2KX7A

Solution structure of the e.coli rcsd-abl domain (residues 688-795)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
b'MERLLDDVCVMVDVTSAEIRNIVTRQLENWGATCITPDERLISQDYDIFLTDNPSNLTASGLLLSDDESGVREIGPGQLCVNFNMSNAMQEAVLQLIEVQLAQEEVTESRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Sensor-like histidine kinase yojN
publication title Structural Insights into Rcs Phosphotransfer: The Newly Identified RcsD-ABL Domain Enhances Interaction with the Response Regulator RcsB.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 31
structure length 111
sequence length 111
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2010-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16359 RcsD_ABL RcsD-ABL domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kx7A00
2KX7A
chains in the Genus database with same CATH superfamily
2NG1A 4GX1A 2MU1A 3FMIA 3T7RA 1CVLA 3H1FA 3N2ZB 4QYIB 2SECE 1WU8A 3KLOA 3AFIA 2FCRA 4FLEA 1AQYA 1E96A 4I66A 4LBVA 3FOEC 1NA5A 3MC1A 4QHTA 1W2HA 4KR2A 1VYHA 3HJUA 1IAQA 5FRDA 3W7BA 2ID9A 1KO1A 1RTTA 4Z4QA 3K96A 2N9UA 2XVMA 4PM4A 4RH1A 4EARA 5L9AA 2ODTX 3KOYA 3ZIAD 2QMQA 5CVVA 1MC1A 1BEEA 1L5ZA 3DDUA 4OFXA 4CTNA 2BL4A 3E7WA 3DGEC 5AM1A 1EFPB 2AEMA 4ZJZA 5IM4A 1RWXA 3PDIA 5A0TA 2WVHA 3QKUA 3HDVA 4BGVA 4JI8B 2DHDA 1O58A 3WBJA 2X6RA 2Z4SA 3IQEA 3R7AA 3GEGA 3PGKA 4BKPA 4JYPA 4EYKA 4POAA 3O3OB 2C5EA 4R69A 3RU3A 4EYGA 1Z0IA 4KRGA 5DNCA 4NXNB 1GAJA 1IH8A 3Q3IA 5WRFA 4TYNA 3FFWA 4K0RA 1I24A 2M6RA 5M2QA 3ZW8A 1CFZA 5JDCA 4TMYA 1FLNA 4V0LA 3MYRA 2X9GA 2JLRA 4GGPA 1FIUA 1UH5A 1JHVA 1NXTA 3GFBA 1ZD5A 4FLMA 4CLEA 4Z9YA 3PPWA 2W2PA 3O1IC 3M34A 3PD1A 5JYEA 2PXCA 3PIDA 4PONA 2LD4A 3JWGA 5DFAA 1DRWA 4B6OA 1Z3CA 5IT4A 3HR4A 3IJPA 3IDSA 2Q3HA 5DW0A 1QLJA 3O95A 4WOJA 1JBEA 2AOVA 1XRNA 2C5GA 2GUWA 2X0NA 3H1GA 4OY3A 4Y7CA 1VBFA 3Q72A 4MDHA 3KPVA 2I4IA 3N2KB 2ZRDA 3C6KA 2XKAA 4O8ZA 3TZLA 5REQA 5HX7A 5CA0B 3IPRA 3SX0A 2FMHA 3SF0A 1JV2B 4FE3A 1DRUA 4FGJA 4H15A 3E27A 4KV9A 3F3YA 2LZ0A 4O4LB 4UCQA 4L73A 4RVGA 1FU8A 1COZA 5FL7D 3RHSA 3EHEA 3AVYA 3AF3A 3E35A 1E2IA 1XVVA 3TO5A 4MUAA 1J21A 1HQYE 2IHYA 1T35A 3OWXA 1H4VB 4D57A 1G1AA 4WN3A 2YV5A 2GHQA 3DDCA 4ZA2A 3JWHA 1VA5A 4HGZA 1DAKA 1WRBA 5TQVA 3I9NA 4DR4B 4GBGA 1A82A 2H2GA 4G1BA 4NS4A 1KERA 1BU8A 3OMWA 4RSRA 1HZZA 1M1XB 1NXVA 3PU6A 3OZAA 2YC4C 3T9EA 3D8NA 4JH0A 2WKSA 1ENZA 4X6UA 5JI2E 4AKGA 4O2BF 1E32A 1TUGA 3H5AA 1PG2A 2O3JA 3EZNA 2TRSB 2OO7A 3B1KA 3TIGA 4J49A 3VR4H 4IUYA 4XB6B 5DIFA 3GQBA 9ABPA 1FDUA 2OECA 2GXAA 5JPDA 2H06A 3RUDA 1RS0A 1F8FA 2H4HA 3DLTA 1NVWQ 4FBGA 4FZVA 4E13A 1SVSA 3CF2A 3HRIA 4MQ6A 1Z73A 1DAPA 2FZLA 3I30X 1P4JA 3HY4A 2D2VA 4IMPA 4LRSB 3LS2A 2C82A 4XIFA 5JC1A 3R9WA 2I2CA 3JYLA 4N54A 5AUOB 2F9LA 3IT2A 4HB2A 3ZVNA 2KBEA 2H0AA 2HB6A 4F3KA 1W36B 4DDMA 3TSAA 4Y0VA 5KNCH 3UK0A 3BIFA 1QX3A 2NO9A 1LPMA 1X8LA 2G40A 3MAGA 1SR8A 4QXOA 2Q07A 3QKSA 4HL6A 5BSEA 4G8JA 1QZXA 1C8LA 4X7BA 1G0OA 2HCFA 2PFSA 2WUEA 3CV3A 5J5CA 2KHZA 1EK6A 2E5FA 5SYNA 3V8EA 1LNZA 2A9QA 3SYNA 3IUSA 3DMDA 3ZZNA 4D4LA 4AU1A 4DQUA 3H9JA 4PSUA 2UKDA 5ICEA 3GDGA 3G2QA 2W71A 3BGVA 1ZISA 3L4EA 2OV2A 5DIZA 1VMDA 3JQFA 4CGYA 2PUJA 2J85A 1F0NA 4OUKX 3BC1A 3VPFA 5IX8A 4QM7A 2HPZA 1X14A 3KPJA 2V59A 4RACA 4AS2A 4PAOA 4RZ2A 4HVAA 5D3MB 5C1IA 3F3KA 2PXXA 1D1TA 1A8SA 2ZP1A 4Y6GB 4CFZA 2PZEA 4MGIR 4MR9B 3HB5X 2YIDA 1P6UA 3W1WA 2GLTA 1Z0JA 2UU9B 1TCBA 1YO6A 3N2EA 2GRJA 2H2FA 1F9EA 3NTVA 2WD7A 2YJ3A 3UJ8A 3VSCA 1U2DC 1BEUB 3KQOA 1TW2A 3TSCA 3N7AA 3JASB 1QIGA 1VE6A 3G5MA 2P27A 3HDQA 2BELA 3Q3HA 1E1YA 4LS3A 4F4IA 1RRMA 3MINB 3O6VA 5TEWA 3WDMA 2W6MA 3QVOA 3QX8A 3LD9A 4PYNA 3WLSA 2GDJA 2HMTA 5IEJA 1CY2A 2PGNA 3QBTA 2I3GA 3BSSA 4I4CA 1I9GA 3GDHA 2JAHA 3WB2A 2YZ7A 2BHTA 2ZYTX 4WNAA 4RPKA 1F2UA 1SXJA 4KQHA 3FSJX 2PGXA 4PGHA 5CNJA 3H11B 2PZMA 4QM6A 2WJ3A 3T3EA 3LIPA 4U7TB 2BGJA 4XD7D 4M6WB 4HYEA 4FW9A 4C7OA 2NAFA 3G6KA 4WUTA 5IJXA 3ASVA 2VK2A 5FT9A 1L1EA 3D64A 5L8VA 3A2MA 4LGCA 3DF9A 3LSYA 2GM5A 3U16A 1OW3B 1DTWB 3THYA 4R7GA 3LXUX 4E5MA 1SIUA 1X19A 3GD7A 4EW2A 5JD6A 1FZTA 2HQRA 3P9XA 1W8DA 3LXRA 1HMYA 4BP9A 1UXHA 4EHDA 2PY6A 5LL6P 3B9RA 5HQJA 4XDYA 4RV5A 1JEDA 2NUAA 2VXBA 2VYND 3R6WA 2OCDA 1N5OX 2I78A 4CE6A 1VDZA 3QE9Y 1QSGA 3JD4A 1RI1A 3AINA 5CDSA 1SKBA 4RJ2A 3E8XA 2VSFA 1YIDA 3AR4A 3JSAA 3QXGA 5HXAA 3W2FA 4O29A 3MA0A 2HR1A 1UZAA 3ASUA 1E1DA 3V42A 1MABB 2DMRA 4M1KA 4XX0A 1OIVA 3R0JA 2QX9A 3OZRA 1W4BA 3KDAA 2OG2A 3OLWA 4BVGA 1R0LA 2VP0A 1UOQA 2EG5A 3UHJA 1S8NA 4HG2A 1PD0A 3ZG6A 2BONA 3GARA 3D3EA 3EISA 2PH3A 2NSJA 5CT4A 1KP3A 2OLEA 2OBNA 3LKVA 4TUYA 4IIJA 1GFSA 1T25A 3S1SA 4WZBB 3G1UA 4DMLA 3THRA 1AC5A 3WLIA 4HAIA 1M0WA 1SNYA 3WA7A 4HUJA 1NRWA 2X5JO 3FB4A 3C87A 4IEEA 5FD8A 1U9JA 2PXHA 4HX5A 4ZWNA 3W77A 4CTMA 4EYEA 4OBWA 1RJWA 1ZX1A 5G41A 3S1LA 4K03A 4D6XA 3NONA 2FSPA 4ECAA 1R6VA 1SXGA 3Q3VA 2O2YA 3TVTA 3LQFA 4FYHA 4QOIA 2B99A 2IKSA 2SBTA 1PFVA 2OTCA 2VRWA 1IM2A 4M9CA 1QG0A 5TARA 5C9ZA 2Q5CA 3IBSA 4FE7A 4FN4A 4FYVA 4YRRA 4OHCA 2WWIA 2GEKA 1HM5A 1TUBB 4ZDWA 3HP4A 3EXEB 5HFJA 4JLKA 5JJLA 4AJ4A 3S7TA 4EGSA 2G71A 4D7AA 3HEMA 1FX0B 3T7KA 4GX2A 3FLBA 4L8YA 1RC8A 3NDJA 3OZTA 4OQLA 5GONF 4B33A 1B16A 1DO2A 3ZR4B 1H2BA 3GD5A 1KEEB 3STUA 2H1WA 5DHSA 4AJ2A 3QNWA 4ZP1A 4ZVMA 1QFJA 2CMKA 4I19A 3JW8A 2VQ3A 1KI2A 4X8MA 1DHRA 3GEHA 1U7ZA 3SAJA 1SUIA 1TC1A 2V8OA 1UMKA 3PLAE 4AN0A 3ST7A 4RD0A 4M36A 1VHJA 2FE1A 2VF7A 1EDZA 1EVKA 5DB4A 1XMXA 4XYMA 1Z82A 2MR6A 2ZYIA 3GWZA 1PSWA 5FUWA 1TZ2A 3KR1A 4QLAA 2HGSA 2ZSHA 4C7KA 1QORA 3EMKA 3QOFA 1EB9A 1KMHB 1T9BA 1UR5A 4GEKA 3KQUA 3EX7C 1EBFA 1PFKA 5ED4A 1U1IA 3GT0A 1M6NA 3OH8A 5IF9A 4JI6B 5EWMA 1O6GA 2HF7A 3J7TA 5CNKA 5C53B 5BSWA 2FPWA 3OF3A 2NACA 5KNBA 4E30A 1BFDA 1NVAA 1M66A 2OPHA 2PM8A 4NENA 7ADHA 5F3WB 1JZQA 1ZN2A 1MTZA 1C9KA 3FNEA 3OLVA 5IKEA 5ESXA 3QE3A 4LNUA 5AK6A 3BOSA 1EQUA 2QGFA 4PBSA 4RELA 3I6MA 3DNMA 4GX5A 3LQ2A 4HZIA 1U2GA 1U94A 1L9KA 2IPLA 3CLKA 5JSUA 5DGHA 1P9LA 1X0VA 2NSLA 1ZQ1A 2O2HA 2VPIA 3BMOA 3QYPA 4RIGA 2JEOA 3TPZA 3VU3A 3WKCA 2IX3A 4H1TA 2QLMA 2A14A 3UG6A 2QN3A 4U9IS 1CDZA 1FDWA 1X3SA 3OX1A 4WT7A 5CLLA 4KBYA 1M0EA 4ND8B 2GAJA 2YCLA 3DOEA 3B2EA 5FLYA 3OX2A 4TL6A 1U80A 1ZJYA 2J7KA 1H2EA 1LU9A 1TVEA 3OIGA 4HN2A 1V0JA 5AHWA 3QI2A 4HQRA 3MTBA 3KG2A 3SEFA 4ZC8A 1RRGA 3STTA 2EU8A 1BE0A 4CN8A 4XRGA 4R54A 1W30A 4UEKA 1U7WA 1UWKA 4EY6A 1D5WA 2HCRA 5LPNA 5K8JB 3AX6A 4J1SA 1VCOA 4C1BA 1OZFA 1F6BA 4S0XA 1FMCA 3DMYA 4HNAA 1I2BA 3GEPA 2D3WA 2WWXA 3B9QA 13PKA 2PQ6A 1TKRA 4AJHA 621PA 3HCFA 2B36A 2IZ1A 2RB4A 1MB9A 4JGIA 2GJ4A 3BE6A 5ALJA 2XWBF 3ZCQA 4G01B 4UNQA 4HDKB 2HHHB 4B75A 2RGEA 1IN1A 1BMDA 3MRSA 3E2MA 1F0YA 2ACWA 4M0CA 4MRPA 2V03A 3JRNA 1SVKA 3JR3A 1UM9B 2GCOA 3MXOA 4KQMA 2C5FA 4I9NA 1WULS 5LP1A 3AR7A 3D54D 4B1FA 4C3ZA 4N6OA 5C7OO 2GXQA 2AXEA 3F6RA 2IPMA 3VJKA 2Y05A 1N75A 2ZDGA 4C2AA 3LP6A 3LTEA 3VR5A 1A5TA 4B74A 5BNWA 5KHLB 3Q10A 4KXUA 4M8SA 1YZLA 4BUCA 3DULA 4ETMA 5FL3A 3TXAA 5BORA 4DCVA 2PH1A 4PQFA 4PV7A 3T9FA 1LBTA 1QQTA 3MBOA 3TTUA 3WAKA 4QVIA 4LF6B 2JBHA 3AOGA 3K0FB 5TGZA 3ZBTA 1OH7A 1M2HA 2WKQA 4CU5A 3IP9A 2HMYB 1U8UA 2O0KA 2XYQA 3U3DA 4DTCA 5IVKA 4ZI3A 4O33A 3M6IA 2MINB 4MS3B 1YB1A 1YE8A 2ECQA 2KYRA 3K0CA 4GYYA 5EC8A 2J3HA 4ERXA 3C6YA 5EJ6A 1LBSA 5JAZA 4RCZA 5EIWA 3F9RA 3UWPA 5AW9A 3ZWWA 1GQYA 4ZMSA 1DMRA 1PDOA 3A4YA 3I9KA 1NUTA 1Y48E 3INRA 4HWKA 4M9UA 3VO9A 3R5KA 1YD7A 2C20A 3AJ8A 2GPBA 5AJUA 4A6DA 4F97A 5B3KA 1T9KA 2QT1A 2H5JA 5I4CA 3GLUA 3ZUPA 4YXWD 3F4KA 4Z9AA 1OBCA 1E92A 2OQVA 1SHTX 2BKAA 4QATA 1GSIA 4HNRA 4Q7EA 5CYFA 2QYOA 1SD2A 1NY6A 3M6VA 2PGLA 3H2HA 2OBFA 4UEQA 4AUKA 5I3ZA 3H87A 4WXMA 5K3FA 5ADHA 3HO6A 2HRCA 2QUZA 3MWDA 1S02A 4K2HA 5AM3A 1GZVA 2ECPA 1DKMA 1JLLA 1YMUA 2HHAA 3HBFA 3QVUA 2AK3A 3I01M 4GIBA 4Q24A 3OSZA 5HS4A 4LF8B 1V2GA 4UBLA 5AYVA 4EITA 1UPUA 2QLBA 4K9RA 2IY7A 2ALJA 1G8JA 1GLNA 4LJ9A 3EVCA 2BEWB 4P5EA 1GDHA 2FI1A 3ETHA 1X7YB 3D31A 4OMCA 4G36A 4M49A 2NUBA 1LQ2A 3AERB 4UDYX 3CWQA 2RKOA 2PU7A 3W9UA 2P4EA 4BRWA 2O52A 4XLTA 3HM2A 4ZAFA 2ZXFA 2ZPAA 4D98A 5AVXA 1RHJA 2HQ1A 1TADA 3G8YA 3NWJA 3W8NA 4AX8A 3ZKWA 1OB5A 4GYKA 2O8DA 4IL5A 1S2NA 1HQDA 2NNLD 3EPKA 1KI6B 3LUAA 2VDKB 4CR7A 1T26A 2EQBA 2VNHA 1GITA 3LY7A 4B6PA 4DIUA 1RR6A 2VT3A 3LXMA 1MOPA 3FCCA 5L3ZA 1A04A 2Q5OA 2YOHA 5FJIA 1ZJ6A 3H0CA 5MN5A 2MMCA 1FLAA 3DEAA 3T52A 3NQ41 3O4HA 1ZMBA 4IYRA 3WMRA 3L1IA 3I61A 1B6GA 1R4NB 1Q6YA 3D2CA 4GE0A 4E2ZA 4L8LA 4UE6A 3KLMX 1ACLA 1FDTA 1P5FA 4DUGD 5KB3A 3R7NA 1JJ7A 1H8HD 2WAAA 1LW6E 4KXWA 4QG3A 5TMPA 3P5BA 1MO5A 4NBUA 1BMTA 2XT6A 3JVEA 5KKNB 3RU2A 3NWOA 3HXPA 3SYLA 4MINA 2I9KA 1HE3A 4NARA 4BO3A 4FFOA 4REMA 2P9HA 3L18A 4AYTA 4CFYA 3KJZA 3EYAA 1QTNA 2PAAA 1PL0A 1OXBB 3AY7A 4MB0A 3AB8A 4HDSA 3OTIA 3PZBA 1Q1NA 5KSOA 3S1AB 3B1XA 3LOPA 1H2WA 1BVRA 4WFIA 1V7ZA 2XVZA 4HS9A 1JQAA 1T0BA 1Y5LA 2IVFA 3RC9A 1S9DA 2QORA 4HMOA 3JTEA 3CW9A 4E5NA 5FHRA 1TUEA 1STOA 1O08A 1QH8B 1Y4UA 2CNKA 4KQCA 2R2AA 5FLEX 3T5TA 2VDLB 3ICCA 1PJZA 2G76A 3QX9A 5DXAA 2JFHA 2WUFA 2RC6A 4KE9A 2PKXA 4GP6A 4MYDA 4RHEA 3S70A 1C8KA 4MMYB 3AL3A 4ZPXA 4BWGA 4GPIB 2QAGA 3C3JA 3QM1A 4J94A 4JQSA 4LRWA 3QLVC 5TMDA 1JLRA 4LCJA 4NV1A 3RSOA 5GJWC 3S5JA 3G2JA 1KQNA 1HE4A 1S2OA 4EVSA 1FRFS 4WADA 5FBZA 3AIOA 3SDSA 1HDIA 3P9ZA 3UPUA 1EK5A 4LC1A 1AB6A 2ZWAA 3QUAA 2Y77A 1CUIA 1WQ3A 2P3QA 1URPA 5SZHB 2W42A 1A9PA 1S8OA 2I55A 4W5HA 1DNPA 3TW6A 4WLVA 4EI2A 1XZAA 4OO3A 4UHEA 1W49A 4YP6A 1YB4A 3HCRA 4CFSA 5KSZA 4HDMB 4WK0B 1IQPA 4D6PA 1PR9A 4I6GA 1AKTA 1NXSA 3QEOA 4OA5A 2OFFA 1ADFA 3IMGA 4XUGB 4S12A 3GPLA 1JIQA 4RQAA 3TMYA 1GNQA 3NJRA 4US1R 5FUQA 2R1VA 1NHWA 3FAZA 3T4UA 5AO9A 2X1MA 2NYUA 4XR4A 4RHXA 4F6RA 4RTOA 4YYEA 4KIJA 1HYQA 4Y2JA 1U0JA 5E4TA 5MDHA 3RYCA 1GQQA 4RV4A 1NGSA 1Q84A 3G2NA 3P0JA 3V48A 4JCOA 5B12A 1DDIA 1CQXA 4RKQA 1X1TA 4HGRA 1T29A 3N7UA 3KXDA 3OQ1A 2R1ZA 1G9SA 1G9XA 1HL3A 3K0BA 2I3DA 2O0JA 3A70A 4MUEA 5P21A 1NPYA 2K2WA 4TWBA 3PQ8A 1J2UA 3RSZA 1ZN9A 3ZXXA 5AW0A 4PLHA 5JS7A 5B3JA 4YRSA 2XZOA 3T54A 5BT8A 2ZULA 1WIWA 1CW2B 3IR5A 2I2AA 4FDTA 3D9QX 4G2TA 5JS2A 4EPTA 1NQWA 1O94C 2Y9MB 4NOJA 4X54A 4L15A 1ECBA 1U4NA 2YDXA 5NLLA 2QRNA 1R50A 4V3BA 4F12A 4X20B 1JQEA 1MXHA 2O3SA 3QIAA 5FUVA 3X2FA 4MW4A 5FUXA 4ZC1A 4X62B 3I3OA 3E9DA 2O5VA 4IX9A 1JE0A 3IPLA 4TV9B 3EXIB 4K28A 3WISA 2A84A 1L7VC 3CKLA 4M1TA 1R10A 4WTOA 1TJYA 4KO2S 5DEIA 3CUYA 2FPOA 1Q0SA 3BFVA 3RYIA 3EXHB 4W99A 2VO1A 4RA9B 5BMVA 3I45A 5ERXA 3STVA 3WICA 2WMNB 3IP5A 4GMFA 4MGEA 4CDNA 4P2BA 3JALB 5G0WA 5IU6A 1XVTA 1P3JA 1YKFA 2CYCA 2IHKA 1XJCA 4JQZA 4MP3A 1AUOA 4OXQA 3I9FA 3ULKA 5IBCA 3AYXB 1S3IA 4UDOA 4EGFA 4PSVA 2YZMA 3EG9A 3SIWA 4C2UA 1Z35A 4ANFA 3NALA 2GTPA 3U3JA 3HB4X 2FMTA 4QJ5A 1B00A 5BN4A 2OA0A 4HWOA 1P9WA 5TGDA 2DFTA 1FSSA 3Q6NA 2D4AA 5DNUA 2R48A 2FOIA 3AL2A 1P1RA 3OP4A 3IKTA 5C7IO 3QH4A 5F4ZA 1J33A 2VBFA 1RXUA 5EZYA 3HCDA 1EFVB 1CIPA 2R1TA 5JVDB 2RCYA 1GGVA 3OTWA 1NI3A 5I51A 1PVOA 1T2AA 1FFHA 2I34A 3MUFA 3ESZA 2WIKA 2QUIA 2RB5A 1XEWX 1K97A 1Z0SA 2PUWA 3FWYA 1U0OC 3GMTA 4FCCA 4HLUC 5CUQA 2I2XB 1MN6A 4I4IA 4CG2A 3U6KA 3WNVA 1Y9ZA 3EUAA 5HF6A 1FNBA 4TVBA 4YLEA 3D4NA 3N5CA 4CKEA 3MWYW 5JD5A 2V6JA 2WM2A 2YFYA 3AP3A 4KXYA 4BYMA 4WXRA 4DSZA 4H7JA 1MW8X 1K7YA 1ZGHA 4KR7A 4G67A 1LVHA 1VRWA 2CFOA 2N47A 2HDWA 2WFAA 3LY8A 4P7FA 3ECCA 1C7ZA 5KHAA 2VQEB 4ACBA 2NVBA 5HZKA 2FWNA 2QTGA 3STWA 2J3IA 4TTPA 2PRIA 4ND6A 1OXUA 3EEIA 1ZWKA 3JQ8B 4LE1A 4KYTA 4EA7A 1IOZA 4I8DA 1RIIA 2L2QA 2JLXA 5KQPA 3JZFA 2Q3DA 4PLYA 5L3QA 5ERYA 3ADKA 4LXQA 3WTBA 1ADYA 3WLRA 1ABBA 3CVWA 3ETLA 4V0OA 3A36A 1E1CA 5LOVB 2A58A 1A9ZA 2CBXA 4M1EA 4IXTA 1CUUA 3BPSA 5CFNA 1BHQ1 1SVLA 3BS4A 3FNRA 3EAQA 4ZQGA 1RRPA 4ZJUA 1FUUA 1U3FA 3ADDA 4OKIA 3OU6A 2Y66A 3IMEA 1FFYA 2WM8A 2QN2A 1Q57A 4K9NA 1H3EA 1NYTA 1T5HX 3L1KA 5T57A 1KPGA 3K30A 2YJ4A 3FDZA 2IXEA 1Z33A 3WAJA 1MB0A 3UMSA 3KD3A 2ATXA 4O4IF 1KP9A 3GZNA 4HADA 2ZJ6A 1Z6PA 1IXZA 1WF3A 4JKOA 1JR4A 3V1YA 1VJCA 3GH3A 5F2NA 4CUKA 3SOPA 4KO8A 1PWHA 5GZ1A 2YWBA 4ZIRB 1F0PA 3WRYC 1RYHA 5DI3A 4DV4B 2IIQA 4UZEA 5EMMA 5J4KA 4ZALA 2C2ZA 2G70A 3ZJYA 3PDJA 3ELBA 3BJRA 4Q47A 2I3AA 2GASA 2QTFA 1NTRA 3G5TA 4XEUA 5AKYA 2E4AA 5CLJA 4L4ZA 4KSCA 5JIBA 5DBOA 5BXYA 4N41A 1KL7A 3RS4A 3IXMA 5U1PA 3WJ2A 1U2TA 3GG9A 4NNOA 1YU9A 5SZKB 4B85A 1WU7A 5KTKA 2XMRA 2E5LB 2NVUB 1HETA 1EWRA 2RGDA 3S1AA 1KDZA 1YZVA 4J7AA 5IT9A 1UBOS 3U4QB 4UJ3A 4P83A 4EQ6A 7MDHA 2ZVPX 4RSMA 3EPLA 3FDXA 3RFTA 4QYIA 3QYFA 1JDBB 2A0FA 2CLHB 1EFUA 5J9FA 1GN8A 2L0XA 2ST1A 1VSQA 3JQ7B 1P9OA 3PDUA 4MA0A 2GCGA 2JCVA 4QWMA 3OE7A 4Q3BA 1L5VA 3EC2A 4HEA1 1O97D 3RSQA 3S44A 1T8SA 3OZFA 4FGWA 3IE1A 2Y6UA 1F60A 2P4SA 4MKXA 1Y8RB 2HFKA 1Y6ZA 2W90A 2XNKA 2Z1NA 3FRHA 3JARB 3LOUA 5C1PA 5I7RA 1EFPA 1HG0A 3EWIA 3D4LA 5J2TB 6Q21A 2HJSA 3L92A 2Z1DA 4PZYA 2DHQA 1RXWA 4KPFC 4JXKA 1G5PA 5CXUA 1XXHE 1LV7A 1DC4A 4DG9A 4IFIA 4JI0B 3EFEA 1CY8A 1F06A 5F3RA 3DFIA 2EZ8A 1WZIA 3UKDA 4Q93A 5G0SA 1P1HA 1AGNA 3N0WA 1VGQA 2ZYRA 4EFKA 2QDXA 3NBUA 3JQAB 4H3VA 2YC2C 3W6OA 4EHKA 5C8YB 1N34B 1CUCA 2Z6UA 3QX7A 1ULZA 3WGKA 4G89A 1PG5A 4JVNA 3P2EA 4D9HA 1YQUA 3HLYA 5AM4A 3L6OO 1Y5IA 4B8YA 3A3KA 4Y2VA 2ID4A 4EEZA 3N2KA 3IC5A 4U63A 4Y6PA 2CVHA 4OK3A 1TVCA 2WSSA 3BE8A 4OV6B 3LF2A 5CA0A 3VU9A 1PYDA 1WNTA 1XCJA 2WTNA 3BHJA 1PNQA 1MVLA 4NCHA 2V6IA 4O4LA 2WU1A 5G1PA 3WE7A 5IZ4A 1NUQA 4UFNA 3U7FB 4H6WA 3E48A 4INPA 1QBKC 5SV2A 1V25A 2RGBA 4RIFA 1MX5A 3TAUA 1FVFA 4DRXB 3AFNA 4CN9A 1HNXB 4LC9A 5F78A 1NVGA 5K3EA 1UJCA 3BRQA 1GNVA 4GLLA 2IY9A 2R6CA 3NI2A 1T4BA 3W79A 2AKYA 4Q4AA 4B7AA 4F6CA 3M3DA 1CUVA 1NULA 3RFUA 3RC1A 2IYSA 1QV7A 2IYPA 2W2OA 2F4VB 4BQIA 1A71A 2WIAA 3Q15C 1CE8B 1KNQA 1IVSA 1D4ZA 3BEOA 4JLNA 4NULA 4CMCA 5C2JB 4UATA 4PN3A 2Z8YM 3V55A 3A2KA 1ML3A 2GBCA 3F7OA 3QVJA 2OCPA 1RC0A 5K1ZA 1IK6A 1JYFA 1W6RA 3MCWA 1WB5A 3QVLA 2JVJA 2G1JA 2D1QA 3QWFA 4TXLA 3CPEA 4NC9A 3LO8A 1T6ZA 3NEYA 4P4LA 3SF8B 2HRQA 3W5VA 4UUNA 2FW9A 1LNQA 2C2KA 2WPNA 1K63A 3DVSX 2C5AA 3IVGA 3M33A 2PG3A 4DBLC 4OI1A 1MU0A 3DE1X 1MHTA 1Y7PA 4DVJA 5AHXA 1ZBDA 3VZPA 1E1LA 4LNHA 5AJWA 2H17A 3VU1A 1NFFA 3ZTYA 1P60A 2HNBA 2QT0A 4Z99A 3D3KA 3VAAA 1TZBA 3L0YA 3OKAA 2PQ0A 2JEZA 4FSXA 4P31A 3IAM1 4TWJA 4TYQA 1BS9A 1ODKA 2QRPA 1E1RA 4FNOA 5EIHA 5HDBB 2VEOA 4AJJA 2BC9A 2W5UA 1H85A 3PRJA 5ARBA 3IT0A 1AMOA 1P39A 2IS6A 2FMXA 3CXUA 2O05A 4GEGA 5KVAA 2DXIA 2Y27A 2XUHA 3O3NB 4XX1A 2GUGA 1XP5A 3ZE7A 1DXYA 1KSGA 2A5LA 4QYXA 3K70B 4HXYA 4IRXA 1TEHA 1QZUA 2XJ4A 1OI3A 3EZ2A 2XDYA 4N6NA 3AZPA 4DJFC 2P8JA 2DPLA 3K94A 4UCFA 5D3MA 4YRBA 4KLRA 5HOEA 1SU4A 2QN9A 5C1OA 2D2FA 1D9XA 1M34E 3G8BA 4MR9A 4QTUB 2JVKA 1ZWLA 4BMPB 2IPNA 1GG8A 1OFUX 5EJIA 4I3FA 2HIMA 4MKFA 3EE6A 2HHCA 2O0LA 1Z0DA 1IQUA 3BZBA 1MRNA 1OTHA 1SZPA 4RDCA 2PCJA 4FLFA 3JASA 1NIJA 4KAAA 1LVUA 4CNQA 2W6IA 3C98A 5LWHA 4EB0A 1BA2A 3MINA 1O87A 4RY8A 3W78A 5C3MA 1XD2B 3RKSA 4RS4A 3X43A 4CIXA 2ZITA 4BLPA 1QM5A 4OPMA 1DB3A 4QUDA 4D5EA 2BW0A 1P4AA 3T35A 3LLMA 2BWJA 3VVMA 5LU9A 2F1HA 3CCFA 3H11A 4L9AA 3ZZ0A 1B0PA 5J5AA 5HOQA 3REOA 1AA9A 2WF6A 3ONEA 5KJFA 1C0KA 2FSHA 4M6WA 5IZCA 1K88A 1C9JA 2WUVA 1WVIA 2XZLA 4P38A 4C2BA 4QUAA 3JS5A 3AUFA 4DY6A 1TPZA 2IPAB 2PSJA 3QF4B 5CLHA 4G24A 2O7RA 3UVEA 1DTWA 1QIEA 4AAYA 5IK2D 2YV4A 4R1PA 1WTCA 3I2HA 4GZLA 5IT5A 4WK2B 5E1MA 4QJ4A 4F3YA 3I4CA 4P3PA 1DXQA 1FVOA 2V0NA 4N0QA 1ZM7A 4OB8A 3GCDA 1TXGA 4PWZA 2A7XA 5LBTA 1S3FA 2Y76A 3TVDA 4BJ5A 3AUTA 3W5BA 1KEPA 1TU3A 5KDOA 2D3TA 3PRKE 5DN6A 4C4TA 3PFIA 4KI7A 2D1YA 2D0DA 4OLHA 1I9CA 4KG7A 3H3FA 1GPJA 1W93A 1E9DA 2H1LA 1UFVA 3P9YA 1UBCA 1W5TA 2J0SA 5A6SB 1ZM9A 3CE6A 4CLRB 1QO7A 3PNKA 5B2ZA 1MABA 2EZ9A 5EG5A 3VGPA 1NQTA 3DTTA 2A1TS 2AD1A 3NJ8A 4DLKA 4G4IA 5CVDA 1G8FA 1VI5A 2XYVA 3OE7D 1XG5A 3OIYA 4P3NA 4YEDA 5EERA 4F92B 3IOEA 1AOXA 3OVMA 3GV0A 5CH8A 3G7SA 2CJXA 2IXBA 3GGPA 2WMOB 1EWVA 4ASUA 2BMFA 4JV5B 3FLEA 2PZAA 2J4DA 4RXMA 1UBEA 2ECOA 4CM1A 4JBXA 2G7MC 2CXRA 2ZDHA 1U3WA 4MUGA 4WZBA 5FLKA 2C84A 1L5LA 1LWOA 7AT1A 3HXTA 5TQ2B 4TSFD 3RK0A 3CBGA 3L0ZA 3ILSA 4OLJA 5DI9A 1N6OA 1ZXBA 4ER5A 1YU6A 2FMFA 3KTAB 5FPKA 3U4CA 4KXNA 1Z22A 5MGNA 1DADA 5SZJA 1JPVA 5LNK6 4K81B 1WMSA 1YQXA 1KYWA 4I1RA 2O7SA 2O50A 2WILA 2W2LA 4MLPA 4MO9A 4UW9A 1ZXXA 2FSGA 1MD9A 3PRHA 4IY1A 1NM5C 1AHPA 3EK2A 2JRCA 2PX0A 2D7DA 5JSKA 1SKMA 3HB0A 1TUBA 1XZIA 4R6WA 1L3CA 3EXEA 2WT9A 2V1XA 2W0SA 3B2NA 3G8DA 4J4TA 3W1VA 4OJNA 3WRXA 3G59A 4A1FA 3B8EA 3QUQA 3WZ2A 3MFQA 3FPLA 2ETXA 4O4HB 4WECA 3CRMA 1UPTA 3ZDZB 3G9XA 5FI1B 1W73A 4DV1B 2GTIA 2VOJA 3PD7A 3I9V1 3QY0A 1FY2A 2D54A 3ZW9A 1OBOA 3HZHA 4G0MA 1JJBA 3VTFA 1KEEA 1QOPB 2SKCA 3EB9A 3MCTA 2JA1A 3GMIA 4GLFA 4IFTA 4K2AA 4CMHA 1ZH2A 4Z54A 5JCZA 3BVPA 2IUUA 2X41A 3A31A 3SZUA 4D9CA 4IRUB 4ZVSA 4IQ8A 2UYQA 3ZJUA 1SC4A 3L77A 5EP1A 1H22A 1QNLA 3PS9A 4YRPA 2A4KA 5U4QA 4QZVA 4PRLA 3HYNA 4H6PA 4MW6A 1ZJJA 2PTHA 2Q3BA 4P3YA 5T6BA 3VC1A 2GO1A 2IE0A 1KMHA 1KRHA 3KKEA 3QZUA 3LYUA 2QTBA 2GBPA 1ONPA 1XVIA 2YFKA 4IM7A 4L50A 1V2HE 3OJCA 2V6GA 1KFKB 1U3VA 1EA5A 2DUJA 4RLQA 3ZNQA 3ML1A 5KHOC 3ESBA 1JLSA 1ZQ9A 2JNWA 2W2MA 2PEYA 3UMRA 1GNLA 3KWMA 5CTJA 3TSYA 1Y1SA 3GAFA 4F9EA 1CQWA 1AG9A 2W6CX 2XKJE 3IKMB 2YZ2A 5CNMA 1XZDA 3OPVA 4P4UA 5FBKA 2X40A 4D9MA 3O4IA 1VG8A 1ZYUA 2BGIA 4NXMB 4BLWA 3FTPA 4C4RA 1KK0A 1SQ5A 1FFBA 1SVUA 1T36A 3ACDA 3UGKA 2VJOA 1KSHA 4CRWB 4DA7A 4RHUA 2Q46A 1KE1A 1T5OA 3RFCA 2PWYA 2ORWA 4MICA 1PZXA 2W6JD 2IP4A 3UWSA 1RI5A 2QRVB 3BGDA 3WNQA 1FS5A 2QRUA 2TMGA 3R9KA 4ND8A 5AESA 6ABPA 4EJFA 1XVLA 4IKEA 3HYCA 5E7IA 3MAAC 2Z5GA 4H7IA 3VDNB 6GPBA 3T3OA 2DKNA 4L5AA 1U0FA 1XTIA 1YMQA 2C07A 2DKFA 4MWEA 3B6JA 3O7MA 4I4TB 3CIOA 3HL0A 5GJVC 3X44A 1E1RD 2BEVB 4F2GA 5HM8A 4R1OA 4DSNA 3OBBA 3NC1C 2X5KO 5J2UB 4L5JA 4GGOA 1UFQA 2X8LA 3GLFE 2JFYA 3UPDA 6LDHA 1Z08A 3KZMA 1YVDA 4C07A 3M82A 5LWQA 3ROGA 3LCMA 3HSYA 3M4NA 3ETJA 5DNYB 4TRJA 3LDAA 4YAUA 2H65A 1RLOA 4JZYA 2VPWA 2EL7A 1YS9A 2FMUA 2GGSA 2VP4A 3A6ZA 3E03A 3MAJA 2ZXEA 3PK0A 4GRIA 1SBHA 2HGZA 2AJDA 1CPYA 4QGHA 4X1KB 3U56A 1BQ4A 3A9RA 4TWAA 5ITWA 2CLSA 3ABQB 2NOAA 1YS1X 3I1YA 1U28C 4KXXA 4MVJA 5KREA 1DMSA 2G63A 2QQGA 3K0SA 1UM9A 3OPQA 1A4UA 3WB9A 1CEQA 2B8WA 1IN5A 2G5GX 1VPDA 1HSZA 3D8HA 5TX7A 2YJNA 1VXRA 1V3VA 1K8XB 1WMBA 2W6ID 3IUJA 1FSFA 1RZRD 3B52X 4E03A 2BKEA 2JHCA 3HYRA 4MIEA 3RS9A 3DV9A 2WP0A 1P6QA 4U4AA 5CFRA 4EKDA 5KWJA 4FDAA 1CRPA 5FTWA 1DWQA 3D1VA 4KUEA 3IVMA 1S5PA 2QMUA 3RLIA 4AUMA 3GUZA 1F7UA 1L4NA 3LUKA 5BSUA 1N2ZA 3OD5A 1C4OA 1EM6A 1K8QA 3K0FA 3W8RA 3KJFA 1CY0A 1FDOA 3EFOB 5CA1B 2E82A 5KQRA 1XZEA 3ZX5A 2YWFA 3AHIA 3KWJA 3TG8A 3OQJA 2EJTA 2MINA 1JFRA 3LUGA 3MRVA 4FGKA 4MS3A 3B1ZA 4IIYA 4Q4CA 1QK4A 3EJWA 3W4JA 5LQRA 5C5EA 2ZU0C 4J91A 1IUPA 1RPAA 4FOLA 3TGWA 1DQZA 2DGDA 2GJAA 1U7OA 4MCJA 1YIAA 4BB0A 4E4RA 5IDWA 1BDHA 1SJ9A 2HPAA 1SQFA 2JGEA 2OY0A 2N1BA 2VJDA 4G5FA 4UVHA 1NP3A 3GO4A 3ITNA 3C85A 5DN6D 1QO0A 2ZAYA 4QQ8A 4OUDB 2XUPA 3IBGA 1X9GA 1Y98A 1F8YA 4OHBA 3H2BA 2IHTA 4HRYA 4QJIA 4D4GA 5KNDA 3RUPA 3U3MA 3F78A 1XEXB 2MSDB 2P62A 4LRXA 1UZLA 4S1PA 5T4BA 2D6FA 3GJXC 1EX1A 1CDEA 2VJLA 1SHKA 4MOWA 5CM8B 1DTEA 2FEMA 3DZHA 3KZ1E 5ELMA 2RBGA 2PUBA 1LX7A 2FUNB 3RRYA 3T5PA 1K2WA 5FAXA 3T41A 3MCAA 3CB4A 2RGGA 1DC7A 4DUZB 1NZJA 4ZI2A 1KEWA 3I6QA 1KDRA 2IUFA 4NEQA 3REGA 4DDWA 3RK4A 5A0VA 5JWRA 4RS3A 2W48A 4FNMA 1X7YA 3PF8A 4KXMA 5G0UA 3AERA 1I5RA 1RAGA 3H8WA 3PKIA 5ILGA 1KP2A 3ZD7A 2RJOA 4QUEA 4JDUA 5BURA 5K0CA 3P0FA 2AOWA 4UBJA 1WMAA 4JEMA 5FIUA 2UYCA 1C3LA 5HIKA 2C4MA 3VO1A 1JQBA 3HUDA 1KI6A 4LV6A 5DKFA 3L6CA 4WK6A 3T1OA 1LEHA 3VZBA 1ZI8A 2W2LD 3AM3A 3PGVA 3M6FA 4OD0A 1ST2A 3VNAA 1FDSA 3HV0A 3THOA 3QBEA 2QNRA 1U3UA 3UT6A 3VR0A 1B6RA 4R9NA 2I4MA 3GJ7A 1M5TA 1VQ1A 2R6R1 4WE3A 2I1WA 5AJVB 1U8FO 5BSMA 4XWKA 2VA8A 1XA0A 2I7CA 1R4NA 2C58A 2ZGVA 1Z37A 3OD1A 1N6NA 1OAKA 1Z25A 5JFOA 4IIXA 3GRZA 4PW0A 2F55A 1SCNE 3NUQA 1S4MA 4YP5A 2C3OA 2Y93A 4PFSA 5L4SA 3IL2A 2E89A 1PD1A 3NOOA 4OP1A 1T3SA 5EYPB 1L0BA 3WLEA 2I7DA 1S2LA 2CNWA 3RBVA 1C81A 1CY1A 1U0TA 4Q9HA 1GFIA 3SNHA 3OY2A 3KYJB 5LP6F 5LZ5A 4GNKA 3ILVA 4YY3B 1XYYA 2NSHA 2QK4A 4BB9A 4S0ZA 3TR5A 4F9GA 4ZYWA 2NVWA 4NMMA 3ZI4A 4B44A 3PL1A 4OQFA 3E1KA 1W96A 3KVRA 3ZN2A 3KB8A 1W5SA 3FVRA 3O4GA 1UEJA 3UWMA 2GNOA 4LSWA 5L3RA 4KFUA 2ASEA 1UJ2A 4JUDX 2XTZA 4RW0A 2IYLD 3ODPA 4ZGBA 1Z36A 4PPQA 1F4LA 2XR1A 3ND5A 1UBKS 3C5HA 2N3ZA 3U4IA 1YA4A 3FHOA 1MX3A 4LHEA 4QULA 4NPAA 5E6UB 1FK8A 3CW2A 3FMVA 3L7BA 4G8CA 1KGDA 1M10A 2ONKA 1P0MA 3RIEA 2E55A 2JEYA 1II9A 1CULC 4B3TB 1A1VA 3ZLUA 3UAXA 3OMLA 2JKVA 4FCVA 4FQ7A 5COBA 5G40A 2MYTA 1CK4A 1ZIXA 3H6GA 3B1FA 3O8OB 3CEAA 4CF7A 3KYDB 1FYFA 3FSEA 4FI3C 1IZ9A 3EVZA 4M8KA 1RJEA 3GW8A 3CVYA 1Z0KA 4YP1A 1EDBA 2ZI7A 5EESA 1G3MA 4HDMA 5B3LA 2BLNA 2X9LA 3R0IA 2OFWA 3CZRA 1PBNA 3FCUB 2G88A 3I76A 3T99A 1H23A 1JKFA 3CLSD 2ZRBA 4MI3A 2AFHB 3T9AA 2EBFX 3MGBA 3HPRA 5KWIA 1YWGO 4I8XA 1ODLA 2HREA 3AEQB 1O9HA 2ID7A 2OD9A 3I04A 5EGNA 3MW8A 1AURA 1L7BA 1DELA 1RZUA 5FADA 4EELA 2IS1A 1L6IA 2QW0X 1USIA 3FWHA 4BFVA 2QEQA 3BFKA 3CSUA 3DEYX 4CL3A 1SURA 4JC4A 1EFLA 3KE8A 4YV1A 4ZT2A 4TMVA 3B8HA 1PK8A 2ISSD 2IT1A 4AYWA 2PJDA 5JMWA 1BE1A 1DGQA 1KYQA 1DKOA 1GAEO 2ZVJA 3CNOA 3C8HA 2J7PD 3ZVLA 4C0BA 1NSYA 1OHHD 4C22A 1UADA 3HBNA 3SR3A 1LTQA 4HATA 1HT1E 2WTXA 1ZICA 3HN6A 4PG7A 2D7CA 2DWUA 1FJHA 3DAGA 4ZXFA 1VYVA 4MVJD 5CG1A 5BP7A 3KYCB 2O07A 1GY8A 1OX5A 1B8NA 1HTBA 2DR0A 3FOCA 3I2KA 4HBGA 4Z8XA 2QTWB 5AIBA 3AR8A 3S40A 5CFOA 4LE2A 4RLFA 4TV9A 3EXIA 1JLHA 3T34A 1L3BA 3KQKA 1TQHA 2G4CA 3DZ8A 4YMUA 1VMAA 1CRLA 1PR4A 3EXHA 2WU8A 4RA9A 3H84A 1P1IA 5DPMA 2V9CA 3BBLA 2XMBA 4AZ0B 3JALA 2GVNA 1RMTA 1ZCFA 2HAEA 4TS9A 2BFCB 3FKJA 2XTJA 4OQXA 3TB4A 1DE0A 1HFJA 3IV9A 4LG1A 3RT9A 4NYMR 1KNXA 1NWHA 3ZH9B 1ZD1A 4ZT6A 4CQNA 2J32A 3IQDB 1D6JA 1U8AA 1X8JA 2FSIA 5TR9A 1E63A 2VDUE 5HCUA 3ZDAA 5FR2A 1NI4B 2D1TA 4V39A 3FOZA 4AX4A 1WXXA 4B3GA 3UAVA 4YO8A 1I2DA 1P0PA 2WHRA 3EUEA 3LKDA 4ZU6X 4YMTA 5J1SB 3FYDA 5KTPA 2I91A 3ZZ1A 3G88A 3KXIA 3L0OA 2V7UA 1P1CA 2HV9A 4NEGA 4PXSA 4C0AC 5ALDA 1EX7A 3THXB 3FF1A 1Y1PA 4MUJA 1MC4A 3N2GB 5JRZA 2YJ6A 5IVHA 5F73A 4WK4B 1MB3A 4L4YA 1GPNA 1EFVA 2DWPA 5KU7A 1RQLA 2F1IA 2RHGB 4QOJA 4DOMA 1BWRA 1CUZA 4KNYA 1E58A 1GPLA 4OHMA 3NTQA 3ZV3A 1OBVA 1T2DA 3DGFC 2PUEA 4B3DA 4HN9A 1EPUA 3F97A 4UHHA 5I7WA 2EWWA 2Q1YA 3S99A 1K7FB 3V33A 4XWOA 1YB2A 3P26A 2X13A 2CFSA 2M1XA 1J8DA 3D0QA 3LHFA 2P78A 1KWGA 3KX2A 4WPGA 3GLIE 3CLUC 3GLHE 3RC8A 4N39A 1DIOB 1K08A 2Q4BA 4KUHA 4QOHA 1X92A 2B8EA 3C39A 1J22A 1CUBA 2V54A 4FTWA 1LDGA 4JOSA 4W7IA 5ECYA 3V00A 721PA 5EMJA 3CA8A 1Q15A 3GZ4A 1RWOA 4LY6A 5ALRA 1QP4A 3U3KA 2Z2ZA 3FZEA 5G1OA 3UMCA 2B5VA 2H85A 3HTXA 1RKVA 1OYWA 1Z6YA 1QE5A 2R8PA 2GRUA 4ENUA 1ZM3A 3JQ8A 1T3GA 2RHWA 1CF9A 5DSZA 2PKQP 4PYIA 4MQBA 1U63A 2D5AA 2H07A 4U9UA 4F0JA 4E31A 1Z7WA 1E0SA 1M2NA 1HRKA 1Z8NA 3A1EA 3EAGA 3PR2B 5D5HA 5LR6A 3JATB 4URHA 3GP8A 4IILA 3OSUA 1EVEA 4ARVA 4QUBA 4LA4A 3AHDA 1Z7YA 2FPGA 2HLDD 1O57A 1R8JA 4AO8A 3MTEA 1KXJA 2IV7A 5LOVA 5B6IA 1B0AA 2I99A 4M1ZA 3PNVA 3CONA 1TJ4A 5I9NA 4INZA 3C74A 1Y4AE 3PSHA 3K20A 4FFWA 3UXYA 1RFLA 3VO2A 2QMEA 2IY8A 1ND5A 4KFCA 1N3IA 4MTLA 4CCSA 4BJ6A 4LGYA 2GYWA 2KMLA 2CB0A 2WJIA 4MKGA 3TGLA 2C57A 3O2QB 3NFRA 1HE1C 2WIGA 4PYRA 1XCOA 1GTVA 3OEHA 1DCKA 3W5DA 3R0VA 1P81A 3GRYA 1L7OA 3QWBA 3R5HA 2CNWD 1THZA 2OZPA 3MRTA 2QTTA 4Z0TA 4MP6A 4ZIRA 3ZGZA 1RZ3A 3HGTA 3HN2A 4H08A 3Q0IA 4YJGB 3C7TA 1KFBB 2GF0A 3ZHZA 4ZO6A 1ISRA 1QPZA 4AURA 3S68A 3TM5A 2VNAA 3LUJA 2UXDB 2ZBVA 2NO7A 5K0NA 4QSHA 3ORYA 4MHTA 1ZR4A 3Q41A 4WNYA 2XQKA 5EKUA 1TRHA 1UFKA 2NVUA 3HJTA 2JI7A 4F91B 1NZFA 2RFLA 2NZ8A 1J7KA 3P32A 3U4QA 4QOEA 3SP1A 1IUKA 4LI3X 1IK4A 3O2JA 2DQSA 2Q29A 3T6KA 4UXIA 4KOEC 4XDHA 2TSYB 3JYQA 2ERYA 3JQ7A 3JD0A 4PHHA 2OHIA 1GPKA 1P44A 3E9YA 1NJ1A 1XDDA 1M33A 1H6AA 4IGFA 1G38A 4NBKA 5EP3A 4NP6A 4V38A 1E4EB 4MITA 2V5AA 1EP9A 2YWJA 2IUSA 4IJKA 1CQIB 3FNFA 3D8SA 5B4VA 1Y8RA 3SVTA 3JARA 4JOCA 5ULLA 3TLEA 2B92A 3A9WA 1V1RB 4RMGA 1Z18A 1V35A 2GN1A 3NT5A 5BT9A 4JL6A 1R4ZA 5I6DA 1PLLA 3D5QA 2ZUTA 1QHYA 2XPCA 3KM0A 1PJSA 2EC5A 1JT9A 1K8RA 5JBIA 2YXEA 1L4YA 1XL1A 4OREX 5KKAA 4ECEA 4PO8A 3PNOA 3D43A 2DBYA 3NHWA 3DW3X 4MQLA 1D3AA 3ICPA 3STYA 2F59A 3UAZA 1SUWA 4WOCA 3TX6A 2XXAB 2QR5A 4J0FA 4RZ3A 4ZCQA 5HUQA 3YASA 4TV8B 3R3JA 3JQAA 4FWBA 4P4TA 1IY0A 3W05A 5HQTA 2O5CA 2NQ2C 3QMPA 5C8YA 4MWSA 4GZ3A 3ZJVA 5TQ0B 1C1XB 3T4XA 2WT8A 2DZDA 2PKRA 5IG2A 3TZCA 3JWPA 4S1VA 4I6JA 4E88A 4D6YA 2R3SA 3RUCA 5TDHA 4XWYA 1JQKA 1GUBA 2VNJA 3DB2A 5IUNC 4UHKA 4Z86A 4QEKA 2FW0A 4DANA 4H4DA 4R1NA 3N7TA 4P82A 1TM3E 4YDSA 3BGSA 3FD8A 4JT9A 4L27A 1I13A 4DRXA 1Z68A 1P17A 3H5WA 3IAS6 4XFKA 1KO7A 1EAYA 3WSTA 1Q0ZA 2ZE5A 3A6DA 4XJTA 4QNRA 4FJ1A 4U7WA 1K6JA 2O19A 3KSZO 4D42A 3V8QA 4DSTA 2QU7A 4GXNA 2FHPA 3EVNA 4JENA 2V6MA 2VDPB 2VK4A 2BMJA 3IJRA 1CE8A 2EJWA 4KIWA 2VHWA 2PJRA 4RF5A 2OMKA 1XJWA 4QRIA 3GG2A 3UMBA 3CUTA 2GESA 3JPWA 3OEEA 4PZDA 3L6RA 4DPLA 1DIGA 3GA5A 3UCFA 1A88A 4JLMA 4R51A 4BX9A 2EDCA 2XNDD 5DTEA 3BBPA 4LXUA 5F3DA 3EVTA 3JQPA 2UVQA 3WGOA 3SF8A 2LDBA 4HWSA 3SNKA 3Q7TA 4CUZA 1FFGA 4I50F 4JA2A 1WZUA 2GN9A 4FYJA 4IQ4A 2RHJA 4EA8A 2G9UA 1ISHA 3CH6A 4ZQBA 2P9JA 1YB7A 1SKYB 1JEOA 2PJZA 3TFWA 2I8CA 4UQLA 2OEPA 1QVVA 2AT1A 3AHFA 1M8GA 1NN3A 4MEBA 3WXBA 3A32A 4FC7A 3V4PB 1WA5A 4F3CA 3CYFA 3P4UA 2FQXA 4DNFA 3IR7A 2EFHB 2VWHA 1Y34E 4ZREA 1WOYA 2XOXA 1MV5A 1ZGJA 3I39X 4FN5A 3EY9A 5C4GB 4WX2B 4XUEA 1T1RA 1P4SA 1J7JA 2VT6A 2WABA 2ZU6A 2B35A 4HKTA 2B94A 4QC2A 3N8DA 3K3PA 1M74A 2AFVA 4X97A 3WHPA 4YJ2F 1SQ6A 5CU7A 5FPQA 1YE3A 3WYGA 3TDMA 5FNVB 2HF8A 3SN6A 4QDKA 2A9FA 2V96A 1U3GA 3GNQA 4H35A 4PC7A 3OOSA 4IHJF 3JQEA 4IDFA 3AMVA 3LCUA 4HJRA 2JGNA 2F9FA 4RMIA 2X4GA 4IWXA 1D2AA 3DYIA 3JV7A 2XF2A 2XWQA 3I1FA 3JXEA 2W8ZA 4OHZA 3FCAA 1M76A 1RQGA 3MWEB 1SK8A 1YS4A 1BQEA 4K9MA 4D2IA 4OHUA 4H3HB 3RJTA 2E85A 4YRMA 1ANKA 1Z6ZA 5FTKA 3WSVA 4YXFA 1ZR2A 3HXLA 1MAAA 1Y33E 2W2XA 2YRFA 4R5MA 1GEEA 2PZJA 4U7JA 5FTMA 2JW5A 4BNDB 4D46A 3ESQA 1PO7A 1XD2A 4LZWA 1QWOA 2WIJA 1Y8AA 3BIOA 1NX6A 4GI1A 3LL7A 1T5SA 3PZRA 5IJWA 5ITVA 3DP7A 3HA7A 1FW8A 3HYSA 4CQMB 2JJ1A 3AKCA 4RY9A 3MTAA 1NDQA 1R18A 1W6UA 1XIVA 3HU1A 1LI4A 3QLUC 1GFWA 2QJWA 4OHPA 1ULHA 1JR6A 1O95C 4AB1A 4BAGA 5I7SA 1XZCA 3QF4A 3A3NA 1A0OA 4MVJH 4PRZA 2QLTA 5FWNA 3AB7A 1VRCA 3HR8A 4YAWA 1NXWA 3SIPA 2XRFA 3H9GA 5JZOA 1A95A 1NBWB 4RJIA 3CU5A 3E9QA 3PRYA 3ASYA 3AIMA 1EBUA 1XCBA 4XGKA 4OJTA 5BO5A 3GEDA 4HAXA 3MSXA 4U0KA 2WLTA 3FPAA 3AKZA 1DZIA 1BJRE 3AKEA 3M4ZA 4IYJA 4FT4A 3EDYA 4LJSA 3O9MA 2HLHA 3T4EA 3WGJA 4CMEA 2JGFA 5BWNA 4DLNA 5SZIA 1OXKB 2R96A 1BHJA 1C0IA 3KO8A 3K09C 1ZK0A 1J07A 2BF4A 3RSHA 3SJ7A 5A6SA 1KVUA 5K2OA 4BFSA 4BLOA 4EKGA 4CLRA 1Y7LA 1NIPA 1GUDA 3AP1A 3M5WA 2NZYA 3FB1A 5DW3A 2XXBA 3SKYA 3T1QA 3VV3A 3KQHA 4GPAA 3KZXA 1WNFA 3GELA 3URKA 4F3RA 2VK1A 3AETB 5CFPA 2WLSA 3K4QA 4QAJA 3OOYA 4RK5A 3SC4A 5CK4A 2WIFA 4E09A 3SMVA 1OZGA 1EP3B 1CEXA 4O0MA 1V8FA 3CB2A 1PX2A 1OC4A 1R0KA 1Z6QA 2GD2A 3CINA 5TQ2A 4UQOA 3DTVA 5YASA 1CUFA 3OOWA 2R6ZA 1LDBA 1U6JA 2WKWA 1SBZA 1E3DA 1OR8A 2E2WA 3KTAA 1WQ1R 1ZH0A 3IAHA 3W2HA 2D5LA 3GLGE 3I6IA 3R24A 1NW9B 2FEKA 3WP1B 4G5GA 5FTLA 3CT4A 4JMPA 3L0CA 2HA4A 2WMYA 3U37A 1Z5NA 3W5IA 3KUCA 2OCXA 4ZOCA 5CFLA 4QYTA 4XVCA 3PHCA 1GOTA 4E5UA 2A5JA 4RIHA 2VIIA 5FYQA 2KB0A 3UZUA 4TYPA 4GWLA 4LMPA 3SYMA 3DE6X 1SA0B 3QU5A 3ZQ4A 2PU5A 4OF4A 3H99A 3RARA 4IICA 1HC7A 3M89A 1ZD3A 4KSBA 5BQPA 1NRJB 2YZKA 1NRXA 2VCYA 1UPFA 4O4HA 4OLFA 1KWKA 4ZDKA 3CWCA 2IW3A 2JIMA 2PDAA 3J80A 3U60B 4YRTA 1BFUA 3NKLA 4YMHA 3CQ9A 1SZDA 1TJ5A 3SX4A 5BW6B 2RD2A 3R3UA 2OT3B 3DV0B 2WG2A 3IXQA 5AVJA 2JZCA 2ZREA 3IHWA 3UBMA 1MPTA 1LBQA 4GG1A 3ZDYB 5M29A 1SCBA 3PHLA 2CCGA 2WV9A 4Q9DA 2OCLA 4RKEA 3WWYA 1XSEA 4EF4A 2DR2A 1FP6A 3KQSA 5CLIA 4HD8A 2QL6A 4FYPA 1U2RA 3D2BA 1SXJE 5A5FA 4E5SA 1F20A 2ZJ5A 5HW0A 3C3DA 2AJLI 4A0RA 3DCIA 3EGXB 4WBSA 2CNNA 3ACCA 4MRVA 4F5ZA 1W5FA 5JMOA 3H0EA 5BYAA 1GILA 3ADPA 2JJQA 1IM5A 5IKMA 3MOIA 2XZDA 1EVZA 3QF7A 2AKAB 1BN6A 3GJTA 5I3CA 3A25A 5GM2A 3B6EA 3U44B 3OEED 4XLLA 2YZGA 2RARA 1XEFA 4DIEA 4YLYA 1I6MA 1W76A 2XIQA 3W2IA 3SM3A 1AQLA 1FNMA 2ZM6B 5FQNA 1P7YA 3KVVA 2EKBA 2QY6A 4DCSA 2EBHX 1OV6A 2PKEA 1BX1A 3PXDA 4ZV9A 3KV3O 1QFSA 2PMEA 1P8JA 3TLCA 4E12A 4MI6A 5HSGA 1PJBA 5CDFA 1LA2A 3HFJA 1UBRS 4YRLA 3TUZC 4FR0A 4A6XA 2VLBA 2B0CA 3WQHA 2XUQA 3WL4A 3IPYA 2QRVA 3EVGA 4Y9TA 2GM3A 2VP2A 1JDUA 4ZCRA 2HQSA 4IGEA 5EIEA 1QCDA 2UUPA 4W9NC 3ROTA 5DYNA 1T34A 2GWRA 5E2BA 3WYEA 3HEBA 1SUDA 4XCQA 4DV0B 1P7WA 2C29D 2APJA 4JASB 4I4TA 4XQEA 3HVUA 2BEVA 4IG4A 1SRRA 2NT3A 1SVWA 1T8YA 2C2HA 3VH3A 3EVAA 3IQZA 1UMDB 2AA3A 4B9AA 1LSUA 3GCXA 1FTNA 2WJGA 1YCGA 5J2UA 4ZCTA 1N4DA 2E4ZA 1PSDA 1U2DA 1UC5B 5EL0A 4CM9A 1KJYA 2ZSIA 2OE2A 4GL4A 4H59A 1HUQA 2ZSKA 3TL6A 3O7WA 5DOZA 4DJ5X 1Z6AA 2HSEA 3RPEA 3K70D 2PUCA 3TSZA 1T4DA 2ACKA 2WSBA 3QTBA 2QMHA 3QPVA 3VNBA 2BFBB 1E6MA 3WLJA 5LLTA 4PX5A 1OJ7A 1ECJA 2QP3A 1T4GA 3DOUA 3OPXA 1UDWA 3E05A 3SC2B 4F4FA 1K5HA 1UBSB 3VNSA 5HTKA 4X1KA 1Y6GA 1RVDA 2XUFA 2DX7A 2XNSA 5LDGA 3QXSA 5DGIA 3C1TA 4NG4A 4J43A 3ZU3A 4R0VA 4XE5A 2WRZA 1JG7A 1SPBS 1Q0HA 2H8KA 2QLNA 3KKKA 4JAVC 5ALFA 3C5VA 3TPFA 5LQAA 3RK1A 3UJ3X 3W5HA 1VZ3A 2H4WA 4A4DA 4B4OA 4WHMA 3MEQA 4BFCA 5CCBA 1KU0A 4Q1AA 4KRXA 2A1UB 3RRMA 1OFTA 1Q16A 3W6UA 5TEVA 2RKBA 3BD7A 5KSWB 1OIXA 3O1HB 1T8UA 3AF4A 4LCEA 2JJ1D 5BR7A 4LX0A 5CA1A 1AN9A 1M0TA 1SCDA 1T9ZA 5EE1A 3IPAA 4MW9A 3EFOA 3ZI0A 1IHYA 3EWAA 4FS3A 2J33A 3W7VA 4ZU1X 3V6LA 4FX2A 1E0KA 2BGMA 4KOAA 2VAVA 1TOAA 4KZKA 1CUJA 2V3VA 2P9EA 4KN9S 2WPDD 4P32A 1F2VA 2TECE 2JJMA 4KZPA 3J81A 1MTOA 1ZSNA 2F8TA 2IWHA 2QXTA 2X8WA 3V80A 1TU0A 5EIXA 2J0QA 3E5NA 3G7UA 4R1MA 5EZ5A 3TZQA 2XITA 2IU4A 4G0YA 4JEUA 3SQDA 3K1TA 1CG6A 1G20E 1PN3A 4HQ6A 4RDHA 4ZOLF 1MZVA 4C89A 1PYGA 4OUDA 4M7OA 3IIKA 2GK4A 3N5KA 3HVRA 1GU1A 5AW4A 1L5HB 1XEXA 1VKHA 4D02A 3NWEA 5F23A 5AI4A 1WCXA 2ZZKA 3TNYA 1VSVA 3PPIA 2O1WA 2BP7A 1NVTA 2A30A 1TK9A 3L7KA 2N1MA 1DBRA 2XAUA 1JHDA 3U9LA 1P0QA 1BQ3A 2H7VA 3KHSA 4QD3A 4F8JA 3VKGA 1T1EA 4EDHA 1ZK2A 2EKZA 5A3QA 3HZRA 5HKOA 2Y0EA 3EQ7A 1TQ6A 3RWMB 5C8DA 3DTVD 4NMHA 2JGRA 3VV2A 3EARA 1NI5A 1VPLA 3GUCA 1YR8A 4IS3A 5K3CA 5A0FA 1FS4A 3P0EA 3WQSB 1I3MA 3AONB 1RAEA 2YQ5A 3C6XA 2I4NA 1EX6A 1X3LA 4LRUA 3M1YA 4S05A 3IP3A 3BT7A 2PS0A 2YYZA 3UATA 1C1DB 4AG6A 2OVBA 4RFSB 1OTYA 3IBYA 2AZTA 3FKSD 4KIUA 1T15A 1IPFA 4X7MA 4ENQA 5A1JA 1PZFA 2DFPA 4XTCS 1X1SA 3SWWA 2HSGA 3N2IA 3MPUA 3SIRA 2XEXA 1RPZA 2XSZA 3AVPA 3DNPA 5B5SA 3D4PA 2QD1A 1MG5A 4M83A 4UUPA 4AI6A 2D8AA 2V3WA 1R2QA 1VMEA 1XROA 2DPMA 3O9ZA 1L5NA 2POQX 1PFGA 1TK2A 5IF3A 1I4DD 1JALA 5G02A 2XH8A 5GY7A 2P68A 3GGDA 1XD8A 4TRNA 5EYPA 2OXTA 7GPBA 1CEEA 5HDQA 5B58T 2J30A 4D3DA 5A3RA 4UMVA 4BZPA 2JD1A 1FYWA 5AKEA 3PXXA 4B34A 1IWBB 2GZSA 4QGAA 2EHDA 1Z8HA 1NOKA 1U3TA 1E94E 3OAAA 2YNMC 4JDPA 1FXWA 3VHLB 3DDWA 3FPHA 4Y6QA 5IS2A 2XB8A 3O8BA 1X9HA 5KEIA 4RZQA 1ISPA 1F5NA 2V5VA 4LX8A 4D26A 4GMHA 1BAPA 2VP3A 5E3JA 2NTNA 4EGAA 4D9BA 1YJ5A 5A06A 2HOQA 2P1ZA 5CX1B 2J3MA 3QJGA 3O8NA 2M98A 1JAXA 2H2HA 4ZD6A 5MN6A 3IT3A 4AP9A 4V0SA 1ZESA 3ROQA 1CX9B 1K6EA 2J46A 3BB4A 3DZBA 3PR3A 4QOGA 3RYFB 4E08A 4QXMA 5IHPA 1N6RA 5E6UA 1CR1A 3IAAA 5EIOA 3M6AA 4FOSA 2LP4Y 2ZYGA 1XU7A 4Y2HA 4MEJA 1RRCA 1RIFA 3P9SA 1U5BB 3FOBA 5KOHB 3EGWA 4M0PA 3WGGA 1M34B 2B1JA 3IVRA 2IC5A 1PVDA 3ENKA 3BGIA 3O8OA 2PSSA 4M7RA 4U5QA 1QP7A 3AVXA 3EAFA 1IEWA 3KYDA 2ATVA 2PTGA 4Y6LA 4BVFA 4KV7A 1FBTA 4TWIA 5E1BA 4Q7QA 4O2AB 1C9MA 1XRQA 1N7GA 2ZSDA 4KQXA 2BM0A 4A0SA 4G81A 4BV2A 2R0QC 1QDUA 2P2SA 4U7FA 1USGA 4NOKA 4YPOA 1CJMA 4B09A 4ZAWA 2AFHA 3KNZA 3IEMA 4FM9A 2IIBA 2CEKA 2EZTA 3AEQA 3DE0X 3QOXA 2QG6A 2I4OA 4Y18A 1KMNA 3PQ6A 1V9CA 3ZJ5A 3W2EA 1JXMA 4ZK2A 1KI9A 5ES3A 3SE0A 5A4FS 4G1FA 3LSTA 2NTEA 1BX3A 3T1TA 2ZBUA 3NRJA 2OFOA 3TUJC 1IQ0A 4N4AA 1Y8ZA 1PVVA 3PNQA 1YA8A 4K7JA 5CB4B 3HJHA 1K5PA 1YRBA 2HCBA 4YIKA 2JHPA 4WRRA 2UUOA 2XGSA 3C3KA 3FXAA 3S8MA 1N1MA 4B4DA 1W7AA 2GAIA 1G7RA 4GOXA 4QRHA 4RM3A 4C4SA 4G2NA 1YJBA 1JKIA 2QVCA 2QTAA 5ECGC 4QICA 4CQLA 1R3UA 4YPVA 1QUEA 2M32A 3DAPA 4Q19A 3G02A 1YBFA 3KYCA 3AFHA 3GY0A 5I9BA 3MMNA 1JVNA 3TFQA 2AI3A 5EN4A 1V5GA 1HLDA 1P2UA 1CHNA 3V97A 3H19A 3HUEA 1CLEA 1TQ2A 2VUHB 3F7MA 4CYMA 5IYZB 4BHTA 3N2LA 4F86A 2B61A 1PWXA 1KBQA 1JHAA 1LPBB 2ZJ3A 3R6LA 3A10A 4WN9B 3TZ6A 2BUAA 4AZ0A 2Y1DA 1JDJA 3DMRA 2FPKA 3ESRA 5L95A 2BFCA 1RYEA 5D51S 3VC3A 2QVLA 1FYEA 3IUBA 1UBMS 4Q4DA 1FXSA 1OY1A 2V45A 5EUMA 4EMTA 1TLTA 3DEJA 2ROQA 2X42A 4NSNA 4YQZA 1LSOA 2PIAA 3USCS 1GYRA 1YHZA 2LR0A 2PS3A 2Q9AA 1HDRA 2X1LA 1T8TA 3EIWA 1ISMA 5FYDA 3ZQJA 1NI4A 4YMLA 5JCXA 1P61B 1GTL1 1MJFA 1YGYA 2PR7A 2VF2A 2GNAA 3HSKA 3VKUA 1EIWA 3I73A 5JPCA 4QRDA 3KJGA 5H80A 3I4LA 1NMSA 4KWTA 3X2SA 4LY9A 1HNNA 2R66A 3U3OA 3W5SA 2QPTA 1KVTA 1YJCA 3K15A 1L7DA 3LE8A 1WUKS 3NC4A 1HV8A 4LVCA 1FYVA 3UEOA 4A8PA 3N2GA 4IUCS 4F60A 3THXA 1UKAA 3K0AB 4L85A 3ZGOA 3PT5A 2Q5HA 1AS2A 2OSVA 5CXXA 3BDIA 1R4AA 1YZQA 5F5XA 2GZ1A 1T8WA 5BSFA 2FFBA 2XCQA 3DO5A 3F6SA 10MHA 2RHMA 3MVEA 4GQIA 5D00A 1JU3A 1RWNA 3RTGA 3HGMA 3JRXA 1BWPA 4NAVA 1ZAKA 1VL0A 7YASA 2DEUA 3KUUA 1ESZA 2GZHA 2X0RA 3N74A 4AICA 5ANRB 4R4JA 2WZCA 4C30A 1CZHA 4ZVOA 2HBYA 1VJTA 1YJ8A 1ZXLA 1N5KA 1NVEA 2RONA 2XGMA 3EULA 4KQIA 2E3JA 1NKSA 3CZAA 1VCIA 2FEXA 1XEAA 2FW6A 4HQKA 4IX1A 1ZD2P 2RH8A 3PFNA 4P86A 5EWLB 3V8MA 3ZZUA 4JLVA 1KMCA 3Q2OA 1QB7A 1XMJA 2NZVG 4WIAA 2C9MA 2LGJA 1S2MA 4Z3KA 5L40A 3AG6A 2CHGA 3VYTB 5K0SA 3VNVA 3NB0A 2VI5A 1UT6A 1FYXA 4PRKA 3L8CA 3S2ZA 1NVKA 1E3MA 1OGJA 1BROA 3JATA 3V8VA 5L3SB 1QPGA 4EKNB 1PQYA 3GFFA 3PGJA 3TE7A 3O74A 3ADCA 3PKZA 4LHYA 4IEFB 2B2XA 5E1DA 5L4NA 3Q9UA 3EGVA 3VR3D 3UJ9A 1U0GA 3F8TA 221PA 2FMKA 2G04A 2AYYA 5T3UA 5CCXA 2EQ5A 4PHCA 3ZWOA 5IJ9A 2GX6A 3LA6A 3D4IA 4WNIA 1E2BA 4QYWA 4DMRA 2H63A 4EHJA 1QJ4A 4N3GA 2VRCA 3G7NA 4CHGA 1Q77A 4WBNF 3RREA 4RZHA 2FPPA 2V98A 1KYYA 1ZH4A 2Q9CA 3X3HA 3I09A 4Z9XA 5I8PA 3AWDA 3B5EA 3BAZA 3LTNC 2Q1XA 1QMGA 1AKRA 1QAQA 3QLVA 4QGBA 4YJGA 3GRFA 3B6KA 3WIBA 4RAOA 4BWFB 1TMYA 1Y4DE 9ATCA 4CNBA 1DC6A 1DG1G 2WDPA 4CWAA 3IIMA 1VB5A 3VX4A 1S01A 2GPTA 2HNKA 4MV8A 4B3HA 1HYGA 2H1CA 2QTRA 3NHUA 4IXNA 1A9QA 2PV0A 3DTYA 5CLGA 3SHVA 1I5EA 4QLBA 1ZI6A 3GFGA 1LQTA 1E18A 3ELUA 1MW9X 4Z1MA 4ALNA 4UTVA 1A96A 4L74A 3V4SA 3EEFA 1NLUA 4OQZA 3ETDA 4UZSA 4HR7A 2QYSA 3ZCXA 5HRUA 3E2PA 1QK3A 2JGMA 4HEHA 2GILA 4YJ3F 1NNLA 3O03A 3LDUA 3OQBA 1E4EA 3SG0A 4F7WA 4PZZA 1Q3TA 1P7CA 2HK8A 2I54A 2Q2WA 1CQIA 5BW5A 3M6MD 2QUAA 2Y1LA 5A4DA 4PS1A 1EXDA 1V1RA 2JGLA 4QNNA 3UQYS 2O8CB 1OD6A 3O47A 1BE8A 3EUWA 4NEHB 3IE2A 1N2OA 3EC7A 4GKBA 1UKBA 4JK3A 4OAOA 1E6EA 2IEBA 3L4BC 3T3PB 4C0JA 3FPBA 3QMWA 1DAFA 3W8DA 5IAOA 1COWA 3DCJA 2L69A 1PAUA 4WUVA 4XI9A 5M7EA 1AIPA 1M72A 1R7RA 4YCDA 3H5VA 4ZV7A 5JNVA 1ZGGA 2W6ZA 4WEOA 1O94A 3GAMA 4OOFA 2XXAA 4PO3X 1QG6A 2QTZA 5EE3A 4G4GA 1ZH6A 1DOHA 4JMLA 1YUNA 4P53A 4TV8A 2VKTA 3SSMA 3G9QA 5BUQA 3LIIA 1ILEA 1I5OA 3NNNA 2ONJA 4MIYA 2BGWA 1L1QA 2CZCA 3MJ4A 3GA7A 1DUIA 1KJ8A 3QBJA 2ZUUA 2XQFA 3DPUA 3F2VA 1LX6A 4YGYA 5TQ0A 1C1XA 3OFVA 4C76A 2YL2A 1WUYA 4DA4A 4OMDA 1G64A 5E8RA 4YJ2B 4DM4A 4REOA 4CKYA 1F51E 2K6GA 2FZ4A 2HO5A 3BKXA 1XQWA 4DL9A 1SU8A 3OFKA 5AK5A 2OHJA 2PSHA 3IQWA 4GM1A 2PNJA 3SVZA 3K8ZA 2ZUBA 5LD2C 4DLSA 3WNDA 3ZUGA 5IBQA 2PX8A 2E9SA 4PICA 4Q7LA 4PCVA 3I05A 2OC4A 3VH2A 2E18A 3AFMA 4GKAA 3ZWAA 2EW2A 4BRUA 1U4OA 3E6AA 4B6GA 3QMMA 4DT1B 1Q0UA 1Y6JA 5DWDA 2WR8A 3R75A 5KPJA 1F0KA 1H5UA 1XHFA 1XKLA 4HHEA 4TPKA 2B7CA 1L4UA 2GEBA 4TS3A 4TLAA 5EJAA 2HSJA 1MLDA 3BK7A 2D00A 3DV2A 3UGJA 4R68A 1USUA 3CVOA 3CZCA 4IVQA 4O1HA 3PC3A 5J43A 2P30A 3QPDA 2P2NA 1V39A 1YDWA 1Z4KA 2WVJA 3FNHA 2DETA 4DSUA 2WYOA 2PGOA 1ADJA 1NVFA 4RVNA 2ILVA 2NXNA 4HLUA 4TS4A 1Z45A 3G0CA 3BYZA 4LKRA 3H2IA 4NJMB 5SY6A 3UT5A 4A16A 5HZHA 1CJCA 4BE9A 3SD7A 5GGXA 1QFMA 4TZKA 3DHEA 3MNFA 2LBPA 4EG0A 1YT5A 4IW3B 4Z4EA 4XQGA 1Q14A 3DP9A 2Q6LA 3DXYA 3H86A 1FJ2A 3PHIA 4A5OA 4MKZA 2JFNA 4D8WA 1MO3A 2ES4A 1NMXA 3NWBA 1PQPA 1U8EA 3RAJA 5F77A 4JI2B 5TLSA 4H1WA 1LJ8A 3MD9A 1PP4A 5EXXA 2OV6A 4UUQA 2XUZA 5I4IA 3BXHA 5A9RA 4AZWA 5J4LA 2ZRNA 1LTHR 1Q50A 3N8GA 3N07A 4UMFA 2WSIA 4PIPA 1NMZA 5KNBH 2VUUA 1CVRA 1L9XA 3DE7X 4A8JC 4TTIA 4DCMA 3C6BA 2WB4A 1IVNA 4BVAA 1RKQA 3ZPXA 3HL4A 5I7UA 1QK5A 4W5NA 3DL2A 3ICOA 1G8PA 5ALLA 5FNVA 5LMCA 2V7GA 1Q1ZA 3ZEAA 2IUTA 1Q7RA 2ZJ2A 5CT9A 3JD2A 2X7JA 4ZI7B 1IWOA 4C3VA 2IS4A 4P7JA 2JLCA 4GLBA 1TLLA 3CX4A 4RENA 4AP5A 1JA1A 3U7IA 4E5KA 3NR2A 2JIOA 4Q1EA 1DS6A 1XUOA 1B8PA 3MWEA 2E87A 2XWSA 2EW8A 4BBAA 1D0SA 4D0NA 5DWQA 4RTRA 1AUQA 5HEKA 2ZS7A 4R31A 1C2TA 2K4MA 1O0SA 2CSUA 1JLKA 1EK0A 3CX7A 4YMSA 1P80A 2HPVA 1SB8A 2PZLA 3C41J 3OKPA 3VRHA 3VM6A 5FFMA 3WRYA 1SQ0A 4BNDA 4GMGA 3U61B 4XA8A 3WWOA 3ZVKA 4QVGA 1R0XA 3RU9A 4DR2B 3FZNA 3QK7A 4LBYA 4EFMA 2D5CA 2DHEA 2GHIA 2XADA 3PQFA 3F67A 4CQMA 4ETWA 1RMYA 4TYYA 5EPUA 2J9GA 3EW9A 4QKQA 2QX8A 3C8MA 1M7GA 4NK5A 5GJCA 1AK2A 2WWRA 4HMPA 4MX8A 2FE4A 2OC9A 4GECA 2AZDA 1P2BA 3K31A 3T0GA 2LDXA 1VYUA 2ZYVX 3N8NA 3O93A 1VG9B 1JJVA 4OSOA 2ILTA 3B6IA 4BWVA 1ZDMA 4AKHA 1QLWA 3CISA 1IHOA 4O5AA 4UTRA 2DF8A 4CCWA 1P5JA 4EYOA 3A3PA 2RCNA 1H4QA 3D7NA 5KYXB 1VSTA 5IASA 3TQRA 1DSSG 2YW9A 3DFMA 4Y6RA 2WICA 4BO9A 2WU0A 4R9VA 4C0QC 2Q6OA 3PUYA 2V1UA 2Q62A 1R0CA 3CC8A 1WPXA 4QREA 2NMVA 3ZOZA 1FFXB 3DEIA 4HH3C 4QTZA 4TSRA 4Z1MD 5FH9A 4UFPA 1JF8A 2BGNA 4RYDA 4E94A 5K8TA 3RGWS 3AETA 4PO9A 1JTVA 1WUJS 1Z4IA 2ZPUA 3AJ9A 4J0CA 4YJDA 3SHFA 4H7HA 2A3RA 2GEUA 4PLCA 2Y8EA 3KU4A 3WB1A 3WYNA 4J9UE 5AHKA 4ZAZA 5FXMA 1N6KA 2AQ8A 1GPBA 2ZIGA 3HMQA 3TE6A 2OLJA 1GRCA 4ETIA 1TFUA 1OAAA 5F9MA 2BSQA 3ZWVA 4PC2A 4YAEA 3VR1A 3HCBA 4NNJA 4QXAA 5B30A 3V1LA 2B20A 1G8HA 3AYZB 4EHNA 1FBNA 1BN7A 1D2RA 1MGOA 1Z83A 3FI0A 4I55B 3UNXA 4B6RA 1SBIA 4CF6A 2IELA 1TQ8A 3ER6A 2W6PA 2QNIA 3HWSA 4HXGA 4RWZA 1N2XA 2XNCA 3KB6A 4N1AA 4WI1A 5AVKA 2NO6A 2QVGA 3PFWO 3E70C 3GQVA 1XLTC 5HUHA 4QFDA 3AOEA 2AC4A 2JK0A 4CG0A 1KH2A 2NZUG 1SA0A 2J3JA 1CZRA 3QPWA 4FHFA 2ZE7A 3KOMA 4DCCA 5CEFA 1ZS9A 1AKQA 1GADO 2PRYA 1XHLA 521PA 4AS3A 1AQUA 1IY2A 4IV0A 4Q01A 4ETNA 1NUSA 2DHRA 1Y6RA 2I65A 4TMTA 5IVIA 1K8YB 2HTFA 3LHIA 3NBKA 1TEVA 3HA5A 1CZLA 3K4PA 4MRMB 4R2XA 5JU6A 3IP7A 3WBFA 1XRLA 2CUNA 3SFZA 2ZYUX 4NICA 3OLCX 3DV0A 4UXJA 2PLFA 5C4IA 3URMA 1UPBA 3O1JC 2PE5A 3GGSA 3WMEA 3ZV7A 4BVLA 4E3ZA 5I45A 4YC7A 3AESB 1QG2A 4FW8A 1XNJA 1KJJA 2Y1WA 1X7GA 3GRUA 4CL0A 1QVRA 3OOHA 4OQDA 1UQUA 2ZSFA 1EMDA 3S28A 3EGXA 4HJXA 5LBIA 4Z0HO 4QXQA 4CIDA 3GLHB 1KK1A 2C5SA 2ZAMA 4DCOA 5LYJB 3OKCA 5AP9A 2C97A 4HAOA 2VHZA 1WPGA 1QDLB 2WJYA 4IP0A 5AM2A 3DBRB 4RMHA 5FUMA 1I6KA 2XIJA 3S2FA 1G7SA 5K8VA 1TGYA 2EFCB 4J0GA 3U44A 1CC1S 3LC2O 4CLOB 1QKJA 3E61A 1I2AA 4MV3A 4MWTA 1II0A 4ZZIA 5ICMA 4X6YA 3PJDA 5CT8A 1Z4MA 1DFIA 5EZQA 4ZGGA 4FEEA 1PV4A 6PFKA 3W9BA 1SU6A 3BM5A 4B6EA 4EW3A 4C4AA 1E7MA 3WP0A 4B7CA 2OWDA 3NNSA 5EHXA 4FMCF 5I4BA 5K0ZA 4AKIA 3GPDG 2EV9A 2P5TB 2W8BB 4W8HA 1IN8A 2O6HA 4C20A 1JWBB 1YGPA 3BXGA 2K7FA 4A0QA 1NXQA 3WXMA 4Q02A 1NV9A 3UXHA 2AWOA 4I5FA 2R7KA 1X0XA 1O9GA 2XGOA 3CUUA 5TF4A 2HA7A 4IIUA 2D2XA 3UHOA 1QHIA 1VMKA 2IXAA 2PRJA 4HK4A 4TN1A 5EUBA 1PL8A 3CHYA 4CLXA 5IH3A 2HHLA 1THMA 4H31A 2UVDA 4B76A 3RC2A 2FV8A 4ZO7A 4WZBE 1OFUA 4BUZA 1GKIA 1SPXA 2UXBB 1YDGA 3L8FA 2HA0A 4LJYA 1AGYA 4LOAA 5KWVA 1UMDA 3E4CA 4BKUA 4DNPA 4JT2A 1QWSA 1KQOA 4HRVA 1IHDA 2C4NA 1XP8A 2QN1A 1AGXA 4JLJA 4OB7A 5ALEA 2C94A 1DDGA 1NNEA 1OH8A 2DCUA 1QTQA 5B1YA 2ZT8A 1CIVA 1XNGA 3G2HA 3OX3A 2BFBA 4TMKA 2H54A 3CLRC 4B35A 5LFAA 5K0EA 5C34B 3TF5A 1U2EA 3R77A 2ZROA 3HYLA 5B36A 1H2AS 3ENWA 3NTXA 5GV7A 3AF1A 4ZT4A 1MAUA 2WJHA 4JLAA 4PSAA 1D4FA 3CKKA 3VSBA 2G67A 4ZEOA 4BMXA 3R3YA 4G4JA 1JU9A 2ZJYA 3FN4A 1XA3A 1R9GA 4AFNA 4D3SA 3EHDA 5BPFA 5MFPA 2DPHA 3QV1A 1ETUA 2B4KA 2QIOA 4OYHA 1BHSA 1SMKA 1VYTA 4UCXA 4TWRA 2XV1A 3ETGA 1LJLA 2A1UA 1TO6A 3TNFA 5DBHX 4CMEC 2EEZA 4QU0A 2WT4A 3M5CA 4Y1FA 1VA4A 2CY0A 4GI5A 4MJ7A 1WZEA 1YZYA 2EX0A 4HNHA 2FQWA 4YREA 4HDAA 3SHWA 5A3VA 3TB6A 4AO7A 2Z30A 2C3UA 1LI7A 3A2NA 4C87A 1U6IA 2H1VA 4QDUA 1HNZB 3L46A 3QTLA 5DK6A 4HWPA 3HVIA 2FRXA 3EIEA 1HO3A 3LA8A 1YDHA 1JHOA 2ISQA 2IOQA 2QM0A 1Q95A 3CUKA 3UV7A 4KRYA 2QTLA 1XTQA 1N9ZA 2NIPA 3BFXA 5IDVA 1RKXA 3B85A 1F38A 1E3WA 1G8YA 1Q1GA 3LLUA 3T7SA 1W36C 2XQIA 3R5JA 4N76A 4EUNA 3OY7A 3BJIC 3NASA 2AV6A 4Z5XA 3H2SA 2RG7A 2VBGA 3RC3A 5E4JA 3AVQA 1WUIS 2ZIUB 1ZPDA 2YHIA 2IKQA 1IDOA 2BM9A 3I37X 1UZMA 1R3DA 3M83A 5H4HA 4CEJB 3WYDA 3E3NA 1L5HA 1S96A 4DCGA 1F6DA 4Z3DA 2OBYA 4Q82A 4QPNA 3TZKA 1EP1B 3ZU6A 5F98A 4EY4A 4FGLA 4LZOA 4AMYA 4RXTA 4WXHA 4I81A 4IQFA 2AF3C 4QDZA 1XYVA 3G13A 3K9LA 3B82A 1IBKB 4PAMA 4TXNA 2IOFK 4KQFA 2EZ4A 1PV1A 1JTEA 3L7JA 1PJAA 2OL4A 2QX4A 3UWKA 1KZ1A 1ZMXA 3VNUA 3QP9A 4QT0A 1NM5A 1JMVA 1N0WA 1HEYA 3KRTA 1JKJB 1R8YA 3BERA 1E89A 3TRFA 3V1KA 3VTAA 3I5XA 1RJGA 1WPQA 2BF7A 3LUPA 2H7YA 3A1TA 2PYIA 4LYGA 2ZVDA 2ZIFA 2ZIEA 4JC5A 4PHGA 4EHBA 5I7VA 4A23A 2JIRA 5DGCA 1RXVA 5B1SA 1X1DA 5JQGB 2FZKA 1HT3A 1P72A 1XDZA 3K2QA 2QY9A 5HQ3A 5LVAA 2B3TA 1BH6A 2ACVA 2OKCA 4WESB 1VPEA 2FPIA 2PH7A 2ZAIA 2ZE6A 1Q0LA 4HN4B 4BC1A 4M0MA 1OFGA 3IUMA 3EZ9A 5EINA 1GXSB 1C1DA 2WJPA 4GAEA 2JC3A 3TYXA 4RFSA 2VBIA 3I0MA 4RYLA 2CZGA 3ZCTA 1RRVA 2FG6C 5EJFA 3IE0A 3ME5A 1AUVA 4GH5A 2BCJQ 1OBHA 1A5ZA 1QX4A 2D5IA 1KBZA 2VTKA 1KJIA 3SBOA 2C88A 1XZFA 2JFUA 2JJ2D 3I42A 4MVJE 3TIXB 3WJ1A 4EPRA 1ECFA 1DXOA 1E66A 1I51A 3OQMA 3D6MA 1JR3A 1S0UA 1UJNA 5FOSA 2X3UA 5DVZA 3F1LA 4W5JA 4KVZA 1A98A 2IW1A 2C2XA 3FUUA 4BZXA 4D99A 3TLJA 5HFNA 2EFGA 3U49A 4GC5A 1SOWA 2Z5FA 2ZTMA 4Y1RB 3IJ5A 1Z8FA 4BQQA 5K6RA 4J6EA 5CD1A 1OZ0A 3JQBC 5FPTA 1DARA