2KXJA

Solution structure of ubx domain of human ubxd2 protein
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
90
structure length
90
Chain Sequence
MGHHHHHHMSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution strcture of UBX domain of human UBXD2 protein
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords UBX domain-containing protein 4
total genus 10
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2010-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kxjA00
3NHEB 1WGYA 2G4SA 3PSEB 1YD8U 4WAAA 4BBNF 2GBKA 2C7NB 3KYCD 4F8CB 2LVPA 3VH4B 1V9JA 1BT0A 5L95C 2XK5A 3PRPB 4W9DA 4JGHB 2CU1A 5BO4B 4NJ7A 3RYTA 1GC7A 2GBMA 1XD3B 1RLFA 4HCPB 3A4RA 2BYVE 3Q3FA 4FHJA 2KJRA 2BPSA 2V4LA 4RMAA 5HKHA 1F9JA 2MQJA 4WQOB 2J0JA 4BOZB 4MEMA 4EUTA 5C1ZA 2K8HA 2NPTA 3TJPA 4LJPB 2ZVNA 2MW5A 4K81A 4GGQA 3IBEA 3T8MA 2NS5A 3JVZX 1WI0A 3KH0A 4MELA 3PRMB 3OLMD 4FADA 2CHWA 3TL5A 2C5LC 3K9PB 2KX3A 5C23A 4HDQA 3V61A 3QCAA 1WGDA 3X0WA 3R3MA 5IAAC 2CKHB 4G11A 5LXIB 3EHVA 1V49A 3PS6A 4KZCA 4ICUA 3PHWB 2KTRB 3JYUA 3M63B 3VTUA 2K8CA 2XK5B 3QC8B 1NDDA 3DVNV 4TQ0A 2ZNVB 4KDLB 4II3B 3RCZA 2L7RA 3QK0A 4URKA 1NBFC 2KOXA 3AU4A 3ZNGC 4FULA 5J17A 1YX6B 2N9EB 3ML8A 2HD5B 1K8RB 1TGZB 3ZNZB 1S1QB 3AULA 4MJSA 2WX1A 3L10B 3RULA 2ZJDA 4B9KA 2FCQA 4DBGA 2XBBC 4LDTB 1LM8B 1WRDB 2LWPA 4FLHA 1V81A 1WGGA 4KIKA 1IP9A 1E8WA 1CMXB 3S2AA 1WX7A 4AWJA 4IUMB 4BKSD 4DXAB 4MJSB 2K1FA 2AL6A 2DZIA 3ZUNA 3CSFA 3PZDA 4PYUA 2NCNA 4DHJD 1V80A 4TUUA 2BKRB 5CHFA 5E6NA 3V6EB 1WR1A 3PVLA 5G2NA 4HPLB 3BINA 2GMIC 1WGRA 3QHTA 4ANUA 2N7DA 1I35A 4FN2A 1LQBA 2AWTA 4KZ0A 2GBNA 3TCAA 3QIJA 5TR5A 5E6OA 4HXDA 3KUZA 3MHSD 2JWZA 3L54A 1WYWB 3RUIB 4J6IA 2M17A 3QAQA 2KD0A 3QJZA 3N3KB 2AYOB 4HJKA 2MCNB 3QQ8B 1MG8A 1WXAA 2A5UA 2KJHB 2FNJB 2ZNVC 2KQ7A 1I42A 4WJQA 1WJUA 5FR6A 2L0FA 3QARA 3PTFC 1E5WA 1WGHA 3A9JA 1WXSA 4EKUA 2QHOA 4TQ1A 2J0KA 4WJPA 1Q0WB 3ZDMC 4BBNC 5KHQA 2JZZA 2DX5B 2BKFA 3AU5A 2DYBA 2C60A 2KHWB 4IWPA 2N7EA 1ZW7A 1P1AA 2JXXA 2O6VB 3KW5B 1GJZA 3APDA 1YQBA 3TIXA 2UYZB 2ZEQA 1M94A 4F7ZA 4AJWA 1GC6A 1SIFA 2L8JA 3R7QA 3NS8A 2ZPYA 4W9FA 4ANVA 5CX3A 2NVUI 2ZCCA 2DHZA 3NZSA 2D3GA 3PRZA 5CHWA 3ZRCA 1JRUA 2ASQA 1Y8RC 2MBOA 4M8NA 3B0AA 4GDLB 4II2B 2R2QA 3VFKA 2ZCBA 3L0WB 4E74A 2C7MB 2N9PC 1WX8A 3PGEA 2Y5BB 1UZXB 2XEWA 2KZRA 2KDIA 2IBIB 2M1MA 1OGWA 2M8SA 4E3CA 1WFYA 3SDLC 3ZLZA 3WALA 1R4NI 5CHVC 3TMPB 2ZZPB 3R66C 5AEKB 2K39A 5D94A 2RPQA 3ZRFA 3ZVVA 2KX0A 3O65B 5D2MB 2ZPNA 1J8CA 2JRIB 3DQVA 5DPWA 2G3QB 4ASWC 5LLIA 3H7PB 3WIMA 2IO1B 2A4ZA 1C3TA 4AOFA 2MLBA 2PE9A 3B1LX 4JQWC 3ZTCA 5LXHA 2KLCA 2G45B 2LGXA 3APFA 4JIOU 3UIOB 3A1QB 1L2NA 1WMHB 4ZRJA 2MP2B 4KIKB 4M0WB 2PE6B 5JZEB 2JT4B 4GMVA 4BFRA 4B95A 3C0RB 3H9DA 1C1YB 1Z2MA 3VUYA 3VTVA 3KVFB 3Q3JA 4XX5A 2LJ5A 1EF5A 3RZFA 1IPGA 2KWVB 4FJYA 1H4RA 4IM0A 2Z0DB 3KUDB 4IW0A 3PLVA 3DCGA 2CHZA 1RFAA 2N9XA 4MSMB 3DPDA 3VH3B 5J2RA 4BKGA 1EO6A 1WR6E 2MRPA 3ML9A 3ZKJC 3WAPA 2HTHA 1WZ0A 3W1YA 2I1KA 2IO3B 2KXJA 4GB9A 4CO7A 3P2BA 3L13A 1WH3A 1V5OA 4LDTD 2Z0EB 1WM2A 4TKNA 2KFJA 4W9EA 3UGBB 4BKSA 4KVGB 1YIWA 4OVVA 2KTRA 3A4SC 4GN1A 3D32A 1UH6A 2DZJA 5DPRA 1P0RA 5GMVA 1OEYJ 1AARA 1UELA 2D2QA 3VHTC 3EC8A 3L08A 2MBEA 3EFUA 2KC1A 4IG7B 2RD0A 2AEHA 1EF1A 2L3ZA 2KMAA 2KDEB 4BVUC 4CHKA 2FCNA 2O6VD 1TTNA 3VVWB 2CHXA 3NY5A 4YL8A 2KFKB 4DHZB 3U7DA 3WA0A 4WWPA 1Z5SB 2BWFA 4W9CA 4DHJB 3PT2B 2O2VB 2KK8A 3A1QA 2KDFB 2NBVB 4FHKA 4F1SA 2C9WB 2BYEA 2KWUB 2KANA 3MJWA 3ZNHB 3DVNU 4MGYE 4W9IA 5KHOA 3HM6X 3L17A 3NZUA 2EMSA 2K6QA 1UBIA 3A9KA 1P9DU 4G0NB 4EZJA 2GOWA 1E90A 2N4FA 3DBRI 1SE9A 5D7GA 3W1SC 4AP4C 4DK5A 1V86A 4W9JA 2HJ8A 1E7UA 1PQSA 1YX5B 4MGKE 5DPTA 3OJ3A 1SGHA 2C7HA 2NBWB 3A9JB 2LRWA 4LJOB 3CMMB 4GU2A 3LDZE 1KM7A 1Q5WB 3ZNID 1HE8A 2MBQA 3VQIA 4NQKE 3ZIMA 3A33B 2I1JA 4NAWB 2JRHA 4I6NB 2VRRB 4HWIB 2NR2A 2YVCA 2LGDA 4MDKE 2FAZA 1J19A 1OTRB 1R4MI 4DHZE 3SHQA 4NPNA 1TBEA 2L76A 2PPHA 1WJNA 2MWSB 3LJ3A 1Q1OA 4I6PA 4K7UA 2L05A 1WMHA 4DDID 2UWQA 3IHPC 1V2YA 2KDBA 4K7WA 2NBUA 4HLEA 2LI5A 3RT3B 4FA6A 4EOYA 5E6PA 1KJTA 2RGFA 3KYDD 2ZVOA 4A20A 1EUVB 2N1WA 2K8BA 3NOBA 2FIDA 4W9HA 2FCSA 4MM3A 3R7RA 5J18A 2KC2A 4EZKA 2DYMA 3JSVB 4PYZA 5EDSA 3H6NA 2RSUA 4GDKA 1VCBA 1UGMA 5IA7A 3MTNB 1ZKHA 2J0MA 2MBBB 1ZGUB 1WXMA 3U30A 4A3PA 4BKTA 4B6WA 3DOWA 1E8ZA 2W9NA 4W9LA 4E71A 4A3OA 4ZYNA 1GG3A 2KO3A 1WY8A 3IFWB 3U8ZA 3T9LA 2BYFA 4RM9A 3ZW3A 1L7YA 3V62A 2WYQA 4MH0E 3HM3A 2DYOA 4N9F4 1QZEA 2Z59B 2JPHA 4NQLB 1XQQA 4IM2A 2OOBB 3B08A 2CS4A 4HDOA 1E8XA 2IY1B 1TZ1A 4I6LB 2HE7A 4ICVA 5DPSA 3CSTA 2JZ3B 4W9KA 3V60A 3PLUA 3BY4B 4W9GA 3VAWA 2KN5A 4NJ6A 3VTWA 2BF8B 4GOCA 3VUWA 1U4AA 1UD7A 3L16A 4GDKB 1WX9A 3W1SA 4WWNA 4IM3A 4RM8A 2JF5A 1E7VA 2LUEA 1WXVA 3SD5A 4BOSC 1OEYA 2DAJA 3A9KB 4KSLC 3ZDTA 5AZHA 1RRBA 2GBJA 2YLMA 3OJ4B 1FXTB 4HPMB 1WZ3A 2FCMA 2JY6A 2WWZA 4M8MA 3JW0X 3DVGX 2M4NA 3OAWA 2EMTA 4TV3A 5JH5C 5AZGA 2LGYA 1D3ZA 3DBHI 1E8YA 2IY0B 2LVQA 4AUQC 2O2VA 3WAOA 3WAMA 2PEAA 4EEWA 1GNUA 2DZKA 3I3TB 2REXA 5JHAA 3H1UA 3UINB 3ALBA 4PS8A 2K25A 4GXBA 4ZRIA 4ANXA 2KWCA 3QWZB 2CR5A 2BGFA 2KQSA 2KMCA 4KV2A 2DAFA 3QX1A 2EKEC 3PREA 2FIFA 2KJ6A 2IO0B 2L00B 2OJRA 3IG3A 4JL9A 4WJNA 2R2OA 4G50A 4KDIC 4OVUA 2O6VA 3DVGY 5DCNA 1J0GA 2MP2A 3CF6E 3ECIA 2WX0A 4X57B 5L83A 1WJ6A 4XZ4A 4WJOA 3QA8A 3GOEA 1RAXA 4EZLA 1G6JA 4ANWA 2LXAA 3X23A 5JHBA 4GDLA 1WIAA 2G4DB 2L0TA 1LFDA 3HK0A 4MGZE 4CYEA 3PPAA 2LXCA 1GUAB 3N32A 3TBLD 4IWOA 2GBRA 3HIZA 3WANA 2MX2A 2IO2B 4XC2A 1T0YA 4JLCA 4HCNB 1NI2A 3VXWA 3N30A 1UBQA 3H7PA 2DZMA 1WE6A 2D07B 1KLVA 1WM3A 2KTFA 3UF8A 3M62B 2K6DB 3ONSA 4FJVB 1XT9B 4DWFA 1IYFA 2JVCA 4K1RB 2KLGA 4IWQA 1KOTA 2RR9A 3M3JA 1P3QU 2V3SA 2V1YA 3RZWC 4DDGD 1S3SG 5D6JB 2LVOA 3V6CB 3ZTDA 1P98A 2IYDB 2JUOA 1V5TA 2KFKA 4HK2A 1H8CA 1X1MA 2LASA 3K9OB 3JSVA 3KUCB 2KKCA 2NPTB 4WWOA 3DBLI 3VDZA 2MA9B 3UQBA 4IC7B 4K7SA 4NNJB 4GIVA 3H7SA 4EFOA 3PV1A 2AL3A 4G3XB 1OQYA 1V6EA 4GSWA 3PHXB 3ZO5B 4MSQB 5G55A 2DENB 2D10A 5AZFA 2MSED 2M0XA 1LXDA 3ENEA 4LCDE 1ISNA 1VD2A 3AXCA 3M95A 4MGIE 2KNBA 3SU8X 3AI5A 2LD9A 3APCA 1WE7A 2N1VA 2PJHA 2FUHB 3RD2A 2J7QB 4AJYB 3HHMA 3DBSA 3DDCB 1YJ1A 3GZNI 2LZ6A 4NY0A 4P7IA 3UQAA 4FBJB 3UIPB 3IVFA 2WDTB 3VUXA 4HVBA 2B3AA 2D11A 3EECA 1WJ4A 4NAWA 5CTRC 2MBHA 4KSKC 4FJZA 2IZVB 4ZRKA 2BWES 2KVRA 4PS7A 2LRUA 1A5RA 4ZDVA 4PS3A 1WF9A
chains in the Genus database with same CATH superfamily
3NHEB 3PSEB 4F8CB 2C7NB 2LVPA 2KN4A 2N7JA 2WDRB 2XK5A 1I4XA 4W9DA 1ZXIA 1NENB 2CU1A 1GC7A 4OZAA 1XD3B 3Q3FA 2N0SB 2BPSA 5HKHA 5C1ZA 1FM0D 3ZJVA 4RF1A 5IOIA 2NPTA 3TJPA 2ZVNA 2MW5A 3T8MA 3NVZA 1FCLA 4HDQA 3NVYA 4P6VF 2K9XA 2PVGC 5IAAC 5LXIB 1J7AA 3PS6A 3PHWB 2KTRB 3JYUA 2K8CA 2K0PA 3NS1A 3RCZA 3AU4A 2QEJC 1K8RB 1CK1A 1SBBB 3RULA 2WX1A 2ZJDA 2FCQA 2W82A 2J53A 1HXYD 2XBBC 2LWPA 3MJ5A 5TSSA 2KQ4X 1WGGA 4A9AA 1WX7A 4MJSB 2WXNA 5FR3A 2AL6A 4ZHOA 5CHFA 1WR1A 2GMIC 4YTPB 1P7EA 4KZ0A 1ZDXA 5E6OA 4HXDA 5BMIA 2ZW0A 1FD6A 2KT7A 2M17A 1N6ZA 4YXDB 2KD0A 1E0ZA 5AUKA 2AYOB 2KJHB 1YN5A 1ZP0B 3PTFC 1E5WA 2PTLA 4BBNC 3ZJUA 2WXLA 1QQRA 1MG4A 2JXXA 2O6VB 4OW0A 3KW5B 3TIXA 1WYGA 2ZEQA 2ONQA 5HHDG 2FBWB 1ENFA 2RDGA 2ZCCA 2DHZA 3NZSA 2D3GA 1KLUD 4HROA 3N9YC 4II2B 3AE1B 2R2QA 3GE8C 4TMAB 3L0WB 2Y5BB 3DBHB 2XEWA 1WFYA 3SDLC 2LHDA 3WALA 5EE9A 3TMPB 4ACFA 3W9CB 3AE6B 1ZPSA 3ZVVA 2HJ1A 2KX0A 2QIEB 2ZPNA 2D3AA 2JRIB 5DPWA 3H7PB 2IO1B 2A4ZA 1TY0A 2MJEA 4JQWC 2LGXA 4JIOU 3UIOB 3PZ8A 2IPKD 1WMHB 4ZRJA 4M0WB 1WXQA 2JT4B 4B95A 4C4VA 1I4QA 1T0SC 3AMZA 1JWMD 2KWVB 5E6JA 3KUDB 2BW2A 3PLVA 1TKYA 4BKGA 3OG5A 3ML9A 3WAPA 3L4PA 2BQQA 3P2BA 4LDTD 1XF5L 4BKSA 2AQ1B 4ITKA 3GS2A 4IKGA 2DZJA 5GMVA 1OEYJ 1UELA 3EC8A 4OVZA 2MBEA 4ARIA 2RD0A 4HJGE 4C7ZA 1EF1A 3FILA 1TTNA 2LMCA 4DHZB 4GLSC 1Z5SB 2BWFA 3KLSX 2C9WB 1I4RA 1YOVB 3ZNHB 4W9IA 2M19A 3HM6X 2LUMA 4LNFA 1P9DU 4G0NB 2GOWA 1NI3A 1CQVA 1SE9A 1V86A 4W9JA 4MGKE 1SGHA 4LJOB 3A9JB 3CMMB 3LDZE 1ZDVA 2VZKD 3NUHB 3VQIA 1ROEA 2NMQA 3A33B 3H8HA 3BYTB 2LGDA 4RH6A 4MDKE 4HRSA 2SAKA 2WXPA 2BB6A 4WAFA 3RNGC 1TZOA 1FNUA 1FFUA 1UNSA 2L76A 1WJNA 1WGKA 2UWQA 4IDIA 1TYGB 1SIJA 4HLEA 2LI5A 4FA6A 4JWSC 4US8A 3KYDD 1NEKB 5HG2A 2N1WA 2K8BA 4MM3A 2TSSA 1I4HA 5EDSA 2J0MA 4XWWA 4RGNA 3U30A 4A3PA 3B2GA 4ZYNA 1GG3A 3P42A 4CQNA 1OQQA 3ZW3A 4MH0E 3HM3A 2CU3A 1QZEA 3RMKC 2DNFA 3B08A 2CS4A 1C78A 1F0ZA 3V60A 4A90A 4A8XC 3BY4B 4W9GA 3VAWA 4NJ6A 2INDC 3LYYA 3L16A 1WX9A 3DBRB 3Q3NC 1YMHE 2ZW1A 3ZDTA 2Y5CA 4HPMB 2WWZA 2M4NA 5JH5C 5AZGA 3DBHI 4AUQC 3FILB 3IXSA 3MFGA 3I3TB 5JHAA 2WXIA 3H1UA 3UINB 4PS8A 2K25A 4ZRIA 4FXCA 2CR5A 3PREA 4US9A 4G50A 4KDIC 1FRDA 4OVUA 5DCNA 2WX0A 3QA8A 3GOEA 2BS3B 1PYWD 3AE4B 1WIAA 2D3CA 1CJEA 1UGJA 3LB8C 4JLCA 3EFCA 1OQRA 5FK9C 4HCNB 1LGRA 2PIAA 2DZMA 1KLVA 3FC4A 1E10A 2RPVA 2KTFA 3UF8A 2BT6A 4FJVB 1XT9B 2JVCA 2QSDA 3HUIA 2V1YA 4P1BC 1AN8A 1P98A 1XLPA 2QC8A 4HK2A 3URYA 4RF0A 1MFWA 3P63A 3KUCB 2MA9B 4IC7B 3PV1A 4G3XB 2XNAC 3ENEA 4LCDE 3SU8X 2M56B 3TUOA 2FUHB 3DBSA 1YJ1A 1HEZE 1JRPA 4AQ7A 2BS2B 3MHZA 3IVFA 3GB1A 2D11A 1SJED 3EECA 5CTRC 1MJDA 4FJZA 5T8IA 2BWES 2GLSA 1FNWA 2LRUA 1QKZA 1A5RA 3Q14C 1WF9A 1WGYA 1YD8U 3VH4B 2H88B 2WDQB 5IN7A 3TSSA 1I4GA 3AE8B 3A4RA 2KJRA 1N63A 2AX5A 1F9JA 4LNOA 4MEMA 4AS1A 2K8HA 1YQ4B 4GGQA 1DOXA 2NS5A 3KH0A 2INCC 3DHHC 1EWCA 2MJDA 1KRHA 3RFZB 3SEBA 3X0WA 4LTUA 3EHVA 3V05A 1D6EC 1JWBD 2XK5B 3QC8B 3AV8A 1NDDA 4TQ0A 1SXTA 1QLBB 2L7RA 3QK0A 1TS3A 1NBFC 5J17A 3CWIA 3ML8A 2HD5B 1TGZB 3AULA 3L10B 1L0YB 1E7PB 1F2RC 1V81A 1IP9A 3P1MA 4AWJA 4DXAB 3DBLB 3TEYA 2LGIA 1V80A 5E6NA 2L52A 2D5GA 3QHTA 1I35A 1GB1A 1LQBA 3UI3A 4KKIA 1FCCC 2JWZA 3L54A 5I4DA 3KWLA 3VRAB 2JSVX 3QAQA 3N3KB 2JYTA 1E9MA 2A5UA 2LGSA 3Q6BA 2W3SA 2B76B 1T0RC 3ZYYX 5FR6A 4NJCA 1WGHA 3A9JA 2QHOA 4TQ1A 5KHQA 1XLQA 2C60A 3PO0A 5D3IB 3MC9A 3APDA 1PGBA 1GC6A 1SIFA 3N20C 3NS8A 2ZPYA 1STEA 1D5ZC 5CX3A 3ZRCA 4PT5A 4KKJA 1Y8RC 3B0AA 3VFKA 2AQ3B 1ZE3D 2C7MB 4DXGA 1LO5D 1OGWA 2M8SA 1JALA 5CHVC 4ZHPA 2ZZPB 3R66C 5AEKB 3OWEB 2QCZA 2X38A 5D94A 2RPQA 3O65B 5D2MB 1J8CA 3DQVA 3WIMA 1C3TA 2MLBA 3ZTCA 5LXHA 3A1QB 2MP2B 4KIKB 4GMVA 1FO4A 4BFRA 1Q10A 1C1YB 3VUYA 3VTVA 3Q3JA 2DWQA 2V0GA 1EF5A 4FJYA 2Z0DB 4IW0A 2CHZA 1EO6A 5EE1A 2NTSA 1WR6E 2MRPA 3ZKJC 3W1YA 4CO7A 1F1HA 1YJIA 2Z0EB 2D3BA 2KFJA 4GN1A 2SEBD 3MC0B 1TIFA 1FXAA 3VHTC 2UU7A 3EFUA 5AUIA 2AEHA 1NYQA 2FCNA 2O6VD 4CHKA 2CHXA 3NY5A 1C4AA 3WA0A 2RMMA 4ZYSA 1L6VA 1YN3A 2O2VB 4FHKA 2JYEA 2BYEA 2KMMA 2KWUB 3DVNU 1ZXHA 3L17A 3NZUA 2K6QA 4EZJA 2YEPF 1E90A 2BS4B 2N4FA 2ON8A 4WWMA 4AP4C 5IP4D 1PQSA 1RFKA 5DPTA 3OJ3A 3HVDA 1HZ5A 1A70A 1KM7A 1C79A 2KVZA 4NQKE 4M0WA 4I6NB 1T3QA 2IGGA 2I38A 3DHIC 2N9LA 4DHZE 3O13A 2PPHA 2MWSB 4I6PA 4DDID 2WXRA 2GRIA 3FKYA 2KDBA 4K7WA 3RT3B 3AE3B 3GZNB 4OHJA 5E6PA 5H92C 1QT9A 2FIDA 5J18A 1JCKB 2DYMA 4PYZA 1KH0A 2RSUA 5BYRA 1VCBA 1UGMA 3I63C 3MTNB 1ZKHA 1WXMA 3I57A 4BKTA 3DOWA 4W9LA 4E71A 2LHEA 4N58A 1WY8A 3IFWB 3T9LA 1F77A 4KGTA 2OOBB 1L5PA 1VLBA 2IY1B 1TZ1A 4I6LB 2G9HD 5DPSA 3N1YC 3VTWA 1UD7A 3W1SA 3ABVB 3HRDD 4IM3A 4WWNA 4NAMA 1E7VA 2DAJA 3AEBB 2QJLA 4UDUC 2GBJA 2K22A 1WZ3A 3W2DA 3Q8AA 2WXGA 2PEAA 4EEWA 3BVGA 1GNUA 1DGJA 4TSSA 2QDFA 3V3XA 2IDYA 4GXBA 4ANXA 3QWZB 2KQSA 2DAFA 2FIFA 2OJRA 4JL9A 2IGHA 3DVGY 1T6BX 2MP2A 3ECIA 3T3OA 1RAXA 1G6JA 4MH8A 4ANWA 2LXAA 1V1PA 3AECB 3EA6A 1JW9D 1GUAB 3N32A 3TBLD 4IWOA 2IO2B 4XC2A 1VR9A 5EE3A 3N30A 4C4VB 2KAJA 3I5JC 3BZDB 3Q69A 1XCQL 3M62B 3ONSA 1IYFA 2KLGA 3TEXA 4A55A 4IWQA 4RFBA 3U2SC 3RZWC 1S3SG 2LVOA 1EWYC 2BVCA 2JUOA 1V5TA 2L32A 3K9OB 2KKCA 2WP9B 1YNTE 3DBLI 2RDHA 4K7SA 4EFOA 4NNJB 3ZO5B 1OQYA 4GSWA 1TY2A 2Q5WD 2DENB 5G55A 1C9FA 2INPE 5AZFA 4LLGM 1XCTL 1UF0A 1L0XB 3M95A 3NZ3A 2BBCA 3APCA 1R7SA 1HA5A 5LNK1 1SE3A 2LFIA 3HHMA 3AB5A 4YSXB 3C19A 3DDCB 2LZ6A 4FBJB 2LEKA 2WXOA 3IT4B 2B3AA 1JWAD 4B0EA 2WS3B 3P4RB 3GP7A 4PS7A 5FKAC 3ZGZA 2G4SA 2X8XX 4ZOHC 4BBNF 1BT0A 1VZ6A 5L95C 3PRPB 5BO4B 4NJ7A 3RYTA 2GBMA 1FPYA 1MPEA 1RLFA 4USAA 4JWUC 4C00A 1UWMA 1L6UA 2V4LA 4RMAA 2MQJA 4WQOB 2J0JA 4BOZB 4LJPB 1ZUD2 3IBEA 1DYQA 2HDEA 3JVZX 1WI0A 3LXFA 4FADA 2CHWA 1VDVA 1SSNA 3TL5A 2C5LC 5C23A 1WGDA 3RNFC 3R3MA 1PDXA 3PZ7A 1V49A 4KZCA 4ICUA 1BUIC 4XWTA 3M63B 3VTUA 1GOZA 3DVNV 2ZNVB 2KOXA 1VZ7A 2N9EB 3ZNZB 2HTME 5BMHA 4B9KA 2V4IB 1WRDB 2YEPB 1JWSD 4KIKA 1CMXB 3RNEC 3NJTA 2L83A 4HKZE 4M00A 3B9JA 3Q8EA 3ZUNA 4REZA 3PZDA 2NCNA 2V3NA 4RGMA 1YQ3B 2BKRB 3V6EB 3PVLA 4HPLB 3BINA 1WGRA 2AWTA 2IJ0A 3AEDB 1MHXA 4R3DA 2QILA 3KUZA 1IBXB 3MHSD 1IGCA 2WXKA 4HJKA 2MCNB 3QQ8B 1MG8A 2ZNVC 2FNJB 2KQ7A 4WJQA 1WJUA 3ZJTA 2ACZB 3Q3MC 4N59A 3DWMA 1WXSA 3BWUD 4WJPA 2J0KA 3ZDMC 2G1EA 2WXHA 3J9CA 3AU5A 2DYBA 4MM3B 3ZQ4A 5C2TB 1GJZA 1D5XC 1YQBA 2UYZB 1IGDA 1M94A 5JXVA 2WNMA 1FEHA 4W9FA 4ANVA 4XGAB 3TEZA 5CHWA 2ASQA 1ET9A 2MBOA 4GDLB 5BYSA 3N1XC 2ZCBA 2N9PC 1WX8A 2WU5B 3PGEA 2KDIA 2IBIB 2M1MA 2PLPA 4XDCA 3AE5B 3ZLZA 2K39A 1EM7A 4O1NA 2L1AA 4WIPA 2EELA 2G3QB 4ASWC 1HTQA 4AOFA 1NVID 2G45B 1V97A 2JQRB 1L2NA 2ICIA 5JZEB 2OEDA 3AE2B 5GXGB 3RPFC 1QILA 3KVFB 2WHIA 3EGRA 4XX5A 2Y3AA 2WXQA 1H4RA 2VZKB 3DPDA 4YWGG 3MP9A 2HTHA 2I1KA 2IO3B 3DHGC 4GB9A 1WH3A 1V5OA 4W9EA 3UGBB 1WM2A 4KVGB 1YIWA 4OVVA 2KTRA 3A4SC 1UH6A 3SR6A 4N6EB 2D2QA 3L08A 4YSZB 4RGOS 2KC1A 1B9RA 4IG7B 3BVMA 2W54A 2L3ZA 2KDEB 1CZPA 3VVWB 3NVVA 1ET6A 3P4SB 3U7DA 4W9CA 1QOFA 3TEWA 3PT2B 1DOIA 2NBVB 4F1SA 2FE8A 3ETRA 3MJWA 4MGYE 4WURA 2EMSA 1UBIA 1V8CA 4LNNA 5D7GA 3W1SC 4ZRQA 1E7UA 2JXTA 2C7HA 1YJJA 3VR8B 4HEA1 2I1JA 1D5MC 2JRHA 2NR2A 1TKEA 4RCOA 1RWSA 1J19A 1K50A 3SHQA 4NPNA 1TBEA 1JQ4A 2E6XA 1Q1OA 4K7UA 4LK0M 1V2YA 4NZLB 1KJTA 2RGFA 2MEKA 4HPPA 2Y5PA 2ZVOA 2PW9A 4W9HA 2FCSA 1ZOYB 3JSVB 3H6NA 4GDKA 2W55A 3RNCC 3SFDB 1E8ZA 4A3OA 2KO3A 1TS2A 4DQOC 2K5PA 2WLBA 1L4DB 2N9KA 3U8ZA 1T5XD 2M0AA 2JX5A 2WYQA 1I4PA 4WH4A 2Z59B 2JPHA 1XQQA 1XO3A 3GE3C 1E8XA 2HE7A 4YTMB 4ICVA 1KLGD 3ZXVA 3CSTA 5MPOA 1L0VB 1T0QC 3PLUA 4S17A 2BF8B 4GOCA 5G5GA 4H2AA 1N5WA 3Q8FA 2JF5A 2LUEA 4DXFA 1C76A 1L4ZB 1C4PA 4M01A 1YN4A 1OEYA 3A9KB 1RM6C 3OJ4B 4LNIA 2FCMA 2JY6A 3JW0X 3DVGX 4ARCA 2EMTA 1J7CA 1HTOA 1D3ZA 1PGAA 1E8YA 2IY0B 3WAMA 2REXA 3ALBA 3VR9B 3BVZA 2BGFA 3QX1A 2EKEC 4XYCA 3E9SA 2IO0B 3IG3A 2R2OA 1J0GA 3CF6E 5L83A 1WJ6A 4WJOA 4BAXA 4M02A 3NRZA 5JHBA 4A6QA 2KWDA 2L0TA 3HK0A 4MGZE 3PPAA 3HIZA 3WANA 2MX2A 1T0YA 4P1CC 4K3BA 4KGSA 3VXWA 1UBQA 2WXFA 3H7PA 1WE6A 1R4MB 2D07B 2BYTA 3BK2A 2E3TA 2K6DB 1FIQA 4K1RB 1KOTA 3M3JA 2V3SA 5D6JB 3ZTDA 2IYDB 1X1MA 1K53A 3JSVA 2NPTB 3VDZA 3UQBA 4EE2A 1V6EA 2MSED 2M0XA 1LXDA 3Q2AC 5HI1A 1VD2A 2K3UA 4MGIE 1SE4A 2LD9A 1M4VA 3AEAB 2N1VA 2PJHA 3RD2A 1WSPA 3AN1A 3KQ4A 4P7IA 4JX1C 2EKIA 2WDTB 4HVBA 1SB3C 1VRAB 1WJ4A 2IZVB 4ZRKA 3NVWA 4ZDVA 4PS3A 4WAAA 2GBKA 3KYCD 4IOIE 4B0MA 1V9JA 3AM9A 1BMLC 4JGHB 3T3NA 5IO9A 4HCPB 2BYVE 3U52E 4FHJA 1TT5B 3R8BA 4EUTA 3C8YA 1PGXA 3B2FA 1R4NB 4K81A 4XE0A 4MELA 3PRMB 2JU6X 3OLMD 1K52A 3K9PB 2KX3A 3V61A 3QCAA 2INNE 4P16A 3RN9C 3MC8A 2CKHB 3P4QB 3P4PB 4G11A 3AH7A 2GI9A 4PK1A 1JMLA 4KDLB 4II3B 4URKA 3ZNGC 2KYWA 4FULA 1YX6B 1Y56A 2JZPA 1S1QB 1SF0A 4MJSA 4DBGA 4LDTB 1LM8B 4FLHA 1E8WA 3S2AA 4IUMB 4BKSD 3AEGB 4S0RA 2K1FA 3E56A 2DZIA 3CSFA 4PYUA 4DHJD 1F52A 4TUUA 5G2NA 3U4EG 4ANUA 1XLOA 2N7DA 4FN2A 1K51A 2GBNA 3TCAA 3QIJA 5TR5A 3RI7C 1WYWB 3RUIB 4J6IA 1JROA 3QJZA 4LNKA 1QOBA 2NTTA 3HVZA 1WXAA 4J3OD 1I42A 3DWGC 2L0FA 3QARA 1BXTA 4EKUA 1Q0WB 2BTEA 2JZZA 2DX5B 2BKFA 4WQMA 2KHWB 4IWPA 2N7EA 1ZW7A 1P1AA 1AW7A 2H89B 1PFDA 4F7ZA 4AJWA 3R7QA 2L8JA 1HZ6A 1P7FA 1WRIA 1F2RI 2NVUI 3PRZA 5C3JB 1SJHD 4XDDA 4YTNB 1JRUA 2I2YA 4M8NA 4C56C 4E74A 2PMVA 2DLBA 1UZXB 1AWDA 2KZRA 4E3CA 3W5VB 1R4NI 3W5UB 1EU3A 2J42A 1PUTA 3ZRFA 1ESFA 1TKGA 5LLIA 3B1LX 2PE9A 2KLCA 3APFA 4YT0B 1XXGA 4HKQA 4RNAA 1XEEA 1I7HA 2PE6B 3RNBC 3C0RB 3H9DA 1Z2MA 2VH2A 4JE3B 2CJOA 2LJ5A 3RZFA 3KWVA 1IPGA 4IM0A 3DCGA 5BMGA 1RFAA 2N9XA 4MSMB 3VH3B 5J2RA 1FRRA 3BIID 1WZ0A 3I9V1 1FXIA 2KXJA 1N62A 3L13A 4TKNA 1KTKA 2BB5A 1OFFA 3D32A 5H8YE 4C80A 5DPRA 1P0RA 2FUG1 1FFVA 1AARA 2LJIA 2RDBC 4K3CA 1DOYA 2KMAA 2MH7A 4BVUC 4YL8A 2KFKB 1GB4A 3SFEB 2KDMA 4WWPA 2OHFA 4C7YA 1J7BA 4DHJB 2KK8A 3A1QA 2KDFB 1QOGA 2KANA 5IKCM 5KHOA 1C77A 3A9KA 5HFYA 3DBRI 4L2YA 4DK5A 2HJ8A 4D2KA 1YX5B 2NBWB 2LRWA 4RGTA 4GU2A 1Q5WB 1ACCA 2R61A 3ZNID 2PVOD 1HE8A 2MBQA 3ZIMA 3BK1A 4NAWB 2VRRB 1N5XA 1V1PB 4HWIB 2YVCA 1TS4A 3NG0A 2FAZA 1OTRB 3CIRB 1R4MI 4MT5A 2XN9C 3LJ3A 1TS5A 2PKOA 2L05A 1WMHA 3IHPC 1V1OA 2NBUA 2VH1A 4EOYA 4KGRA 2V3PA 4A20A 4BZAA 1EUVB 3R7RA 2KC2A 4EZKA 4KX6B 5IA7A 2J52A 2MBBB 3R2TA 1ZGUB 1JWUD 4B6WA 2W9NA 4L1BA 2BYFA 4RM9A 1L7YA 3V62A 2DYOA 2J4XA 4N9F4 3IAS1 4NQLB 4IM2A 2V9HA 3N1ZC 4HDOA 3AE9B 3Q8BA 3R2IA 3IT6B 2JZ3B 1MI0A 4W9KA 2KN5A 4JPSA 3RNAC 2W3RA 3AEFB 3VUWA 1U4AA 1SE2A 4GDKB 1N60A 4RM8A 1RYJA 1UWXA 1WXVA 3SD5A 2QMTA 4BOSC 4KSLC 1FNVA 5AZHA 1RRBA 2YLMA 1N61A 1FXTB 4M8MA 4TV3A 1GAQB 3OAWA 2WQYB 2LGYA 2LVQA 2O2VA 3WAOA 3IAM1 2DZKA 1VJKA 1D4BA 4ZRPA 1QOAA 2OJWA 2KWCA 2WGSA 1WWTA 3VRBB 3BYYB 2KMCA 4KV2A 4WJNA 2KJ6A 2L00B 5EE0A 2WU2B 1C4CA 3FAHA 2O6VA 3AE7B 3WCQA 1NYRA 4L23A 4X57B 4YSYB 4XZ4A 4EZLA 2CJNA 3X23A 1QF6A 1AYFA 1GPXA 4GDLA 2G4DB 1LFDA 4CYEA 1HQRD 2LXCA 2Z8LA 2GBRA 2WDVB 1EU4A 2JWUA 2DBYA 1NI2A 3Q3OC 1WM3A 2WXMA 3AEEB 1UUPA 4DWFA 1MVKA 2KACA 1TJEA 5BYQA 4QAYA 2RR9A 1P3QU 3U7ZA 3ZXRA 4OZBA 4DDGD 3V6CB 4OZCA 2KFKA 1H8CA 2MJ3A 2LASA 1KFYB 4WWOA 2GB1A 4GIVA 3H7SA 1KF6B 2AL3A 5D3DA 3PHXB 1MHHE 4MSQB 1B1ZA 2D10A 2AQ2B 5G5HA 1ISNA 3AXCA 2KNBA 3AI5A 4Q2JA 1WE7A 1E6EB 2J7QB 2IGDA 3EUB2 4AJYB 1IUEA 3Q8CA 1XLNA 3GZNI 4NY0A 3UQAA 2MHJA 3UIPB 1FMAD 4MACA 3VUXA 4NAWA 2MBHA 4KSKC 2KVRA 1IBXA 2WXJA 1SEBD 1VZ8A 3NOBA
chains in the Genus database with same CATH topology
3NHEB 1WGYA 2G4SA 3PSEB 1YD8U 4WAAA 4BBNF 2GBKA 2C7NB 3KYCD 4F8CB 2LVPA 3VH4B 1V9JA 1BT0A 5L95C 2XK5A 3PRPB 4W9DA 4JGHB 2CU1A 5BO4B 4NJ7A 3RYTA 1GC7A 2GBMA 1XD3B 1RLFA 4HCPB 3A4RA 2BYVE 3Q3FA 4FHJA 2KJRA 2BPSA 2V4LA 4RMAA 5HKHA 1F9JA 2MQJA 4WQOB 2J0JA 4BOZB 4MEMA 4EUTA 5C1ZA 2K8HA 2NPTA 3TJPA 4LJPB 2ZVNA 2MW5A 4K81A 4GGQA 3IBEA 3T8MA 2NS5A 3JVZX 1WI0A 3KH0A 4MELA 3PRMB 3OLMD 4FADA 2CHWA 3TL5A 2C5LC 3K9PB 2KX3A 5C23A 4HDQA 3V61A 3QCAA 1WGDA 3X0WA 3R3MA 5IAAC 2CKHB 4G11A 5LXIB 3EHVA 1V49A 3PS6A 4KZCA 4ICUA 3PHWB 2KTRB 3JYUA 3M63B 3VTUA 2K8CA 2XK5B 3QC8B 1NDDA 3DVNV 4TQ0A 2ZNVB 4KDLB 4II3B 3RCZA 2L7RA 3QK0A 4URKA 1NBFC 2KOXA 3AU4A 3ZNGC 4FULA 5J17A 1YX6B 2N9EB 3ML8A 2HD5B 1K8RB 1TGZB 3ZNZB 1S1QB 3AULA 4MJSA 2WX1A 3L10B 3RULA 2ZJDA 4B9KA 2FCQA 4DBGA 2XBBC 4LDTB 1LM8B 1WRDB 2LWPA 4FLHA 1V81A 1WGGA 4KIKA 1IP9A 1E8WA 1CMXB 3S2AA 1WX7A 4AWJA 4IUMB 4BKSD 4DXAB 4MJSB 2K1FA 2AL6A 2DZIA 3ZUNA 3CSFA 3PZDA 4PYUA 2NCNA 4DHJD 1V80A 4TUUA 2BKRB 5CHFA 5E6NA 3V6EB 1WR1A 3PVLA 5G2NA 4HPLB 3BINA 2GMIC 1WGRA 3QHTA 4ANUA 2N7DA 1I35A 4FN2A 1LQBA 2AWTA 4KZ0A 2GBNA 3TCAA 3QIJA 5TR5A 5E6OA 4HXDA 3KUZA 3MHSD 2JWZA 3L54A 1WYWB 3RUIB 4J6IA 2M17A 3QAQA 2KD0A 3QJZA 3N3KB 2AYOB 4HJKA 2MCNB 3QQ8B 1MG8A 1WXAA 2A5UA 2KJHB 2FNJB 2ZNVC 2KQ7A 1I42A 4WJQA 1WJUA 5FR6A 2L0FA 3QARA 3PTFC 1E5WA 1WGHA 3A9JA 1WXSA 4EKUA 2QHOA 4TQ1A 2J0KA 4WJPA 1Q0WB 3ZDMC 4BBNC 5KHQA 2JZZA 2DX5B 2BKFA 3AU5A 2DYBA 2C60A 2KHWB 4IWPA 2N7EA 1ZW7A 1P1AA 2JXXA 2O6VB 3KW5B 1GJZA 3APDA 1YQBA 3TIXA 2UYZB 2ZEQA 1M94A 4F7ZA 4AJWA 1GC6A 1SIFA 2L8JA 3R7QA 3NS8A 2ZPYA 4W9FA 4ANVA 5CX3A 2NVUI 2ZCCA 2DHZA 3NZSA 2D3GA 3PRZA 5CHWA 3ZRCA 1JRUA 2ASQA 1Y8RC 2MBOA 4M8NA 3B0AA 4GDLB 4II2B 2R2QA 3VFKA 2ZCBA 3L0WB 4E74A 2C7MB 2N9PC 1WX8A 3PGEA 2Y5BB 1UZXB 2XEWA 2KZRA 2KDIA 2IBIB 2M1MA 1OGWA 2M8SA 4E3CA 1WFYA 3SDLC 3ZLZA 3WALA 1R4NI 5CHVC 3TMPB 2ZZPB 3R66C 5AEKB 2K39A 5D94A 2RPQA 3ZRFA 3ZVVA 2KX0A 3O65B 5D2MB 2ZPNA 1J8CA 2JRIB 3DQVA 5DPWA 2G3QB 4ASWC 5LLIA 3H7PB 3WIMA 2IO1B 2A4ZA 1C3TA 4AOFA 2MLBA 2PE9A 3B1LX 4JQWC 3ZTCA 5LXHA 2KLCA 2G45B 2LGXA 3APFA 4JIOU 3UIOB 3A1QB 1L2NA 1WMHB 4ZRJA 2MP2B 4KIKB 4M0WB 2PE6B 5JZEB 2JT4B 4GMVA 4BFRA 4B95A 3C0RB 3H9DA 1C1YB 1Z2MA 3VUYA 3VTVA 3KVFB 3Q3JA 4XX5A 2LJ5A 1EF5A 3RZFA 1IPGA 2KWVB 4FJYA 1H4RA 4IM0A 2Z0DB 3KUDB 4IW0A 3PLVA 3DCGA 2CHZA 1RFAA 2N9XA 4MSMB 3DPDA 3VH3B 5J2RA 4BKGA 1EO6A 1WR6E 2MRPA 3ML9A 3ZKJC 3WAPA 2HTHA 1WZ0A 3W1YA 2I1KA 2IO3B 2KXJA 4GB9A 4CO7A 3P2BA 3L13A 1WH3A 1V5OA 4LDTD 2Z0EB 1WM2A 4TKNA 2KFJA 4W9EA 3UGBB 4BKSA 4KVGB 1YIWA 4OVVA 2KTRA 3A4SC 4GN1A 3D32A 1UH6A 2DZJA 5DPRA 1P0RA 5GMVA 1OEYJ 1AARA 1UELA 2D2QA 3VHTC 3EC8A 3L08A 2MBEA 3EFUA 2KC1A 4IG7B 2RD0A 2AEHA 1EF1A 2L3ZA 2KMAA 2KDEB 4BVUC 4CHKA 2FCNA 2O6VD 1TTNA 3VVWB 2CHXA 3NY5A 4YL8A 2KFKB 4DHZB 3U7DA 3WA0A 4WWPA 1Z5SB 2BWFA 4W9CA 4DHJB 3PT2B 2O2VB 2KK8A 3A1QA 2KDFB 2NBVB 4FHKA 4F1SA 2C9WB 2BYEA 2KWUB 2KANA 3MJWA 3ZNHB 3DVNU 4MGYE 4W9IA 5KHOA 3HM6X 3L17A 3NZUA 2EMSA 2K6QA 1UBIA 3A9KA 1P9DU 4G0NB 4EZJA 2GOWA 1E90A 2N4FA 3DBRI 1SE9A 5D7GA 3W1SC 4AP4C 4DK5A 1V86A 4W9JA 2HJ8A 1E7UA 1PQSA 1YX5B 4MGKE 5DPTA 3OJ3A 1SGHA 2C7HA 2NBWB 3A9JB 2LRWA 4LJOB 3CMMB 4GU2A 3LDZE 1KM7A 1Q5WB 3ZNID 1HE8A 2MBQA 3VQIA 4NQKE 3ZIMA 3A33B 2I1JA 4NAWB 2JRHA 4I6NB 2VRRB 4HWIB 2NR2A 2YVCA 2LGDA 4MDKE 2FAZA 1J19A 1OTRB 1R4MI 4DHZE 3SHQA 4NPNA 1TBEA 2L76A 2PPHA 1WJNA 2MWSB 3LJ3A 1Q1OA 4I6PA 4K7UA 2L05A 1WMHA 4DDID 2UWQA 3IHPC 1V2YA 2KDBA 4K7WA 2NBUA 4HLEA 2LI5A 3RT3B 4FA6A 4EOYA 5E6PA 1KJTA 2RGFA 3KYDD 2ZVOA 4A20A 1EUVB 2N1WA 2K8BA 3NOBA 2FIDA 4W9HA 2FCSA 4MM3A 3R7RA 5J18A 2KC2A 4EZKA 2DYMA 3JSVB 4PYZA 5EDSA 3H6NA 2RSUA 4GDKA 1VCBA 1UGMA 5IA7A 3MTNB 1ZKHA 2J0MA 2MBBB 1ZGUB 1WXMA 3U30A 4A3PA 4BKTA 4B6WA 3DOWA 1E8ZA 2W9NA 4W9LA 4E71A 4A3OA 4ZYNA 1GG3A 2KO3A 1WY8A 3IFWB 3U8ZA 3T9LA 2BYFA 4RM9A 3ZW3A 1L7YA 3V62A 2WYQA 4MH0E 3HM3A 2DYOA 4N9F4 1QZEA 2Z59B 2JPHA 4NQLB 1XQQA 4IM2A 2OOBB 3B08A 2CS4A 4HDOA 1E8XA 2IY1B 1TZ1A 4I6LB 2HE7A 4ICVA 5DPSA 3CSTA 2JZ3B 4W9KA 3V60A 3PLUA 3BY4B 4W9GA 3VAWA 2KN5A 4NJ6A 3VTWA 2BF8B 4GOCA 3VUWA 1U4AA 1UD7A 3L16A 4GDKB 1WX9A 3W1SA 4WWNA 4IM3A 4RM8A 2JF5A 1E7VA 2LUEA 1WXVA 3SD5A 4BOSC 1OEYA 2DAJA 3A9KB 4KSLC 3ZDTA 5AZHA 1RRBA 2GBJA 2YLMA 3OJ4B 1FXTB 4HPMB 1WZ3A 2FCMA 2JY6A 2WWZA 4M8MA 3JW0X 3DVGX 2M4NA 3OAWA 2EMTA 4TV3A 5JH5C 5AZGA 2LGYA 1D3ZA 3DBHI 1E8YA 2IY0B 2LVQA 4AUQC 2O2VA 3WAOA 3WAMA 2PEAA 4EEWA 1GNUA 2DZKA 3I3TB 2REXA 5JHAA 3H1UA 3UINB 3ALBA 4PS8A 2K25A 4GXBA 4ZRIA 4ANXA 2KWCA 3QWZB 2CR5A 2BGFA 2KQSA 2KMCA 4KV2A 2DAFA 3QX1A 2EKEC 3PREA 2FIFA 2KJ6A 2IO0B 2L00B 2OJRA 3IG3A 4JL9A 4WJNA 2R2OA 4G50A 4KDIC 4OVUA 2O6VA 3DVGY 5DCNA 1J0GA 2MP2A 3CF6E 3ECIA 2WX0A 4X57B 5L83A 1WJ6A 4XZ4A 4WJOA 3QA8A 3GOEA 1RAXA 4EZLA 1G6JA 4ANWA 2LXAA 3X23A 5JHBA 4GDLA 1WIAA 2G4DB 2L0TA 1LFDA 3HK0A 4MGZE 4CYEA 3PPAA 2LXCA 1GUAB 3N32A 3TBLD 4IWOA 2GBRA 3HIZA 3WANA 2MX2A 2IO2B 4XC2A 1T0YA 4JLCA 4HCNB 1NI2A 3VXWA 3N30A 1UBQA 3H7PA 2DZMA 1WE6A 2D07B 1KLVA 1WM3A 2KTFA 3UF8A 3M62B 2K6DB 3ONSA 4FJVB 1XT9B 4DWFA 1IYFA 2JVCA 4K1RB 2KLGA 4IWQA 1KOTA 2RR9A 3M3JA 1P3QU 2V3SA 2V1YA 3RZWC 4DDGD 1S3SG 5D6JB 2LVOA 3V6CB 3ZTDA 1P98A 2IYDB 2JUOA 1V5TA 2KFKA 4HK2A 1H8CA 1X1MA 2LASA 3K9OB 3JSVA 3KUCB 2KKCA 2NPTB 4WWOA 3DBLI 3VDZA 2MA9B 3UQBA 4IC7B 4K7SA 4NNJB 4GIVA 3H7SA 4EFOA 3PV1A 2AL3A 4G3XB 1OQYA 1V6EA 4GSWA 3PHXB 3ZO5B 4MSQB 5G55A 2DENB 2D10A 5AZFA 2MSED 2M0XA 1LXDA 3ENEA 4LCDE 1ISNA 1VD2A 3AXCA 3M95A 4MGIE 2KNBA 3SU8X 3AI5A 2LD9A 3APCA 1WE7A 2N1VA 2PJHA 2FUHB 3RD2A 2J7QB 4AJYB 3HHMA 3DBSA 3DDCB 1YJ1A 3GZNI 2LZ6A 4NY0A 4P7IA 3UQAA 4FBJB 3UIPB 3IVFA 2WDTB 3VUXA 4HVBA 2B3AA 2D11A 3EECA 1WJ4A 4NAWA 5CTRC 2MBHA 4KSKC 4FJZA 2IZVB 4ZRKA 2BWES 2KVRA 4PS7A 2LRUA 1A5RA 4ZDVA 4PS3A 1WF9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NHE B;  1WGY A;  2G4S A;  3PSE B;  1YD8 U;  4WAA A;  4BBN F;  2GBK A;  2C7N B;  3KYC D;  4F8C B;  2LVP A;  3VH4 B;  1V9J A;  1BT0 A;  5L95 C;  2XK5 A;  3PRP B;  4W9D A;  4JGH B;  2CU1 A;  5BO4 B;  4NJ7 A;  3RYT A;  1GC7 A;  2GBM A;  1XD3 B;  1RLF A;  4HCP B;  3A4R A;  2BYV E;  3Q3F A;  4FHJ A;  2KJR A;  2BPS A;  2V4L A;  4RMA A;  5HKH A;  1F9J A;  2MQJ A;  4WQO B;  2J0J A;  4BOZ B;  4MEM A;  4EUT A;  5C1Z A;  2K8H A;  2NPT A;  3TJP A;  4LJP B;  2ZVN A;  2MW5 A;  4K81 A;  4GGQ A;  3IBE A;  3T8M A;  2NS5 A;  3JVZ X;  1WI0 A;  3KH0 A;  4MEL A;  3PRM B;  3OLM D;  4FAD A;  2CHW A;  3TL5 A;  2C5L C;  3K9P B;  2KX3 A;  5C23 A;  4HDQ A;  3V61 A;  3QCA A;  1WGD A;  3X0W A;  3R3M A;  5IAA C;  2CKH B;  4G11 A;  5LXI B;  3EHV A;  1V49 A;  3PS6 A;  4KZC A;  4ICU A;  3PHW B;  2KTR B;  3JYU A;  3M63 B;  3VTU A;  2K8C A;  2XK5 B;  3QC8 B;  1NDD A;  3DVN V;  4TQ0 A;  2ZNV B;  4KDL B;  4II3 B;  3RCZ A;  2L7R A;  3QK0 A;  4URK A;  1NBF C;  2KOX A;  3AU4 A;  3ZNG C;  4FUL A;  5J17 A;  1YX6 B;  2N9E B;  3ML8 A;  2HD5 B;  1K8R B;  1TGZ B;  3ZNZ B;  1S1Q B;  3AUL A;  4MJS A;  2WX1 A;  3L10 B;  3RUL A;  2ZJD A;  4B9K A;  2FCQ A;  4DBG A;  2XBB C;  4LDT B;  1LM8 B;  1WRD B;  2LWP A;  4FLH A;  1V81 A;  1WGG A;  4KIK A;  1IP9 A;  1E8W A;  1CMX B;  3S2A A;  1WX7 A;  4AWJ A;  4IUM B;  4BKS D;  4DXA B;  4MJS B;  2K1F A;  2AL6 A;  2DZI A;  3ZUN A;  3CSF A;  3PZD A;  4PYU A;  2NCN A;  4DHJ D;  1V80 A;  4TUU A;  2BKR B;  5CHF A;  5E6N A;  3V6E B;  1WR1 A;  3PVL A;  5G2N A;  4HPL B;  3BIN A;  2GMI C;  1WGR A;  3QHT A;  4ANU A;  2N7D A;  1I35 A;  4FN2 A;  1LQB A;  2AWT A;  4KZ0 A;  2GBN A;  3TCA A;  3QIJ A;  5TR5 A;  5E6O A;  4HXD A;  3KUZ A;  3MHS D;  2JWZ A;  3L54 A;  1WYW B;  3RUI B;  4J6I A;  2M17 A;  3QAQ A;  2KD0 A;  3QJZ A;  3N3K B;  2AYO B;  4HJK A;  2MCN B;  3QQ8 B;  1MG8 A;  1WXA A;  2A5U A;  2KJH B;  2FNJ B;  2ZNV C;  2KQ7 A;  1I42 A;  4WJQ A;  1WJU A;  5FR6 A;  2L0F A;  3QAR A;  3PTF C;  1E5W A;  1WGH A;  3A9J A;  1WXS A;  4EKU A;  2QHO A;  4TQ1 A;  2J0K A;  4WJP A;  1Q0W B;  3ZDM C;  4BBN C;  5KHQ A;  2JZZ A;  2DX5 B;  2BKF A;  3AU5 A;  2DYB A;  2C60 A;  2KHW B;  4IWP A;  2N7E A;  1ZW7 A;  1P1A A;  2JXX A;  2O6V B;  3KW5 B;  1GJZ A;  3APD A;  1YQB A;  3TIX A;  2UYZ B;  2ZEQ A;  1M94 A;  4F7Z A;  4AJW A;  1GC6 A;  1SIF A;  2L8J A;  3R7Q A;  3NS8 A;  2ZPY A;  4W9F A;  4ANV A;  5CX3 A;  2NVU I;  2ZCC A;  2DHZ A;  3NZS A;  2D3G A;  3PRZ A;  5CHW A;  3ZRC A;  1JRU A;  2ASQ A;  1Y8R C;  2MBO A;  4M8N A;  3B0A A;  4GDL B;  4II2 B;  2R2Q A;  3VFK A;  2ZCB A;  3L0W B;  4E74 A;  2C7M B;  2N9P C;  1WX8 A;  3PGE A;  2Y5B B;  1UZX B;  2XEW A;  2KZR A;  2KDI A;  2IBI B;  2M1M A;  1OGW A;  2M8S A;  4E3C A;  1WFY A;  3SDL C;  3ZLZ A;  3WAL A;  1R4N I;  5CHV C;  3TMP B;  2ZZP B;  3R66 C;  5AEK B;  2K39 A;  5D94 A;  2RPQ A;  3ZRF A;  3ZVV A;  2KX0 A;  3O65 B;  5D2M B;  2ZPN A;  1J8C A;  2JRI B;  3DQV A;  5DPW A;  2G3Q B;  4ASW C;  5LLI A;  3H7P B;  3WIM A;  2IO1 B;  2A4Z A;  1C3T A;  4AOF A;  2MLB A;  2PE9 A;  3B1L X;  4JQW C;  3ZTC A;  5LXH A;  2KLC A;  2G45 B;  2LGX A;  3APF A;  4JIO U;  3UIO B;  3A1Q B;  1L2N A;  1WMH B;  4ZRJ A;  2MP2 B;  4KIK B;  4M0W B;  2PE6 B;  5JZE B;  2JT4 B;  4GMV A;  4BFR A;  4B95 A;  3C0R B;  3H9D A;  1C1Y B;  1Z2M A;  3VUY A;  3VTV A;  3KVF B;  3Q3J A;  4XX5 A;  2LJ5 A;  1EF5 A;  3RZF A;  1IPG A;  2KWV B;  4FJY A;  1H4R A;  4IM0 A;  2Z0D B;  3KUD B;  4IW0 A;  3PLV A;  3DCG A;  2CHZ A;  1RFA A;  2N9X A;  4MSM B;  3DPD A;  3VH3 B;  5J2R A;  4BKG A;  1EO6 A;  1WR6 E;  2MRP A;  3ML9 A;  3ZKJ C;  3WAP A;  2HTH A;  1WZ0 A;  3W1Y A;  2I1K A;  2IO3 B;  2KXJ A;  4GB9 A;  4CO7 A;  3P2B A;  3L13 A;  1WH3 A;  1V5O A;  4LDT D;  2Z0E B;  1WM2 A;  4TKN A;  2KFJ A;  4W9E A;  3UGB B;  4BKS A;  4KVG B;  1YIW A;  4OVV A;  2KTR A;  3A4S C;  4GN1 A;  3D32 A;  1UH6 A;  2DZJ A;  5DPR A;  1P0R A;  5GMV A;  1OEY J;  1AAR A;  1UEL A;  2D2Q A;  3VHT C;  3EC8 A;  3L08 A;  2MBE A;  3EFU A;  2KC1 A;  4IG7 B;  2RD0 A;  2AEH A;  1EF1 A;  2L3Z A;  2KMA A;  2KDE B;  4BVU C;  4CHK A;  2FCN A;  2O6V D;  1TTN A;  3VVW B;  2CHX A;  3NY5 A;  4YL8 A;  2KFK B;  4DHZ B;  3U7D A;  3WA0 A;  4WWP A;  1Z5S B;  2BWF A;  4W9C A;  4DHJ B;  3PT2 B;  2O2V B;  2KK8 A;  3A1Q A;  2KDF B;  2NBV B;  4FHK A;  4F1S A;  2C9W B;  2BYE A;  2KWU B;  2KAN A;  3MJW A;  3ZNH B;  3DVN U;  4MGY E;  4W9I A;  5KHO A;  3HM6 X;  3L17 A;  3NZU A;  2EMS A;  2K6Q A;  1UBI A;  3A9K A;  1P9D U;  4G0N B;  4EZJ A;  2GOW A;  1E90 A;  2N4F A;  3DBR I;  1SE9 A;  5D7G A;  3W1S C;  4AP4 C;  4DK5 A;  1V86 A;  4W9J A;  2HJ8 A;  1E7U A;  1PQS A;  1YX5 B;  4MGK E;  5DPT A;  3OJ3 A;  1SGH A;  2C7H A;  2NBW B;  3A9J B;  2LRW A;  4LJO B;  3CMM B;  4GU2 A;  3LDZ E;  1KM7 A;  1Q5W B;  3ZNI D;  1HE8 A;  2MBQ A;  3VQI A;  4NQK E;  3ZIM A;  3A33 B;  2I1J A;  4NAW B;  2JRH A;  4I6N B;  2VRR B;  4HWI B;  2NR2 A;  2YVC A;  2LGD A;  4MDK E;  2FAZ A;  1J19 A;  1OTR B;  1R4M I;  4DHZ E;  3SHQ A;  4NPN A;  1TBE A;  2L76 A;  2PPH A;  1WJN A;  2MWS B;  3LJ3 A;  1Q1O A;  4I6P A;  4K7U A;  2L05 A;  1WMH A;  4DDI D;  2UWQ A;  3IHP C;  1V2Y A;  2KDB A;  4K7W A;  2NBU A;  4HLE A;  2LI5 A;  3RT3 B;  4FA6 A;  4EOY A;  5E6P A;  1KJT A;  2RGF A;  3KYD D;  2ZVO A;  4A20 A;  1EUV B;  2N1W A;  2K8B A;  3NOB A;  2FID A;  4W9H A;  2FCS A;  4MM3 A;  3R7R A;  5J18 A;  2KC2 A;  4EZK A;  2DYM A;  3JSV B;  4PYZ A;  5EDS A;  3H6N A;  2RSU A;  4GDK A;  1VCB A;  1UGM A;  5IA7 A;  3MTN B;  1ZKH A;  2J0M A;  2MBB B;  1ZGU B;  1WXM A;  3U30 A;  4A3P A;  4BKT A;  4B6W A;  3DOW A;  1E8Z A;  2W9N A;  4W9L A;  4E71 A;  4A3O A;  4ZYN A;  1GG3 A;  2KO3 A;  1WY8 A;  3IFW B;  3U8Z A;  3T9L A;  2BYF A;  4RM9 A;  3ZW3 A;  1L7Y A;  3V62 A;  2WYQ A;  4MH0 E;  3HM3 A;  2DYO A;  4N9F 4;  1QZE A;  2Z59 B;  2JPH A;  4NQL B;  1XQQ A;  4IM2 A;  2OOB B;  3B08 A;  2CS4 A;  4HDO A;  1E8X A;  2IY1 B;  1TZ1 A;  4I6L B;  2HE7 A;  4ICV A;  5DPS A;  3CST A;  2JZ3 B;  4W9K A;  3V60 A;  3PLU A;  3BY4 B;  4W9G A;  3VAW A;  2KN5 A;  4NJ6 A;  3VTW A;  2BF8 B;  4GOC A;  3VUW A;  1U4A A;  1UD7 A;  3L16 A;  4GDK B;  1WX9 A;  3W1S A;  4WWN A;  4IM3 A;  4RM8 A;  2JF5 A;  1E7V A;  2LUE A;  1WXV A;  3SD5 A;  4BOS C;  1OEY A;  2DAJ A;  3A9K B;  4KSL C;  3ZDT A;  5AZH A;  1RRB A;  2GBJ A;  2YLM A;  3OJ4 B;  1FXT B;  4HPM B;  1WZ3 A;  2FCM A;  2JY6 A;  2WWZ A;  4M8M A;  3JW0 X;  3DVG X;  2M4N A;  3OAW A;  2EMT A;  4TV3 A;  5JH5 C;  5AZG A;  2LGY A;  1D3Z A;  3DBH I;  1E8Y A;  2IY0 B;  2LVQ A;  4AUQ C;  2O2V A;  3WAO A;  3WAM A;  2PEA A;  4EEW A;  1GNU A;  2DZK A;  3I3T B;  2REX A;  5JHA A;  3H1U A;  3UIN B;  3ALB A;  4PS8 A;  2K25 A;  4GXB A;  4ZRI A;  4ANX A;  2KWC A;  3QWZ B;  2CR5 A;  2BGF A;  2KQS A;  2KMC A;  4KV2 A;  2DAF A;  3QX1 A;  2EKE C;  3PRE A;  2FIF A;  2KJ6 A;  2IO0 B;  2L00 B;  2OJR A;  3IG3 A;  4JL9 A;  4WJN A;  2R2O A;  4G50 A;  4KDI C;  4OVU A;  2O6V A;  3DVG Y;  5DCN A;  1J0G A;  2MP2 A;  3CF6 E;  3ECI A;  2WX0 A;  4X57 B;  5L83 A;  1WJ6 A;  4XZ4 A;  4WJO A;  3QA8 A;  3GOE A;  1RAX A;  4EZL A;  1G6J A;  4ANW A;  2LXA A;  3X23 A;  5JHB A;  4GDL A;  1WIA A;  2G4D B;  2L0T A;  1LFD A;  3HK0 A;  4MGZ E;  4CYE A;  3PPA A;  2LXC A;  1GUA B;  3N32 A;  3TBL D;  4IWO A;  2GBR A;  3HIZ A;  3WAN A;  2MX2 A;  2IO2 B;  4XC2 A;  1T0Y A;  4JLC A;  4HCN B;  1NI2 A;  3VXW A;  3N30 A;  1UBQ A;  3H7P A;  2DZM A;  1WE6 A;  2D07 B;  1KLV A;  1WM3 A;  2KTF A;  3UF8 A;  3M62 B;  2K6D B;  3ONS A;  4FJV B;  1XT9 B;  4DWF A;  1IYF A;  2JVC A;  4K1R B;  2KLG A;  4IWQ A;  1KOT A;  2RR9 A;  3M3J A;  1P3Q U;  2V3S A;  2V1Y A;  3RZW C;  4DDG D;  1S3S G;  5D6J B;  2LVO A;  3V6C B;  3ZTD A;  1P98 A;  2IYD B;  2JUO A;  1V5T A;  2KFK A;  4HK2 A;  1H8C A;  1X1M A;  2LAS A;  3K9O B;  3JSV A;  3KUC B;  2KKC A;  2NPT B;  4WWO A;  3DBL I;  3VDZ A;  2MA9 B;  3UQB A;  4IC7 B;  4K7S A;  4NNJ B;  4GIV A;  3H7S A;  4EFO A;  3PV1 A;  2AL3 A;  4G3X B;  1OQY A;  1V6E A;  4GSW A;  3PHX B;  3ZO5 B;  4MSQ B;  5G55 A;  2DEN B;  2D10 A;  5AZF A;  2MSE D;  2M0X A;  1LXD A;  3ENE A;  4LCD E;  1ISN A;  1VD2 A;  3AXC A;  3M95 A;  4MGI E;  2KNB A;  3SU8 X;  3AI5 A;  2LD9 A;  3APC A;  1WE7 A;  2N1V A;  2PJH A;  2FUH B;  3RD2 A;  2J7Q B;  4AJY B;  3HHM A;  3DBS A;  3DDC B;  1YJ1 A;  3GZN I;  2LZ6 A;  4NY0 A;  4P7I A;  3UQA A;  4FBJ B;  3UIP B;  3IVF A;  2WDT B;  3VUX A;  4HVB A;  2B3A A;  2D11 A;  3EEC A;  1WJ4 A;  4NAW A;  5CTR C;  2MBH A;  4KSK C;  4FJZ A;  2IZV B;  4ZRK A;  2BWE S;  2KVR A;  4PS7 A;  2LRU A;  1A5R A;  4ZDV A;  4PS3 A;  1WF9 A; 
#chains in the Genus database with same CATH topology
 3NHE B;  3PSE B;  4F8C B;  2C7N B;  2LVP A;  2KN4 A;  2N7J A;  2WDR B;  2XK5 A;  1I4X A;  4W9D A;  1ZXI A;  1NEN B;  2CU1 A;  1GC7 A;  4OZA A;  1XD3 B;  3Q3F A;  2N0S B;  2BPS A;  5HKH A;  5C1Z A;  1FM0 D;  3ZJV A;  4RF1 A;  5IOI A;  2NPT A;  3TJP A;  2ZVN A;  2MW5 A;  3T8M A;  3NVZ A;  1FCL A;  4HDQ A;  3NVY A;  4P6V F;  2K9X A;  2PVG C;  5IAA C;  5LXI B;  1J7A A;  3PS6 A;  3PHW B;  2KTR B;  3JYU A;  2K8C A;  2K0P A;  3NS1 A;  3RCZ A;  3AU4 A;  2QEJ C;  1K8R B;  1CK1 A;  1SBB B;  3RUL A;  2WX1 A;  2ZJD A;  2FCQ A;  2W82 A;  2J53 A;  1HXY D;  2XBB C;  2LWP A;  3MJ5 A;  5TSS A;  2KQ4 X;  1WGG A;  4A9A A;  1WX7 A;  4MJS B;  2WXN A;  5FR3 A;  2AL6 A;  4ZHO A;  5CHF A;  1WR1 A;  2GMI C;  4YTP B;  1P7E A;  4KZ0 A;  1ZDX A;  5E6O A;  4HXD A;  5BMI A;  2ZW0 A;  1FD6 A;  2KT7 A;  2M17 A;  1N6Z A;  4YXD B;  2KD0 A;  1E0Z A;  5AUK A;  2AYO B;  2KJH B;  1YN5 A;  1ZP0 B;  3PTF C;  1E5W A;  2PTL A;  4BBN C;  3ZJU A;  2WXL A;  1QQR A;  1MG4 A;  2JXX A;  2O6V B;  4OW0 A;  3KW5 B;  3TIX A;  1WYG A;  2ZEQ A;  2ONQ A;  5HHD G;  2FBW B;  1ENF A;  2RDG A;  2ZCC A;  2DHZ A;  3NZS A;  2D3G A;  1KLU D;  4HRO A;  3N9Y C;  4II2 B;  3AE1 B;  2R2Q A;  3GE8 C;  4TMA B;  3L0W B;  2Y5B B;  3DBH B;  2XEW A;  1WFY A;  3SDL C;  2LHD A;  3WAL A;  5EE9 A;  3TMP B;  4ACF A;  3W9C B;  3AE6 B;  1ZPS A;  3ZVV A;  2HJ1 A;  2KX0 A;  2QIE B;  2ZPN A;  2D3A A;  2JRI B;  5DPW A;  3H7P B;  2IO1 B;  2A4Z A;  1TY0 A;  2MJE A;  4JQW C;  2LGX A;  4JIO U;  3UIO B;  3PZ8 A;  2IPK D;  1WMH B;  4ZRJ A;  4M0W B;  1WXQ A;  2JT4 B;  4B95 A;  4C4V A;  1I4Q A;  1T0S C;  3AMZ A;  1JWM D;  2KWV B;  5E6J A;  3KUD B;  2BW2 A;  3PLV A;  1TKY A;  4BKG A;  3OG5 A;  3ML9 A;  3WAP A;  3L4P A;  2BQQ A;  3P2B A;  4LDT D;  1XF5 L;  4BKS A;  2AQ1 B;  4ITK A;  3GS2 A;  4IKG A;  2DZJ A;  5GMV A;  1OEY J;  1UEL A;  3EC8 A;  4OVZ A;  2MBE A;  4ARI A;  2RD0 A;  4HJG E;  4C7Z A;  1EF1 A;  3FIL A;  1TTN A;  2LMC A;  4DHZ B;  4GLS C;  1Z5S B;  2BWF A;  3KLS X;  2C9W B;  1I4R A;  1YOV B;  3ZNH B;  4W9I A;  2M19 A;  3HM6 X;  2LUM A;  4LNF A;  1P9D U;  4G0N B;  2GOW A;  1NI3 A;  1CQV A;  1SE9 A;  1V86 A;  4W9J A;  4MGK E;  1SGH A;  4LJO B;  3A9J B;  3CMM B;  3LDZ E;  1ZDV A;  2VZK D;  3NUH B;  3VQI A;  1ROE A;  2NMQ A;  3A33 B;  3H8H A;  3BYT B;  2LGD A;  4RH6 A;  4MDK E;  4HRS A;  2SAK A;  2WXP A;  2BB6 A;  4WAF A;  3RNG C;  1TZO A;  1FNU A;  1FFU A;  1UNS A;  2L76 A;  1WJN A;  1WGK A;  2UWQ A;  4IDI A;  1TYG B;  1SIJ A;  4HLE A;  2LI5 A;  4FA6 A;  4JWS C;  4US8 A;  3KYD D;  1NEK B;  5HG2 A;  2N1W A;  2K8B A;  4MM3 A;  2TSS A;  1I4H A;  5EDS A;  2J0M A;  4XWW A;  4RGN A;  3U30 A;  4A3P A;  3B2G A;  4ZYN A;  1GG3 A;  3P42 A;  4CQN A;  1OQQ A;  3ZW3 A;  4MH0 E;  3HM3 A;  2CU3 A;  1QZE A;  3RMK C;  2DNF A;  3B08 A;  2CS4 A;  1C78 A;  1F0Z A;  3V60 A;  4A90 A;  4A8X C;  3BY4 B;  4W9G A;  3VAW A;  4NJ6 A;  2IND C;  3LYY A;  3L16 A;  1WX9 A;  3DBR B;  3Q3N C;  1YMH E;  2ZW1 A;  3ZDT A;  2Y5C A;  4HPM B;  2WWZ A;  2M4N A;  5JH5 C;  5AZG A;  3DBH I;  4AUQ C;  3FIL B;  3IXS A;  3MFG A;  3I3T B;  5JHA A;  2WXI A;  3H1U A;  3UIN B;  4PS8 A;  2K25 A;  4ZRI A;  4FXC A;  2CR5 A;  3PRE A;  4US9 A;  4G50 A;  4KDI C;  1FRD A;  4OVU A;  5DCN A;  2WX0 A;  3QA8 A;  3GOE A;  2BS3 B;  1PYW D;  3AE4 B;  1WIA A;  2D3C A;  1CJE A;  1UGJ A;  3LB8 C;  4JLC A;  3EFC A;  1OQR A;  5FK9 C;  4HCN B;  1LGR A;  2PIA A;  2DZM A;  1KLV A;  3FC4 A;  1E10 A;  2RPV A;  2KTF A;  3UF8 A;  2BT6 A;  4FJV B;  1XT9 B;  2JVC A;  2QSD A;  3HUI A;  2V1Y A;  4P1B C;  1AN8 A;  1P98 A;  1XLP A;  2QC8 A;  4HK2 A;  3URY A;  4RF0 A;  1MFW A;  3P63 A;  3KUC B;  2MA9 B;  4IC7 B;  3PV1 A;  4G3X B;  2XNA C;  3ENE A;  4LCD E;  3SU8 X;  2M56 B;  3TUO A;  2FUH B;  3DBS A;  1YJ1 A;  1HEZ E;  1JRP A;  4AQ7 A;  2BS2 B;  3MHZ A;  3IVF A;  3GB1 A;  2D11 A;  1SJE D;  3EEC A;  5CTR C;  1MJD A;  4FJZ A;  5T8I A;  2BWE S;  2GLS A;  1FNW A;  2LRU A;  1QKZ A;  1A5R A;  3Q14 C;  1WF9 A;  1WGY A;  1YD8 U;  3VH4 B;  2H88 B;  2WDQ B;  5IN7 A;  3TSS A;  1I4G A;  3AE8 B;  3A4R A;  2KJR A;  1N63 A;  2AX5 A;  1F9J A;  4LNO A;  4MEM A;  4AS1 A;  2K8H A;  1YQ4 B;  4GGQ A;  1DOX A;  2NS5 A;  3KH0 A;  2INC C;  3DHH C;  1EWC A;  2MJD A;  1KRH A;  3RFZ B;  3SEB A;  3X0W A;  4LTU A;  3EHV A;  3V05 A;  1D6E C;  1JWB D;  2XK5 B;  3QC8 B;  3AV8 A;  1NDD A;  4TQ0 A;  1SXT A;  1QLB B;  2L7R A;  3QK0 A;  1TS3 A;  1NBF C;  5J17 A;  3CWI A;  3ML8 A;  2HD5 B;  1TGZ B;  3AUL A;  3L10 B;  1L0Y B;  1E7P B;  1F2R C;  1V81 A;  1IP9 A;  3P1M A;  4AWJ A;  4DXA B;  3DBL B;  3TEY A;  2LGI A;  1V80 A;  5E6N A;  2L52 A;  2D5G A;  3QHT A;  1I35 A;  1GB1 A;  1LQB A;  3UI3 A;  4KKI A;  1FCC C;  2JWZ A;  3L54 A;  5I4D A;  3KWL A;  3VRA B;  2JSV X;  3QAQ A;  3N3K B;  2JYT A;  1E9M A;  2A5U A;  2LGS A;  3Q6B A;  2W3S A;  2B76 B;  1T0R C;  3ZYY X;  5FR6 A;  4NJC A;  1WGH A;  3A9J A;  2QHO A;  4TQ1 A;  5KHQ A;  1XLQ A;  2C60 A;  3PO0 A;  5D3I B;  3MC9 A;  3APD A;  1PGB A;  1GC6 A;  1SIF A;  3N20 C;  3NS8 A;  2ZPY A;  1STE A;  1D5Z C;  5CX3 A;  3ZRC A;  4PT5 A;  4KKJ A;  1Y8R C;  3B0A A;  3VFK A;  2AQ3 B;  1ZE3 D;  2C7M B;  4DXG A;  1LO5 D;  1OGW A;  2M8S A;  1JAL A;  5CHV C;  4ZHP A;  2ZZP B;  3R66 C;  5AEK B;  3OWE B;  2QCZ A;  2X38 A;  5D94 A;  2RPQ A;  3O65 B;  5D2M B;  1J8C A;  3DQV A;  3WIM A;  1C3T A;  2MLB A;  3ZTC A;  5LXH A;  3A1Q B;  2MP2 B;  4KIK B;  4GMV A;  1FO4 A;  4BFR A;  1Q10 A;  1C1Y B;  3VUY A;  3VTV A;  3Q3J A;  2DWQ A;  2V0G A;  1EF5 A;  4FJY A;  2Z0D B;  4IW0 A;  2CHZ A;  1EO6 A;  5EE1 A;  2NTS A;  1WR6 E;  2MRP A;  3ZKJ C;  3W1Y A;  4CO7 A;  1F1H A;  1YJI A;  2Z0E B;  2D3B A;  2KFJ A;  4GN1 A;  2SEB D;  3MC0 B;  1TIF A;  1FXA A;  3VHT C;  2UU7 A;  3EFU A;  5AUI A;  2AEH A;  1NYQ A;  2FCN A;  2O6V D;  4CHK A;  2CHX A;  3NY5 A;  1C4A A;  3WA0 A;  2RMM A;  4ZYS A;  1L6V A;  1YN3 A;  2O2V B;  4FHK A;  2JYE A;  2BYE A;  2KMM A;  2KWU B;  3DVN U;  1ZXH A;  3L17 A;  3NZU A;  2K6Q A;  4EZJ A;  2YEP F;  1E90 A;  2BS4 B;  2N4F A;  2ON8 A;  4WWM A;  4AP4 C;  5IP4 D;  1PQS A;  1RFK A;  5DPT A;  3OJ3 A;  3HVD A;  1HZ5 A;  1A70 A;  1KM7 A;  1C79 A;  2KVZ A;  4NQK E;  4M0W A;  4I6N B;  1T3Q A;  2IGG A;  2I38 A;  3DHI C;  2N9L A;  4DHZ E;  3O13 A;  2PPH A;  2MWS B;  4I6P A;  4DDI D;  2WXR A;  2GRI A;  3FKY A;  2KDB A;  4K7W A;  3RT3 B;  3AE3 B;  3GZN B;  4OHJ A;  5E6P A;  5H92 C;  1QT9 A;  2FID A;  5J18 A;  1JCK B;  2DYM A;  4PYZ A;  1KH0 A;  2RSU A;  5BYR A;  1VCB A;  1UGM A;  3I63 C;  3MTN B;  1ZKH A;  1WXM A;  3I57 A;  4BKT A;  3DOW A;  4W9L A;  4E71 A;  2LHE A;  4N58 A;  1WY8 A;  3IFW B;  3T9L A;  1F77 A;  4KGT A;  2OOB B;  1L5P A;  1VLB A;  2IY1 B;  1TZ1 A;  4I6L B;  2G9H D;  5DPS A;  3N1Y C;  3VTW A;  1UD7 A;  3W1S A;  3ABV B;  3HRD D;  4IM3 A;  4WWN A;  4NAM A;  1E7V A;  2DAJ A;  3AEB B;  2QJL A;  4UDU C;  2GBJ A;  2K22 A;  1WZ3 A;  3W2D A;  3Q8A A;  2WXG A;  2PEA A;  4EEW A;  3BVG A;  1GNU A;  1DGJ A;  4TSS A;  2QDF A;  3V3X A;  2IDY A;  4GXB A;  4ANX A;  3QWZ B;  2KQS A;  2DAF A;  2FIF A;  2OJR A;  4JL9 A;  2IGH A;  3DVG Y;  1T6B X;  2MP2 A;  3ECI A;  3T3O A;  1RAX A;  1G6J A;  4MH8 A;  4ANW A;  2LXA A;  1V1P A;  3AEC B;  3EA6 A;  1JW9 D;  1GUA B;  3N32 A;  3TBL D;  4IWO A;  2IO2 B;  4XC2 A;  1VR9 A;  5EE3 A;  3N30 A;  4C4V B;  2KAJ A;  3I5J C;  3BZD B;  3Q69 A;  1XCQ L;  3M62 B;  3ONS A;  1IYF A;  2KLG A;  3TEX A;  4A55 A;  4IWQ A;  4RFB A;  3U2S C;  3RZW C;  1S3S G;  2LVO A;  1EWY C;  2BVC A;  2JUO A;  1V5T A;  2L32 A;  3K9O B;  2KKC A;  2WP9 B;  1YNT E;  3DBL I;  2RDH A;  4K7S A;  4EFO A;  4NNJ B;  3ZO5 B;  1OQY A;  4GSW A;  1TY2 A;  2Q5W D;  2DEN B;  5G55 A;  1C9F A;  2INP E;  5AZF A;  4LLG M;  1XCT L;  1UF0 A;  1L0X B;  3M95 A;  3NZ3 A;  2BBC A;  3APC A;  1R7S A;  1HA5 A;  5LNK 1;  1SE3 A;  2LFI A;  3HHM A;  3AB5 A;  4YSX B;  3C19 A;  3DDC B;  2LZ6 A;  4FBJ B;  2LEK A;  2WXO A;  3IT4 B;  2B3A A;  1JWA D;  4B0E A;  2WS3 B;  3P4R B;  3GP7 A;  4PS7 A;  5FKA C;  3ZGZ A;  2G4S A;  2X8X X;  4ZOH C;  4BBN F;  1BT0 A;  1VZ6 A;  5L95 C;  3PRP B;  5BO4 B;  4NJ7 A;  3RYT A;  2GBM A;  1FPY A;  1MPE A;  1RLF A;  4USA A;  4JWU C;  4C00 A;  1UWM A;  1L6U A;  2V4L A;  4RMA A;  2MQJ A;  4WQO B;  2J0J A;  4BOZ B;  4LJP B;  1ZUD 2;  3IBE A;  1DYQ A;  2HDE A;  3JVZ X;  1WI0 A;  3LXF A;  4FAD A;  2CHW A;  1VDV A;  1SSN A;  3TL5 A;  2C5L C;  5C23 A;  1WGD A;  3RNF C;  3R3M A;  1PDX A;  3PZ7 A;  1V49 A;  4KZC A;  4ICU A;  1BUI C;  4XWT A;  3M63 B;  3VTU A;  1GOZ A;  3DVN V;  2ZNV B;  2KOX A;  1VZ7 A;  2N9E B;  3ZNZ B;  2HTM E;  5BMH A;  4B9K A;  2V4I B;  1WRD B;  2YEP B;  1JWS D;  4KIK A;  1CMX B;  3RNE C;  3NJT A;  2L83 A;  4HKZ E;  4M00 A;  3B9J A;  3Q8E A;  3ZUN A;  4REZ A;  3PZD A;  2NCN A;  2V3N A;  4RGM A;  1YQ3 B;  2BKR B;  3V6E B;  3PVL A;  4HPL B;  3BIN A;  1WGR A;  2AWT A;  2IJ0 A;  3AED B;  1MHX A;  4R3D A;  2QIL A;  3KUZ A;  1IBX B;  3MHS D;  1IGC A;  2WXK A;  4HJK A;  2MCN B;  3QQ8 B;  1MG8 A;  2ZNV C;  2FNJ B;  2KQ7 A;  4WJQ A;  1WJU A;  3ZJT A;  2ACZ B;  3Q3M C;  4N59 A;  3DWM A;  1WXS A;  3BWU D;  4WJP A;  2J0K A;  3ZDM C;  2G1E A;  2WXH A;  3J9C A;  3AU5 A;  2DYB A;  4MM3 B;  3ZQ4 A;  5C2T B;  1GJZ A;  1D5X C;  1YQB A;  2UYZ B;  1IGD A;  1M94 A;  5JXV A;  2WNM A;  1FEH A;  4W9F A;  4ANV A;  4XGA B;  3TEZ A;  5CHW A;  2ASQ A;  1ET9 A;  2MBO A;  4GDL B;  5BYS A;  3N1X C;  2ZCB A;  2N9P C;  1WX8 A;  2WU5 B;  3PGE A;  2KDI A;  2IBI B;  2M1M A;  2PLP A;  4XDC A;  3AE5 B;  3ZLZ A;  2K39 A;  1EM7 A;  4O1N A;  2L1A A;  4WIP A;  2EEL A;  2G3Q B;  4ASW C;  1HTQ A;  4AOF A;  1NVI D;  2G45 B;  1V97 A;  2JQR B;  1L2N A;  2ICI A;  5JZE B;  2OED A;  3AE2 B;  5GXG B;  3RPF C;  1QIL A;  3KVF B;  2WHI A;  3EGR A;  4XX5 A;  2Y3A A;  2WXQ A;  1H4R A;  2VZK B;  3DPD A;  4YWG G;  3MP9 A;  2HTH A;  2I1K A;  2IO3 B;  3DHG C;  4GB9 A;  1WH3 A;  1V5O A;  4W9E A;  3UGB B;  1WM2 A;  4KVG B;  1YIW A;  4OVV A;  2KTR A;  3A4S C;  1UH6 A;  3SR6 A;  4N6E B;  2D2Q A;  3L08 A;  4YSZ B;  4RGO S;  2KC1 A;  1B9R A;  4IG7 B;  3BVM A;  2W54 A;  2L3Z A;  2KDE B;  1CZP A;  3VVW B;  3NVV A;  1ET6 A;  3P4S B;  3U7D A;  4W9C A;  1QOF A;  3TEW A;  3PT2 B;  1DOI A;  2NBV B;  4F1S A;  2FE8 A;  3ETR A;  3MJW A;  4MGY E;  4WUR A;  2EMS A;  1UBI A;  1V8C A;  4LNN A;  5D7G A;  3W1S C;  4ZRQ A;  1E7U A;  2JXT A;  2C7H A;  1YJJ A;  3VR8 B;  4HEA 1;  2I1J A;  1D5M C;  2JRH A;  2NR2 A;  1TKE A;  4RCO A;  1RWS A;  1J19 A;  1K50 A;  3SHQ A;  4NPN A;  1TBE A;  1JQ4 A;  2E6X A;  1Q1O A;  4K7U A;  4LK0 M;  1V2Y A;  4NZL B;  1KJT A;  2RGF A;  2MEK A;  4HPP A;  2Y5P A;  2ZVO A;  2PW9 A;  4W9H A;  2FCS A;  1ZOY B;  3JSV B;  3H6N A;  4GDK A;  2W55 A;  3RNC C;  3SFD B;  1E8Z A;  4A3O A;  2KO3 A;  1TS2 A;  4DQO C;  2K5P A;  2WLB A;  1L4D B;  2N9K A;  3U8Z A;  1T5X D;  2M0A A;  2JX5 A;  2WYQ A;  1I4P A;  4WH4 A;  2Z59 B;  2JPH A;  1XQQ A;  1XO3 A;  3GE3 C;  1E8X A;  2HE7 A;  4YTM B;  4ICV A;  1KLG D;  3ZXV A;  3CST A;  5MPO A;  1L0V B;  1T0Q C;  3PLU A;  4S17 A;  2BF8 B;  4GOC A;  5G5G A;  4H2A A;  1N5W A;  3Q8F A;  2JF5 A;  2LUE A;  4DXF A;  1C76 A;  1L4Z B;  1C4P A;  4M01 A;  1YN4 A;  1OEY A;  3A9K B;  1RM6 C;  3OJ4 B;  4LNI A;  2FCM A;  2JY6 A;  3JW0 X;  3DVG X;  4ARC A;  2EMT A;  1J7C A;  1HTO A;  1D3Z A;  1PGA A;  1E8Y A;  2IY0 B;  3WAM A;  2REX A;  3ALB A;  3VR9 B;  3BVZ A;  2BGF A;  3QX1 A;  2EKE C;  4XYC A;  3E9S A;  2IO0 B;  3IG3 A;  2R2O A;  1J0G A;  3CF6 E;  5L83 A;  1WJ6 A;  4WJO A;  4BAX A;  4M02 A;  3NRZ A;  5JHB A;  4A6Q A;  2KWD A;  2L0T A;  3HK0 A;  4MGZ E;  3PPA A;  3HIZ A;  3WAN A;  2MX2 A;  1T0Y A;  4P1C C;  4K3B A;  4KGS A;  3VXW A;  1UBQ A;  2WXF A;  3H7P A;  1WE6 A;  1R4M B;  2D07 B;  2BYT A;  3BK2 A;  2E3T A;  2K6D B;  1FIQ A;  4K1R B;  1KOT A;  3M3J A;  2V3S A;  5D6J B;  3ZTD A;  2IYD B;  1X1M A;  1K53 A;  3JSV A;  2NPT B;  3VDZ A;  3UQB A;  4EE2 A;  1V6E A;  2MSE D;  2M0X A;  1LXD A;  3Q2A C;  5HI1 A;  1VD2 A;  2K3U A;  4MGI E;  1SE4 A;  2LD9 A;  1M4V A;  3AEA B;  2N1V A;  2PJH A;  3RD2 A;  1WSP A;  3AN1 A;  3KQ4 A;  4P7I A;  4JX1 C;  2EKI A;  2WDT B;  4HVB A;  1SB3 C;  1VRA B;  1WJ4 A;  2IZV B;  4ZRK A;  3NVW A;  4ZDV A;  4PS3 A;  4WAA A;  2GBK A;  3KYC D;  4IOI E;  4B0M A;  1V9J A;  3AM9 A;  1BML C;  4JGH B;  3T3N A;  5IO9 A;  4HCP B;  2BYV E;  3U52 E;  4FHJ A;  1TT5 B;  3R8B A;  4EUT A;  3C8Y A;  1PGX A;  3B2F A;  1R4N B;  4K81 A;  4XE0 A;  4MEL A;  3PRM B;  2JU6 X;  3OLM D;  1K52 A;  3K9P B;  2KX3 A;  3V61 A;  3QCA A;  2INN E;  4P16 A;  3RN9 C;  3MC8 A;  2CKH B;  3P4Q B;  3P4P B;  4G11 A;  3AH7 A;  2GI9 A;  4PK1 A;  1JML A;  4KDL B;  4II3 B;  4URK A;  3ZNG C;  2KYW A;  4FUL A;  1YX6 B;  1Y56 A;  2JZP A;  1S1Q B;  1SF0 A;  4MJS A;  4DBG A;  4LDT B;  1LM8 B;  4FLH A;  1E8W A;  3S2A A;  4IUM B;  4BKS D;  3AEG B;  4S0R A;  2K1F A;  3E56 A;  2DZI A;  3CSF A;  4PYU A;  4DHJ D;  1F52 A;  4TUU A;  5G2N A;  3U4E G;  4ANU A;  1XLO A;  2N7D A;  4FN2 A;  1K51 A;  2GBN A;  3TCA A;  3QIJ A;  5TR5 A;  3RI7 C;  1WYW B;  3RUI B;  4J6I A;  1JRO A;  3QJZ A;  4LNK A;  1QOB A;  2NTT A;  3HVZ A;  1WXA A;  4J3O D;  1I42 A;  3DWG C;  2L0F A;  3QAR A;  1BXT A;  4EKU A;  1Q0W B;  2BTE A;  2JZZ A;  2DX5 B;  2BKF A;  4WQM A;  2KHW B;  4IWP A;  2N7E A;  1ZW7 A;  1P1A A;  1AW7 A;  2H89 B;  1PFD A;  4F7Z A;  4AJW A;  3R7Q A;  2L8J A;  1HZ6 A;  1P7F A;  1WRI A;  1F2R I;  2NVU I;  3PRZ A;  5C3J B;  1SJH D;  4XDD A;  4YTN B;  1JRU A;  2I2Y A;  4M8N A;  4C56 C;  4E74 A;  2PMV A;  2DLB A;  1UZX B;  1AWD A;  2KZR A;  4E3C A;  3W5V B;  1R4N I;  3W5U B;  1EU3 A;  2J42 A;  1PUT A;  3ZRF A;  1ESF A;  1TKG A;  5LLI A;  3B1L X;  2PE9 A;  2KLC A;  3APF A;  4YT0 B;  1XXG A;  4HKQ A;  4RNA A;  1XEE A;  1I7H A;  2PE6 B;  3RNB C;  3C0R B;  3H9D A;  1Z2M A;  2VH2 A;  4JE3 B;  2CJO A;  2LJ5 A;  3RZF A;  3KWV A;  1IPG A;  4IM0 A;  3DCG A;  5BMG A;  1RFA A;  2N9X A;  4MSM B;  3VH3 B;  5J2R A;  1FRR A;  3BII D;  1WZ0 A;  3I9V 1;  1FXI A;  2KXJ A;  1N62 A;  3L13 A;  4TKN A;  1KTK A;  2BB5 A;  1OFF A;  3D32 A;  5H8Y E;  4C80 A;  5DPR A;  1P0R A;  2FUG 1;  1FFV A;  1AAR A;  2LJI A;  2RDB C;  4K3C A;  1DOY A;  2KMA A;  2MH7 A;  4BVU C;  4YL8 A;  2KFK B;  1GB4 A;  3SFE B;  2KDM A;  4WWP A;  2OHF A;  4C7Y A;  1J7B A;  4DHJ B;  2KK8 A;  3A1Q A;  2KDF B;  1QOG A;  2KAN A;  5IKC M;  5KHO A;  1C77 A;  3A9K A;  5HFY A;  3DBR I;  4L2Y A;  4DK5 A;  2HJ8 A;  4D2K A;  1YX5 B;  2NBW B;  2LRW A;  4RGT A;  4GU2 A;  1Q5W B;  1ACC A;  2R61 A;  3ZNI D;  2PVO D;  1HE8 A;  2MBQ A;  3ZIM A;  3BK1 A;  4NAW B;  2VRR B;  1N5X A;  1V1P B;  4HWI B;  2YVC A;  1TS4 A;  3NG0 A;  2FAZ A;  1OTR B;  3CIR B;  1R4M I;  4MT5 A;  2XN9 C;  3LJ3 A;  1TS5 A;  2PKO A;  2L05 A;  1WMH A;  3IHP C;  1V1O A;  2NBU A;  2VH1 A;  4EOY A;  4KGR A;  2V3P A;  4A20 A;  4BZA A;  1EUV B;  3R7R A;  2KC2 A;  4EZK A;  4KX6 B;  5IA7 A;  2J52 A;  2MBB B;  3R2T A;  1ZGU B;  1JWU D;  4B6W A;  2W9N A;  4L1B A;  2BYF A;  4RM9 A;  1L7Y A;  3V62 A;  2DYO A;  2J4X A;  4N9F 4;  3IAS 1;  4NQL B;  4IM2 A;  2V9H A;  3N1Z C;  4HDO A;  3AE9 B;  3Q8B A;  3R2I A;  3IT6 B;  2JZ3 B;  1MI0 A;  4W9K A;  2KN5 A;  4JPS A;  3RNA C;  2W3R A;  3AEF B;  3VUW A;  1U4A A;  1SE2 A;  4GDK B;  1N60 A;  4RM8 A;  1RYJ A;  1UWX A;  1WXV A;  3SD5 A;  2QMT A;  4BOS C;  4KSL C;  1FNV A;  5AZH A;  1RRB A;  2YLM A;  1N61 A;  1FXT B;  4M8M A;  4TV3 A;  1GAQ B;  3OAW A;  2WQY B;  2LGY A;  2LVQ A;  2O2V A;  3WAO A;  3IAM 1;  2DZK A;  1VJK A;  1D4B A;  4ZRP A;  1QOA A;  2OJW A;  2KWC A;  2WGS A;  1WWT A;  3VRB B;  3BYY B;  2KMC A;  4KV2 A;  4WJN A;  2KJ6 A;  2L00 B;  5EE0 A;  2WU2 B;  1C4C A;  3FAH A;  2O6V A;  3AE7 B;  3WCQ A;  1NYR A;  4L23 A;  4X57 B;  4YSY B;  4XZ4 A;  4EZL A;  2CJN A;  3X23 A;  1QF6 A;  1AYF A;  1GPX A;  4GDL A;  2G4D B;  1LFD A;  4CYE A;  1HQR D;  2LXC A;  2Z8L A;  2GBR A;  2WDV B;  1EU4 A;  2JWU A;  2DBY A;  1NI2 A;  3Q3O C;  1WM3 A;  2WXM A;  3AEE B;  1UUP A;  4DWF A;  1MVK A;  2KAC A;  1TJE A;  5BYQ A;  4QAY A;  2RR9 A;  1P3Q U;  3U7Z A;  3ZXR A;  4OZB A;  4DDG D;  3V6C B;  4OZC A;  2KFK A;  1H8C A;  2MJ3 A;  2LAS A;  1KFY B;  4WWO A;  2GB1 A;  4GIV A;  3H7S A;  1KF6 B;  2AL3 A;  5D3D A;  3PHX B;  1MHH E;  4MSQ B;  1B1Z A;  2D10 A;  2AQ2 B;  5G5H A;  1ISN A;  3AXC A;  2KNB A;  3AI5 A;  4Q2J A;  1WE7 A;  1E6E B;  2J7Q B;  2IGD A;  3EUB 2;  4AJY B;  1IUE A;  3Q8C A;  1XLN A;  3GZN I;  4NY0 A;  3UQA A;  2MHJ A;  3UIP B;  1FMA D;  4MAC A;  3VUX A;  4NAW A;  2MBH A;  4KSK C;  2KVR A;  1IBX A;  2WXJ A;  1SEB D;  1VZ8 A;  3NOB A; 
#chains in the Genus database with same CATH homology
 3NHE B;  1WGY A;  2G4S A;  3PSE B;  1YD8 U;  4WAA A;  4BBN F;  2GBK A;  2C7N B;  3KYC D;  4F8C B;  2LVP A;  3VH4 B;  1V9J A;  1BT0 A;  5L95 C;  2XK5 A;  3PRP B;  4W9D A;  4JGH B;  2CU1 A;  5BO4 B;  4NJ7 A;  3RYT A;  1GC7 A;  2GBM A;  1XD3 B;  1RLF A;  4HCP B;  3A4R A;  2BYV E;  3Q3F A;  4FHJ A;  2KJR A;  2BPS A;  2V4L A;  4RMA A;  5HKH A;  1F9J A;  2MQJ A;  4WQO B;  2J0J A;  4BOZ B;  4MEM A;  4EUT A;  5C1Z A;  2K8H A;  2NPT A;  3TJP A;  4LJP B;  2ZVN A;  2MW5 A;  4K81 A;  4GGQ A;  3IBE A;  3T8M A;  2NS5 A;  3JVZ X;  1WI0 A;  3KH0 A;  4MEL A;  3PRM B;  3OLM D;  4FAD A;  2CHW A;  3TL5 A;  2C5L C;  3K9P B;  2KX3 A;  5C23 A;  4HDQ A;  3V61 A;  3QCA A;  1WGD A;  3X0W A;  3R3M A;  5IAA C;  2CKH B;  4G11 A;  5LXI B;  3EHV A;  1V49 A;  3PS6 A;  4KZC A;  4ICU A;  3PHW B;  2KTR B;  3JYU A;  3M63 B;  3VTU A;  2K8C A;  2XK5 B;  3QC8 B;  1NDD A;  3DVN V;  4TQ0 A;  2ZNV B;  4KDL B;  4II3 B;  3RCZ A;  2L7R A;  3QK0 A;  4URK A;  1NBF C;  2KOX A;  3AU4 A;  3ZNG C;  4FUL A;  5J17 A;  1YX6 B;  2N9E B;  3ML8 A;  2HD5 B;  1K8R B;  1TGZ B;  3ZNZ B;  1S1Q B;  3AUL A;  4MJS A;  2WX1 A;  3L10 B;  3RUL A;  2ZJD A;  4B9K A;  2FCQ A;  4DBG A;  2XBB C;  4LDT B;  1LM8 B;  1WRD B;  2LWP A;  4FLH A;  1V81 A;  1WGG A;  4KIK A;  1IP9 A;  1E8W A;  1CMX B;  3S2A A;  1WX7 A;  4AWJ A;  4IUM B;  4BKS D;  4DXA B;  4MJS B;  2K1F A;  2AL6 A;  2DZI A;  3ZUN A;  3CSF A;  3PZD A;  4PYU A;  2NCN A;  4DHJ D;  1V80 A;  4TUU A;  2BKR B;  5CHF A;  5E6N A;  3V6E B;  1WR1 A;  3PVL A;  5G2N A;  4HPL B;  3BIN A;  2GMI C;  1WGR A;  3QHT A;  4ANU A;  2N7D A;  1I35 A;  4FN2 A;  1LQB A;  2AWT A;  4KZ0 A;  2GBN A;  3TCA A;  3QIJ A;  5TR5 A;  5E6O A;  4HXD A;  3KUZ A;  3MHS D;  2JWZ A;  3L54 A;  1WYW B;  3RUI B;  4J6I A;  2M17 A;  3QAQ A;  2KD0 A;  3QJZ A;  3N3K B;  2AYO B;  4HJK A;  2MCN B;  3QQ8 B;  1MG8 A;  1WXA A;  2A5U A;  2KJH B;  2FNJ B;  2ZNV C;  2KQ7 A;  1I42 A;  4WJQ A;  1WJU A;  5FR6 A;  2L0F A;  3QAR A;  3PTF C;  1E5W A;  1WGH A;  3A9J A;  1WXS A;  4EKU A;  2QHO A;  4TQ1 A;  2J0K A;  4WJP A;  1Q0W B;  3ZDM C;  4BBN C;  5KHQ A;  2JZZ A;  2DX5 B;  2BKF A;  3AU5 A;  2DYB A;  2C60 A;  2KHW B;  4IWP A;  2N7E A;  1ZW7 A;  1P1A A;  2JXX A;  2O6V B;  3KW5 B;  1GJZ A;  3APD A;  1YQB A;  3TIX A;  2UYZ B;  2ZEQ A;  1M94 A;  4F7Z A;  4AJW A;  1GC6 A;  1SIF A;  2L8J A;  3R7Q A;  3NS8 A;  2ZPY A;  4W9F A;  4ANV A;  5CX3 A;  2NVU I;  2ZCC A;  2DHZ A;  3NZS A;  2D3G A;  3PRZ A;  5CHW A;  3ZRC A;  1JRU A;  2ASQ A;  1Y8R C;  2MBO A;  4M8N A;  3B0A A;  4GDL B;  4II2 B;  2R2Q A;  3VFK A;  2ZCB A;  3L0W B;  4E74 A;  2C7M B;  2N9P C;  1WX8 A;  3PGE A;  2Y5B B;  1UZX B;  2XEW A;  2KZR A;  2KDI A;  2IBI B;  2M1M A;  1OGW A;  2M8S A;  4E3C A;  1WFY A;  3SDL C;  3ZLZ A;  3WAL A;  1R4N I;  5CHV C;  3TMP B;  2ZZP B;  3R66 C;  5AEK B;  2K39 A;  5D94 A;  2RPQ A;  3ZRF A;  3ZVV A;  2KX0 A;  3O65 B;  5D2M B;  2ZPN A;  1J8C A;  2JRI B;  3DQV A;  5DPW A;  2G3Q B;  4ASW C;  5LLI A;  3H7P B;  3WIM A;  2IO1 B;  2A4Z A;  1C3T A;  4AOF A;  2MLB A;  2PE9 A;  3B1L X;  4JQW C;  3ZTC A;  5LXH A;  2KLC A;  2G45 B;  2LGX A;  3APF A;  4JIO U;  3UIO B;  3A1Q B;  1L2N A;  1WMH B;  4ZRJ A;  2MP2 B;  4KIK B;  4M0W B;  2PE6 B;  5JZE B;  2JT4 B;  4GMV A;  4BFR A;  4B95 A;  3C0R B;  3H9D A;  1C1Y B;  1Z2M A;  3VUY A;  3VTV A;  3KVF B;  3Q3J A;  4XX5 A;  2LJ5 A;  1EF5 A;  3RZF A;  1IPG A;  2KWV B;  4FJY A;  1H4R A;  4IM0 A;  2Z0D B;  3KUD B;  4IW0 A;  3PLV A;  3DCG A;  2CHZ A;  1RFA A;  2N9X A;  4MSM B;  3DPD A;  3VH3 B;  5J2R A;  4BKG A;  1EO6 A;  1WR6 E;  2MRP A;  3ML9 A;  3ZKJ C;  3WAP A;  2HTH A;  1WZ0 A;  3W1Y A;  2I1K A;  2IO3 B;  2KXJ A;  4GB9 A;  4CO7 A;  3P2B A;  3L13 A;  1WH3 A;  1V5O A;  4LDT D;  2Z0E B;  1WM2 A;  4TKN A;  2KFJ A;  4W9E A;  3UGB B;  4BKS A;  4KVG B;  1YIW A;  4OVV A;  2KTR A;  3A4S C;  4GN1 A;  3D32 A;  1UH6 A;  2DZJ A;  5DPR A;  1P0R A;  5GMV A;  1OEY J;  1AAR A;  1UEL A;  2D2Q A;  3VHT C;  3EC8 A;  3L08 A;  2MBE A;  3EFU A;  2KC1 A;  4IG7 B;  2RD0 A;  2AEH A;  1EF1 A;  2L3Z A;  2KMA A;  2KDE B;  4BVU C;  4CHK A;  2FCN A;  2O6V D;  1TTN A;  3VVW B;  2CHX A;  3NY5 A;  4YL8 A;  2KFK B;  4DHZ B;  3U7D A;  3WA0 A;  4WWP A;  1Z5S B;  2BWF A;  4W9C A;  4DHJ B;  3PT2 B;  2O2V B;  2KK8 A;  3A1Q A;  2KDF B;  2NBV B;  4FHK A;  4F1S A;  2C9W B;  2BYE A;  2KWU B;  2KAN A;  3MJW A;  3ZNH B;  3DVN U;  4MGY E;  4W9I A;  5KHO A;  3HM6 X;  3L17 A;  3NZU A;  2EMS A;  2K6Q A;  1UBI A;  3A9K A;  1P9D U;  4G0N B;  4EZJ A;  2GOW A;  1E90 A;  2N4F A;  3DBR I;  1SE9 A;  5D7G A;  3W1S C;  4AP4 C;  4DK5 A;  1V86 A;  4W9J A;  2HJ8 A;  1E7U A;  1PQS A;  1YX5 B;  4MGK E;  5DPT A;  3OJ3 A;  1SGH A;  2C7H A;  2NBW B;  3A9J B;  2LRW A;  4LJO B;  3CMM B;  4GU2 A;  3LDZ E;  1KM7 A;  1Q5W B;  3ZNI D;  1HE8 A;  2MBQ A;  3VQI A;  4NQK E;  3ZIM A;  3A33 B;  2I1J A;  4NAW B;  2JRH A;  4I6N B;  2VRR B;  4HWI B;  2NR2 A;  2YVC A;  2LGD A;  4MDK E;  2FAZ A;  1J19 A;  1OTR B;  1R4M I;  4DHZ E;  3SHQ A;  4NPN A;  1TBE A;  2L76 A;  2PPH A;  1WJN A;  2MWS B;  3LJ3 A;  1Q1O A;  4I6P A;  4K7U A;  2L05 A;  1WMH A;  4DDI D;  2UWQ A;  3IHP C;  1V2Y A;  2KDB A;  4K7W A;  2NBU A;  4HLE A;  2LI5 A;  3RT3 B;  4FA6 A;  4EOY A;  5E6P A;  1KJT A;  2RGF A;  3KYD D;  2ZVO A;  4A20 A;  1EUV B;  2N1W A;  2K8B A;  3NOB A;  2FID A;  4W9H A;  2FCS A;  4MM3 A;  3R7R A;  5J18 A;  2KC2 A;  4EZK A;  2DYM A;  3JSV B;  4PYZ A;  5EDS A;  3H6N A;  2RSU A;  4GDK A;  1VCB A;  1UGM A;  5IA7 A;  3MTN B;  1ZKH A;  2J0M A;  2MBB B;  1ZGU B;  1WXM A;  3U30 A;  4A3P A;  4BKT A;  4B6W A;  3DOW A;  1E8Z A;  2W9N A;  4W9L A;  4E71 A;  4A3O A;  4ZYN A;  1GG3 A;  2KO3 A;  1WY8 A;  3IFW B;  3U8Z A;  3T9L A;  2BYF A;  4RM9 A;  3ZW3 A;  1L7Y A;  3V62 A;  2WYQ A;  4MH0 E;  3HM3 A;  2DYO A;  4N9F 4;  1QZE A;  2Z59 B;  2JPH A;  4NQL B;  1XQQ A;  4IM2 A;  2OOB B;  3B08 A;  2CS4 A;  4HDO A;  1E8X A;  2IY1 B;  1TZ1 A;  4I6L B;  2HE7 A;  4ICV A;  5DPS A;  3CST A;  2JZ3 B;  4W9K A;  3V60 A;  3PLU A;  3BY4 B;  4W9G A;  3VAW A;  2KN5 A;  4NJ6 A;  3VTW A;  2BF8 B;  4GOC A;  3VUW A;  1U4A A;  1UD7 A;  3L16 A;  4GDK B;  1WX9 A;  3W1S A;  4WWN A;  4IM3 A;  4RM8 A;  2JF5 A;  1E7V A;  2LUE A;  1WXV A;  3SD5 A;  4BOS C;  1OEY A;  2DAJ A;  3A9K B;  4KSL C;  3ZDT A;  5AZH A;  1RRB A;  2GBJ A;  2YLM A;  3OJ4 B;  1FXT B;  4HPM B;  1WZ3 A;  2FCM A;  2JY6 A;  2WWZ A;  4M8M A;  3JW0 X;  3DVG X;  2M4N A;  3OAW A;  2EMT A;  4TV3 A;  5JH5 C;  5AZG A;  2LGY A;  1D3Z A;  3DBH I;  1E8Y A;  2IY0 B;  2LVQ A;  4AUQ C;  2O2V A;  3WAO A;  3WAM A;  2PEA A;  4EEW A;  1GNU A;  2DZK A;  3I3T B;  2REX A;  5JHA A;  3H1U A;  3UIN B;  3ALB A;  4PS8 A;  2K25 A;  4GXB A;  4ZRI A;  4ANX A;  2KWC A;  3QWZ B;  2CR5 A;  2BGF A;  2KQS A;  2KMC A;  4KV2 A;  2DAF A;  3QX1 A;  2EKE C;  3PRE A;  2FIF A;  2KJ6 A;  2IO0 B;  2L00 B;  2OJR A;  3IG3 A;  4JL9 A;  4WJN A;  2R2O A;  4G50 A;  4KDI C;  4OVU A;  2O6V A;  3DVG Y;  5DCN A;  1J0G A;  2MP2 A;  3CF6 E;  3ECI A;  2WX0 A;  4X57 B;  5L83 A;  1WJ6 A;  4XZ4 A;  4WJO A;  3QA8 A;  3GOE A;  1RAX A;  4EZL A;  1G6J A;  4ANW A;  2LXA A;  3X23 A;  5JHB A;  4GDL A;  1WIA A;  2G4D B;  2L0T A;  1LFD A;  3HK0 A;  4MGZ E;  4CYE A;  3PPA A;  2LXC A;  1GUA B;  3N32 A;  3TBL D;  4IWO A;  2GBR A;  3HIZ A;  3WAN A;  2MX2 A;  2IO2 B;  4XC2 A;  1T0Y A;  4JLC A;  4HCN B;  1NI2 A;  3VXW A;  3N30 A;  1UBQ A;  3H7P A;  2DZM A;  1WE6 A;  2D07 B;  1KLV A;  1WM3 A;  2KTF A;  3UF8 A;  3M62 B;  2K6D B;  3ONS A;  4FJV B;  1XT9 B;  4DWF A;  1IYF A;  2JVC A;  4K1R B;  2KLG A;  4IWQ A;  1KOT A;  2RR9 A;  3M3J A;  1P3Q U;  2V3S A;  2V1Y A;  3RZW C;  4DDG D;  1S3S G;  5D6J B;  2LVO A;  3V6C B;  3ZTD A;  1P98 A;  2IYD B;  2JUO A;  1V5T A;  2KFK A;  4HK2 A;  1H8C A;  1X1M A;  2LAS A;  3K9O B;  3JSV A;  3KUC B;  2KKC A;  2NPT B;  4WWO A;  3DBL I;  3VDZ A;  2MA9 B;  3UQB A;  4IC7 B;  4K7S A;  4NNJ B;  4GIV A;  3H7S A;  4EFO A;  3PV1 A;  2AL3 A;  4G3X B;  1OQY A;  1V6E A;  4GSW A;  3PHX B;  3ZO5 B;  4MSQ B;  5G55 A;  2DEN B;  2D10 A;  5AZF A;  2MSE D;  2M0X A;  1LXD A;  3ENE A;  4LCD E;  1ISN A;  1VD2 A;  3AXC A;  3M95 A;  4MGI E;  2KNB A;  3SU8 X;  3AI5 A;  2LD9 A;  3APC A;  1WE7 A;  2N1V A;  2PJH A;  2FUH B;  3RD2 A;  2J7Q B;  4AJY B;  3HHM A;  3DBS A;  3DDC B;  1YJ1 A;  3GZN I;  2LZ6 A;  4NY0 A;  4P7I A;  3UQA A;  4FBJ B;  3UIP B;  3IVF A;  2WDT B;  3VUX A;  4HVB A;  2B3A A;  2D11 A;  3EEC A;  1WJ4 A;  4NAW A;  5CTR C;  2MBH A;  4KSK C;  4FJZ A;  2IZV B;  4ZRK A;  2BWE S;  2KVR A;  4PS7 A;  2LRU A;  1A5R A;  4ZDV A;  4PS3 A;  1WF9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...