2KXGA

The solution structure of the squash aspartic acid proteinase inhibitor (sqapi)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
95
structure length
95
Chain Sequence
GPGPAIGEVIGISVNDPRVKEIAEFALKQHAEQNLILAGVDAGQIIKGIPHWDNYYNLILSAKHSPHEFSKFYNVVVLEKASDNSLKLVAFVPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the squash aspartic acid proteinase inhibitor (SQAPI) and mutational analysis of pepsin inhibition.
pubmed doi rcsb
molecule keywords Aspartic protease inhibitor
molecule tags Hydrolase inhibitor
source organism Cucurbita maxima
total genus 14
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2010-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16845 SQAPI Aspartic acid proteinase inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.10 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 2kxgA00
4N6OB 1MOLA 4N6UA 1YVBI 1N5PA 3PS8A 1EQKA 1NB5I 3Q2PA 3PYJA 2BO9B 1FA3A 1NB3I 4N6TA 1A67A 3UL5A 1IV7A 2W9QA 4N6V0 5LC6A 1A90A 1CYUA 1IV9A 3L0RA 1TIJA 3NX0A 4N6LA 1GD3A 3QRDA 3GAXA 1M9GA 1CYVA 1N9JA 2OCTA 1FUWA 1KWIA 2O9UX 3S67A 2KXGA 5ELJA 1MNLA 1WNHA 1DVCA 1GD4A 2CH9A 1ROAA 3MWZA 4LZIA 3UL6A 1RN7A 3SVAA 5LC7A 1STFI 1DVDA 3IMAB 5ELUA 1LXEA 1R4CA 3KFQC 5A0OB 3K9MC 1N5HA 4N6MA 4ZM8A 1CEWI 1PFPA 4EYCA 3LH4A 4N6NB 4CCVA 4IT7A 5EQLA 2W9PA 4TX4A 3KSED 1G96A 3PXMA
chains in the Genus database with same CATH superfamily
1B2MA 1FGRA 4J9AA 1SPUA 2P09A 2ZHXB 4GHOA 4OK0A 4X2OA 4HM5B 4ILFA 4NHFA 3IPTA 2C11A 2BMQB 3EN8A 1WMOA 4DKIA 4N6UA 1B2UA 1O7NB 3AMOA 1YVBI 4O02B 3ALAA 3N54B 3I553 2E2TA 1B2SA 1LOWA 1K41A 2CG0A 2P38A 3EBYA 1W2B2 4HM1B 3CCQ3 1KD14 3WA2X 3NQYA 1BVIA 3AHWA 5IG3A 2CKFB 5G2GA 2KF4A 3QK9A 1UUGB 4HVNA 1FA3A 3MG1A 5IG0A 1VQK3 1JB2A 6RNTA 1UGIA 2XEPA 3MPHA 4NPBA 2WGQA 3NXJA 1JJ22 5HGRA 4CJNA 1VQ53 1GY5A 1E3VA 1SIIA 2W56B 2Q07A 5AI1A 3VSYA 1MGWA 1IVXA 2L1SA 2H0IA 2W9QA 4R9KA 4QWTA 1BRGA 4R4KA 3BNBA 2GU1A 2UGIA 3DGLA 3CMA3 1FGMA 1SIHA 1GMRA 4JRFA 5JBSA 5KP3A 4KFEA 3WDGB 3FKAA 3NX0A 1IQXA 1FZUA 2CFGA 3DXOA 1JKGB 1EA2A 3HI7A 3H3HA 2RNTA 4BTXA 3WOEB 2XGNA 2CC3A 1IQYA 4XBYA 3BNEA 1Q42A 4L7KA 1E3RA 1ZO2A 2BMRB 3URPA 1YHQ3 4N3VA 2O9UX 4WHAA 3DGMA 3F8XA 3LZAA 3S67A 4XB5A 3CCL3 1W4NA 4OUQA 1C54A 1RRLA 5M18A 4FMCA 5DRVA 1NU3A 3LTDA 3U1WA 2Z77A 1J2BA 1FW7A 1MWUA 2XGLA 2C10A 4AEQA 3OWSA 1FGTA 2UUGC 1RNTA 1BIRA 3CCR3 5BXQA 2HMKB 2XF3A 1UCJA 2IMJA 2FNQA 1O7PB 3SOAA 1Q9EA 3EF8A 4XBXA 1YNVX 1TRPA 4MEIA 1YJW3 3LTBA 1AVKA 2K3DA 1RN7A 2W2CA 1RCKA 4HM0B 3DM8A 1YIT3 1N8R4 3JUNA 1BRKA 1BSEA 4H61A 4I5QA 1CQSA 2XRXB 1YIJ3 1X1XA 1BSBA 5STDA 2RFRA 2FGTA 3G6E3 4LGQA 3EC9A 3IMAB 5IF6A 3S27A 1YVSA 1YJN3 2MC8A 1JB4A 1VQO3 4XM4A 3T8NA 2B24B 4J5KA 3G16A 1OUNA 1N5HA 2C4BA 1RJOA 4N6MA 2RBIA 1AV4A 1T5YA 2W6JH 1CEWI 2CHCA 1PFPA 1JN5B 3RNTA 1BAOA 4EYCA 1BGSA 1BUJA 3LXUX 4IT7A 3EE1A 2PZVA 2XFSA 2YFLB 1RGFA 2W9PA 1OGXA 1FUSA 1QAFA 5AEUB 4FCMA 1HU9A 4LYLB 1V57A 3VF1A 5BIRA 5IERA 2CIUA 2Z7AA 3OW22 1IVUA 2Z6BA 4EBGA 2Z76A 3PXMA 3LTCA 1IVWA 2BNGA 1OACA 3CCE3 1A2VA 3JUQA 4K1VA 5TGNA 3S5CA 5HOHA 3FF0A 1VQ43 1BSDA 2QGUA 2YFJB 3PS8A 1GYBA 4HM7B 4KFFA 1W6GA 3NUVA 1VQM3 3K0ZA 1EQKA 1UGHI 3OXAA 4R80A 1I2EA 1T2HA 5CK6A 3NM7A 3B8LA 1VQ83 3CNXA 3V92A 1SARA 2F98A 5IENA 1LNHA 1NB3I 2F86B 1RNBA 2YFIB 4X2HA 4LEHA 2OWPA 2H0HA 1BRIA 1E97A 2CW9A 2V1LA 3D9RA 3DZLA 3E99A 3GZYB 7STDA 5CF2A 3RDEA 3IJEB 1PYLA 1Z1SA 1IV7A 1BRHA 2BU4A 4RNYA 3T0UA 3I563 1VQ73 1BNRA 5LC6A 5BU4A 3LTAA 1B20A 1DMMA 2RCDA 1X1YA 2XFTA 3F7SA 3Q3FA 1BSAA 2R4IA 3GSPA 1UW1A 3AGNA 4LSOA 3V98A 1RHLA 3CC73 2J8XB 1RN1A 1TIJA 4WYKA 1K734 3SX1A 3LOYA 3MSOA 4N6LA 3X40A 1JZOA 3K5TA 3QRDA 2IUJA 2CX0A 4IIAA 3SEDA 2W0QA 1BNSA 1ASKA 1CYVA 1UUWB 1N9JA 2P0MA 1Q824 1A2PA 1OF5A 1K8A4 1EEJA 2QEX3 1ZX2A 2HMJB 4HM8B 1N9EA 1Q864 2ZDJA 3WA3A 2OOVC 1OCVA 1WQLB 2OCTA 1FUWA 1AR0A 1WMPA 3GZXB 1Q40A 3HIIA 3HOHA 2F5MA 3AMOB 4HBRA 4BL3A 3D79A 1GY6A 2K0MA 3AHSA 2IA7A 1RGAA 1W00A 1RMSA 3PCRA 4XDVA 3HX8A 3CCM3 2OOVA 2WGOA 3WHOA 2LYXA 3ECFA 1VQ63 1PU4A 3JVCA 4HKVB 2JQ5A 4ORLA 1GD4A 4EV2A 3B7CA 4XBTA 3U97A 3OX9A 4RZMA 3SXXA 2HOHA 2W03A 1ROAA 3MWZA 1TRQA 4RNTA 3ER7A 3UL6A 3X3ZA 4HM3B 4RNZA 1K9M4 2KF3A 4J5GA 3CPW2 1M1K4 3KCHA 4FCZA 5FGOA 3X3YA 3BU4A 1JB5A 5ELUA 3CCJ3 1VQQA 4K61A 3DGYA 1T3BA 3DY5A 3KFQC 4HOHA 4PEJA 3OWUA 1DMNA 1UI8A 2STDA 2P05A 3PGBA 1UCKA 1IK3A 2OQEC 1A2KA 3BIRA 1NO3A 1RN4A 2CWVA 3PZWA 3S29A 4K1UA 1OH0A 2KAAA 2YX9A 2KCDA 3F8HA 4AKZA 2GBXB 4CCVA 3MKIA 2CWTA 4WWUC 4HM6B 4I4KA 1JBRA 1LOXA 1STDA 2SARA 3KN4A 3D5GA 1FGOA 3CNMA 3DUKA 3O8YA 1BNJA 3EN1B 3SOYA 3DGOA 1DETA 1FUTA 1RGGA 1JBSA 2QIYA 5GSPA 4BTYA 1EG9B 5AIGA 4HM4B 1Q7Y4 3F7XA 1ULJB 3EX9A 3JUOA 3PCSA 3X41A 2F4YA 1YI23 3UJMA 2GU3A 3GWRA 4GB5A 4GSPA 2XSOB 1BU4A 1GOUA 5AEWB 5IG5A 1UDII 4MJDA 1RKYA 3ZG0A 1BNIA 3HIGA 3NV0A 1MWRA 1IT8A 3HK4A 4MMZB 1IVVA 2BMOB 4LMIA 4O8SA 1VZZA 3Q2PA 2ML6A 4EXRA 2F5WA 3PYJA 5KP1A 3NHXA 3CXC2 2CWUA 4FCJA 3DH2A 1LQMB 1W5ZA 3J7Yd 3JUMA 4EV5A 1GOYA 4U13A 3CD63 1D6YA 5D83A 1D6UA 1TP6A 1OGZA 2BHMA 2HMNB 3F9SA 1IQ8A 1TJDA 2IUKA 1UUVB 1EUIC 3V99A 3K63A 1WTHA 1GMQA 4HZ9B 3OWYA 2E2VA 1GY7A 1LOYA 4FR9A 1RLSA 1B27A 2IYJA 1A90A 6GSPA 2HMOB 5AYSC 3GRDA 1IV9A 4R9LA 3BLZA 4KZ1A 1W01A 3F40A 1S723 3L0RA 4OVMA 3M8CA 1FGQA 3EHCA 1I0XA 1SJWA 2HMMB 3FG1A 1F8NA 1GD3A 1WMNA 4WFOA 3GAXA 2H0GA 1BNGA 1M9GA 1RGKA 2WO0A 3N8BA 2F56A 1ULIB 2R41A 1QJGA 1BOXA 1JZDA 1RSNA 3B4OA 4BIRA 3BNCA 3FG3A 5AIIA 9RNTA 2IY2A 1VQ93 1OHSA 1UCLA 1BRJA 1M1XB 4WP5A 3CME3 1I2GA 5KP4A 1UCIA 3NBJA 3CPOA 5AIFA 1QVF2 2AAEA 4HJLB 5EEOA 1TUHA 3MYTA 3STDA 5ELJA 1SQWA 1KC84 3CC43 1WNHA 1DVCA 5IW9A 1QVG2 1GOVA 3CU3A 7RNTA 3WODG 1Y4KA 4EC6A 1G02A 3HZPA 1NNVA 4AKYA 3G8ZA 1NWWA 3DGNA 1N8QA 4NREA 2CH9A 4CPKA 4LZIA 4BL2A 2BIRA 3MG3A 1ZGXA 1LOVA 3H51A 5JPUA 1YGWA 2GEYA 1MWTA 3SVAA 1TFKA 3ZFZA 3KSPA 4KT3B 6STDA 5CLKA 1STFI 5EVHA 1O7GB 1O7WB 1DVDA 1B3SA 2GBWB 1UI7A 1R4CA 2CFWA 2I9WA 4Q53A 2W04A 3FH1A 3SYUA 3B4PA 2ZL8A 2CFLA 4WYKB 3WR2A 2RGQA 3GZRA 1TFOA 1JBTA 2PNCA 2W56A 4IPBA 4MMYB 4XDWA 5AIHA 2D42A 5CF1A 1BANA 4ZM8A 3CCV3 3EB8A 1Q7HA 2ZA4A 1M904 1NDOB 4K90B 1OF5B 2XH9A 2RSXA 1DMQA 2A15A 2JDIH 1V58A 2XSHB 3A5EA 4G1MB 3ZG5A 3WMDA 3NBBA 3FGYA 1Q40B 4TX4A 3KSED 1JKGA 1W7CA 4R1KA 5CXOA 3BB9A 2CK3H 2ML5A 3X42A 3ROBA 3D5IA 1KSIA 4N6OB 3RGRA 2CFDA 1AY7A 1QAKA 1JRQA 3JUPA 4J8TA 3DMCA 2WOHA 1MOLA 1V74A 4H3UA 3LMLA 3CCU3 1MGRA 1Q814 1QALA 3FG4A 5G1LA 1I0VA 1BNEA 1I70A 1N5PA 1RTUA 3D4AA 2KRTA 2P0XA 5DREA 3TDGA 3EJVA 3UB1A 1I3FA 2WOFA 3OV4A 5D82A 1NB5I 5D81A 1US1A 3LT8A 2BO9B 1FYSA 2K54A 4FMAA 1X1WA 4L8OA 2GEXA 2OQEA 1RGLA 2GSPA 2E2UA 3G0KA 4N6TA 5AYRB 3RGAA 3FF2A 5IG4A 2CG1A 1LRAA 1CH0A 1JV2B 1I8VA 3A76A 1A67A 2Y74A 1KQS2 1LVNA 2D1WA 3N9HA 3UL5A 3F14A 3CC23 3CCS3 1VQL3 5G1KA 3UNLA 1DE3A 1I2FA 1RCLA 1BSCA 4N6V0 4HYZA 3NBRA 3G4S3 2B1XB 4FMDA 4CDLA 1IYYA 1O7HB 1CYUA 3BNDA 5IEPA 1R4YA 1AQZA 3G713 4O2HA 3T8UA 2BT3A 3D3LA 4RBNA 4HAAA 7GSPA 1B2XA 5FW5A 2QA43 1RRHA 1NJI4 1YJ93 1JN5A 3KZTA 3Q90A 3FLJA 4L8PA 1BNFA 1RGEA 1S5AA 3SLUA 1T2IA 1MWSA 1KWIA 3KIIA 1W2ZA 4MMXB 1OHOA 4FMBA 1VQP3 2OTL3 1EKMA 2GXFA 2MF7A 1U8CB 2KF5A 3Q1CA 1YGEA 3NV0B 1IU7A 2CFKA 3FZWA 3FCSB 5M19A 2KXGA 1MNLA 4HM2B 2CX1A 1I3IA 2HMLB 1OHPA 5IEOA 1ZS7A 2LQVA 1RGHA 2M7OA 4GL6A 1LQGC 4BTWA 3VGNA 3MG2A 4EW5A 1ISKA 1B2ZA 1X1UA 3EBTA 5I97A 3X3XA 1TTOA 1B21A 5BVBA 3I0YA 1BRNL 8RNTA 1PY3A 2UX0A 1G0TA 1IDPA 3EQQB 3K7CA 5LC7A 2L4VA 5M1AA 1RDSA 3NM2A 8CHOA 1D6ZA 4STDA 3LT9A 1OPYA 2SBLA 3S28A 1U5OA 1DYUA 1LXEA 1W6YA 1BRSA 1BUQA 2F99A 3FSDA 2FXTA 3KKGA 1GMPA 3LYGA 4HZBB 1JNQA 5A0OB 3AGOA 1IT7A 3K9MC 4BU4A 1LNIA 2Y73A 1K28A 3GZBA 1L5GB 1QMAA 1AVLA 1HKXA 4JF8A 1W6CA 1W02A 1GSPA 3WOFB 1VQN3 4KFDA 3LH4A 4N6NB 5EQLA 5JPPA 1O7MB 1GS3A 1C7HA 1HZ1A 1TU5A 2OTJ3 3NQZA 2XR8B 4KVHA 1RGCA 1HYFA 2O3OA 4O3VA 1ROVA 5RNTA 3KE7A 2KF6A 2AADA 2INXA 1G96A 3MHEA
chains in the Genus database with same CATH topology
1FGRA 4J9AA 1SPUA 2P09A 4OK0A 4X2OA 4HM5B 4NHFA 3IPTA 2C11A 2BMQB 3EN8A 1WMOA 4N6UA 1O7NB 3AMOA 1YVBI 4O02B 3ALAA 3N54B 3I553 2E2TA 2CG0A 2P38A 1K41A 1W2B2 3EBYA 1KD14 4HM1B 3CCQ3 3WA2X 3NQYA 5IG3A 2CKFB 5G2GA 3QK9A 4HVNA 1FA3A 3MG1A 5IG0A 1VQK3 1JB2A 2XEPA 3MPHA 2WGQA 3NXJA 1JJ22 5HGRA 1VQ53 1GY5A 1E3VA 1SIIA 2W56B 2Q07A 5AI1A 3VSYA 1IVXA 4R9KA 4QWTA 2W9QA 4R4KA 3BNBA 2GU1A 3DGLA 3CMA3 1FGMA 1SIHA 4JRFA 5JBSA 5KP3A 4KFEA 3WDGB 3FKAA 3NX0A 1IQXA 2CFGA 3DXOA 1JKGB 1EA2A 3HI7A 3H3HA 4BTXA 3WOEB 2XGNA 2CC3A 1IQYA 4XBYA 3BNEA 1Q42A 4L7KA 1E3RA 1ZO2A 2BMRB 1YHQ3 4N3VA 2O9UX 4WHAA 3DGMA 3F8XA 3LZAA 3S67A 4XB5A 3CCL3 1W4NA 4OUQA 1RRLA 4FMCA 5DRVA 1NU3A 3LTDA 3U1WA 2Z77A 1J2BA 2XGLA 2C10A 4AEQA 3OWSA 1FGTA 3CCR3 5BXQA 2HMKB 2XF3A 2IMJA 2FNQA 1O7PB 3SOAA 3EF8A 4XBXA 4MEIA 1YJW3 3LTBA 1AVKA 1RN7A 2W2CA 4HM0B 1YIT3 3DM8A 1N8R4 3JUNA 4H61A 1YIJ3 1CQSA 2XRXB 5STDA 2RFRA 2FGTA 3G6E3 4LGQA 3EC9A 3IMAB 5IF6A 3S27A 1YJN3 2MC8A 1JB4A 1VQO3 4XM4A 3T8NA 2B24B 3G16A 1OUNA 1N5HA 1RJOA 4N6MA 1AV4A 1T5YA 2W6JH 1CEWI 2CHCA 1PFPA 1JN5B 4EYCA 3LXUX 4IT7A 3EE1A 2PZVA 2XFSA 2YFLB 2W9PA 1OGXA 1QAFA 5AEUB 4FCMA 1HU9A 5IERA 3VF1A 3OW22 2CIUA 2Z7AA 1IVUA 2Z6BA 4EBGA 2Z76A 3PXMA 3LTCA 1IVWA 2BNGA 1OACA 3CCE3 1A2VA 3JUQA 4K1VA 5TGNA 3S5CA 3FF0A 1VQ43 2QGUA 2YFJB 3PS8A 1GYBA 4HM7B 4KFFA 1W6GA 3NUVA 1VQM3 3K0ZA 1EQKA 3OXAA 4R80A 5CK6A 3NM7A 3B8LA 1VQ83 3CNXA 3V92A 2F98A 5IENA 1LNHA 1NB3I 2F86B 2YFIB 4X2HA 4LEHA 2OWPA 3E99A 2CW9A 1E97A 2V1LA 3D9RA 3DZLA 3GZYB 7STDA 5CF2A 3RDEA 3IJEB 3I563 1Z1SA 1IV7A 4RNYA 3T0UA 1VQ73 5LC6A 3LTAA 1DMMA 2RCDA 2XFTA 3F7SA 4LSOA 2R4IA 3CC43 3V98A 1UW1A 3CC73 4WYKA 1TIJA 1K734 3SX1A 3LOYA 3MSOA 4N6LA 3X40A 3QRDA 3K5TA 2IUJA 4IIAA 3SEDA 2W0QA 1ASKA 1CYVA 1UUWB 1N9JA 2P0MA 1Q824 1OF5A 1K8A4 2QEX3 1ZX2A 2HMJB 4HM8B 1N9EA 1Q864 2ZDJA 3WA3A 2OOVC 1OCVA 1WQLB 2OCTA 1FUWA 1AR0A 1WMPA 3GZXB 1Q40A 3HIIA 3AMOB 4HBRA 1GY6A 2K0MA 2IA7A 1W00A 3PCRA 4XDVA 3HX8A 3CCM3 2OOVA 2WGOA 1VQ63 2LYXA 3ECFA 1PU4A 3JVCA 4HKVB 2JQ5A 4ORLA 1GD4A 4EV2A 3B7CA 4XBTA 3U97A 3OX9A 4RZMA 3SXXA 2W03A 1ROAA 3MWZA 3ER7A 3UL6A 3X3ZA 4HM3B 4RNZA 1K9M4 3CPW2 1M1K4 4FCZA 5FGOA 3X3YA 1JB5A 5ELUA 3CCJ3 4K61A 3DY5A 3KFQC 4PEJA 3OWUA 1DMNA 1UI8A 2STDA 2P05A 3PGBA 1IK3A 2OQEC 1A2KA 1NO3A 2CWVA 3PZWA 3S29A 4K1UA 1OH0A 2YX9A 2KCDA 3F8HA 4AKZA 2GBXB 4CCVA 3MKIA 2CWTA 4WWUC 4HM6B 4I4KA 1LOXA 1STDA 3KN4A 1FGOA 3CNMA 3DUKA 3O8YA 3EN1B 3SOYA 3DGOA 2QIYA 4BTYA 1Q7Y4 1EG9B 5AIGA 4HM4B 3F7XA 1ULJB 3EX9A 3JUOA 3PCSA 3X41A 1YI23 3UJMA 2GU3A 3GWRA 4GB5A 2XSOB 5AEWB 5IG5A 4MJDA 1RKYA 3HIGA 3NV0A 1IT8A 3HK4A 4MMZB 1IVVA 2BMOB 4LMIA 4O8SA 1VZZA 3Q2PA 2ML6A 4EXRA 3PYJA 5KP1A 3NHXA 3CXC2 2CWUA 4FCJA 1W5ZA 3J7Yd 3JUMA 4EV5A 4U13A 3CD63 1D6YA 5D83A 1D6UA 1TP6A 1OGZA 2BHMA 2HMNB 3F9SA 1IQ8A 2IUKA 1UUVB 3V99A 3K63A 1WTHA 4HZ9B 3OWYA 2E2VA 1GY7A 4FR9A 1A90A 2HMOB 5AYSC 3GRDA 1IV9A 4R9LA 3BLZA 4KZ1A 1W01A 3F40A 1S723 3L0RA 4OVMA 3M8CA 1FGQA 3EHCA 2HMMB 1SJWA 4WFOA 3FG1A 1F8NA 1GD3A 1WMNA 3GAXA 1M9GA 2WO0A 3N8BA 1ULIB 1QJGA 3B4OA 3BNCA 3FG3A 5AIIA 1VQ93 1OHSA 1M1XB 4WP5A 3CME3 5KP4A 3NBJA 3CPOA 5AIFA 1QVF2 4HJLB 5EEOA 1TUHA 3MYTA 3STDA 5ELJA 1SQWA 1KC84 1WNHA 1DVCA 5IW9A 1QVG2 3CU3A 3WODG 1Y4KA 4EC6A 3HZPA 4AKYA 3G8ZA 1NWWA 3DGNA 1N8QA 4NREA 2CH9A 4LZIA 3MG3A 3H51A 5JPUA 2GEYA 3SVAA 1TFKA 3KSPA 6STDA 5CLKA 1STFI 5EVHA 1O7GB 1O7WB 1DVDA 2GBWB 1UI7A 1R4CA 2CFWA 2I9WA 4Q53A 2W04A 3FH1A 3B4PA 2ZL8A 2CFLA 4WYKB 2RGQA 3GZRA 1TFOA 2PNCA 2W56A 4IPBA 4MMYB 4XDWA 5AIHA 2D42A 5CF1A 3CCV3 4ZM8A 1M904 3EB8A 1NDOB 4K90B 1OF5B 2XH9A 2RSXA 1DMQA 2A15A 2JDIH 2XSHB 4G1MB 3WMDA 3NBBA 3FGYA 1Q40B 4TX4A 3KSED 1JKGA 1W7CA 4R1KA 5CXOA 3BB9A 2ML5A 2CK3H 3X42A 3ROBA 1KSIA 4N6OB 3RGRA 2CFDA 1QAKA 1JRQA 3JUPA 4J8TA 3DMCA 2WOHA 1MOLA 1V74A 4H3UA 3LMLA 3CCU3 1Q814 1QALA 3FG4A 1N5PA 2KRTA 2P0XA 5DREA 3TDGA 3EJVA 3UB1A 2WOFA 3OV4A 5D82A 1NB5I 5D81A 1US1A 3LT8A 2BO9B 2K54A 4FMAA 4L8OA 2GEXA 2OQEA 2E2UA 3G0KA 4N6TA 5AYRB 3RGAA 3FF2A 5IG4A 2CG1A 1JV2B 3A76A 1A67A 2Y74A 1KQS2 1LVNA 2D1WA 3N9HA 3UL5A 3F14A 3CC23 3CCS3 1VQL3 3UNLA 4N6V0 4HYZA 3NBRA 3G4S3 2B1XB 4FMDA 4CDLA 1CYUA 1O7HB 3BNDA 5IEPA 3G713 4O2HA 3T8UA 2BT3A 3D3LA 4RBNA 5FW5A 2QA43 1RRHA 1NJI4 1YJ93 1JN5A 3KZTA 3Q90A 3FLJA 4L8PA 1S5AA 3SLUA 1KWIA 3KIIA 1W2ZA 4MMXB 1OHOA 4FMBA 1VQP3 2OTL3 1EKMA 2GXFA 2MF7A 1U8CB 3Q1CA 1YGEA 3NV0B 1IU7A 2CFKA 3FZWA 3FCSB 2KXGA 1MNLA 4HM2B 2HMLB 1OHPA 5IEOA 2M7OA 2LQVA 4GL6A 4BTWA 3VGNA 3MG2A 1ISKA 3EBTA 5I97A 3X3XA 5BVBA 3I0YA 2UX0A 1IDPA 3EQQB 3K7CA 5LC7A 2L4VA 3NM2A 8CHOA 1D6ZA 4STDA 3LT9A 1OPYA 2SBLA 3S28A 1U5OA 1DYUA 1LXEA 1W6YA 1BUQA 2F99A 3FSDA 2FXTA 3KKGA 4HZBB 3LYGA 1JNQA 5A0OB 1IT7A 3K9MC 2Y73A 1K28A 3GZBA 1L5GB 1QMAA 1AVLA 1HKXA 4JF8A 1W6CA 1W02A 3WOFB 1VQN3 4KFDA 3LH4A 4N6NB 5EQLA 5JPPA 1O7MB 1GS3A 1C7HA 1TU5A 2OTJ3 3NQZA 2XR8B 4KVHA 4O3VA 2O3OA 1ROVA 3KE7A 2INXA 1G96A 3MHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6O B;  1MOL A;  4N6U A;  1YVB I;  1N5P A;  3PS8 A;  1EQK A;  1NB5 I;  3Q2P A;  3PYJ A;  2BO9 B;  1FA3 A;  1NB3 I;  4N6T A;  1A67 A;  3UL5 A;  1IV7 A;  2W9Q A;  4N6V 0;  5LC6 A;  1A90 A;  1CYU A;  1IV9 A;  3L0R A;  1TIJ A;  3NX0 A;  4N6L A;  1GD3 A;  3QRD A;  3GAX A;  1M9G A;  1CYV A;  1N9J A;  2OCT A;  1FUW A;  1KWI A;  2O9U X;  3S67 A;  2KXG A;  5ELJ A;  1MNL A;  1WNH A;  1DVC A;  1GD4 A;  2CH9 A;  1ROA A;  3MWZ A;  4LZI A;  3UL6 A;  1RN7 A;  3SVA A;  5LC7 A;  1STF I;  1DVD A;  3IMA B;  5ELU A;  1LXE A;  1R4C A;  3KFQ C;  5A0O B;  3K9M C;  1N5H A;  4N6M A;  4ZM8 A;  1CEW I;  1PFP A;  4EYC A;  3LH4 A;  4N6N B;  4CCV A;  4IT7 A;  5EQL A;  2W9P A;  4TX4 A;  3KSE D;  1G96 A;  3PXM A; 
#chains in the Genus database with same CATH topology
 1B2M A;  1FGR A;  4J9A A;  1SPU A;  2P09 A;  2ZHX B;  4GHO A;  4OK0 A;  4X2O A;  4HM5 B;  4ILF A;  4NHF A;  3IPT A;  2C11 A;  2BMQ B;  3EN8 A;  1WMO A;  4DKI A;  4N6U A;  1B2U A;  1O7N B;  3AMO A;  1YVB I;  4O02 B;  3ALA A;  3N54 B;  3I55 3;  2E2T A;  1B2S A;  1LOW A;  1K41 A;  2CG0 A;  2P38 A;  3EBY A;  1W2B 2;  4HM1 B;  3CCQ 3;  1KD1 4;  3WA2 X;  3NQY A;  1BVI A;  3AHW A;  5IG3 A;  2CKF B;  5G2G A;  2KF4 A;  3QK9 A;  1UUG B;  4HVN A;  1FA3 A;  3MG1 A;  5IG0 A;  1VQK 3;  1JB2 A;  6RNT A;  1UGI A;  2XEP A;  3MPH A;  4NPB A;  2WGQ A;  3NXJ A;  1JJ2 2;  5HGR A;  4CJN A;  1VQ5 3;  1GY5 A;  1E3V A;  1SII A;  2W56 B;  2Q07 A;  5AI1 A;  3VSY A;  1MGW A;  1IVX A;  2L1S A;  2H0I A;  2W9Q A;  4R9K A;  4QWT A;  1BRG A;  4R4K A;  3BNB A;  2GU1 A;  2UGI A;  3DGL A;  3CMA 3;  1FGM A;  1SIH A;  1GMR A;  4JRF A;  5JBS A;  5KP3 A;  4KFE A;  3WDG B;  3FKA A;  3NX0 A;  1IQX A;  1FZU A;  2CFG A;  3DXO A;  1JKG B;  1EA2 A;  3HI7 A;  3H3H A;  2RNT A;  4BTX A;  3WOE B;  2XGN A;  2CC3 A;  1IQY A;  4XBY A;  3BNE A;  1Q42 A;  4L7K A;  1E3R A;  1ZO2 A;  2BMR B;  3URP A;  1YHQ 3;  4N3V A;  2O9U X;  4WHA A;  3DGM A;  3F8X A;  3LZA A;  3S67 A;  4XB5 A;  3CCL 3;  1W4N A;  4OUQ A;  1C54 A;  1RRL A;  5M18 A;  4FMC A;  5DRV A;  1NU3 A;  3LTD A;  3U1W A;  2Z77 A;  1J2B A;  1FW7 A;  1MWU A;  2XGL A;  2C10 A;  4AEQ A;  3OWS A;  1FGT A;  2UUG C;  1RNT A;  1BIR A;  3CCR 3;  5BXQ A;  2HMK B;  2XF3 A;  1UCJ A;  2IMJ A;  2FNQ A;  1O7P B;  3SOA A;  1Q9E A;  3EF8 A;  4XBX A;  1YNV X;  1TRP A;  4MEI A;  1YJW 3;  3LTB A;  1AVK A;  2K3D A;  1RN7 A;  2W2C A;  1RCK A;  4HM0 B;  3DM8 A;  1YIT 3;  1N8R 4;  3JUN A;  1BRK A;  1BSE A;  4H61 A;  4I5Q A;  1CQS A;  2XRX B;  1YIJ 3;  1X1X A;  1BSB A;  5STD A;  2RFR A;  2FGT A;  3G6E 3;  4LGQ A;  3EC9 A;  3IMA B;  5IF6 A;  3S27 A;  1YVS A;  1YJN 3;  2MC8 A;  1JB4 A;  1VQO 3;  4XM4 A;  3T8N A;  2B24 B;  4J5K A;  3G16 A;  1OUN A;  1N5H A;  2C4B A;  1RJO A;  4N6M A;  2RBI A;  1AV4 A;  1T5Y A;  2W6J H;  1CEW I;  2CHC A;  1PFP A;  1JN5 B;  3RNT A;  1BAO A;  4EYC A;  1BGS A;  1BUJ A;  3LXU X;  4IT7 A;  3EE1 A;  2PZV A;  2XFS A;  2YFL B;  1RGF A;  2W9P A;  1OGX A;  1FUS A;  1QAF A;  5AEU B;  4FCM A;  1HU9 A;  4LYL B;  1V57 A;  3VF1 A;  5BIR A;  5IER A;  2CIU A;  2Z7A A;  3OW2 2;  1IVU A;  2Z6B A;  4EBG A;  2Z76 A;  3PXM A;  3LTC A;  1IVW A;  2BNG A;  1OAC A;  3CCE 3;  1A2V A;  3JUQ A;  4K1V A;  5TGN A;  3S5C A;  5HOH A;  3FF0 A;  1VQ4 3;  1BSD A;  2QGU A;  2YFJ B;  3PS8 A;  1GYB A;  4HM7 B;  4KFF A;  1W6G A;  3NUV A;  1VQM 3;  3K0Z A;  1EQK A;  1UGH I;  3OXA A;  4R80 A;  1I2E A;  1T2H A;  5CK6 A;  3NM7 A;  3B8L A;  1VQ8 3;  3CNX A;  3V92 A;  1SAR A;  2F98 A;  5IEN A;  1LNH A;  1NB3 I;  2F86 B;  1RNB A;  2YFI B;  4X2H A;  4LEH A;  2OWP A;  2H0H A;  1BRI A;  1E97 A;  2CW9 A;  2V1L A;  3D9R A;  3DZL A;  3E99 A;  3GZY B;  7STD A;  5CF2 A;  3RDE A;  3IJE B;  1PYL A;  1Z1S A;  1IV7 A;  1BRH A;  2BU4 A;  4RNY A;  3T0U A;  3I56 3;  1VQ7 3;  1BNR A;  5LC6 A;  5BU4 A;  3LTA A;  1B20 A;  1DMM A;  2RCD A;  1X1Y A;  2XFT A;  3F7S A;  3Q3F A;  1BSA A;  2R4I A;  3GSP A;  1UW1 A;  3AGN A;  4LSO A;  3V98 A;  1RHL A;  3CC7 3;  2J8X B;  1RN1 A;  1TIJ A;  4WYK A;  1K73 4;  3SX1 A;  3LOY A;  3MSO A;  4N6L A;  3X40 A;  1JZO A;  3K5T A;  3QRD A;  2IUJ A;  2CX0 A;  4IIA A;  3SED A;  2W0Q A;  1BNS A;  1ASK A;  1CYV A;  1UUW B;  1N9J A;  2P0M A;  1Q82 4;  1A2P A;  1OF5 A;  1K8A 4;  1EEJ A;  2QEX 3;  1ZX2 A;  2HMJ B;  4HM8 B;  1N9E A;  1Q86 4;  2ZDJ A;  3WA3 A;  2OOV C;  1OCV A;  1WQL B;  2OCT A;  1FUW A;  1AR0 A;  1WMP A;  3GZX B;  1Q40 A;  3HII A;  3HOH A;  2F5M A;  3AMO B;  4HBR A;  4BL3 A;  3D79 A;  1GY6 A;  2K0M A;  3AHS A;  2IA7 A;  1RGA A;  1W00 A;  1RMS A;  3PCR A;  4XDV A;  3HX8 A;  3CCM 3;  2OOV A;  2WGO A;  3WHO A;  2LYX A;  3ECF A;  1VQ6 3;  1PU4 A;  3JVC A;  4HKV B;  2JQ5 A;  4ORL A;  1GD4 A;  4EV2 A;  3B7C A;  4XBT A;  3U97 A;  3OX9 A;  4RZM A;  3SXX A;  2HOH A;  2W03 A;  1ROA A;  3MWZ A;  1TRQ A;  4RNT A;  3ER7 A;  3UL6 A;  3X3Z A;  4HM3 B;  4RNZ A;  1K9M 4;  2KF3 A;  4J5G A;  3CPW 2;  1M1K 4;  3KCH A;  4FCZ A;  5FGO A;  3X3Y A;  3BU4 A;  1JB5 A;  5ELU A;  3CCJ 3;  1VQQ A;  4K61 A;  3DGY A;  1T3B A;  3DY5 A;  3KFQ C;  4HOH A;  4PEJ A;  3OWU A;  1DMN A;  1UI8 A;  2STD A;  2P05 A;  3PGB A;  1UCK A;  1IK3 A;  2OQE C;  1A2K A;  3BIR A;  1NO3 A;  1RN4 A;  2CWV A;  3PZW A;  3S29 A;  4K1U A;  1OH0 A;  2KAA A;  2YX9 A;  2KCD A;  3F8H A;  4AKZ A;  2GBX B;  4CCV A;  3MKI A;  2CWT A;  4WWU C;  4HM6 B;  4I4K A;  1JBR A;  1LOX A;  1STD A;  2SAR A;  3KN4 A;  3D5G A;  1FGO A;  3CNM A;  3DUK A;  3O8Y A;  1BNJ A;  3EN1 B;  3SOY A;  3DGO A;  1DET A;  1FUT A;  1RGG A;  1JBS A;  2QIY A;  5GSP A;  4BTY A;  1EG9 B;  5AIG A;  4HM4 B;  1Q7Y 4;  3F7X A;  1ULJ B;  3EX9 A;  3JUO A;  3PCS A;  3X41 A;  2F4Y A;  1YI2 3;  3UJM A;  2GU3 A;  3GWR A;  4GB5 A;  4GSP A;  2XSO B;  1BU4 A;  1GOU A;  5AEW B;  5IG5 A;  1UDI I;  4MJD A;  1RKY A;  3ZG0 A;  1BNI A;  3HIG A;  3NV0 A;  1MWR A;  1IT8 A;  3HK4 A;  4MMZ B;  1IVV A;  2BMO B;  4LMI A;  4O8S A;  1VZZ A;  3Q2P A;  2ML6 A;  4EXR A;  2F5W A;  3PYJ A;  5KP1 A;  3NHX A;  3CXC 2;  2CWU A;  4FCJ A;  3DH2 A;  1LQM B;  1W5Z A;  3J7Y d;  3JUM A;  4EV5 A;  1GOY A;  4U13 A;  3CD6 3;  1D6Y A;  5D83 A;  1D6U A;  1TP6 A;  1OGZ A;  2BHM A;  2HMN B;  3F9S A;  1IQ8 A;  1TJD A;  2IUK A;  1UUV B;  1EUI C;  3V99 A;  3K63 A;  1WTH A;  1GMQ A;  4HZ9 B;  3OWY A;  2E2V A;  1GY7 A;  1LOY A;  4FR9 A;  1RLS A;  1B27 A;  2IYJ A;  1A90 A;  6GSP A;  2HMO B;  5AYS C;  3GRD A;  1IV9 A;  4R9L A;  3BLZ A;  4KZ1 A;  1W01 A;  3F40 A;  1S72 3;  3L0R A;  4OVM A;  3M8C A;  1FGQ A;  3EHC A;  1I0X A;  1SJW A;  2HMM B;  3FG1 A;  1F8N A;  1GD3 A;  1WMN A;  4WFO A;  3GAX A;  2H0G A;  1BNG A;  1M9G A;  1RGK A;  2WO0 A;  3N8B A;  2F56 A;  1ULI B;  2R41 A;  1QJG A;  1BOX A;  1JZD A;  1RSN A;  3B4O A;  4BIR A;  3BNC A;  3FG3 A;  5AII A;  9RNT A;  2IY2 A;  1VQ9 3;  1OHS A;  1UCL A;  1BRJ A;  1M1X B;  4WP5 A;  3CME 3;  1I2G A;  5KP4 A;  1UCI A;  3NBJ A;  3CPO A;  5AIF A;  1QVF 2;  2AAE A;  4HJL B;  5EEO A;  1TUH A;  3MYT A;  3STD A;  5ELJ A;  1SQW A;  1KC8 4;  3CC4 3;  1WNH A;  1DVC A;  5IW9 A;  1QVG 2;  1GOV A;  3CU3 A;  7RNT A;  3WOD G;  1Y4K A;  4EC6 A;  1G02 A;  3HZP A;  1NNV A;  4AKY A;  3G8Z A;  1NWW A;  3DGN A;  1N8Q A;  4NRE A;  2CH9 A;  4CPK A;  4LZI A;  4BL2 A;  2BIR A;  3MG3 A;  1ZGX A;  1LOV A;  3H51 A;  5JPU A;  1YGW A;  2GEY A;  1MWT A;  3SVA A;  1TFK A;  3ZFZ A;  3KSP A;  4KT3 B;  6STD A;  5CLK A;  1STF I;  5EVH A;  1O7G B;  1O7W B;  1DVD A;  1B3S A;  2GBW B;  1UI7 A;  1R4C A;  2CFW A;  2I9W A;  4Q53 A;  2W04 A;  3FH1 A;  3SYU A;  3B4P A;  2ZL8 A;  2CFL A;  4WYK B;  3WR2 A;  2RGQ A;  3GZR A;  1TFO A;  1JBT A;  2PNC A;  2W56 A;  4IPB A;  4MMY B;  4XDW A;  5AIH A;  2D42 A;  5CF1 A;  1BAN A;  4ZM8 A;  3CCV 3;  3EB8 A;  1Q7H A;  2ZA4 A;  1M90 4;  1NDO B;  4K90 B;  1OF5 B;  2XH9 A;  2RSX A;  1DMQ A;  2A15 A;  2JDI H;  1V58 A;  2XSH B;  3A5E A;  4G1M B;  3ZG5 A;  3WMD A;  3NBB A;  3FGY A;  1Q40 B;  4TX4 A;  3KSE D;  1JKG A;  1W7C A;  4R1K A;  5CXO A;  3BB9 A;  2CK3 H;  2ML5 A;  3X42 A;  3ROB A;  3D5I A;  1KSI A;  4N6O B;  3RGR A;  2CFD A;  1AY7 A;  1QAK A;  1JRQ A;  3JUP A;  4J8T A;  3DMC A;  2WOH A;  1MOL A;  1V74 A;  4H3U A;  3LML A;  3CCU 3;  1MGR A;  1Q81 4;  1QAL A;  3FG4 A;  5G1L A;  1I0V A;  1BNE A;  1I70 A;  1N5P A;  1RTU A;  3D4A A;  2KRT A;  2P0X A;  5DRE A;  3TDG A;  3EJV A;  3UB1 A;  1I3F A;  2WOF A;  3OV4 A;  5D82 A;  1NB5 I;  5D81 A;  1US1 A;  3LT8 A;  2BO9 B;  1FYS A;  2K54 A;  4FMA A;  1X1W A;  4L8O A;  2GEX A;  2OQE A;  1RGL A;  2GSP A;  2E2U A;  3G0K A;  4N6T A;  5AYR B;  3RGA A;  3FF2 A;  5IG4 A;  2CG1 A;  1LRA A;  1CH0 A;  1JV2 B;  1I8V A;  3A76 A;  1A67 A;  2Y74 A;  1KQS 2;  1LVN A;  2D1W A;  3N9H A;  3UL5 A;  3F14 A;  3CC2 3;  3CCS 3;  1VQL 3;  5G1K A;  3UNL A;  1DE3 A;  1I2F A;  1RCL A;  1BSC A;  4N6V 0;  4HYZ A;  3NBR A;  3G4S 3;  2B1X B;  4FMD A;  4CDL A;  1IYY A;  1O7H B;  1CYU A;  3BND A;  5IEP A;  1R4Y A;  1AQZ A;  3G71 3;  4O2H A;  3T8U A;  2BT3 A;  3D3L A;  4RBN A;  4HAA A;  7GSP A;  1B2X A;  5FW5 A;  2QA4 3;  1RRH A;  1NJI 4;  1YJ9 3;  1JN5 A;  3KZT A;  3Q90 A;  3FLJ A;  4L8P A;  1BNF A;  1RGE A;  1S5A A;  3SLU A;  1T2I A;  1MWS A;  1KWI A;  3KII A;  1W2Z A;  4MMX B;  1OHO A;  4FMB A;  1VQP 3;  2OTL 3;  1EKM A;  2GXF A;  2MF7 A;  1U8C B;  2KF5 A;  3Q1C A;  1YGE A;  3NV0 B;  1IU7 A;  2CFK A;  3FZW A;  3FCS B;  5M19 A;  2KXG A;  1MNL A;  4HM2 B;  2CX1 A;  1I3I A;  2HML B;  1OHP A;  5IEO A;  1ZS7 A;  2LQV A;  1RGH A;  2M7O A;  4GL6 A;  1LQG C;  4BTW A;  3VGN A;  3MG2 A;  4EW5 A;  1ISK A;  1B2Z A;  1X1U A;  3EBT A;  5I97 A;  3X3X A;  1TTO A;  1B21 A;  5BVB A;  3I0Y A;  1BRN L;  8RNT A;  1PY3 A;  2UX0 A;  1G0T A;  1IDP A;  3EQQ B;  3K7C A;  5LC7 A;  2L4V A;  5M1A A;  1RDS A;  3NM2 A;  8CHO A;  1D6Z A;  4STD A;  3LT9 A;  1OPY A;  2SBL A;  3S28 A;  1U5O A;  1DYU A;  1LXE A;  1W6Y A;  1BRS A;  1BUQ A;  2F99 A;  3FSD A;  2FXT A;  3KKG A;  1GMP A;  3LYG A;  4HZB B;  1JNQ A;  5A0O B;  3AGO A;  1IT7 A;  3K9M C;  4BU4 A;  1LNI A;  2Y73 A;  1K28 A;  3GZB A;  1L5G B;  1QMA A;  1AVL A;  1HKX A;  4JF8 A;  1W6C A;  1W02 A;  1GSP A;  3WOF B;  1VQN 3;  4KFD A;  3LH4 A;  4N6N B;  5EQL A;  5JPP A;  1O7M B;  1GS3 A;  1C7H A;  1HZ1 A;  1TU5 A;  2OTJ 3;  3NQZ A;  2XR8 B;  4KVH A;  1RGC A;  1HYF A;  2O3O A;  4O3V A;  1ROV A;  5RNT A;  3KE7 A;  2KF6 A;  2AAD A;  2INX A;  1G96 A;  3MHE A; 
#chains in the Genus database with same CATH homology
 1FGR A;  4J9A A;  1SPU A;  2P09 A;  4OK0 A;  4X2O A;  4HM5 B;  4NHF A;  3IPT A;  2C11 A;  2BMQ B;  3EN8 A;  1WMO A;  4N6U A;  1O7N B;  3AMO A;  1YVB I;  4O02 B;  3ALA A;  3N54 B;  3I55 3;  2E2T A;  2CG0 A;  2P38 A;  1K41 A;  1W2B 2;  3EBY A;  1KD1 4;  4HM1 B;  3CCQ 3;  3WA2 X;  3NQY A;  5IG3 A;  2CKF B;  5G2G A;  3QK9 A;  4HVN A;  1FA3 A;  3MG1 A;  5IG0 A;  1VQK 3;  1JB2 A;  2XEP A;  3MPH A;  2WGQ A;  3NXJ A;  1JJ2 2;  5HGR A;  1VQ5 3;  1GY5 A;  1E3V A;  1SII A;  2W56 B;  2Q07 A;  5AI1 A;  3VSY A;  1IVX A;  4R9K A;  4QWT A;  2W9Q A;  4R4K A;  3BNB A;  2GU1 A;  3DGL A;  3CMA 3;  1FGM A;  1SIH A;  4JRF A;  5JBS A;  5KP3 A;  4KFE A;  3WDG B;  3FKA A;  3NX0 A;  1IQX A;  2CFG A;  3DXO A;  1JKG B;  1EA2 A;  3HI7 A;  3H3H A;  4BTX A;  3WOE B;  2XGN A;  2CC3 A;  1IQY A;  4XBY A;  3BNE A;  1Q42 A;  4L7K A;  1E3R A;  1ZO2 A;  2BMR B;  1YHQ 3;  4N3V A;  2O9U X;  4WHA A;  3DGM A;  3F8X A;  3LZA A;  3S67 A;  4XB5 A;  3CCL 3;  1W4N A;  4OUQ A;  1RRL A;  4FMC A;  5DRV A;  1NU3 A;  3LTD A;  3U1W A;  2Z77 A;  1J2B A;  2XGL A;  2C10 A;  4AEQ A;  3OWS A;  1FGT A;  3CCR 3;  5BXQ A;  2HMK B;  2XF3 A;  2IMJ A;  2FNQ A;  1O7P B;  3SOA A;  3EF8 A;  4XBX A;  4MEI A;  1YJW 3;  3LTB A;  1AVK A;  1RN7 A;  2W2C A;  4HM0 B;  1YIT 3;  3DM8 A;  1N8R 4;  3JUN A;  4H61 A;  1YIJ 3;  1CQS A;  2XRX B;  5STD A;  2RFR A;  2FGT A;  3G6E 3;  4LGQ A;  3EC9 A;  3IMA B;  5IF6 A;  3S27 A;  1YJN 3;  2MC8 A;  1JB4 A;  1VQO 3;  4XM4 A;  3T8N A;  2B24 B;  3G16 A;  1OUN A;  1N5H A;  1RJO A;  4N6M A;  1AV4 A;  1T5Y A;  2W6J H;  1CEW I;  2CHC A;  1PFP A;  1JN5 B;  4EYC A;  3LXU X;  4IT7 A;  3EE1 A;  2PZV A;  2XFS A;  2YFL B;  2W9P A;  1OGX A;  1QAF A;  5AEU B;  4FCM A;  1HU9 A;  5IER A;  3VF1 A;  3OW2 2;  2CIU A;  2Z7A A;  1IVU A;  2Z6B A;  4EBG A;  2Z76 A;  3PXM A;  3LTC A;  1IVW A;  2BNG A;  1OAC A;  3CCE 3;  1A2V A;  3JUQ A;  4K1V A;  5TGN A;  3S5C A;  3FF0 A;  1VQ4 3;  2QGU A;  2YFJ B;  3PS8 A;  1GYB A;  4HM7 B;  4KFF A;  1W6G A;  3NUV A;  1VQM 3;  3K0Z A;  1EQK A;  3OXA A;  4R80 A;  5CK6 A;  3NM7 A;  3B8L A;  1VQ8 3;  3CNX A;  3V92 A;  2F98 A;  5IEN A;  1LNH A;  1NB3 I;  2F86 B;  2YFI B;  4X2H A;  4LEH A;  2OWP A;  3E99 A;  2CW9 A;  1E97 A;  2V1L A;  3D9R A;  3DZL A;  3GZY B;  7STD A;  5CF2 A;  3RDE A;  3IJE B;  3I56 3;  1Z1S A;  1IV7 A;  4RNY A;  3T0U A;  1VQ7 3;  5LC6 A;  3LTA A;  1DMM A;  2RCD A;  2XFT A;  3F7S A;  4LSO A;  2R4I A;  3CC4 3;  3V98 A;  1UW1 A;  3CC7 3;  4WYK A;  1TIJ A;  1K73 4;  3SX1 A;  3LOY A;  3MSO A;  4N6L A;  3X40 A;  3QRD A;  3K5T A;  2IUJ A;  4IIA A;  3SED A;  2W0Q A;  1ASK A;  1CYV A;  1UUW B;  1N9J A;  2P0M A;  1Q82 4;  1OF5 A;  1K8A 4;  2QEX 3;  1ZX2 A;  2HMJ B;  4HM8 B;  1N9E A;  1Q86 4;  2ZDJ A;  3WA3 A;  2OOV C;  1OCV A;  1WQL B;  2OCT A;  1FUW A;  1AR0 A;  1WMP A;  3GZX B;  1Q40 A;  3HII A;  3AMO B;  4HBR A;  1GY6 A;  2K0M A;  2IA7 A;  1W00 A;  3PCR A;  4XDV A;  3HX8 A;  3CCM 3;  2OOV A;  2WGO A;  1VQ6 3;  2LYX A;  3ECF A;  1PU4 A;  3JVC A;  4HKV B;  2JQ5 A;  4ORL A;  1GD4 A;  4EV2 A;  3B7C A;  4XBT A;  3U97 A;  3OX9 A;  4RZM A;  3SXX A;  2W03 A;  1ROA A;  3MWZ A;  3ER7 A;  3UL6 A;  3X3Z A;  4HM3 B;  4RNZ A;  1K9M 4;  3CPW 2;  1M1K 4;  4FCZ A;  5FGO A;  3X3Y A;  1JB5 A;  5ELU A;  3CCJ 3;  4K61 A;  3DY5 A;  3KFQ C;  4PEJ A;  3OWU A;  1DMN A;  1UI8 A;  2STD A;  2P05 A;  3PGB A;  1IK3 A;  2OQE C;  1A2K A;  1NO3 A;  2CWV A;  3PZW A;  3S29 A;  4K1U A;  1OH0 A;  2YX9 A;  2KCD A;  3F8H A;  4AKZ A;  2GBX B;  4CCV A;  3MKI A;  2CWT A;  4WWU C;  4HM6 B;  4I4K A;  1LOX A;  1STD A;  3KN4 A;  1FGO A;  3CNM A;  3DUK A;  3O8Y A;  3EN1 B;  3SOY A;  3DGO A;  2QIY A;  4BTY A;  1Q7Y 4;  1EG9 B;  5AIG A;  4HM4 B;  3F7X A;  1ULJ B;  3EX9 A;  3JUO A;  3PCS A;  3X41 A;  1YI2 3;  3UJM A;  2GU3 A;  3GWR A;  4GB5 A;  2XSO B;  5AEW B;  5IG5 A;  4MJD A;  1RKY A;  3HIG A;  3NV0 A;  1IT8 A;  3HK4 A;  4MMZ B;  1IVV A;  2BMO B;  4LMI A;  4O8S A;  1VZZ A;  3Q2P A;  2ML6 A;  4EXR A;  3PYJ A;  5KP1 A;  3NHX A;  3CXC 2;  2CWU A;  4FCJ A;  1W5Z A;  3J7Y d;  3JUM A;  4EV5 A;  4U13 A;  3CD6 3;  1D6Y A;  5D83 A;  1D6U A;  1TP6 A;  1OGZ A;  2BHM A;  2HMN B;  3F9S A;  1IQ8 A;  2IUK A;  1UUV B;  3V99 A;  3K63 A;  1WTH A;  4HZ9 B;  3OWY A;  2E2V A;  1GY7 A;  4FR9 A;  1A90 A;  2HMO B;  5AYS C;  3GRD A;  1IV9 A;  4R9L A;  3BLZ A;  4KZ1 A;  1W01 A;  3F40 A;  1S72 3;  3L0R A;  4OVM A;  3M8C A;  1FGQ A;  3EHC A;  2HMM B;  1SJW A;  4WFO A;  3FG1 A;  1F8N A;  1GD3 A;  1WMN A;  3GAX A;  1M9G A;  2WO0 A;  3N8B A;  1ULI B;  1QJG A;  3B4O A;  3BNC A;  3FG3 A;  5AII A;  1VQ9 3;  1OHS A;  1M1X B;  4WP5 A;  3CME 3;  5KP4 A;  3NBJ A;  3CPO A;  5AIF A;  1QVF 2;  4HJL B;  5EEO A;  1TUH A;  3MYT A;  3STD A;  5ELJ A;  1SQW A;  1KC8 4;  1WNH A;  1DVC A;  5IW9 A;  1QVG 2;  3CU3 A;  3WOD G;  1Y4K A;  4EC6 A;  3HZP A;  4AKY A;  3G8Z A;  1NWW A;  3DGN A;  1N8Q A;  4NRE A;  2CH9 A;  4LZI A;  3MG3 A;  3H51 A;  5JPU A;  2GEY A;  3SVA A;  1TFK A;  3KSP A;  6STD A;  5CLK A;  1STF I;  5EVH A;  1O7G B;  1O7W B;  1DVD A;  2GBW B;  1UI7 A;  1R4C A;  2CFW A;  2I9W A;  4Q53 A;  2W04 A;  3FH1 A;  3B4P A;  2ZL8 A;  2CFL A;  4WYK B;  2RGQ A;  3GZR A;  1TFO A;  2PNC A;  2W56 A;  4IPB A;  4MMY B;  4XDW A;  5AIH A;  2D42 A;  5CF1 A;  3CCV 3;  4ZM8 A;  1M90 4;  3EB8 A;  1NDO B;  4K90 B;  1OF5 B;  2XH9 A;  2RSX A;  1DMQ A;  2A15 A;  2JDI H;  2XSH B;  4G1M B;  3WMD A;  3NBB A;  3FGY A;  1Q40 B;  4TX4 A;  3KSE D;  1JKG A;  1W7C A;  4R1K A;  5CXO A;  3BB9 A;  2ML5 A;  2CK3 H;  3X42 A;  3ROB A;  1KSI A;  4N6O B;  3RGR A;  2CFD A;  1QAK A;  1JRQ A;  3JUP A;  4J8T A;  3DMC A;  2WOH A;  1MOL A;  1V74 A;  4H3U A;  3LML A;  3CCU 3;  1Q81 4;  1QAL A;  3FG4 A;  1N5P A;  2KRT A;  2P0X A;  5DRE A;  3TDG A;  3EJV A;  3UB1 A;  2WOF A;  3OV4 A;  5D82 A;  1NB5 I;  5D81 A;  1US1 A;  3LT8 A;  2BO9 B;  2K54 A;  4FMA A;  4L8O A;  2GEX A;  2OQE A;  2E2U A;  3G0K A;  4N6T A;  5AYR B;  3RGA A;  3FF2 A;  5IG4 A;  2CG1 A;  1JV2 B;  3A76 A;  1A67 A;  2Y74 A;  1KQS 2;  1LVN A;  2D1W A;  3N9H A;  3UL5 A;  3F14 A;  3CC2 3;  3CCS 3;  1VQL 3;  3UNL A;  4N6V 0;  4HYZ A;  3NBR A;  3G4S 3;  2B1X B;  4FMD A;  4CDL A;  1CYU A;  1O7H B;  3BND A;  5IEP A;  3G71 3;  4O2H A;  3T8U A;  2BT3 A;  3D3L A;  4RBN A;  5FW5 A;  2QA4 3;  1RRH A;  1NJI 4;  1YJ9 3;  1JN5 A;  3KZT A;  3Q90 A;  3FLJ A;  4L8P A;  1S5A A;  3SLU A;  1KWI A;  3KII A;  1W2Z A;  4MMX B;  1OHO A;  4FMB A;  1VQP 3;  2OTL 3;  1EKM A;  2GXF A;  2MF7 A;  1U8C B;  3Q1C A;  1YGE A;  3NV0 B;  1IU7 A;  2CFK A;  3FZW A;  3FCS B;  2KXG A;  1MNL A;  4HM2 B;  2HML B;  1OHP A;  5IEO A;  2M7O A;  2LQV A;  4GL6 A;  4BTW A;  3VGN A;  3MG2 A;  1ISK A;  3EBT A;  5I97 A;  3X3X A;  5BVB A;  3I0Y A;  2UX0 A;  1IDP A;  3EQQ B;  3K7C A;  5LC7 A;  2L4V A;  3NM2 A;  8CHO A;  1D6Z A;  4STD A;  3LT9 A;  1OPY A;  2SBL A;  3S28 A;  1U5O A;  1DYU A;  1LXE A;  1W6Y A;  1BUQ A;  2F99 A;  3FSD A;  2FXT A;  3KKG A;  4HZB B;  3LYG A;  1JNQ A;  5A0O B;  1IT7 A;  3K9M C;  2Y73 A;  1K28 A;  3GZB A;  1L5G B;  1QMA A;  1AVL A;  1HKX A;  4JF8 A;  1W6C A;  1W02 A;  3WOF B;  1VQN 3;  4KFD A;  3LH4 A;  4N6N B;  5EQL A;  5JPP A;  1O7M B;  1GS3 A;  1C7H A;  1TU5 A;  2OTJ 3;  3NQZ A;  2XR8 B;  4KVH A;  4O3V A;  2O3O A;  1ROV A;  3KE7 A;  2INX A;  1G96 A;  3MHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...