A;  5DKK A;  3KO6 A;  2HGV A;  4L9G A;  1TD5 A;  2GNX A;  5DFX A;  1NWZ A;  4K08 A;  2D01 A;  3CUE C;  3T4L A;  3MF0 A;  1YAX A;  4ZRR A;  3H82 B;  3R4K A;  1LSW A;  2M7V A;  5HWW A;  2QKP A;  3MQ0 A;  2HF6 A;  2XA7 S;  3IBJ A;  3LR4 A;  4O8G A;  4HHD A;  5J4E A;  2ZBB A;  3GEC A;  4ME4 A;  4I3A A;  2KLI A;  1XJ2 A;  3EQU A;  4H6J B;  1MKM A;  3OCL A;  3O5Y A;  2VA0 A;  3E0Y A;  1YKD A;  2K7S A;  3EGD C;  4Q0J A;  1OPX A;  2BAS A;  5DJU A;  4I5S A;  4EW7 A;  4P6Z M;  4Y3I A;  3S7N A;  4LRX C;  5IT5 A;  3NOT C;  3HCY A;  5DJT A;  3C38 A;  4Q0I A;  3KSF A;  4Y5F A;  3CLO A;  4I38 A;  4R70 A;  3E98 A;  3T4S A;  1DP6 A;  3F1P B;  5TJJ A;  2M7U A;  4HH2 A;  1XJ4 A;  3UE3 A;  3UE6 A;  2I9V A;  1F98 A;  4UQI M;  3CUE A;  4HOI A;  3F1N A;  2VZW A;  3ZYT A;  5KIZ A;  2O9A A;  4LRY C;  4WUJ A;  5LBR A;  1DP9 A;  1MC0 A;  2VKS A;  3RFB A;  2GX5 A;  5KSH A;  5J3W A;  1NLY A;  4NXG A;  2W3H A;  4JGR A;  3LIF A;  4PKY A;  5F6A A;  1LSV A;  1OJ5 A;  1YSQ A;  1STZ A;  3T4O A;  5K5B A;  2PHY A;  1X0O A;  3B42 A;  3BY8 A;  1XJ6 A;  3OBF A;  1S1Y A;  2VV6 A;  5G4Z A;  1ZTU A;  1OTE A;  3K2N A;  3MR0 A;  4Z1W A;  2B02 A;  1N9O A;  2L0W A;  3TW8 A;  3KSH A;  1OT9 A;  3LR0 A;  2L4R A;  2XRO A;  3EGX C;  3LIE A;  5IS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...