2KX7A

Solution structure of the e.coli rcsd-abl domain (residues 688-795)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
b'MERLLDDVCVMVDVTSAEIRNIVTRQLENWGATCITPDERLISQDYDIFLTDNPSNLTASGLLLSDDESGVREIGPGQLCVNFNMSNAMQEAVLQLIEVQLAQEEVTESRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor-like histidine kinase yojN
molecule tags Protein binding
source organism Escherichia coli
publication title Structural Insights into Rcs Phosphotransfer: The Newly Identified RcsD-ABL Domain Enhances Interaction with the Response Regulator RcsB.
pubmed doi rcsb
total genus 31
structure length 111
sequence length 111
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16359 RcsD_ABL RcsD-ABL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kx7A00
2KX7A
chains in the Genus database with same CATH superfamily
2LD4A 4UFOA 1G3RA 1HM5A 1BCSA 5CT8A 2QQ5A 3BB3A 1ZD3A 4DLKA 5JPIA 3G7SA 3TZQA 3O8QB 3FWKA 4PO9A 3RUHA 2CLLB 2A5JA 2ZVPX 4NZPA 1IZYA 3CVOA 3EODA 3AG6A 1E2BA 1HDZA 1WSWA 4R1UA 4XB1A 4AAYA 4ZGWA 2BCEA 3PFHA 3PJDA 2CVHA 4PEVA 3MGKA 4Y1EA 2HN9A 4JJKA 5I7RA 1XQXA 2CWDA 3K9GA 1VIAA 4RH3A 3FF1A 1O8CA 3ZX4A 5KVCA 1QHIA 1CQIA 3FDXA 1V11A 1JQEA 3MCAA 3LUCA 4LC9A 3SJBA 3GEGA 2AQHA 3EVNA 3FPHA 3K7EA 1GKUB 3NASA 2JLXA 4JYCA 1JHPA 5NLLA 1WLSA 3TK1A 4WFJA 5BUCA 2OXIA 2EDAA 4X7BA 1EFDN 1TQHA 1EYZA 1W88B 4BATA 2B4QA 4YR9A 4D9JA 5DIZA 3SC3A 4BXOA 3MWDB 4H0CA 5G4KB 2EJWA 3CLRD 3ZE0B 1J0CA 4YGYA 4NV1A 3OZUA 1S2IA 5LNK6 1SMKA 1JHYA 5JOQA 1QP4A 4J0IA 1S01A 2G3YA 1N2XA 2ZSHA 3A7EA 2EKQA 1T2DA 2XCTB 3B6JA 2VDPB 4KQ1A 1XZMA 4O29A 4TRJA 3IGFA 3E5NA 4RPIA 3CONA 1SAYA 3ICWA 1K68A 3IEMA 4YRBA 1ENPA 1XWWA 3OT4A 1IQPA 4HX9A 4UVGA 4HMQA 5I7OA 2PXAA 1QYCA 4G85A 4TZTA 4MO9A 4WLNA 3TPCA 4OMDA 3IRUA 1ZOIA 5TY0A 1XJ5A 2ZYTX 3O47A 5DMHA 3PHLA 2NXNA 3JYQA 2OV8A 1K88A 4OAPA 5C7LO 4JP1A 3C16C 2E4ZA 3KNZA 1Y3DE 1BDIA 3I2HA 1VL5A 4QEDA 4RE5A 4L6CA 1L1FA 1MCZA 5CVJA 3VYSB 1VLLA 2JHGA 5DP1A 5HIAA 3EHDA 1JLLB 2BUAA 1WOMA 1NVTA 5A3SA 1WDWB 2F8TA 3X1ZA 2EKBA 3A6FA 2BFFB 2IE0A 3G2NA 1P74A 1TM3E 1XU4A 5CLLA 5IJXA 2R4UA 1KEWA 1AVTA 3LCUA 2BKEA 3BD9A 3QLUC 5HA5A 4BP9A 4CM3A 3BXGA 3HVRA 4PS0A 2A1UA 5I3CA 3BMQA 1N5RA 1EGMB 4IKPA 4JBNA 1CQZA 4TTRA 2P4EA 5AI5A 3W3AD 2AD1A 4EBFA 1YDEA 1YS9A 1WTAA 4IR7A 3V42A 3LQ1A 3W04A 2JFBA 3TBFA 3WNZA 1VCNA 1X8LA 1XQYA 4B6OA 3QXJA 1DBQA 1W6RA 2JC3A 2VKQA 3I61A 3RC7A 4ZMRA 1BX1A 1HYQA 3RFCA 1JLKA 3AOEA 4KACA 2QD3A 4BZQA 3I72A 4XA8A 3DQQA 1EPUA 1EK1A 4FT4A 4X65B 3YASA 4YXFA 1VLMA 4KXXA 4MW7A 1G7RA 2CWWA 4DSUA 4FOPA 1KS9A 2NUAA 5I5EA 4ZO9A 3G9TA 1W96A 4NV3A 4OQ4A 4R2IA 1Q7TA 2DWOA 2XE6A 2FOXA 3HKEB 3VISA 1KR2A 4TQAA 1Z5WA 1QIEA 1K2VN 3FYUA 1C1HA 3CR3C 1FS6A 3EIUA 1GD1O 4B6QA 1XYVA 3ON5A 5G4KA 5C1BA 4WX2B 4RUKA 1IHYA 2XMSA 3U60B 4BMOB 4HPXB 4KJZA 3KJIA 1WW3A 4UUNA 4BNFA 5ALSA 1NAIA 4YREA 4ME6A 1NGSA 4EG6A 2ADFA 1QO0A 1T9GR 2D8AA 3BA6A 1K0FA 3N28A 5IAJA 2A6PA 1HYHA 3KYCB 4PPFA 5DYYA 4ZHQF 5HJ5A 2C42A 3GFTA 1XZBA 4I3FA 3TDNA 4J2TA 3ZK7A 1SXJC 3TLZA 2UUPA 2GKSA 1E4YA 4LXUA 4MRNA 3CR7A 4E07A 4KIUA 3QY0A 2Q1XA 4DGSA 1KRXA 4ZVSA 2FWPA 3K2QA 4X94A 5EE0A 4R2WA 2CL5A 3VPSA 2GNOA 4BU1A 1GTSA 4HLUA 3O2NA 3RR2A 3D0QA 4KX3A 4POOA 2I71A 4A0QA 4GKBA 5KO2A 2H7CA 2H2AA 2WC1A 2ZRCA 2BPOA 3AH8A 3AUYA 4JP5A 1W75A 3BHNA 3BXEA 3EARA 1SKAA 4QUBA 5K0JA 3IMGA 3EPKA 1D2EA 2OOSA 3RSQA 5AXDA 3F9RA 1LJLA 2P8JA 3AERA 4ZT7A 3RHSA 4PSUA 3SG0A 2FOIA 1EHIA 3DDOA 2I4LA 4G4GA 4XIFA 5CIWA 5F33A 1QPZA 3BMCB 1T9AA 1RU3A 2PKQO 1VL6A 4RK5A 2QDXA 4S04A 1FX0B 1Q22A 5C9ZA 1KZ9A 2AFIB 4RPLA 4MAMA 4C3ZA 5K0FA 2PUBA 4C7OB 2B7BA 2PS1A 1E1MA 3HDYA 5AJHA 3IX7A 3FIJA 2P5UA 2D1YA 4HR7A 4RD0A 4OIMA 4XJTA 1ICEA 5I7UA 1GO2A 4RKRA 1MB3A 4EUSA 5KQPA 1VIVA 1D2CA 2VH5R 3G7NA 2Q5QA 1B7GO 3K8QA 3PNOA 4RZ3A 2B1IA 4WK2B 2OA0A 2BFMA 5ADWA 1TEXA 1XCLA 4U7GA 5MFZA 1U0BB 2HRRA 3EGXB 3ZIAA 2M6KA 1WKCA 1BQ4A 1KRHA 1W4BA 3DTNA 2H4WA 1JQ3A 5D01A 5A7FA 1GXSA 1PU2A 2VP9A 4EEZA 5HW0A 1XKLA 3GLHE 5CLHA 3IJ5A 2Q49A 1NMXA 1HSZA 1ZKMA 2PKRA 4L4YA 1IVSA 3NO4A 3K32A 3BKXA 2DETA 3TMAA 3AEYA 4F3KA 5F7JA 2BKVA 1D7OA 4P0QB 2J3JA 1EX6A 3ENQA 4LZNA 3K0FA 1MFPA 1X9HA 1U81A 3GPCA 3V9AA 3WA6A 5JAZA 4JR2A 4DY6A 1OXUA 1CXZA 5D3MB 1IUKA 1HE3A 2G9VA 4BIMA 4NFYA 2I3DA 1D4ZA 2XAAA 2W70A 4BNWA 1MGPA 2R79A 3VJRA 2DUWA 2AWNA 3ONDA 5AKJA 3O90A 3VTAA 2WMNB 1JZSA 1ULSA 2A4MA 1RD4A 2BEVB 3PNKA 1KU6A 1DEAA 2PU7A 1A5SB 2XUHA 2MINB 1PJCA 3ZQ4A 1E6UA 4YJGB 1QOQB 2UAGA 3G2QA 3FFTA 3ZDQA 2PSHA 4V1CA 4MKFA 1U2TA 3EAGA 2AW5A 1TM4E 4EA6A 1GTG1 3VKGA 3NTQA 1JB9A 1AUPA 1T8RA 3I05A 5CDUA 4QDXA 2A57A 2JBWA 1FS5A 2VG8A 4DSZA 2VNJA 3D81A 4TRRA 4FU0A 1V4VA 2GZMA 4N03A 1ANKA 3T7EA 2V7BA 3AJDA 1AY0A 1SBZA 2Y1GA 4E5YA 3VNQA 521PA 5A0FA 3SMVA 3NBMA 3TL3A 1TT7A 1G2PA 3QUAA 1P9WA 3WOHA 5MN6A 4M6WA 3F5MA 3DLTA 4IDOA 1S3SA 2NLOA 2ZR8A 1VYUA 4W5TA 4C6HA 1BW9A 3IQWA 4RTSA 2P4UA 1NY5A 1KYXA 2H4FA 2ODEA 4HTFB 4Q9JA 4ZU6X 4NE9A 5C1OA 2H9AA 3L04A 4L4UA 2PZEA 3SC2A 4RZXA 4BVJA 2XTNA 1FOEB 4B1FA 1IDN1 4DR2B 2PU5A 1UMDA 2AFIE 1W49A 3FI0A 4LZOA 4PSAA 5ALLA 4MR7A 5FHRA 5FRDA 4A23A 4JU8A 3WLHA 4AMZA 2HWUA 4JJ7A 5KQMA 1BCSB 1ZUD1 1MVOA 4IQGA 2X0DA 1NSFA 1P9LA 3MCWA 3KJEA 4OMCA 5C35A 1UBRS 3LXRA 1EGVB 2C7BA 4JJFA 3VR4D 1ZHOA 3BTUA 3BK7A 5ECGC 3C3BA 1M2FA 3HV2A 3IB3A 3NDPA 5FLYA 1SBCA 1VMAA 3ECAA 3X2SA 1I36A 4C87A 4ETWA 5FTKA 1E3SA 1P1CA 1UKBA 4C05A 5KMGB 4O4LB 2B69A 3LY8A 2HHJA 3K9FC 1GZDA 4EY5A 4Q0MA 4AO6A 1NBIA 1IZ9A 2MCFA 1CF4A 1DIAA 2XQJA 4PZ9A 2DAPA 3CW9A 4HB4A 1VSVA 2PEYA 4E30A 1QCYA 1Q16A 2JLRA 3HKBB 3MZ0A 1GDTA 1T5SA 2NNLD 1DBSA 2UUCB 4Z4CA 2WDPA 2YHIB 1MW8X 5JLJA 1UC9A 1II0A 3EXHC 3G5LA 5IJZA 1WPXA 1YTLA 3UYKA 3AKCA 1JR6A 1TKCA 1G0OA 3D6VA 1E3TA 3Q88A 2G9ZA 4G4SP 4Q9DA 1YIAA 1J9ZA 4X6LA 2ZDQA 1Z29A 3U80A 2BN4A 4DMCA 1KF0A 1M72A 4GF5A 4MZDA 4L07A 3PNBA 2FZVA 1V4NA 1XF1A 1YQXA 3M4NA 1XEWX 2ZM6B 5IBPA 4GP7A 3DG9A 1UODA 2ERYA 1JECA 4D9NA 3FYUB 3JRWA 3VNAA 3E4DA 4RD3A 3PLNA 4S1WA 3MGCA 4Z53A 1RZUA 4EY7A 1L5FA 5CCXA 3E3AA 2JI6A 4MROA 3GF4A 5JAUA 1RMTA 2OT3B 3DE4X 1RYEA 1L3IA 2IKQA 2I7CA 3FMFA 1CHNA 4J6FA 1Q17A 4JSTA 3UANA 1NN5A 2G80A 3OQIA 1DC3A 2Q28A 2JEOA 5ILQA 1E3IA 3WGMA 4NQZA 3E6AA 4X66B 2WWYA 4F6LA 1TJNA 3ZNPA 2PZLA 4CTMA 1VE9A 2HRCA 2CNNA 2WB2A 3OKPA 3NNNA 4JROA 3HABA 3GP3A 4LCJA 4QDZA 5JQGB 5DO9A 1QIGA 1HY3A 5CR9A 4DSTA 1W5BA 3DNFA 5LP1A 2JD2A 5DI3B 3BBLA 1C1XB 5HF5A 5TQ2A 2XA9A 3AEKB 3M5CA 1A4UA 2HCJB 2NW6A 2AKYA 2P35A 2QAGC 4GPIB 5EWLA 1P39A 4URHA 2PPLA 3P5BA 4QJ5A 1M33A 4WVLA 5GONA 3FHLA 2A5YB 1DU4A 4L57A 4TN1A 2QY6A 2BMFA 3AIMA 3R3WA 2XMZA 3IKTA 3NIBA 1KP3A 1UMBB 3KELA 3RLIA 2W2QA 1P6XA 3LLMA 4L7QA 3X1XA 3WFZA 1NBAA 4KXLA 4PLWA 2AUMA 4K2AA 5K3BA 1E61A 4LRYA 4RJKA 1UC5B 2GZ3A 3CLHA 2HUNA 2R7AA 4UE3S 2RHCA 4DB2A 3A9CA 2HRZA 5EC8A 1YS4A 5DCYA 3KP1A 5COBA 4CIXA 3P5SA 2BFBA 2COUA 2QY9A 1SK8A 1V3QE 2V98A 3H9CA 3KHUA 4JL8A 3HDVA 4L95C 5D86A 2NUAB 1JQBA 1DUIA 4F4CA 4R1LA 2QL5A 3T5DA 4BFUA 5A03A 4EJ2A 4MUYA 4RULA 1SXHA 2Q50A 1JSCA 3TD9A 2WYIA 1IEWA 2FUKA 3HKDB 4MVJG 4L6IA 5H3CA 1OX4A 3G8DA 2HNAA 4RD6A 2E85A 4YBRA 4LTNA 2YV3A 4ZAYA 4M2LA 1I3LA 1IATA 2H5JA 4G1UC 1L8QA 1WBBA 1RMYA 1IB0A 3T5AA 3CUKA 5KYWA 1U1CA 5IHPA 4O6VA 1U7OA 3DLBA 3G49A 2BR5A 5IM4F 2R6ZA 2Z2KA 4FFPA 4YASA 4DC1A 2IQIA 2VP3A 4ZVNA 1LZKA 5CCDA 4AB1A 3DBVO 3ZDEA 1PEAA 4P92A 3S70A 3V8NA 5BY2A 3H5TA 3UA3A 4AMVA 4N18A 4E5VA 5ARBA 3L7YA 3AUUA 2P6RA 4OI0A 4J1TA 4C5BA 4J0JA 5FTNA 1NNLA 4IDFA 2HW8A 3ANLA 4BE9A 2GN9A 4QJ3A 3NCTA 2Q2NA 2JS7A 3PRHA 1P62B 2GVDC 2O2HA 3F9CA 2PL9A 4D3DA 1VIDA 2M9MA 1LLFA 2Z5LA 4MQMA 7REQA 1CY2A 1E1QD 3NBXX 3GAFA 4HL6A 1T1IA 1GTJ1 1P33A 2G06A 3CLRC 3HPRA 4ER7A 1IIRA 5LP6A 4C06A 2O8DA 1N92A 3UJPA 3TJMA 1KS2A 2Y6VA 3SD7A 4OHCA 2A59A 1HQCA 2CD7A 1VB3A 4KVFA 4C7KA 1P81A 4EG4A 2C7VA 1EXVA 4QE3A 3UCXA 2C98A 3BB1A 1T36B 1T0BA 3D3KA 4MLDA 3SIRA 3O03A 1G2IA 1FU7A 5F7ZA 4O1MA 1R88A 1FVOA 1L1EA 1H1LB 5FV7A 2G09A 3IC5A 3ICEA 3H11B 4BO2A 2ORWA 1TCAA 1DO8A 4CI9A 4U3JB 4WV3A 3DL4A 3K2IA 3O83A 2QRZA 1X13A 1Z0FA 2HQOA 3G82C 4Q82A 1XRMA 5B1DA 5IARA 3WK4A 3OX3A 2PUCA 1C14A 1K9SA 3NM5A 4MVJM 3CZCA 4JYBA 5GMOA 1UZAA 1GP2A 1ZMRA 2R6JA 2P1RA 3OURA 1X92A 2QWXA 4L5IA 4ND5A 3RWMB 1Q14A 5FTJA 3BM5A 2EWMA 3WL4A 3VVMA 4JC5A 1Y98A 4LW8A 1U2GA 2QE7A 2X0RA 3G17A 2HREA 1W5SA 2QTVA 3CNQS 3QUTA 1FFCA 4JLVA 3STXA 2HSJA 1V8OA 5REQB 4EELA 5IBQA 1SQ5A 2C20A 4KXMA 4E6PA 1M9NA 3RG8A 3ILVA 3K0FB 4GOXA 3U2QA 3DTYA 4QGAA 1QZ3A 4F2GA 5JBIA 3JR7A 5LBIA 5C31A 3C0KA 2W2VA 3GW8A 4V0SA 5IASA 4JGBA 1R0KA 2EZTA 1DJLA 4S0ZA 2AI3A 3LL4A 3MOGA 2IITA 3R7AA 3LKVA 3V6MA 1GKKA 3RSSA 4ZQHA 5FFMA 4D82A 1CIVA 3T34A 2YV2A 5JAHA 2B20A 2F3PA 1H6DA 1GCIA 2TMDA 2XRMA 4I1IA 2QRHA 1JNYA 1UAGA 4OL9A 1DX6A 1W73A 2VYVA 4I1UA 4R01A 1YOVA 5FUWA 5IJ0B 1I7NA 1NMYA 4FIZA 3CG4A 3SHOA 1ECGA 3T1QA 1QGYA 1ZK2A 3TVYA 3I3OA 1ZIYA 2AHOA 3SBEA 3ZZUA 2ZJ1A 3TGPA 5GIPE 2YVLA 3NYRA 4BNKA 3FKSD 3FHCB 3M3HA 1KR5A 4Z4GA 5I9TA 1UBCA 4RY2A 3LF2A 4F97A 3WOVA 1YRWA 1N7JA 4RKEA 4RMHA 1MDBA 1CNMA 5IT4A 3QOFA 4D9CA 3O1LA 2CVPA 3BIOA 3BWCA 2DB3A 3HYRA 1NR7A 5K03A 1FFXA 3QJ5A 4KDCA 2ORED 3GLIA 1PAUA 2G08A 1OTXA 3PF9A 3S1AA 3U7IA 4KPYA 1ZLYA 1T3SA 4ALLA 5DK4A 4KFSA 4LJKA 3A2NA 2PGNA 5ESWA 3F5SA 2PCJA 4EF5A 2R00A 3DNPA 5IEJA 4CLDA 4TTAA 2W2PA 5CT4A 5KNCH 1T9DA 3VZCA 2FR0A 3MLAA 3QUQA 1S4QA 2X2PA 3E8SA 3UGTA 3AVUA 3OFJA 2FDXA 3IR6A 2XVMA 2PX2A 4GFDA 3BCUA 4WEOA 1O0BA 1NXSA 1A5AB 2WVGA 3RTAA 3WV4A 5D87A 4L4ZA 1UAAA 4MVXA 5PNTA 3LBHA 2P62A 5K4HA 3MTJA 4IDBA 1UIRA 4WCFB 4M1MA 5DX0A 2P2LA 2GAOA 1X1DA 2QU8A 5TEWA 4PLZA 2CHQA 1SA0A 3UCFA 1ECFA 1Y1TA 4C6TA 3VNVA 5JW6A 5AVKA 3UJ7A 1PBNA 3P96A 2IYXA 4S35A 1VBKA 1A9OA 4WEQA 4UHKA 5KCZA 2I78A 3OQOA 1T0HB 3VU9A 2QR2A 3A3YA 3SE7A 4EKYA 4IH9A 3UV6A 4DXHA 3KKEA 4EPXA 1UXIA 1BROA 2VDLB 3H65A 3CYFA 2DPMA 3H6GA 4GKVA 1SIWA 1U0RA 3LBFA 2ZIUB 2Q6KA 1QKKA 1E79A 4R1OA 1NQWA 1I9CA 4N6GA 5AJWA 5FFNA 3TNLA 4ZAXA 1JS1X 4ISCA 5DNAA 5IF9A 1II8A 4PBTA 4HDMB 2NU9B 4BVGA 2H6EA 1Z82A 1A7KA 1P0FA 4F3RA 1U2ZA 4KRYA 4N5IX 5I9NA 5L4SA 3QYFA 3STHA 3SR0A 3WGQA 1IHDA 2BHNA 3VNBA 3IUYA 4JI2B 1C0LA 3A3OA 1E69A 3T7DA 1ONNA 4FTWA 3R3UA 2OYCA 1NT4A 4G8DA 4KEAA 4EA7A 4TV9B 1BJKA 1E66A 2ZT8A 4IHQA 4KODA 3HKDA 4C6SA 1GZSA 5DYTA 4R6WA 3T6KA 4INPA 5B3JC 3E1KA 2XVYA 4DWOA 4WW0A 3EIQA 3RGGA 4LX0A 5CB6A 3FFBA 2PIAA 3A6ZA 1C7FA 3KJNA 3WQBA 2V0GA 1COWA 2JBAA 4DY4A 2ZFUA 1GPKA 3BOSA 1RYBA 4FFOA 2JIZD 3D0RA 4CUZA 3FGPA 5DSTA 4PAGA 1UWLA 3MEQA 4R7ZA 4BBPA 4C1BA 3KQSA 4L9WA 4E4RA 1VKRA 1TRKA 4WN9B 1UIMA 2CDBA 1WO8A 2IZ0A 2QLLA 1HLDA 2OGUA 4E0BA 3TVDA 2JAPA 2OK8A 4HQOA 1AKTA 1DCMA 1K6EA 4FE3A 2KHZA 4K9DA 1X8JA 5F12A 3R6GA 4ZMBA 4BBZA 4AJ2A 2HMAA 3A31A 5IAGA 2SKCA 1ACMA 3ZVRA 1I3NA 2Q3DA 2YYAA 4EITA 4HB0A 3OMXA 3RSZA 3OLVA 2EVWX 1OT3A 2JIRA 2GD0A 2I87A 3PUZA 4HVTA 3SIXA 2HC9A 2XCRB 1JG7A 3BE5A 1P29A 1T5LA 3BCSA 1RZRD 1KVRA 1OY1A 2WICA 4WNAA 4O08A 2TECE 5KYYB 5KOJB 4K40A 1WU8A 2RI6A 3SFTA 1Z5GA 4LX8A 2ANBA 2RARA 4K3VA 3QMWA 4H16A 4E22A 3JALA 3NIGB 4JJ8A 4LHSA 2Q6TA 2P8SA 2FMKA 4HS4A 2UYOA 1JEYB 1RLOA 4Z3DA 4NJOA 4QOIA 1J2YA 3WMXA 1BGWA 1RWQA 1NZJA 2EX1A 2VXCA 1DGQA 1F3OA 1QRRA 4GOJA 3T95A 3ILSA 2IYSA 1G7TA 1N1EA 4QLAA 4Z9BA 1QYXA 3M70A 5B7GA 3GI1A 4XPIB 2XMBA 2H3HA 4DCPA 1EJ6A 4GYWA 1CWUA 3HYCA 2GR9A 2JIDA 2RHOA 3CVJA 5I9SA 3UAVA 3ROPA 4FWIB 3LT1A 3U4HA 1H8HD 1QWOA 4PRZA 3JQFA 1FK8A 5C3UA 3U6KA 1BXZA 4RZHA 1RRFA 1KZGB 1WP9A 2BFDB 3CZRA 2I0FA 3IP5A 1XROA 3HCFA 2R00C 3UPUA 5DBIA 3VR3A 1AS3A 3WLPA 1OYOA 1KRWA 1U3WA 1JKXA 1XZNA 5JDCC 4XDZA 3WB1A 3HB4X 3MMNA 1SCJA 1U90A 4TKUB 1TADA 5EKDA 1FC0A 1LUAA 2JIOA 3VR3D 1Y9EA 2MR6A 1M1ZA 4U5XA 3V48A 3GRVA 1K8ZB 2IHZA 3LQRA 1RQXA 1CRQA 1VXOA 4HWSA 1ZI8A 5E8JA 3O2QB 1XCGB 2WV9A 2XOKD 2LCQA 1CUJA 4IBOA 4ENQA 2WWWA 1JKJB 2GDZA 5AK0A 3MRVA 3DOUA 1DRWA 2VCYA 1M0EA 4C4XA 5KWEA 3V2GA 4M9QA 2IYYA 5K3DA 2P9YA 3HU2A 1PEDA 1T9HA 2AR9A 2QUHA 3PDUA 2C5FA 2G5CA 1GARA 3JQAD 3N5KA 3HLTA 4L02A 3GLHB 4P4GA 3K0HA 1L4YA 4O0MA 4OHYA 3TKYA 2OD9A 4LJ6A 2NSJA 3ZV7A 1DXHA 1YRHA 1UR5A 2CHEA 3LV8A 3P0HA 2ZRFA 2QSYA 1LH0A 2AXNA 4X1OA 5IH3A 1QH9A 1C7EA 3USCS 4D4KA 5JNTA 3PPIA 3TCNA 2D4AA 2K7FA 4BAGA 5ICCA 2XPCA 3H19A 5A71A 2COKA 1NULA 2CVZA 1LU9A 3AVOA 4LHXA 4FQ7A 4PYQA 1DRKA 2ZUEA 1PFUA 2DFNA 1QRDA 3I04M 4BB0A 2Y0EA 4JSYA 4NSNA 3OUTA 4KRXA 2XGSA 3QQPA 1Y37A 1ABFA 1O94A 4DN6A 3Q8MA 4DMFA 2AFIA 1POWA 1BS1A 2IBSA 3OX4A 1XR3A 4Q5IA 2IODA 3KUCA 1QE5A 1TQ8A 1U2DC 2ZIXB 3AEXA 3NAGA 3B6IA 1P1BA 4HRAA 1VE5A 3AMVA 3ZYCA 4Z9FA 1B15A 2PUJA 4EHLA 4L78A 4YRQA 4NBRA 3TBKA 4CMGA 2VQSA 3HR7A 3OIGA 3QF7A 2G5TA 5DW0A 4GZ6A 1YZUA 4GIBA 2O4CA 3QPBA 4YJKA 1AQYA 2YFQA 2SECE 3CCBA 2YZGA 4HQKA 5CLIA 1O9BA 1RQGA 3GA0A 3U3MA 5JAOA 2CYBA 2RKBA 2R8XA 1CYDA 2V0NA 1ISMA 2YINC 2VO1A 4BFCA 3L6DA 1CUYA 1T4DA 3UB4A 1YB2A 3FWNA 3VTZA 4JEMA 3IEVA 1W94A 2X77A 4PX2A 1WX1A 4LMRA 4Z99A 1P2TA 3PKIA 4MB6A 4XDYA 5JS8A 3RYIB 2KYRA 4GMFA 2KX7A 3ZNOA 3ZHYA 5KQLA 4AK9A 3LUAA 4X44A 4P54A 3PRYA 3Q3HA 5I6DA 4LF7B 3LSYA 3LC0A 3P7MA 1N6IA 4ANFA 4WBNF 3C6KA 3C8DA 2PLNA 3M6IA 1E5XA 3AG5A 4G23A 1NVDA 1SHZA 3ESDA 4FDMA 5GJWC 3VKWA 4PC3A 3D8NA 2JFFA 1P8AA 2FRVA 3WQHA 4C2AA 1IONA 4GZ3A 2I99A 4O4IB 2HT1A 3BERA 1J22A 1AO3A 1L5MA 2WU1A 4J3FA 2GH1A 5HF9A 4BJHB 2H65A 4ARUA 2ZE8A 4DBLC 3CVYA 4KB5A 4ENUA 4JITA 1U0TA 2Z4SA 4DIOA 1XDWA 2R60A 1BMFD 1ZGJA 1VPLA 3L4EA 2YWBA 3SHTA 4NCJA 2PYDA 4WTOA 3E18A 1ZH6A 2PY6A 4FEEA 4MRMB 4ZTUB 3ONNA 1XPJA 5KU7A 3A4LA 4GH5A 3LFUA 3REFA 4CDGA 2GBGA 3D31A 1XRLA 4JH0A 1JDVA 3DWEX 5FWXB 2ZAGA 2O1EA 4CMKA 5JXWA 4PX5A 1ZZEA 3OJCA 2IOQA 1WNTA 3A14A 1JJIA 4QL3A 5LA6A 3S8YA 5E6RB 5HHTA 2OUIA 4KPFC 5AW0A 5H1YA 1I33A 1RFGE 2GA8A 3C3PA 3TKAA 1KQOA 2HNKA 3PGVA 4W5JA 3V2IA 3OCYA 3DPUA 4IV5A 4IOLA 5EXPA 3VUFA 2CBXA 2H4JA 2C77A 4DMHA 5CGQB 3KSAC 5HRCA 4BO4A 1F12A 2O1WA 1JLLA 4FSHA 3WKDA 4BGEA 1W5FA 2AOTA 3PS9A 1GN8A 2VHXA 3CF0A 4AQYB 1BFDA 1XRJA 1SC4A 2XTMA 3PQEA 1FTYA 3H8JA 3N07A 4AQ7A 4G2NA 3L02A 2HA3A 5FI0B 3NTVA 5I9MA 3WZ2A 3Q8WA 4H7PA 3T0GA 5J2TA 4OXNA 1BG6A 4WK6A 5BN4B 5H4GA 3GRUA 4KPUB 1JG1A 1S8NA 2R8YA 3B20A 1HYBA 4YV0A 3K70C 3R0VA 4JBGA 4DJ5X 1FJGB 2YYYA 2C9DA 3CS3A 2C4KA 3AETA 3KAPA 3GEPA 4YP6A 5MGNA 3CKKA 3OECA 3N2GA 1QO0D 1YZQA 2J3EA 2IYTA 2I5PO 5M29A 2HJSA 4EQ6A 2FN4A 1G5QA 3ELWA 2G25A 3E9ZA 4WAUA 4DCOA 1L5VA 3T7AA 3M6XA 4YJFB 4U0KA 2R4QA 3L4BC 4KNVA 1FP6A 2XDYA 2CKDA 2ZVJA 5CA1F 2FPGA 3OZIA 3GV0A 4UEOA 3AJEA 3I4LA 4R9NA 5AM0A 1BE8A 1JA1A 5K3AA 1E99A 3ISVA 4FNGA 1U7XA 1WUTA 5IC6A 3H6HA 1YZLA 4EG7A 4I5EA 1VFPA 2ICAA 1WW8A 2G4CA 4PVDA 3A6PC 5DYIA 2WF9A 4FFBA 2WZCA 3AY0A 4W6ZA 1E6LA 1IUNA 2GYWA 3MT7A 5KNDH 1RHQA 3ITKA 4URZR 3N7AA 2IYZA 3WMWA 2HNBA 2C2KA 2GDJA 4MO2A 3WK6A 4C4RA 1Z7GA 4GMHA 3LPLA 4DR3B 4RLQA 2WW8A 1KZ7B 1ISSA 2AZDA 3D2AA 2C1EA 1FMJA 4GUDA 1YJXA 4RVCA 2ZRHA 3CGWA 1FE8A 1S9HA 3C3CA 2P5SA 3EH1A 3P0RA 4LBVA 3H83A 4RF4A 1J33A 2X5JO 3EDMA 4ZFNA 4KLAA 1ITZA 1HZJA 2RBKA 1XDSA 1Y7HA 1U8AA 3KAQA 3DO8A 3BXFA 2JAHA 4ZZ3A 4MTCA 1U4OA 2BEUA 3MIZA 3U61B 4IMIB 1CVIA 3REQB 2I6GA 1W85B 4M7RA 2VQEB 1RLJA 4WLOA 3OZXA 5E9AA 3OQNA 2V1XA 3TRFA 1O8BA 4HWTA 2DPHA 2QVZX 1PL6A 4MUKA 1CLEA 1EG7A 1U2RA 3QF4A 1KQFA 4A7PA 5IT0A 4OBWA 1F3LA 3T94A 1A2OA 4I1SA 2FP3A 1XYGA 3JALB 2R5NA 2IH4A 3PIDA 2P0YA 2DQSA 1OHHA 4MGHA 2OV2A 4XB2A 5SY4A 1WMSA 5BV1A 1E1RD 1RM4A 1LPMA 1UF9A 4UQLA 3ADCA 4I1PA 2IS4A 1U02A 3BKWA 1F0YA 4IIEA 1F2UA 1X1EA 3SYRA 4L51A 1MEEA 3HKCB 4LDAA 5ALJA 2HYDA 1X86B 2HHHB 2IPLA 4I50B 4CE6A 1C8KA 3NDIA 3EWNA 1QAMA 1FVFA 4A6XA 4F3YA 2IYQA 3C5EA 2AT1A 3L1KA 1N8NA 3T61A 1LD3A 2CBZA 2PD4A 3VMMA 4YIHA 4NJMA 2QRQA 1Z0ZA 3BSYA 4Y2PA 4YQZA 2GBCA 4O4HF 3LHDA 4GYYA 1U0JA 1WCYA 1WQ3A 2J5XA 3L9XA 3PXUA 1J2EA 2ZIAA 4B8WA 1V1MA 1EEXB 4MWEA 2W0MA 2E2WA 3JYHA 5FA5A 4E1AA 2Q2WA 1DS6A 1TQ4A 1HNZB 1E1KA 2JI7A 3MC1A 5JD3A 4ZVTA 1GCUA 3L4BA 4UTPA 2J6HA 3FCXA 1PZMA 1N5LA 1VPEA 2NAFA 1N2OA 1O6BA 4NF2A 4ZRMA 5JD5A 3QFRA 4DNFA 3RFFA 1DJQA 4KXFB 2GCGA 4H0FA 1A98A 2REBA 3P9XA 4JR0A 1IEVA 4OGKA 4QFBA 1C41A 5ILOA 2YYSA 3SU8A 3AUXA 3ER9A 2C2GA 1J4AA 3ODGA 3Q9LA 4BRZA 4ID3A 1I13A 3UM9A 4QEZA 3BTVA 2JGKA 3I9FA 1D2MA 1DQPA 1G5IA 2N1MA 3G2HA 4EPRA 6CHYA 2V9PA 2HQ1A 4G3XA 1IC6A 2EX4A 1DG9A 1IVNA 3AQIA 1M2JA 2WQZA 1B1AA 4J7XA 4J75A 4BMSA 3KLMX 4TMTA 3T1NA 3MWKA 1GAEO 4PGAA 4LY0A 2YJ4A 1H6BA 3ULKA 3IIEA 4MAFA 2MYPA 4XIGS 3FMVA 4GBJA 1I3KA 3ZHRA 2GD1O 4BNLA 3ZJTA 1ZJ6A 4RMJA 4RMNA 1PQWA 4KGVA 3S2IA 3CISA 3RRZA 3UKJA 1F0KA 3QLJA 4KQCA 2I4RA 1FRFS 2V7WA 4B76A 5ECDA 3OOEA 1MORA 5H68A 3OZEA 1VG0B 4BLOA 5C8XA 2W37A 3WADA 5A5VA 2WILA 4LJLA 2W6CX 4MV7A 1OI2A 3QE2A 3AVYA 1YZHA 1LX6A 5C53B 2LCFA 2VZEA 5KUTA 1EGAA 1PX2A 4LXXA 5KI6A 2G83A 2B2CA 1M76A 1Y8QA 4PIVA 3GROA 1ADJA 3K15A 1GZVA 1P5FA 1PNQA 3DT9A 4BB9A 3HKCA 5FBKA 3MMPA 1STOA 4EX6A 4LWQA 2BJHA 2J5QA 4H0NA 4EY6A 2JANA 3IDAA 2GN1A 2J45A 1XIVA 4TXNA 3RYCB 3PHJA 1A0OA 1RAIA 2HCBA 3Q3JB 5K0SA 2UKDA 2CLFB 4FN5A 13PKA 1GNRA 4R3NA 4XLLA 3H9GA 3QXGA 4GI1A 4MQLA 2QTVB 5AKZA 1SXJD 3CPHA 3N8HA 3EGWA 4CQLB 4MYDA 2ET6A 1XBTA 2Y9PB 1N2BA 3U7GA 1GNPA 1FSGA 3OZDA 4ZJPA 1S2GA 2CBGA 2E6UX 1A3CA 5EMJA 5HPYB 2XE4A 4RLHA 2Q7OE 5B1SA 2WRZA 1VI5A 2TSYB 2IYNA 4DG9A 3UAXA 4RCZA 5DH9A 1P7PA 3EIWA 4HNRA 3KTDA 4F2PA 3B53X 1R0LA 1Y1PA 2FK8A 1YR2A 3P0IA 3PF8A 4XRRA 2GRAA 3UENA 2JW5A 3DCNA 4Q93A 1P60A 2AEJA 2WF6A 3G13A 3IQIX 3L0ZA 1XJQA 4XFJA 4UXJA 3ZJ4A 4AZ0B 1OWLA 1Z6GA 3RRBA 3W5VA 3MNFA 4KQMA 3EA0A 2ZSIA 3KXKA 2E3JA 4HO1X 3AEUA 4Z0NA 3WAKA 4AICA 3PSAA 5IKOA 3TQHA 3ENNA 3Q85A 4TUYB 1HLGA 3W6UA 4J0QA 3QPWA 4FOLA 4MCJA 4Q15A 5I9LA 2RH5A 4DR7B 3UHPA 4F4UA 1XKTA 4HGNA 4CM8A 1PFQA 3D7MA 3KEFA 1L5OA 4FXOA 4JUCA 1U1IA 4XI9A 3UK0A 5KTMA 3DEHA 3ENWA 5DX8A 5BYAA 3AFOA 1OXTA 5HFNA 3GRCA 1M5UA 1W7AA 2C82A 2JGFA 3VO1A 2WG2A 2J4FA 3T06B 4E7OA 5HDQA 5EJ9A 3E9RA 4YMGA 1XVIA 5C2JB 2A9RA 1HXHA 3QKRA 1KJZA 1RWMA 5BNFA 3KR2A 2MYTA 5CCBA 4HYTA 5G41A 5B30A 4LAFA 2AOUB 2VDRB 3NHYA 3TZCA 5BNTA 4X8LA 1P1FA 2XNHA 2QU7A 3EFEA 3SX0A 4D4GA 1UDBA 1FLNA 1FMLA 4E2WA 3ABOB 4H4EA 1MFZA 4F06A 4F8EA 2VT7A 3ZGXA 5HKAA 1BX3A 3RC1A 1ZSVA 4BMNA 5LPNA 2PX8A 3BAZA 1MTOA 5EIHA 4RC9A 5E7IA 2IHVA 4I3HA 1D0IA 1K0UA 1G8AA 2BKAA 2C9CA 2F1JA 1EUZA 2QTHA 2ZJ5A 3M2TA 3AINA 5I4IA 1TA9A 3O82A 3AOEC 5LYJA 3IIJA 2WWVD 3Q8KA 4HH3C 4O4IF 2OZLB 5H83A 4HDOB 4QTYA 2HXYA 3KG2A 4WADA 5AD1A 2IEIA 3OZBA 4LYYA 3LP6A 5ALQA 3BX1A 1SUIA 3CB4A 1V95A 4Q66C 3D6FA 4REOA 1H23A 2AYYA 3KR0A 4QVKA 1WTCA 4WCFA 2IP1A 3T7IA 4UJ3A 4ZTBA 4IJ6A 1A9XB 1TM1E 2JCVA 3WNCA 1SA0B 3PHCA 4TL6A 4EI8A 3J80A 3H2IA 3D4OA 4JYPA 4UVEA 3I28A 4WZBB 1KMMA 1D0VA 1RE1A 2YMQA 4YNBA 4DJAA 1DUVG 2EYUA 1CZRA 2I91A 3TZ6A 3NIWA 2ATXA 2FEMA 2XT6A 2XBMA 1DKQA 3IJRA 1RYZA 1N77A 1O6ZA 2EZ9A 3IO3A 4GX0A 1I7QB 1XCBA 3CURA 3UFXB 1LW7A 4QARA 4IJQA 2QX9A 1AQIA 5EIOA 2DPGA 1Y3IA 2X2FA 5CT6A 1X7DA 1S5PA 2DHQA 5GONF 1OCEA 4JQOA 5H9VA 4US0R 1ZXBA 2FTKE 4DR6B 2P9CA 2GBIA 2C5SA 2XZPA 4MEJA 5CHEA 3UH0A 3DBRA 1CR6A 5EVCA 5JDIC 1K4MA 3UAYA 5H3HA 1WXDA 3KDAA 2QYTA 3V4SA 4O4LA 3EVGA 4UHHA 1TECE 1DJMA 1CRWG 2RDMA 4GLJA 1QHHB 4JLMA 4F5ZA 5JJCA 1VBNA 1X1QA 1XTQA 2ZAMA 5B57C 1LJUA 1PR0A 2CF5A 4FZJA 3R7DA 1NI4A 4UKDA 4XIYA 2VA8A 5DT9A 2V8OA 4RZIA 2I65A 2LUOA 2WSIA 5FF9A 2AOWA 1S4MA 2VJPA 3RFUA 3TINA 1U63A 4MWCA 4RGVA 3R5TA 5E1MA 1JAHA 4EY3A 5A9RA 2HRQA 3JW8A 3RUIA 4TLAA 3F6EX 5LUBA 5CVTA 2BTQA 4E7PA 1KNXA 1PGQA 1HKHA 2DWCA 2FPIA 2HTEA 4OHZA 3VU3A 4KHPB 1CFJA 3D5TA 4AJJA 5BR1A 3I6QA 4UMEA 2HADA 3FCCA 4MCHA 5G1NA 2X3FA 3O93A 3SSNA 1YHNA 4B83A 3CZ4A 5E1DA 1ZN7A 8LDHA 1GNVA 1N1MA 2ZJ7A 4UHEA 4EUNA 2P1ZA 3H18A 3OF5A 4N0DA 4PPQA 1ORTA 2QA5A 4P82A 1EXMA 3JX9A 1ULBA 3EISA 2PZJA 1WBJB 4PSKA 3TI7A 3UWOA 5CG1A 5CXQA 1E6EA 5JSFA 1YQEA 1E2KA 1GAJA 1ST2A 3WL6A 2B99A 1XJWA 3G0OA 2YIMA 3UJCA 4CMJA 3O8RA 4LZAA 2R96A 2XIQA 4RWZA 5JC8A 4N39A 3VKFA 5SZKB 1WV0A 5JJBA 4YAGA 5E6UB 1JXOA 2HLDD 3OI7A 4MUIA 3SC4A 4NCBA 4OLAA 1R2QA 3FYTA 5BVGB 1JSLA 4RZQA 1Y9JA 4Y9UA 1X7ZA 2QI9F 4NABA 1ESCA 4KKXB 1Q7EA 4KWEA 4PO1A 3SZOA 2HY7A 5FL3A 2ST1A 4F8JA 1JYSA 2REOA 2VJDA 1PJZA 2JAUA 2JHPA 2Q3LA 1DAOA 3KQTA 3NUQA 1XQWA 3RFXA 4DIDA 4MSUA 4M9CA 1XPOA 3LUPA 1FIUA 4UBNA 1ABEA 1SIOA 2NYAA 4MS1B 3WLIA 1KEKA 1GUDA 2ODNA 1J8MF 3R3SA 5DGCA 1CUSA 5EIBC 3EPHA 1SCAA 1L4NA 3PYXA 2QTNA 1T5TA 4CG0A 3L79A 3EYAA 2QBYA 4KR7A 1R7RA 2V5UA 1BMQA 4WVFA 3AJ9A 3I2JA 4AG6A 4PC6A 1HKUA 4A8TA 4EYOA 2GLUA 4DRXB 3H2JA 1H2WA 3Q7PA 1XZIA 4CCSA 2JEYA 3MJVA 1FDVA 1JDBC 1QHHA 4GI5A 1CJSA 2CXHA 5FOVA 2XMPA 4BMZA 5BURA 1CUAA 1DMRA 3K71B 3E23A 1P4GA 3ETCA 2V6JA 1C3EA 1N9GA 1PDOA 3F7OA 3H4MA 2PMBA 1D7AA 2CNLA 1V3VA 2MYNA 3BPSA 3MXTA 3WLLA 4KQJA 4I50F 1A9ZA 1SBIA 1MAVA 4MOWA 2C9BA 2EW1A 5IWCA 3QKSA 4J7AA 3ZLTA 4V0QA 4BNXA 1Z37A 2BD0A 3I9V6 1SVMA 1P3DA 3GJYA 3CWZA 3IMCA 3D6JA 3QVGB 1PK8A 2XA1A 4GX5A 4ROTA 4C7XA 2B25A 2XOEA 4KUGA 4D3XA 3NI2A 2ODAA 3LUJA 4GMXA 5EZYB 2JLYA 3WLRA 4D74A 1UBLS 3ICCA 4PZEA 3ROQA 5FOQA 5FLKA 1U2EA 2VWPA 1U9IC 1OBVA 3KE9A 4DPLA 4FYJA 4N41A 1CF2O 1WKBA 3LOPA 3IUSA 5LXTA 3GGOA 3SQXA 2VI5A 3INYA 3LIIA 1ZNWA 2A8YA 5E6UA 4M1SA 3ONFA 5F9HA 1W2WB 3IB6A 1DAFA 2PLWA 3H2BA 3EGOA 1U1FA 5F2EA 3UTCA 5BVGA 4JDUA 1KJ8A 4AY2A 3MLEA 2HO5A 1DRUA 3X1DA 1AQUA 4CEJA 4UUQA 5EY5B 6LDHA 2O23A 3FPGA 4FONA 4YCDA 1OXVA 3L46A 1H9AA 4OJQA 1PG2A 2RAUA 4DEYA 3H0CA 4GZ5A 4IDEA 4BNGA 1E7SA 1AMUA 5IH7A 2JFOA 1DP4A 3C7DB 1YU6A 2WTMA 3OHPA 3N2EA 4AN1A 1L3CA 1IY2A 5I7AA 3ZGOA 3DC2A 1QB8A 3BHIA 4KO3S 4YK7A 2J9FA 3UMGA 1S2DA 2XMQA 3RREA 1N75A 2A0FA 1N6HA 1D8AA 1MZVA 2FZ4A 2HDOA 4LMAA 4MWGA 4XSVA 4IQ8A 3UUWA 1V5EA 3WWZA 1CRPA 4LN1A 3BWBA 4HDNA 4JC0A 3BXZA 3OEHA 4C0KA 2VZ0A 2PT9A 1Q50A 1UFRA 2E37A 2X5KO 2YVUA 4FK8A 3MB8A 2VWQA 2OMEA 4KIFA 1XZEA 4OU4A 3U17A 1USVA 4LOJA 1I2ZA 1L7OA 2EL7A 3BK1A 4RJIA 3N6VA 1MHPA 1E7MA 1WOYA 2ZU0C 1L5NA 5TARA 3VZQA 4R0MA 5JMOA 1MAUA 1N9ZA 1WUJS 2EFHB 4QDJA 721PA 3RG2A 2PBZA 2ZJ6A 1TW2A 3GY0A 4MKGA 4WLUA 3ROXA 3TFQA 4EW6A 5AW6A 1HK7A 4FZ5A 4UU0A 2FSVA 4GSLA 3FYSA 2B94A 3LQ2A 4G4SO 4LDZA 2ZWPA 4U39A 4CMIB 1WU7A 2XWQA 1IDOA 3ZJVA 1ZJWA 3MT9A 3ASZA 2V7EA 5A3RA 3THWB 3ANTA 2F67A 1DQZA 4QHYA 2MSLA 5EXTA 5MGBA 5I7VA 1A9PA 1MOPA 3W7BA 1X7YA 4MKZA 3DMRA 3IA7A 3OE5A 4KO2S 1ZK0A 3NDBB 4YA6A 1CJTC 1TA4A 1D2RA 1WDTA 3GUHA 2Q4TA 3KBOA 3X44A 4DIKA 5DDIP 2VNHA 5CURA 1VQ1A 3NGXA 4CIAA 1LNZA 4FLEA 4FVTA 2PTHA 3LBNA 1ODTC 1ZIXA 1JJFA 3KOUA 3FMPB 2PE5A 1YCHA 3ANNA 4U2BA 4IDAA 1PD0A 4X45A 4DM7A 2AZXA 1NWCA 1S2MA 1XPUA 1UM9A 1ESEA 3B1FA 4X6UA 1LSOA 2FPOA 1AKNA 1EG2A 3ROGA 5IDWA 1OSNA 1PWYE 1PR1A 1WABA 1ZICA 3JQ8B 1M1UA 2YNMA 4OBBA 3QI2A 4L4SA 1OFVA 2HMUA 3D1VA 3JV7A 3DMPA 4GM0A 3UH1A 3W0LB 2P40A 2ZANA 5KCMA 3JVEA 3U7QA 1XRRA 1NXTA 3C8ZA 2DHDA 3H5IA 4HX2A 4OJKA 3JQDA 4XIJA 1MA3A 1UH5A 1DLIA 1JG6A 2XT0A 4M9ZA 5FR2A 4FMPA 5H5JA 2GHTA 7ADHA 3U44A 2G6TA 2Z8XA 2ZZKA 1MW9X 3PGJA 4NZOA 1RJ9B 2I1VB 5D3ZA 2IWRA 4AZTA 2OYSA 2YXEA 1QF6A 4ALKA 4BJ5A 1FLVA 4XQCA 5DZSA 3WR5A 4MQ6A 3EQ6A 4EA8A 2N9UA 5IT5A 2X8JA 2A92A 2X7JA 4QPCA 2G0TA 1W52X 2BSQA 4Y2HA 4LDPA 4TVSA 4OCZA 1M2HA 4YO7A 2GUWA 3VOAA 4NAHA 6YASA 3DONA 3GH3A 1CQJA 4UBKA 3S2SA 8OHMA 1GGJA 2PZMA 1V5GA 3IEUA 4ZRDA 3AKDA 1PRYA 3WVNA 1DAEA 2CKMA 2A9FA 1KKUA 3OZFA 1B76A 2J0VA 1KK1A 1T4CB 2FE1A 4G5OA 4NL4H 2ZITA 2C5LA 4PZZA 1KBZA 4R41A 4ZZ2A 1H1DA 3NMUF 4LQCA 2CLKB 5TVKA 3T0FA 1K63A 1PNOA 1VSUA 1PQPA 1Z8DA 2HZ7A 2QNRA 3KU4A 2AI2A 1YA4A 2JI9A 1BKSB 5ESXA 4E88A 1R5BA 1T5OA 3LVBA 1L4MA 5BPHA 3TQQA 2J6BA 2RIRA 1ZSNA 1GPH1 5K51A 1M8GA 2HH9A 1FYWA 3QA9A 1J99A 4L8WB 4V24A 3MMSA 2HK6A 4JBLA 5KJEA 4ABTA 4OHMA 3KHKA 5AMXA 4PIMA 3VO8A 3PX2A 4QZVA 2ZIZA 4ZZ0A 5A4MS 1RM0A 5J4KA 3BWEA 2C31A 3LC1O 1RAAA 2QZSA 4GYKA 2QLTA 3L0DA 4I08A 4Q3KA 4UPDA 4WINA 3T3IA 3WB9A 5LMNB 1VJ1A 3RYHA 1J6UA 2A88A 3GOHA 2I7DA 5DWVA 3LPAA 4JXZA 1Y5LA 1Z0UA 4JB8A 3GRAA 3TCKA 3GMSA 3WIEA 4YT8A 1GQRA 1RPNA 2X15A 4DL9A 3I1YA 1UJ6A 3N2ZB 5LOVA 2PUGA 5A2QA 3B9QA 4HLUC 1MO5A 4FC6A 2WAMA 4C0AC 4U7WA 1N2HA 2DTEA 2P65A 3FG9A 3LX4A 2Z4RA 3CXUA 3OQPA 5TJ9A 2FHPA 3R75A 2ON6A 3L6RA 4E5DA 1FTGA 2P0AA 1Z4NA 3H1GA 2QTFA 4V0OA 1D1QA 2FSHA 1J09A 4NK5A 4RA9B 4F6RB 5ICEA 5IC5A 1C3VA 5H81A 1P75A 4U7FA 2NQ8A 4P7FA 3STWA 3A9SA 3GJRA 3B5EA 3FPBA 1M8JA 3PV0A 4QA9A 2BKXA 4D97A 2I55A 3OE1A 1G41A 4C0QC 2ZIXA 4R98A 3RUDA 3RVMA 1CY6A 4J0KA 5BSVA 1KVSA 1PV2A 2AN3A 5FOSA 3HYTA 5HF6A 4A6EA 2BUBA 4YUAA 9ABPA 9ATCA 4QLBA 4DJEC 2R6DA 2JIZA 4G5RA 3W1EA 1ZN9A 3P9RA 4B9AA 2QRMA 4WFQA 1HUQA 3BFXA 3CN7A 1E18A 3TO5A 4YWJA 3WYCA 1M6VA 1A95A 1XA4A 1EDZA 4AF8A 1YJCA 2ZRBA 1HDYA 1VJRA 4XM0A 3REOA 3ZY5A 4A0SA 1TPYA 2VXOA 1LPNA 3AI1A 1VJCA 4HJXA 3TNDA 4P83A 2FRDA 2ZPUA 1T9GS 4MUFA 1NL3A 3V8PA 4JJ4A 1RBZA 1X9GA 1P1RA 3MJSA 2VBGA 4PXYA 3PNMA 3ZOKA 4CETA 1ZN8A 4YXWD 1JL3A 4LV8B 4X1IB 4B3MB 3CKLA 1GRNA 1LDNA 1DC8A 2KE5A 2VQ6A 1PJSA 2BHTA 1J42A 1TLTA 1GPMA 1LK0A 1P4JA 3WRVA 5DPMA 4EW3A 1DG3A 4OHFA 4ZV9A 3LK6A 5KREA 3VR4A 1NI3A 5ETJA 4L4XA 1QAQA 3JS5A 3HCOA 1JPVA 1ND6A 1YMVA 2E4XA 4LKOA 2BYTA 3PGXA 4TSKA 4U5QA 4QUGA 3X2FA 2VDMB 3LFHA 1A88A 1GG5A 1UPTA 3INTA 3O75A 3OP4A 3DZBA 3M1IA 4L7VA 3H0KA 3L49A 3AR5A 5AUQA 4Z1MA 3VPAA 3UGJA 3VJLA 3OLCX 1LVHA 1OBHA 4OYHA 4M7PA 1PZEA 3UXYA 3UPTA 4RK7A 3PJGA 4YRKA 2CXNA 2G70A 4M4SA 2VHWA 2GF0A 4LISA 3UUGA 2CFTA 3TNFA 2ZQYA 1JFVA 1RZVA 1UDCA 1OWOA 2O2CA 3D8RA 4G9BA 2JAWA 4X1KB 4ESEA 5J40A 1TW3A 2QGZA 4YAEA 3TNJA 1B0AA 1U4SA 3CQ9A 5CXXA 1HPLA 1JE1A 1L7EA 2Y68A 4TMWA 4GRAA 4XUEA 3AB3A 4EDFA 1DT3A 1VKNA 3DAFA 2J5KA 2P41A 3K0AB 4W7SA 5AW7A 1JKMA 2D1SA 3CH5A 4P80A 3T9EA 1SB8A 4YMTA 3NR2A 2JVIA 5E1BA 1YK0A 1OXMA 1XL0A 4L50A 3C2QA 3WYDA 2PKQP 1ZUNB 1RADA 4ZCPA 4R81A 4E08A 2QN7A 1VA5A 3U6BA 1SCIA 4NPHA 5G0TA 4GKJB 3PL5A 4CUJA 1UM9B 3B7PA 1V48A 1W29A 4UUAA 2YY5A 5T67A 4DSOA 4AJNA 2AA3A 4DV0B 2G1PA 3MMXA 2WKSA 5FV4A 2FPSA 4MPDA 1L5ZA 2QGNA 4ND6A 1WSBA 2ZT7A 4MUGA 1JA0A 3M8KA 3OHMA 4J07A 1R66A 5ISMA 3BFJA 2BF7A 1SKQA 1P2DA 4EOGA 4GLBA 2POQX 4YFVA 3T4UA 4EZBA 1N2CE 3S27A 3NBZC 2O4UX 2DC1A 3FF4A 2IOYA 3G2LA 3QXCA 4V0NA 2RB4A 4X1IA 1BOFA 1A82A 2FNAA 2ZIEA 5F35A 2NU8A 4RTMA 4N7JA 2QN3A 1DIOB 3IUEA 5JZVA 2LE0A 3AR7A 1DTWB 4J76A 2ZSBA 3ZWVA 4C89A 5IT9A 1FP4B 1PDWA 5HKLA 4E6EA 1KAQA 2GF9A 3GMIA 3O4GA 2IC5A 3I6BA 4GXQA 4RHTA 5LR6A 1OFGA 1T8PA 2AIRA 2PZAA 3E03A 5DLYA 5JWHA 4ERXA 2XDAA 1KZYC 5JPCA 1KFBB 2BCJQ 2GM4A 1F7VA 2PGLA 4V38A 5DRYA 3IPRA 4LRTB 2YIVX 5ERGB 3DLPX 4ZXPA 1M34E 1XF9A 5ALYA 5BO5A 4F12A 3NHJA 2XYPA 4HQNA 1CS4C 5H7XA 2VSOA 4A8PA 2QL9A 3C3DA 1CDDA 3D0OA 4YHBA 2F9MA 1DIHA 1GGNA 3GJ0A 4B3IA 3TZHA 2ZRLA 1WSDA 3A7DA 3W9SA 3VMFA 4HNUA 3NWBA 4B6SA 4Y2TA 3DLAA 4OMFG 3B9PA 4MINA 1QR2A 4PHGA 1RXVA 4DLXA 4RFVA 2BJWA 4AY3A 2WQ7A 3NV7A 1TQ6A 3BXHA 4JC8A 1M34A 1Q57A 4MKIA 4CM9D 2EQAA 4W8HA 4KRGA 1DQRA 4J9UE 3RS3A 1Y1QA 5IAOA 1YI8A 1R9GA 2Y9MB 4FZ3A 5EA2A 3IPAA 2IHJA 3OP1A 1TAQA 1JZQA 5IZ4A 1A04A 1R0CA 2EV9A 2PO7A 1NBMA 4TLEA 3ZI4A 3GK3A 1Y6ZA 4W8GA 3GUUA 4RANA 3LECA 4UBJA 4CCWA 1LBIA 4EMUA 3VSCA 2RG7A 3IO5A 1TEHA 1MAWA 1Z4MA 1WCXA 1ZRHA 4NE2A 4O63O 3M82A 3VR2A 1EUQA 3T7TA 4B34A 1G3UA 2A14A 1N2CA 2A30A 3OQBA 2VTKA 4F11A 5KTNA 1J8YF 3LWZA 1TA0A 2QYSA 2NZ8A 2W71A 1FDOA 2PRYA 2CJFA 2BDUA 2ZK7A 5LB4A 3HB1A 3EE6A 4H7KA 1GGHA 3F5DA 3HEMA 1AXRA 2VA9A 2ARKA 3I8OA 4TKLA 4URWR 3STVA 3ZCTA 1KSJA 1N7HA 5JQGF 1GZ7A 1J1UA 3IQGX 4Y6RA 4IDHA 5B7PA 3JRNA 3ADOA 3CBGA 4P34A 4EGCB 3WDMA 3OOJA 2ECKA 3HO8A 1ODKA 5COQA 8ABPA 4NDNE 2D13A 3QNMA 4DLZA 2WHYA 1QH1B 2AGVA 2R7MA 3FCOA 1RAHA 1V2HE 1JHOA 1VDZA 5A05A 3FR7A 3T0IA 3JU3A 4B73A 2C8KA 4A2PA 1A97A 3VI3B 3C45A 1T4BA 1IHPA 3AFIA 3MYRA 5IJWA 4KN5A 3ROFA 2Y1LA 2X4LA 4WXYB 2H5IA 1T3GA 2OBYA 4F91B 1RBYA 3UQYS 2DR3A 3FOAA 1Q92A 3PJFA 2VHZA 3PNLA 1ZK3A 4EFKA 3CF6R 3QPVA 5CK5A 3NX4A 5DTJA 3T3MB 2IE8A 2FPKA 2YWFA 4CN8A 1QBGA 1SOVA 4YLYA 3PUKA 4G8JA 3SVLA 1SVSA 1HDCA 1QO7A 1XD9A 1XVLA 4QOHA 3WIOA 4MUMA 3GFSA 1JHXA 4HZGA 5FNVF 3A9UA 3CA8A 4Q48A 3UF0A 1IN4A 3HCBA 3TQIA 5LNK1 5KJ1A 3E2IA 2WAOA 2QMYA 1T2UA 1NDUA 1XDGA 2X7XA 2AX3A 1U0OC 3D7LA 2UYGA 2W2MA 2CHGA 5CTJA 3ROZA 3RYHB 2QP9X 5HM8A 2QOEA 4YI5A 3ZI0A 5JR3A 1NVXQ 2FXVA 1FU4A 2JAXA 1KFJB 3C6XA 4BZXA 4MW6A 4LEIA 4Y2GA 5G3ZA 4GDFA 4G2TA 2HIMA 4GXRA 4YV1A 3M4JA 2M6SA 3WK5A 1RHRA 4KQ2A 1V9SA 1QVVA 1NBEA 2V5VA 3EZ9A 4NULA 4XVQA 2NVUA 1Y5IA 1P9OA 1KQ3A 3QLUA 3F1KA 2AV6A 4NZNA 2D1QA 1AQLA 2JFQA 4U6NA 3DFUA 3COWA 1GOTA 1RIFA 4FX2A 1SQ0A 2B4RO 2WA1A 2MOKA 1NE7A 3PR2B 2MMCA 1HEIA 3DJYA 5G53C 1N6LA 1LI5A 2VUHB 3GFGA 4N4AA 1MG0A 4TQUS 4YMHA 5BV0A 3O8CA 4Y18A 1PO7A 3MQ4A 4BL5A 3C87A 4RHYA 3WJ2A 3NHFA 2OCGA 5JVDB 1QE0A 2C4UA 2IK8A 4UM5A 3W5AA 4UE6A 2CN1A 4ESHA 1DC5A 4RVFA 2B1JA 1CBUA 2XEXA 4JT2A 3UXMA 1ND5A 3E7XA 1YVEI 3VOSA 4Z3OA 3GLFA 5LA6F 3ZIUA 1MOZA 2FETA 3REQA 1ODCA 4DC9A 3HCRA 4R5MA 4N3AA 3U4QB 4KMSA 4DDMA 4CM5A 5ICMA 3IXQA 3JARB 2NNWB 1JALA 1X1RA 2DOKA 1A27A 3M5PA 1D07A 1RE0A 4R71A 4Y1RA 3DKVA 3CRNA 2RE8A 1NNSA 1WF3A 1TRHA 3D64A 2GFHA 4N5MA 4BNMA 2AHRA 2J31A 4QFMA 5C5DA 5LLTA 1KMNA 4DG5A 5BSWA 3OBIA 4BPRA 3L0SA 3PC3A 1HDOA 2CXOA 1F8FA 2A0YA 1Q0TA 2BMDA 3HI4A 4RIFA 4E5NA 4WZAA 2CNWA 4HGOA 1W76A 2VJYA 4J43A 4TXLA 4F1KA 4JL6A 3AERB 1F9EA 3VYTB 4DQUA 2VHJA 1E4VA 4WKPA 3TOCA 1NONA 2MSWA 3MJTA 3AU8A 3HA5A 3JQAA 4G63A 4HLQB 4RM2A 4ER3A 3M9LA 1C3XA 1UOOA 3ILYA 1LPAB 4RFSA 1GJRA 3UK2A 2VT6A 2VHQA 4Y30A 4MVCA 1JBEA 2AOVA 4H7EA 3UTDA 2Q6VA 5KYKA 1WL8A 2WJHA 2COEA 1NP7A 3BGSA 4B3CA 3QJYA 5A4FS 5LMCA 1Z4QA 2IOHA 3MAGA 3H86A 3PITA 5I7FA 2VF7A 5I3ZA 2OB1A 4TLMB 4PYJA 3PD7A 4B6RA 5JY1A 2NG1A 4WLFA 1CQWA 2ZBVA 3UMVA 1VP9A 1F06A 3DV9A 3S3TA 2BH2A 2N0SA 1AS2A 3PUYA 2O8EA 2D2IA 1F2TB 1PW5A 1S89A 1XOIA 1GZ6A 1ZW6A 1CV2A 2OC9A 1RSZA 4R84A 3K1YA 3WYAA 5TPWB 2I3BA 3ZZMA 3B70A 2HSEA 2YMMA 4MVJI 1M83A 1LFAA 4Q3NA 2YIJA 4IL5A 3EZ6A 1AKEA 4QG3A 3NHWA 2FGKA 4IS3A 3RV4A 3OCUA 3U4DA 2VFAA 4ZICA 2QTZA 1ZVMA 1AHHA 4LJ7A 3R5KA 3JASA 3RGWS 1SUCA 5NULA 2ADMA 3KXIA 3HA3A 3K5HA 1EQAA 2OV3A 4FGLA 4Y9TA 1JV2B 1T8SA 5DULA 1U3DA 5CPBA 1U7ZA 4EJFA 3WMGA 4GP6A 5GGXA 2GTPA 1O0SA 1TZKA 1W4AA 2LRHA 4NP6A 4M98A 3WJ7A 3U9SA 2I54A 2KW5A 2NO0A 1YOBA 3JZAA 1YBAA 3P52A 1LVUA 2RHWA 5F77A 1P1KA 3TD6A 1EXWA 3B3AA 1RPAA 3M4ZA 3O0DA 2W6PA 4K8OA 4X7PA 5GJBA 1NUPA 2H5LA 4H3VA 4RQUA 3L1HA 4UUOA 5FUXA 1DWOA 1EWTA 1B8OA 2IIPA 1O96A 5DNDA 3D5EA 4KDEA 1YVPA 3I1FA 3VSDA 5AH0A 4LSZA 4EKNB 2BEKA 4O4LF 3EDRA 3HQ4O 3AHCA 1MB0A 4AX4A 1D2HA 3OFKA 1V7QA 1EJ0A 5IULC 2CNBA 1AGRA 5JDIA 1Y34E 5KC8A 1I7DA 2PWYA 1ZXLA 4IV0A 4PPNA 2FMFA 3GEHA 3DFIA 1QDUA 3NHBA 1QLJA 1WMFA 2QW1A 3O9VA 1ODIA 2WJ3A 3I01A 4KTVE 3AHFA 3ZHCA 2GZAA 1WHSB 2Q27A 3ZVKA 1RABA 2Z08A 3B12A 1VPWA 4IIJA 4QU5A 4TWZA 5J1TB 5F21A 3KLNA 3HLKA 2X58A 5TQVA 2O8NA 1B16A 3DM5A 4IHKA 2F9LA 1YFKA 2CGEA 3DE2X 5E38A 4P86A 3MF4A 1C8LA 1BMFA 1M6VB 2C2WA 3HZHA 5L3SB 4HPJB 2QVYX 1MT3A 2PG3A 3MTGA 2C8VA 4EQ6B 2P78A 2XITA 1KXZA 1T5IA 5ALMA 3IBYA 2XRZA 3CCFA 4I1OA 1Q21A 5KWVA 4YY3B 2IYWA 1QMGA 4KYUA 2RJOA 4C9BA 2H00A 1M6NA 3RAJA 2CMDA 3FOEC 4X91A 2N47A 3HP7A 3ZE2B 5ALVA 4DDTA 5MN4A 2FJUA 2XXBA 3CX8A 4WDQA 2UXCB 3LHFA 4H1WA 5IAEA 5JS7A 1TUEA 3OOHA 4H3KB 5E2AA 3UB3A 1PJQA 2GM5A 1EE9A 1XGKA 3IHTA 3S5UA 3GB9A 3EW7A 1EVLA 1T3TA 3PCRB 4UCXA 4TKVA 1JJVA 1TYCA 2N1BA 1PR5A 1T8UA 2UU9B 2VPZA 3ABZA 1WVIA 2P9JA 1DC7A 2TMYA 1ZA2A 4TUYF 1BWRA 2WUVA 1T1SA 4ND1A 1JGTA 2DE0X 3ZLVA 3HJGA 2OM6A 5ALUA 2SNIE 4DQKA 3JVDA 2QTRA 1QIKA 4LI0A 3UJBA 3WWPA 3LLUA 2DERA 1CJVC 1ULHA 2C61A 3B38A 4B0OA 3HRHA 2OEPA 5HQ3B 4CVNA 3AT1A 1E0SA 5LOVF 3CEPB 2VNSA 4WESA 3O4VA 5ED0A 5C80A 3KBBA 5F51A 4EB3A 1Y4SA 2WP0A 2Z9CA 3DAGA 1B4DA 4RD2A 4GPZA 3ZW8A 1Z17A 4LBZA 2FW9A 2NX2A 1YWGO 1VE1A 2D3TA 4B3TB 3JQBA 4XWYA 1XVAA 2X3YA 2Y0BA 3JQ8A 3K0BA 2Z3ZA 4JBHA 4INOA 1TXGA 3KZCA 4MQFA 2M6LA 4ITRC 3DXFA 4QRDA 2FB9A 2OP1A 2XECA 3N2KB 3U7JA 1LDMA 1ZWLA 2E4VA 5ITSA 3JSXA 2PM8A 1D09A 2QE6A 3O4FA 4R1PA 1QYIA 4EI7A 4I3GA 1ZUWA 2PGAA 2YN0A 1KJ9A 1JDNA 1P31A 3T52A 1ORIA 1QUFA 3ZJUA 1T3ZA 1R12A 2ZYDA 1OPRA 1MQAA 1SQ6A 1X87A 1I4TD 1X7XB 3P2IA 4PC7A 5D1NA 1Z7BA 1MH1A 1YD7A 5IU6A 4JUFA 1O95A 4E5KA 3VPHA 4LXGA 1W47A 2Y0CA 3C43A 2XE7A 2ESRA 1I4WA 2BRUA 2X8AA 2OHVA 3N2LA 1MJHA 2MSDB 1Z6TA 4IZOA 2Q5JA 3VR5H 2F9FA 2P9ZA 3GJ5A 3TTYA 3N3AC 1X8XA 4JA0A 4XW2A 3IV9A 4E3WA 4GM4A 5CIYA 3E82A 3PVSA 4WFKA 1Z2DA 1Z7WA 5GP1A 3IBTA 3RROA 4X8OA 1P4HA 5U4XA 3GGJA 5T41A 3E0XA 3CNEA 4C01A 5CXUA 2QDKA 4F92B 2AKAB 2FQWA 1EBUA 4ER5A 1TGVA 5TVGA 3LKZA 4XXHA 3LCVB 1UQRA 4E4TA 1T9CA 5A62A 1HE5A 2WSSA 1NMSA 2FQQA 3WWYA 1SBHA 3ZCPA 2CJXA 2O2XA 9GPBA 1EDDA 2D0OB 4MQ4A 5TV2A 4MS3A 4HQFA 5JEDA 2H9IA 2J3KA 2PX5A 4M1WA 3E7FA 4BO1A 3IURA 4MQEA 4DLWA 2FJPA 3TCXB 1VL1A 2OBNA 1U8ZA 2QT0A 1P2SA 4DAOA 1ZDMA 4AULA 1WHTB 4KCGA 1KSHA 5DGXA 3ZV5A 1AUXA 3IPYA 4I4IA 2ONKA 5C3MA 2Z56A 5HXAA 5LP6F 1M6HA 3RS9A 1PE0A 1Y48E 3MWJA 3AONB 2GB4A 5E6RA 3CM0A 4MW4A 3AKEA 3DXYA 3L6EA 2HJWA 5EMLA 5H8WA 2HYIC 2XGMA 2GM3A 3I12A 1Q77A 4FZRA 4IF4A 1ZAYA 2UVQA 4CTOA 4GEKA 1P17A 1TYBE 4FYYA 3FOZA 2C7PA 2GNPA 2HQRA 1J2RA 4PR3A 2X9VA 1RCUA 3FZQA 3LC2O 5P8WA 4A5SA 4C03A 3MFYA 3PFIA 3F47A 5CT5A 2W6QA 4OHOA 1GFWA 2P0EA 3OEHD 2XZOA 2OZKA 2LW7A 1BE0A 1TI7A 3A1EA 3BJEA 3DDHA 4PSDA 1IUOA 4HAIA 4JX9A 4X20B 1LWNA 4NARA 3AEKA 1YJ8A 3JVIA 4QHTA 3Q12A 4V3CA 4EKDA 3BULA 5CEJA 4JKIA 1FUYB 3GNLA 2XQIA 4QSHA 4C4OA 1IHOA 3CSSA 3HJUA 3CZQA 1FDIA 5EJAA 1XD2A 4J0HA 4JLNA 1XXHA 4E4YA 2RGWA 4OB7A 3F3KA 2VHUA 3BCHA 3RRNA 1IOLA 2SBTA 4HDAA 1CP3A 4JJGA 1QORA 4R9UC 4TSRA 4FGJA 3AF1A 3ZGYA 2BFCB 2ZB8A 2BGJA 4P7KA 1SU8A 4ZU3A 5A3VA 3T5CA 1N6PA 4Q37A 1E2JA 2AJCA 4FFDA 4F4FA 1X7ZB 3GJTA 4DA8A 1N6RA 4PQEA 4TTSA 2QF7A 3UMJA 3V8EA 1RRMA 2BFPA 3WIUA 4HS9A 1UZMA 2LDBA 4IIBA 4AZ3A 3U5ZB 5KOHA 4YJFA 5TS2A 1PGOA 2QR3A 2J0UA 2PS9A 2TRSB 2IUUA 2IPXA 3SLGA 3V7WA 3AF0A 4BX0A 2X8JB 3QMPA 5JC1A 1U5AA 3RU3A 4Q4HB 4MVJD 3SR4A 1XEFA 4UNPA 3WV5A 3R3YA 2DFVA 5T4BA 5BN1A 1CEYA 4CDNA 3CVXA 3R3ZA 2ZAIA 2CFIA 3Q7EA 1TVKB 3PICA 4FMDB 4R68A 3RVRA 3ANMA 3OEWA 5DYWA 3KQPA 3A4VA 3K4HA 3KEMA 1FCJA 3LLCA 5CFQA 2FV8A 3E53A 3O5AA 2UYCA 3KOXA 2ZCUA 3NORA 2YIDA 1FB5A 1N32B 4LGMA 2J09A 1FTNA 2VL7A 3IYLW 2ETXA 1NZFA 2DUUA 1BZYA 2O2DA 2FR8A 4L6AA 4KKVA 3E1GA 3TLYA 3V8VA 4A9AA 1BH6A 1POXA 2XYRA 3A6HA 1KY5A 2Q5OA 3L18A 3N8DA 2VP0A 5FNVA 2F48A 4HRVA 3GVIA 4OQQA 1PNTA 4KE7A 1PI3A 3FMGA 1N3BA 5HE9A 3G79A 1PTJC 1JU3A 5AXBA 5EP4A 4HNGA 4LGYA 1W36B 1ZQ1A 1JIVA 1IOZA 2QYOA 3HBMA 4R0NA 5EE3A 1C8VB 2AMFA 3FA2A 4NH0A 1ILWA 4LPKA 4E70A 3FGNA 1R4AA 4LVNA 1FSFA 2QUAA 4BC1A 1PV4A 1C9KA 2PT5A 4BN4A 3FZYA 1JMYA 3AOGA 5D6NA 2FFJA 1IK4A 3N87A 4PTYA 1PVOA 4F04A 1GRCA 5CXSA 2OQ2A 5HRUA 3OIVA 1RBQA 1U98A 1SCKA 3EXIB 1JRLA 3HGMA 2JH9A 3NV9A 4S2EA 3WYFA 4CIYA 1JWLA 1G59A 4RTJA 1PBTA 1RYYA 2ZUDA 1FX1A 2R8OA 1Y8AA 4FQ5A 4PONA 1X2BA 4FNOA 1P0QA 1FQJA 4BP1A 5JVDA 3QE4A 1UPFA 3K53A 5FPTA 4J0FA 4NOLA 4M49A 1M2OA 2HV8A 5AVSA 3FFWA 3BL5A 1E3DA 1CQXA 4LDRA 4RA9A 2R5FA 4QTXA 5FP0A 2FE4A 2HOQA 4REMA 3WQQA 4EHJA 5IKXA 3RHZA 5ALOA 5JXJA 4M54A 4NDAA 2YASA 5CPFA 4B0PA 1SCDA 4X61A 3H2ZA 1L1RA 3S99A 2FMHA 4ZI7F 1EVYA 4EFMA 3FIUA 5CBPA 3AYZB 3TLEA 3MMZA 1KKLA 2VIIA 3LCMA 1DKPA 3EXG2 3A1VA 3NUGA 3OC0A 4Q3CA 4R9RA 4K9OA 5CA0B 3F73A 2O9JA 3U9LA 1G8JA 2QRPA 4ZOQI 1L4EA 5BVHA 3G59A 4M0EA 1EB8A 4CQMD 2W2XA 3R09A 2UZ4A 2NZYA 2IPNA 5AI0A 4Y98A 4UTVA 2XJ9A 4RF3A 5AJUA 2WLSA 3BXPA 5DM2A 1WZEA 1RP1A 1NC3A 2B1GA 3CC8A 2GO1A 3DD5A 3NDJA 3PE3A 5BSMA 4GWGA 2XVAA 1SELA 4URYR 3W8FA 3DOCA 4HN4B 4CT5A 3DBRB 3JAWA 4XPZA 3ZWPA 4NOJA 3K8OE 1GQFA 3B3JA 1LGYA 1I1HA 1TFUA 3QUBA 4D9IA 5LLDA 4OX9Y 2JK0A 4H3SA 1CQIB 2FY8A 2IEGA 3GCGA 1N3YA 5KVVA 3AM4A 1GGFA 4RK4A 5D3MA 3WP1B 4CHTA 2CC2A 3RVQA 1W6UA 2Y6UA 3F3YA 2PRZA 4AFNA 4E31A 1K1EA 2PRKA 2WD8A 1OV6A 5A0TA 1BH2A 3DEAA 3GT0A 1ELOA 3COSA 2HDWA 1YQ9A 3ZE6A 3M49A 2EATA 2XV1A 3I2YX 2XWSA 4DCCA 3MSXA 3LT2A 4GQAA 4OOFA 2C5BA 3FPKA 2QR5A 2Q3EA 2VDKB 2V7VA 3QLVC 3D59A 5T5QA 1YVDA 5TJHA 5C8YA 4D41A 5JBNA 2QN2A 3JASB 2BF4A 3PUIA 3SQOA 2Y99A 1GG8A 3A32A 4KUHA 1KMHB 1VGVA 3DR5A 2PSJA 2KI5A 3MD0A 3BDIA 3MQFA 2IY8A 4I66A 16PKA 1JHRA 2XR1A 1RLTA 1DJPA 2F3SA 3AZPA 4JB3A 3TDKA 1URPA 4QXRA 2IP4A 1JI3A 2FF5A 3AF4A 3IVXA 3LD9A 4MIEA 3WYBA 2VYCA 1USGA 3HNPA 5ENDA 3WHIA 3S0JA 1TEZA 1IXZA 2C58A 5H59A 3LT4A 3THOA 3RAPR 3C7CB 4UD6A 1E8DA 1DT5A 1FMTA 3LBYA 1U8CB 1JQDA 3MFQA 3NC1C 4D43A 3WGLA 1HFKA 3P20A 5HZKA 3PU6A 4B80A 4K1XA 1CZNA 4CMEA 5EUBA 1NOKA 4CKYA 2CZGA 1F1BA 3E5HA 4UOQA 1GDHA 1A96A 2WPNA 4NNPA 2VNKA 2VPQA 4UREA 4GPEA 1YHZA 1QRUA 3DEZA 1RAGA 3EVZA 4DYDA 1ZC4A 4Q3OA 1NZDA 1E2GA 3TZLA 5A5GA 3AP3A 2O3QA 4IQ4A 2O52A 3H11A 1VI6A 4NOKA 4WHMA 2LGJA 3SNKA 5M04A 3WGOA 3THXB 4L3WA 2AK3A 2OPBA 1G8KA 5E6SA 3USZA 1KZ1A 1PUXA 1OU4A 2J0EA 4MWOA 4J8PA 4P4TA 2PTGA 4Y7DA 1FJHA 3SZMA 4I2NA 1ZWKA 3HCNA 4C2BA 4RTKA 1UPUA 4RESA 4BNDA 1IZ0A 2EARA 1Y1KE 3OJEA 4D3ZA 1EGQA 5DOVA 3ITEA 4OUDB 2FEXA 5T6BA 3RYIA 5AJXA 3NH9A 4OY3A 4R2KA 1QF7A 2QJRA 2ZUCA 3W6PA 2NZJA 4JNCA 4CW7A 1M10A 3PQ7A 2FWRA 1CJBA 1CY1A 2HB6A 3HKEA 4ENTA 3AC0A 5DCUA 4M53A 3UW3A 2VCHA 1SIUA 3BJMA 4XPIA 5IBCA 4IIUA 3WK7A 2NOAA 2GT1A 3SMQA 5TF0A 3ZLUA 1UDRA 5CUQA 4IWXA 1AD2A 3IAHA 1FTQA 5HUQA 4JJEA 3BJRA 1ZESA 3LGSA 3L6OO 4GC5A 3EGCA 4KVZA 4KIGA 2W2KB 3FPLA 1M6YA 2BOVA 2E82A 1VGQA 3I1JA 4ZV4A 3KFVA 3KQLA 2C2MA 3RS7A 2GXAA 1PWEA 4QXOA 2HA4A 3C4JA 3E5MA 4IM7A 4YDRA 3NTRA 1D9ZA 4H27A 1ZQ9A 1EDEA 4XOIA 3EZYA 4D9HA 2GK7A 3VR4H 2BFEA 1NN0A 3KUXA 4HNHA 3FRIA 3J81A 3D02A 3SSAA 3MRTA 3NHAA 4Q4JB 5CYOA 2IVFA 3GEMA 1USUA 1X7HA 4B3GA 1C0IA 4MHOA 4G5FA 1R8QA 3LQYA 1D4OA 4YMLA 4I5IA 4CL2A 3F46A 1XNHA 3H17A 4U2EA 2JJ1D 4B4OA 4CFSA 3FSRA 1XPRA 1R8SA 5I4KA 3EG9B 3FH0A 4DDWA 3CIFA 4ND8A 5D2CA 3U7HB 2J59A 2JCXA 1X19A 4K8RB 1G9TA 4YCSA 4ZEOA 4RY8A 1Y4ZA 1CW2B 2HF2A 2NADA 1UBJS 3Q5DA 2GM9A 5TSDA 3RU2A 3UQZA 4DRYA 3KETA 4FBGA 1VKJA 2WD7B 3ZJYA 3D6AA 4NCAA 2IS2A 1FYEA 2LKDA 2PJUA 1G19A 3OJ0A 4HVAA 4IEEA 3DHNA 5F1KA 2HFKA 3E58A 4LQ4A 5G4LA 2AJLI 3GUZA 1ZRMA 2RBEA 5AKGA 3WSVA 3GYGA 2VPIA 5ALKA 3G0CA 3IV7A 5DT2A 3TEMA 1PT7A 1C30B 1NQUA 3BGVA 5F1PA 1H4QA 5CJ2A 3GO4A 4N0MA 5EJ7A 4WSOA 3S2UA 2Q8NA 4WECA 4NE7A 1MAAA 3WAJA 2W2NA 5THXA 5JY6A 4CM9A 5B3AA 3HSKA 1Y4DE 2J3IA 2Z9DA 3AETB 3EFOA 4A03A 3RIYA 4E11A 4GVXA 1EK6A 4HYYA 2D2EA 4HAXA 3A3PA 5HE8A 3UKOA 2NP7A 1FF9A 1AHIA 2O7NA 3W6NA 2F55A 1PFKA 2OXCA 2HWXA 5TQ0A 4B84A 4DNOA 2XSZA 4KFUA 3QXHA 3UZUA 1YF3A 2ZKIA 3G5TA 4M0CA 3GDHA 4MS1A 2XX3A 3MJDA 3DDSA 3MD9A 3E3LA 3WWEA 4FB4A 4BLQA 1YJAA 2QAJA 3EXAA 4GL4A 4GOND 4XR4A 3TR6A 2HA5A 3ESXA 3UW1A 3VZDA 3H5RA 1C9DB 2PMFA 4L5CA 2WAAA 4DS3A 3V1YA 3ZWWA 3DHWC 4JKYA 3GVHA 4MKRA 4XOUA 4RS3A 1GFIA 1PQ4A 1SUWA 1D9XA 2BGTA 3HVIA 3R5SA 3WGTA 4CIBA 4WH0A 1DWUA 3B5JA 5B53A 2UXBB 5G40A 4QXQA 3PDIB 4QXAA 1CUXA 1SOAA 2X1MA 3GH1A 2IGBA 1S02A 2A1IA 2H0QA 4M22A 4ASUA 4D0RA 3INRA 1TCVA 3IERA 1S2NA 2Q41A 3IP3A 4PG4A 2BM9A 3GLUA 4EG1A 2W83A 4W5RA 2C2BA 3JD1A 3TRIA 1LV8A 1SRRA 2QIOA 2YRWA 4IIGA 4RMIA 3U4IA 4R1NA 5H82A 3UN1A 1RP7A 2A58A 5D85A 1USWA 4DMKA 3I2IA 5JI2E 1KY2A 4OL0A 4PYNA 3INGA 4X24A 1NBWB 3WIVA 4C7BA 3BD6A 5MDHA 3NRCA 4R05A 4D9BA 1QR6A 1YJQA 4RSGA 3LAWA 2OTCA 3IMKA 2REQB 3NWOA 4I5FA 3WFJA 3L0PA 1H0RA 3ZV6A 1GGVA 5AW3A 5H80A 3KAKA 4NG5A 2X5OA 3B9BA 2FPPA 3HUFA 4O4JB 4PS1A 4BQOA 2HBQA 2GEKA 2WWFA 3QVUA 3HDJA 2X76A 1IJKA 3G8YA 4LIPD 4RORA 4UNIA 2DECA 2DP4E 5EJEA 3D6NB 4GX1A 2RH4A 1Y1LA 3G68A 1YB7A 2OCKA 1H2AS 4RX1A 3R7BA 1FP7A 1O97D 1PZFA 4I8XA 3TNYA 3X43A 4D0SA 3ICVA 3OU2A 2AMLA 1CT9A 3WLNA 1YR9A 3ES9A 4EY4A 2VNIA 2YVAA 3NVDA 5CFZA 3F6SA 3VU0A 2PQMA 3KPWA 3CX7A 1RJFA 4NHEA 2VP5A 2IV2X 2WUDA 2GPYA 1DHRA 1FSPA 4NYMR 3NBFA 3I9NA 4D57A 2WF8A 3FB4A 4RELA 5BSHA 1PVDA 1YZ3A 2EIXA 4N76A 1VMDA 4RF2A 2NYVA 3VC3A 3F8WA 4MEBA 3O8NA 5KSZA 3EB9A 2HLDA 4G8BA 4TMXA 1RQPA 2CEAA 2Q1YA 1NV8A 4BV2A 4S12A 2XKJE 1XRNA 5KOHB 1G55A 1UBKS 1E98A 4YRIA 4NS4A 4JLBA 2DX7A 2YWGA 1JEYA 1KDVA 4QAJA 2R48A 3EGXA 1ZXXA 5EZ6B 4WXRA 2E5FA 4MK4A 1XNRB 1NSYA 3M3DA 1GXSB 3COZA 5EIXA 1KYYA 1GPAA 1I3MA 4G24A 4A5OA 1H8HA 5CU7A 3OC6A 2CL0X 3OZ7A 4Q1VA 5JS1A 3AF3A 4C07A 2OVFA 1LK7A 3OU7A 3Q9UA 1Y6FA 1D2GA 2BP7A 2QJWA 1D1PA 4MIOA 2NTYC 4NEQA 1ZOLA 2HKIA 2I6UA 3P9PA 3ER8A 2BDEA 3QFCA 2XKBA 3ESRA 2NM0A 4H7IA 4NBTA 6REQB 1GHTA 3OPYI 1OTHA 1KJIA 3BGIA 1PEYA 3LCRA 3W05A 2XVXA 2XLCA 1XZQA 3GAMA 3HB7A 3WWOA 1G3IA 3T3PB 2XUOA 5K8LA 2WIDA 4XX0B 3F4LA 2OV1A 3OCVA 4D6YA 4F6CA 5E2BA 1HURA 1OKKD 1SUSA 3QITA 4M1TA 3RB8A 1KK0A 3HLYA 1X77A 2Y1OA 4FYPA 4RPKA 2F17A 2P2YA 4ONEA 3ZZTA 4AIIA 4DT1A 3T8YA 3ZV3A 1E3WB 2ZRIA 4CNQA 5BR8B 3ADDA 4BV9A 1Q5PA 4M0DA 3TFWA 5HJ7A 2QN8A 4Q9HA 3LWNA 5GIOE 1G64A 4L3OA 1RAEA 1U2QA 4N7RA 5ER9A 5IMSA 3EIXA 4BWYA 1OYVA 1XI2A 3GEEA 1R6VA 1ML4A 4XARA 2PNJA 3RBVA 1VKOA 2D6FA 1XZFA 4EYEA 2GVZC 4QWMA 2F64A 1YDWA 4RDIA 4QQRA 4XGIA 4BWVA 4LJRA 4PFSA 4KREA 3GDFA 2VWGA 4ZCRA 4HNTA 1GNSA 5E3JA 1OFUX 3N0XA 3DD1A 1RYHA 2ZRKA 1XALA 1Y80A 3GRFA 2Q1SA 2OSVA 4N9WA 2I6SA 2WNSA 3WQSB 2OXTA 4S1NA 2ZDHA 3EVDA 3RWBA 2FN3A 1KI2A 2GO7A 1LNQA 1KHHA 5BYJA 4YS6A 2AXQA 5DTIA 3NIDB 3GEBA 2DBVO 4H59A 4LMPA 5I5GA 2OB2A 1U3GA 2EBHX 2FEWB 4OB8A 5CW1A 3Q6NA 4IINA 2OAGA 3TTWA 3WMRA 7AT1A 3MYYA 2FP4A 2L69A 1CUZA 2LIPA 3WLJA 4UXIA 1PTJA 2AE2A 4XWAA 4FR5A 4DW8A 1BDBA 4L9AA 2Y3IA 4P4NA 5JALA 3LA8A 2W93A 1L2TA 2PZBA 5EJMA 1T1EA 3LYAA 2WP8J 2P3SA 4DDVA 4AQDA 1KH3A 1F2TA 4UHJA 1UDAA 3V3TA 3JAMA 2PUAA 4R1QA 2ZI4A 2ZBFA 1AGXA 1OLUB 3T35A 4AXXA 3NQ41 1H3FA 4ZU1X 5KZMB 4DV2B