2KXPC

Solution nmr structure of v-1 bound to capping protein (cp)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
118
structure length
118
Chain Sequence
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution NMR structure of V-1 bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 15
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2kxpC00
2F8XK 3C5RA 1G3NB 1K3ZD 4GMRA 4BETA 2ETCA 3TWXA 2RFMA 2XZDG 3B95A 2F8YA 1MX4A 4Z68A 3DEPA 2QC9A 4CZ2D 4BEPA 5ENRD 3UI2A 1NFIE 4TUMA 4K5AB 3EHRA 3JUEA 2DVWA 2XEHA 4U96D 1OT8A 4J8YA 4U95D 4DX7D 5ENOD 5AAOA 5ENSD 1YMPA 4ZHBA 4LSZE 1MYOA 4OAUC 1DCQA 2JABA 3W9FA 3V79K 2DZNA 3HRAA 3KEAA 2DZOA 3TWVA 4LNUD 2NYJA 5ENPD 3TWSA 4HRNA 1MJ0A 3JXJA 1TR4A 5AQ9A 3ZUVB 3T8KA 1QYMA 4C48B 2ETAA 3NOCD 5AARA 1IXVA 3TWTA 4F1PA 2KBXA 4DRXE 5FINA 4HLLA 4DUIA 3UTMA 1AWCB 4A63B 3V30A 3TWWA 5D66A 3JXIA 5CERB 2HE0A 5JMND 4ZFHA 4N5QA 1OY3D 1K1BA 4B93B 1MX6A 5EILA 5AQBA 2RFAA 3J5PA 2ZGDA 4BSZB 1DC2A 4HQDA 1IKND 3TWRA 4HRMB 5KBAA 3ZNGA 4O60A 3NBNB 4YDYA 1BI8B 3EU9A 2Y0BG 1N0RA 2DWZA 4HNAD 2V5QC 2P2CP 3J5QB 1IHBA 4HB5A 3T9KA 2V4HC 4YDWA 4K5BA 5HS0A 5CEDB 3AAAC 2XENA 3TWUA 1MX2A 3Q9UC 1SW6A 2PNNA 4G8KA 4BESA 4CYMD 1BLXB 5HKPA 4DX2A 3ZU7B 5EN5D 3V2OA 3LJNA 3V2XA 5ITZF 1D9SA 4UUCA 3ZKJA 1N0QA 1N11A 2MYOA 3D9HA 4G8LA 3B7BA 5BXOA 2A5EA 2L6BA 4LG6A 1BU9A 5CECB 4O1PA 4F6RD 2AJAA 2BKKB 5KNHD 4HI8A 3UXGA 3Q9NC 5CBOA 5EIBE 1S70B 4NIKA 2VGEA 3IXEA 5KNGA 1YCSB 3SO8A 4U8VD 4JB8P 4ATZD 1YYHA 4U8YD 4QFVA 4DX5D 2XZTG 4HBDA 5EYLA 5HRYA 2Y1LE 5FIOA 4OAVB 2J8SD 2ZGGA 3NOGD 4HRLA 5EIDA 3EHQA 4HI9A 1BD8A 3AJIA 5AQAA 2QYJA 2B0OE 5ENQD 1UOHA 1A5EA 3HG0D 4O1OA 5CEAA 3W9GA 2F37A 1AP7A 1SVXA 4QQIA 4RLYA 3DEOA 1WDYA 5JA4D 4DX6D 2FO1E 3F6QA 5ENTD 4BERA 5AN8A 5CBNA 5KWDA 2ETBA 1K1AA 4J7WA 1WG0A 2KXPC 5BXUA 4DX1A 3TWQA 1BI7B 5AQ7A 3V31A 2XEEA 2BKGA 4GPMA 4K5CA 5EYPF
chains in the Genus database with same CATH superfamily
5CHEE 2F8XK 3SY2A 4CRWA 1E8WA 4GZ5A 2DBAA 3I5PA 4DPRA 5CCLA 2YINA 3ZHEA 2DYSE 4LERA 2IQCA 4DX7D 1TN6A 5G05C 4B94A 3MA5A 3ISMC 4X8QA 4C0EA 4H7XA 3ULQA 1WAO1 1HG2A 5B3SE 2JEKA 4L2LA 4KT6B 3CSFA 4I9EA 4UI9J 1HE8A 3CHRA 4Q69A 3IV0A 5J90A 1XNFA 3CKBA 3Q7FA 1MZCA 1UJJA 3RIBA 3ZNGA 2LXMA 3O4ZA 1H0AA 4KVMA 4K5BA 4Q94A 5CEDB 3PNTB 4BT8A 2X6JA 3L6AA 3NZUA 4FADA 3MCXA 4G25A 3OAWA 1UJKA 4UUCA 3ZKJA 2GRLA 3ML8A 4G8LA 4WWNA 4HFGA 3TAXA 1FT1A 1BU9A 4L7TA 1VDYA 1IQUA 4FHKA 2IEJA 2V8SE 4AP2A 3LDZA 4DI3A 3ZRHA 3MYVA 3UMVA 2NSZA 3S7DA 4XE0A 5FIOA 3EHQA 1HO8A 2QFCA 2IF4A 5CEAA 1SA4A 3CIAA 3ESLA 3L54A 3P1UA 4EHMA 3FUEA 3I4GA 2LUHA 5A7DB 3SNXA 4UWGA 4UWHA 4A1GA 5KWDA 3FUMA 4ANUA 1K1AA 4FHJA 3CEQA 4JC8A 3IHVA 3UIPC 5LOZA 3FY4A 3C98A 1WM5A 3IEGA 3CHMA 4BETA 4XX5A 4APFA 3U4TA 4BEPA 3SBSA 3Q73A 4TUMA 2J4BA 2R05A 4U96D 2EIME 1K8KG 3DSSA 4E85A 4OAUC 2FBNA 2EIJE 2M63A 3EIQC 1H2VC 3QOUA 2LSUA 3TL5A 1LTXA 1TNBA 4KZ0A 2KBXA 4UQYA 4DRXE 3SFYA 1O1RA 4UWKA 3ASNE 2GW1A 3JXIA 1ZBPA 3PE4A 5CERB 2LNIA 3L17A 3ONLA 4I9CA 1H6PA 3D9NA 1N9AA 3SFZA 1KPSB 3AAAC 3QNKA 2PNNA 5BNWA 4CDRA 1BLXB 5A6CA 2OEWA 5EN5D 3EIJA 5C1DA 2IU1A 3E32A 4N2QA 1IYGA 4FJZA 3D9OA 4PS8A 4C9BB 3CHQA 4BT9A 3FTXA 1YYHA 5G2NA 3P2BA 3S7BA 3DSXA 4O1OA 4MRUA 4DX6D 1OCRE 5B1AE 3S7FA 4TUUA 2VSNA 3I4RB 4YDEA 3ZYKA 4MBGA 3BEEA 4CDMA 1H2UA 2WXKA 3TWXA 2XZDG 2FULA 4KVOA 3WXXA 3E34A 4EBAA 3SQVA 3S7JA 4GTOA 5T3RA 1EYHA 4U95D 5ENOD 5ENSD 3CK8A 3PREA 2L0TB 1HS6A 4UI9K 4ABNA 1MQSA 1Z6TA 1HXIA 5FJYA 3CVWA 2Y3AA 2OEVA 2X38A 1N4QA 4OYSA 3NBNB 1HG5A 3GZ2A 2WVIA 3KSLA 3CLJA 2VSOE 1H6KA 2PL2A 2P9LG 2R59A 1N11A 3CHOA 1JCSA 2HO1A 4UQXA 1TJCA 3HXEA 4KBQA 3BQOA 2WPVA 3AS5A 2VJ8A 3CGHA 4QFVA 5KJMA 2XCBA 1XGWA 2UY1A 4ILIA 4FP7A 1HU3A 2VGXB 4CT0A 3ASDA 2WXQA 3SZ7A 4DK5A 5EYPF 2AVPA 3HIZA 1HF8A 4APOA 5EKQD 4HOUA 1N4SA 4JD2G 3CVUA 2H6FA 1EPUA 4J0UA 4BTAA 2KCVA 4JZYA 1WY6A 2FO7A 2ETAA 2J9QA 4ILGA 1IXVA 3RKVA 3PDNA 3SD5A 3NAWA 3ULYA 1KZOA 3PUJA 4L9PA 4ME2A 1JCQA 2WXOA 2IO3C 1X81A 5M72A 2LAIA 1OCZE 2P2CP 2I1JA 3TWUA 4G8KA 4WNDA 3C72A 3ZU7B 2E0IA 5ITZF 1RZ4A 2EILE 2AXUA 3QKYA 1UG3A 1N0QA 3MKQB 4G26A 4IRUA 5CBOA 2LSVA 3E33A 3CQGB 2H6HA 4N2SA 4U8HA 2X6HA 5AJDA 2I2OA 1OWLA 4KMOA 3AJIA 1NL4A 3KEZA 3QWPA 4JL0A 5T4YA 1A5EA 1OUVA 1KLXA 2WXLA 2J49A 1AP7A 3DEOA 5T8IA 3QDNA 3UX4A 2IFUA 4J7WA 3LY9A 4WAFA 4XKCA 3SI5A 1BI7B 2XPZA 4C0MA 1JPLA 3HXCA 4WWOA 2ETCA 3FFLA 4TRQA 3L22A 3LKUA 3DBSA 3DEPA 5CCMA 1HH8A 3FU5A 4HVBA 2I1KA 1DNPA 3CR3A 3WG7E 1N94A 2I9CA 4O6FA 5DBKA 1OWOA 1KZPA 3T8KA 4C48B 4LUNU 4FLHA 1U2VG 2GGFA 3RU0A 2CG2A 3ZYQA 4ANXA 5CMWA 3UKUG 4A63B 2C0LA 4JHKA 4W9RA 1QBQA 2IOSA 1IKND 2WXIA 3RAUA 3FDHA 3MV3B 4GYOA 2VTBA 4YDWA 4GPKA 3B13A 2QYUA 3VLEA 4I6GA 4EZJA 1P5QA 2WXPA 5CMYA 4JHRA 2AJAA 2XGOA 3FH5A 3QK0A 3ZYLA 2VGEA 3Q4AB 3CKCA 4DI4A 3URZA 4DJAA 1B89A 3SHFA 1A17A 4JB8P 2VTBB 3ZGQA 3B7UX 5CRVA 1S64A 5LCWJ 1INZA 2QYJA 2WQ7A 5JA4D 4TV3A 4UI9C 2EINE 2QY7A 2ZISA 4Q96A 2AW6A 4DX2A 4K5CA 2VSXE 4F53A 3PS6A 2ZIRA 3FUIA 3HYMB 1Q2ZA 3PVLA 4G1TA 2I6HA 4GMLA 3CSTA 3W9FA 2DZNA 1TYQG 3KEAA 3TWSA 2VGXA 4HRNA 3HVEA 2GRRB 3PRZA 3NOCD 3JCKC 4IYPA 4HLLA 1SZ9A 2AWIA 4U04A 4GB9A 4OVUA 3OXFA 5D66A 4XI9A 4F7AA 4N5QA 3FUJA 3LY7A 4B93B 5EILA 4YVQC 3FTZA 3QAQA 1EF1C 3FUNA 3T9KA 5HS0A 4GZDA 4MLPA 3OTNA 3DXKG 3HVEB 5LP0A 5FT9A 1D8DA 1FVFA 5BXOA 5JHBA 3TG4A 5EIBE 3KAEA 4WNEA 3NOGD 3RRMB 1JWFA 2VQ2A 1UOHA 3FHEA 3HG0D 3UUXA 3Q79A 4ATGA 4QQIA 1WDYA 3SF4A 1W3BA 4WNGA 2GRQB 2HYZA 1G3NB 3G2VA 3B7TA 1KT0A 4HOSA 1NFIE 3T8MA 5H7PA 3L08A 4FULA 3X2QE 4U0UA 1SA5A 5AQ9A 3MJWA 3VTXA 2VSYA 1H6OA 3PZ3A 5EX0A 2HE0A 1GW6A 2WXFA 4JEUA 2RFAA 1DC2A 3T5VA 4A55A 2WQHA 3UM1A 5KBAA 3ASOE 3C3QA 2DWZA 4DLQA 4HB5A 3PH0C 4BY6A 2HM8A 4B8CB 3D9JA 3JQ0A 4DLOA 5ANRA 3JYSA 4GZ6A 1O5MA 4GA2A 4L2YA 3D9KA 4ACKA 4Y6WA 4HI8A 5ENNA 2P9SG 4NRHB 2HR2A 5BT1A 2OVFA 3LXUX 3GW4A 1S0PA 4HOQA 2GROB 2R02A 2WXHA 3CVYA 3GYZA 4YVOA 3FH7A 4FC8A 1E7UA 1TJFA 1U3CA 4GTMA 4AV7A 1D8EA 4PS3A 3JUEA 4ACLA 4J8YA 3HXFA 5E76A 3HDXA 1KT1A 3RSEG 2XHEA 1O1TA 3HRAA 1N54A 4GTPA 4EZKA 4EECA 3LS8A 2R5SA 3JXJA 1DCEA 3FUHA 4XKBA 3TWTA 2X6KA 2R17C 4DUIA 4B8AA 3AS4A 4L23A 4XZ4A 3TWWA 3R9AB 1TNZA 2CFUA 2E2EA 3OXGA 2KM4A 4WWPA 3CK9A 4HNAD 3APDA 2CFZA 4WNFA 2XRYA 4GTRA 4TXRA 4M3OA 3FTYA 2CHZA 1PAQA 3B7BA 3C3RA 1Z5SC 4EQFA 1Z3YA 1UW4B 3AU5A 3NQPA 1Y6IA 4GA0A 1YA0A 4J8DA 3SO8A 3FU6A 5ANLA 3PE3A 4N5CA 1JWGA 4GTSA 3EHMA 3NF1A 2WXMA 3S2AA 3UT7A 3EUVA 3N71A 2GRNB 1FVHA 4BERA 2C2LA 2RD0A 2XS1A 4PH4B 3FTUA 3UM0A 3ZW3A 2EQXA 2ILRA 2P58C 2F8YA 4Z68A 3VTYA 4CZ2D 3EHRA 2YQ8A 5FQ8A 1UN8A 1PC2A 3BG1B 2J4DA 4ILHB 4LNUD 2FEZA 2GRMA 3FULA 3FTVA 3EJNA 3QWWA 3ABME 4N39A 4BSXA 5KCMA 4BSZB 4HQDA 3TWRA 4KZCA 2V5QC 4J8FA 2L9BA 3DXMG 3FU3A 2V4HC 3Q7AA 3D9LA 3Q9UC 4R7LA 4HXIA 4JXTA 3UIOC 4N3BA 4E6HA 4EZLA 2F0YA 3FP3A 4GTVA 3EU5A 3UXGA 2CHXA 3RK6A 4U07A 4I17A 2IO2C 2R03A 1RW2A 3ASFA 3FWVA 3FUFA 3LJ3A 2Y4UA 4CCAA 1SVXA 3RO3A 5ARFA 3UT4A 3U3WA 5CBNA 3TXMA 2ETBA 3ZFWA 2KCKA 1QQEA 3Q15A 3V31A 3LY8A 1LD7A 5G05J 1N52A 4UWFA 2QC9A 1NA0A 1HFAA 3ZXSA 1OT8A 4JW1A 2P9KG 5G55A 3V79K 2DZOA 3DSVA 1NP7A 2UY1B 3ZUVB 4CGVA 5AARA 1TNUA 3QARA 1E8ZA 3AU4A 4GYWA 3LVRE 5LCWC 3ABKE 4ZFHA 4URKA 3J5PA 3G2WA 2PZIA 1HX8A 4HRMB 1N4PA 4O60A 3MKRA 4RG9A 3U66A 4PDXA 3U64A 3CVPA 2XQ0A 3OXLA 2XPYA 4CYMD 5HKPA 3MV2B 4GZ3A 4LEUA 2MYOA 4WUYA 2EIKE 3RO2A 5CECB 4J8EA 1EDUA 4LNGA 2Y4TA 1TNOA 2WQ6A 4ANWA 4LRZA 3ZXPA 5E75A 1OCCE 4A3TA 2FI7A 3UM2A 5FZQA 2WMOA 4HBDA 2VGYA 2Y1LE 5AQAA 1BD8A 2RG8A 4RSYA 3K9IA 3Q78A 4U63A 3ULEG 3F6QA 4AY5A 3R7QA 4IULA 5FZRA 1V55E 3I3NA 4CGWA 3IKOB 4GCOA 3DWLG 5ARGA 4G2VA 2WXNA 4I43A 3D9PA 3KS2A 5EX3A 2X3MA 3UI2A 4RQIA 4UQZA 1PY1A 2WXRA 4D10C 4LSZE 1ELKA 4K0RA 5ENPD 5BPPA 3DPDA 4A3VA 4CEMA 2J09A 3RJVA 3ASHA 1ELWA 1AWCB 3D9IA 2WB2A 2J07A 2PM6A 3UQ3A 2OVBA 1MX6A 4B0ZA 1S63A 3FTSA 1BI8B 3EU9A 4KYOB 1N0RA 3ENEA 3G2UA 1UN9A 3EHNA 1MX2A 4MS6A 3MGBA 5FZSA 4V3IA 5LFAA 3PUKA 2A5EA 2V5FA 3LEWA 3Q9NC 3ZPJA 3RRNB 4NIKA 2OV8A 2R2LA 4J8SA 1ZB1A 4GA1A 5DIZA 2LO6A 4GTQA 3FUKA 3G2SA 1IHGA 3W9GA 1E90A 3CK7A 3MKQA 2KATA 2V0PA 4Y6CA 5AN8A 1WG0A 2KC7A 5AIJA 5HRYA 1K3ZD 4NURA 2RFMA 3L16A 4BX9A 1MX4A 4AXHA 1IQRA 5KJKA 2XRZA 2ONDA 3UPVA 3HHMA 2YNQA 2DVWA 4LCTA 1E96B 1MYOA 3E4BA 2P9IG 4TXPA 5G04C 1MJ0A 4F3VA 5FWQA 2LAHA 4BWRA 1NZNA 1FPPA 1H19A 3LVQE 1TN8A 3APFA 1TEZA 1OY3D 3JUIA 5AENA 3BUAA 3FH8A 3PEVB 2ZGDA 4BTBA 5BV0A 2KZTA 2UWJG 4AIFA 3CVNA 2C0MA 4GTTA 4YDYA 3HXBA 2XPIA 1Z3XA 2XENA 1SW6A 3ZIMA 3BU8A 2KCLA 1V54E 1N95A 3LJNA 3APCA 3PZ4A 4U0ZA 5FQ7A 4JA7A 4N3CA 2PQRA 2BKKB 3UT8A 1QZ2A 3CQCB 1L5JA 1YCSB 5JJTA 2J8SD 4U7EB 3FU0A 3FTWA 3NB2A 5EDSA 2KXPC 5BXUA 4I6JA 2MHKA 4AVXA 3CVLA 3CVXA 2DYRE 4KXKB 4GMRA 4MKTA 2P9PG 2PM7A 3B95A 4H7YA 1FT2A 2XEHA 4FU3A 2VYIA 5AAOA 4ZHBA 1YMPA 4G24A 5JJ6A 3TWVA 2YHEA 2WM9A 4NQ0A 3ONKA 2P9NG 5J08A 1LD8A 3AG1E 1OWNA 4G23A 2XCCA 1E8XA 3UM3A 5D0OD 2BEDA 5AJLA 2XGMA 2QZAA 2Y0BG 2A5UA 2L0IA 2ZXWE 4N3AA 3V2OA 3V2XA 4O1PA 2PQNA 3GZSA 3E30A 4PUCA 5KNGA 4AJWA 2X6FA 4A1SA 4U8VD 3BG0B 3DSWA 4XI0A 4G11A 2RKKA 3PZDA 3Q49B 3DSUA 4HRLA 1DVPA 4HOTA 2ZU6B 1TNYA 4BFRA 2Q7FA 2GRPB 3LPZA 4HLEA 5FTPA 4U0SA 5D0QD 4LNBA 3MX3A 3FEXA 1FCHA 1E8YA 3ZN3A 4GZCA 5BUZA 1SQMA 2WMNA 4K5AB 4I1AA 3AG2E 4AOFA 3PNLB 2AXZA 1DCQA 2JABA 2JLBA 3ZVVA 4IN3B 3ZEFA 1QYMA 3GZ1A 2IOLA 3HXDA 4JPSA 4F1PA 3Q75A 2XEVA 1NI1A 5JMND 4CDNA 3PZ2A 2B6CA 4GYYA 1K1BA 2XGSA 5G04J 2IONA 4BESA 2IJGX 5KJLA 2V4LA 3D9HA 4J6IA 4LG6A 3QC1A 4HORA 1OXJA 4EBAG 4K03A 4XIFA 4TXQA 3IXEA 4AM9A 4I1OB 1NA3A 4ATZD 3EDTB 4DX5D 5EYLA 4B89A 3DPYA 5BW8C 5B1BE 4M7CA 4OVVA 4RLYA 3ML9A 5JHAA 2CHWA 3CV0A 2X6IA 4I6EA 3CHPA 3D3MA 3QB2A 2BKGA 4RG6A 2WXJA 3C5RA 2MRIA 1BPOA 3SFXA 4NACA 4EPZA 2YHCA 3G2TA 3RRUA 3T5XA 2H6GA 3PEUB 4PS7A 2NC9A 2DCPA 2WXGA 4GAAA 2NYJA 1TR4A 2J08A 3IHYA 2DIWA 5C2YA 5FINA 3TGOA 4JVSA 5IY5E 1TN7A 2MOWA 4YNDA 3QWVA 3V30A 4GU5A 1Y8MA 3CHSA 2L6JA 3AG4E 1H2TC 3J5QB 4BX8A 3FUDA 3AS8A 1OWMA 2OOEA 4RVBA 4JHJA 1D9SA 3PZ1A 1QNFA 1HZ4A 3ESKA 2BTDA 3E37A 4YDOA 2L6BA 3L82A 2IY0C 3NZSA 3CVVA 3R7RA 3FEYA 3TG5A 1S70B 4I1MA 4I2WA 2OCCE 2AXVA 4FA6A 4U8YD 2XZTG 1SZAA 4AEZC 4OAVB 4HI9A 3VLDA 1OCOE 3ABLE 3O48A 3VLFA 2BF0X 1N4RA 5HI7A 2FF4A 3DSTA 3LCAA 1JCRA 4JA9A 5CRUA 3L13A 5AQ7A 1JUQA 2XS8A 4GPMA 3JQ1A 4XEIG 1ZU2A 3C3OA 4ANVA 3CVQA 5BV1A 5ENRD 2KZTB 3L9TA 1E7VA 3MZLB 5D2MC 2LXLA 2P9UG 3UKRG 1O1SA 1LF8A 3Q47B 3D9MA 4HS2A 3MEKA 5LX8A 1U3DA 5HQ8A 4JEHA 4AY6A 3SGHA 3UTMA 2CG3A 1OWPA 4FJYA 5AQBA 3IBEA 5KJNA 4P29A 3R9MA 5JJ7A 3LYAA 4GCNA 3TXNA 5FQ6A 5FQ4A 1IHBA 3ZHEB 2Y69E 3KSQA 4F1SA 3DRAA 4L1BA 1ELRA 2BUGA 3AG3E 3ASGA 1X5BA 3ZYMA 4CT4A 4F6RD 2NXPA 5KNHD 4UWLA 3TJPA 3SBTB 3Q5MA 3UINC 3KD7A 2H6IA 4GMJA 2ZGGA 4FLBA 5EIDA 4I2ZA 2B0OE 3U9WA 5ENQD 1MHQA 5AYWD 2F37A 2A4ZA 3B7RL 2FO1E 5ENTD 3QJZA 4DX1A 3TWQA 3B7SA 2XEEA 5A23A
chains in the Genus database with same CATH topology
2F8XK 3C5RA 1G3NB 1K3ZD 4GMRA 4BETA 2ETCA 3TWXA 2RFMA 2XZDG 3B95A 2F8YA 1MX4A 4Z68A 3DEPA 2QC9A 4CZ2D 4BEPA 5ENRD 3UI2A 1NFIE 4TUMA 4K5AB 3EHRA 3JUEA 2DVWA 2XEHA 4U96D 1OT8A 4J8YA 4U95D 4DX7D 5ENOD 5AAOA 5ENSD 1YMPA 4ZHBA 4LSZE 1MYOA 4OAUC 1DCQA 2JABA 3W9FA 3V79K 2DZNA 3HRAA 3KEAA 2DZOA 3TWVA 4LNUD 2NYJA 5ENPD 3TWSA 4HRNA 1MJ0A 3JXJA 1TR4A 5AQ9A 3ZUVB 3T8KA 1QYMA 4C48B 2ETAA 3NOCD 5AARA 1IXVA 3TWTA 4F1PA 2KBXA 4DRXE 5FINA 4HLLA 4DUIA 3UTMA 1AWCB 4A63B 3V30A 3TWWA 5D66A 3JXIA 5CERB 2HE0A 5JMND 4ZFHA 4N5QA 1OY3D 1K1BA 4B93B 1MX6A 5EILA 5AQBA 2RFAA 3J5PA 2ZGDA 4BSZB 1DC2A 4HQDA 1IKND 3TWRA 4HRMB 5KBAA 3ZNGA 4O60A 3NBNB 4YDYA 1BI8B 3EU9A 2Y0BG 1N0RA 2DWZA 4HNAD 2V5QC 2P2CP 3J5QB 1IHBA 4HB5A 3T9KA 2V4HC 4YDWA 4K5BA 5HS0A 5CEDB 3AAAC 2XENA 3TWUA 1MX2A 3Q9UC 1SW6A 2PNNA 4G8KA 4BESA 4CYMD 1BLXB 5HKPA 4DX2A 3ZU7B 5EN5D 3V2OA 3LJNA 3V2XA 5ITZF 1D9SA 4UUCA 3ZKJA 1N0QA 1N11A 2MYOA 3D9HA 4G8LA 3B7BA 5BXOA 2A5EA 2L6BA 4LG6A 1BU9A 5CECB 4O1PA 4F6RD 2AJAA 2BKKB 5KNHD 4HI8A 3UXGA 3Q9NC 5CBOA 5EIBE 1S70B 4NIKA 2VGEA 3IXEA 5KNGA 1YCSB 3SO8A 4U8VD 4JB8P 4ATZD 1YYHA 4U8YD 4QFVA 4DX5D 2XZTG 4HBDA 5EYLA 5HRYA 2Y1LE 5FIOA 4OAVB 2J8SD 2ZGGA 3NOGD 4HRLA 5EIDA 3EHQA 4HI9A 1BD8A 3AJIA 5AQAA 2QYJA 2B0OE 5ENQD 1UOHA 1A5EA 3HG0D 4O1OA 5CEAA 3W9GA 2F37A 1AP7A 1SVXA 4QQIA 4RLYA 3DEOA 1WDYA 5JA4D 4DX6D 2FO1E 3F6QA 5ENTD 4BERA 5AN8A 5CBNA 5KWDA 2ETBA 1K1AA 4J7WA 1WG0A 2KXPC 5BXUA 4DX1A 3TWQA 1BI7B 5AQ7A 3V31A 2XEEA 2BKGA 4GPMA 4K5CA 5EYPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F8X K;  3C5R A;  1G3N B;  1K3Z D;  4GMR A;  4BET A;  2ETC A;  3TWX A;  2RFM A;  2XZD G;  3B95 A;  2F8Y A;  1MX4 A;  4Z68 A;  3DEP A;  2QC9 A;  4CZ2 D;  4BEP A;  5ENR D;  3UI2 A;  1NFI E;  4TUM A;  4K5A B;  3EHR A;  3JUE A;  2DVW A;  2XEH A;  4U96 D;  1OT8 A;  4J8Y A;  4U95 D;  4DX7 D;  5ENO D;  5AAO A;  5ENS D;  1YMP A;  4ZHB A;  4LSZ E;  1MYO A;  4OAU C;  1DCQ A;  2JAB A;  3W9F A;  3V79 K;  2DZN A;  3HRA A;  3KEA A;  2DZO A;  3TWV A;  4LNU D;  2NYJ A;  5ENP D;  3TWS A;  4HRN A;  1MJ0 A;  3JXJ A;  1TR4 A;  5AQ9 A;  3ZUV B;  3T8K A;  1QYM A;  4C48 B;  2ETA A;  3NOC D;  5AAR A;  1IXV A;  3TWT A;  4F1P A;  2KBX A;  4DRX E;  5FIN A;  4HLL A;  4DUI A;  3UTM A;  1AWC B;  4A63 B;  3V30 A;  3TWW A;  5D66 A;  3JXI A;  5CER B;  2HE0 A;  5JMN D;  4ZFH A;  4N5Q A;  1OY3 D;  1K1B A;  4B93 B;  1MX6 A;  5EIL A;  5AQB A;  2RFA A;  3J5P A;  2ZGD A;  4BSZ B;  1DC2 A;  4HQD A;  1IKN D;  3TWR A;  4HRM B;  5KBA A;  3ZNG A;  4O60 A;  3NBN B;  4YDY A;  1BI8 B;  3EU9 A;  2Y0B G;  1N0R A;  2DWZ A;  4HNA D;  2V5Q C;  2P2C P;  3J5Q B;  1IHB A;  4HB5 A;  3T9K A;  2V4H C;  4YDW A;  4K5B A;  5HS0 A;  5CED B;  3AAA C;  2XEN A;  3TWU A;  1MX2 A;  3Q9U C;  1SW6 A;  2PNN A;  4G8K A;  4BES A;  4CYM D;  1BLX B;  5HKP A;  4DX2 A;  3ZU7 B;  5EN5 D;  3V2O A;  3LJN A;  3V2X A;  5ITZ F;  1D9S A;  4UUC A;  3ZKJ A;  1N0Q A;  1N11 A;  2MYO A;  3D9H A;  4G8L A;  3B7B A;  5BXO A;  2A5E A;  2L6B A;  4LG6 A;  1BU9 A;  5CEC B;  4O1P A;  4F6R D;  2AJA A;  2BKK B;  5KNH D;  4HI8 A;  3UXG A;  3Q9N C;  5CBO A;  5EIB E;  1S70 B;  4NIK A;  2VGE A;  3IXE A;  5KNG A;  1YCS B;  3SO8 A;  4U8V D;  4JB8 P;  4ATZ D;  1YYH A;  4U8Y D;  4QFV A;  4DX5 D;  2XZT G;  4HBD A;  5EYL A;  5HRY A;  2Y1L E;  5FIO A;  4OAV B;  2J8S D;  2ZGG A;  3NOG D;  4HRL A;  5EID A;  3EHQ A;  4HI9 A;  1BD8 A;  3AJI A;  5AQA A;  2QYJ A;  2B0O E;  5ENQ D;  1UOH A;  1A5E A;  3HG0 D;  4O1O A;  5CEA A;  3W9G A;  2F37 A;  1AP7 A;  1SVX A;  4QQI A;  4RLY A;  3DEO A;  1WDY A;  5JA4 D;  4DX6 D;  2FO1 E;  3F6Q A;  5ENT D;  4BER A;  5AN8 A;  5CBN A;  5KWD A;  2ETB A;  1K1A A;  4J7W A;  1WG0 A;  2KXP C;  5BXU A;  4DX1 A;  3TWQ A;  1BI7 B;  5AQ7 A;  3V31 A;  2XEE A;  2BKG A;  4GPM A;  4K5C A;  5EYP F; 
#chains in the Genus database with same CATH topology
 5CHE E;  2F8X K;  3SY2 A;  4CRW A;  1E8W A;  4GZ5 A;  2DBA A;  3I5P A;  4DPR A;  5CCL A;  2YIN A;  3ZHE A;  2DYS E;  4LER A;  2IQC A;  4DX7 D;  1TN6 A;  5G05 C;  4B94 A;  3MA5 A;  3ISM C;  4X8Q A;  4C0E A;  4H7X A;  3ULQ A;  1WAO 1;  1HG2 A;  5B3S E;  2JEK A;  4L2L A;  4KT6 B;  3CSF A;  4I9E A;  4UI9 J;  1HE8 A;  3CHR A;  4Q69 A;  3IV0 A;  5J90 A;  1XNF A;  3CKB A;  3Q7F A;  1MZC A;  1UJJ A;  3RIB A;  3ZNG A;  2LXM A;  3O4Z A;  1H0A A;  4KVM A;  4K5B A;  4Q94 A;  5CED B;  3PNT B;  4BT8 A;  2X6J A;  3L6A A;  3NZU A;  4FAD A;  3MCX A;  4G25 A;  3OAW A;  1UJK A;  4UUC A;  3ZKJ A;  2GRL A;  3ML8 A;  4G8L A;  4WWN A;  4HFG A;  3TAX A;  1FT1 A;  1BU9 A;  4L7T A;  1VDY A;  1IQU A;  4FHK A;  2IEJ A;  2V8S E;  4AP2 A;  3LDZ A;  4DI3 A;  3ZRH A;  3MYV A;  3UMV A;  2NSZ A;  3S7D A;  4XE0 A;  5FIO A;  3EHQ A;  1HO8 A;  2QFC A;  2IF4 A;  5CEA A;  1SA4 A;  3CIA A;  3ESL A;  3L54 A;  3P1U A;  4EHM A;  3FUE A;  3I4G A;  2LUH A;  5A7D B;  3SNX A;  4UWG A;  4UWH A;  4A1G A;  5KWD A;  3FUM A;  4ANU A;  1K1A A;  4FHJ A;  3CEQ A;  4JC8 A;  3IHV A;  3UIP C;  5LOZ A;  3FY4 A;  3C98 A;  1WM5 A;  3IEG A;  3CHM A;  4BET A;  4XX5 A;  4APF A;  3U4T A;  4BEP A;  3SBS A;  3Q73 A;  4TUM A;  2J4B A;  2R05 A;  4U96 D;  2EIM E;  1K8K G;  3DSS A;  4E85 A;  4OAU C;  2FBN A;  2EIJ E;  2M63 A;  3EIQ C;  1H2V C;  3QOU A;  2LSU A;  3TL5 A;  1LTX A;  1TNB A;  4KZ0 A;  2KBX A;  4UQY A;  4DRX E;  3SFY A;  1O1R A;  4UWK A;  3ASN E;  2GW1 A;  3JXI A;  1ZBP A;  3PE4 A;  5CER B;  2LNI A;  3L17 A;  3ONL A;  4I9C A;  1H6P A;  3D9N A;  1N9A A;  3SFZ A;  1KPS B;  3AAA C;  3QNK A;  2PNN A;  5BNW A;  4CDR A;  1BLX B;  5A6C A;  2OEW A;  5EN5 D;  3EIJ A;  5C1D A;  2IU1 A;  3E32 A;  4N2Q A;  1IYG A;  4FJZ A;  3D9O A;  4PS8 A;  4C9B B;  3CHQ A;  4BT9 A;  3FTX A;  1YYH A;  5G2N A;  3P2B A;  3S7B A;  3DSX A;  4O1O A;  4MRU A;  4DX6 D;  1OCR E;  5B1A E;  3S7F A;  4TUU A;  2VSN A;  3I4R B;  4YDE A;  3ZYK A;  4MBG A;  3BEE A;  4CDM A;  1H2U A;  2WXK A;  3TWX A;  2XZD G;  2FUL A;  4KVO A;  3WXX A;  3E34 A;  4EBA A;  3SQV A;  3S7J A;  4GTO A;  5T3R A;  1EYH A;  4U95 D;  5ENO D;  5ENS D;  3CK8 A;  3PRE A;  2L0T B;  1HS6 A;  4UI9 K;  4ABN A;  1MQS A;  1Z6T A;  1HXI A;  5FJY A;  3CVW A;  2Y3A A;  2OEV A;  2X38 A;  1N4Q A;  4OYS A;  3NBN B;  1HG5 A;  3GZ2 A;  2WVI A;  3KSL A;  3CLJ A;  2VSO E;  1H6K A;  2PL2 A;  2P9L G;  2R59 A;  1N11 A;  3CHO A;  1JCS A;  2HO1 A;  4UQX A;  1TJC A;  3HXE A;  4KBQ A;  3BQO A;  2WPV A;  3AS5 A;  2VJ8 A;  3CGH A;  4QFV A;  5KJM A;  2XCB A;  1XGW A;  2UY1 A;  4ILI A;  4FP7 A;  1HU3 A;  2VGX B;  4CT0 A;  3ASD A;  2WXQ A;  3SZ7 A;  4DK5 A;  5EYP F;  2AVP A;  3HIZ A;  1HF8 A;  4APO A;  5EKQ D;  4HOU A;  1N4S A;  4JD2 G;  3CVU A;  2H6F A;  1EPU A;  4J0U A;  4BTA A;  2KCV A;  4JZY A;  1WY6 A;  2FO7 A;  2ETA A;  2J9Q A;  4ILG A;  1IXV A;  3RKV A;  3PDN A;  3SD5 A;  3NAW A;  3ULY A;  1KZO A;  3PUJ A;  4L9P A;  4ME2 A;  1JCQ A;  2WXO A;  2IO3 C;  1X81 A;  5M72 A;  2LAI A;  1OCZ E;  2P2C P;  2I1J A;  3TWU A;  4G8K A;  4WND A;  3C72 A;  3ZU7 B;  2E0I A;  5ITZ F;  1RZ4 A;  2EIL E;  2AXU A;  3QKY A;  1UG3 A;  1N0Q A;  3MKQ B;  4G26 A;  4IRU A;  5CBO A;  2LSV A;  3E33 A;  3CQG B;  2H6H A;  4N2S A;  4U8H A;  2X6H A;  5AJD A;  2I2O A;  1OWL A;  4KMO A;  3AJI A;  1NL4 A;  3KEZ A;  3QWP A;  4JL0 A;  5T4Y A;  1A5E A;  1OUV A;  1KLX A;  2WXL A;  2J49 A;  1AP7 A;  3DEO A;  5T8I A;  3QDN A;  3UX4 A;  2IFU A;  4J7W A;  3LY9 A;  4WAF A;  4XKC A;  3SI5 A;  1BI7 B;  2XPZ A;  4C0M A;  1JPL A;  3HXC A;  4WWO A;  2ETC A;  3FFL A;  4TRQ A;  3L22 A;  3LKU A;  3DBS A;  3DEP A;  5CCM A;  1HH8 A;  3FU5 A;  4HVB A;  2I1K A;  1DNP A;  3CR3 A;  3WG7 E;  1N94 A;  2I9C A;  4O6F A;  5DBK A;  1OWO A;  1KZP A;  3T8K A;  4C48 B;  4LUN U;  4FLH A;  1U2V G;  2GGF A;  3RU0 A;  2CG2 A;  3ZYQ A;  4ANX A;  5CMW A;  3UKU G;  4A63 B;  2C0L A;  4JHK A;  4W9R A;  1QBQ A;  2IOS A;  1IKN D;  2WXI A;  3RAU A;  3FDH A;  3MV3 B;  4GYO A;  2VTB A;  4YDW A;  4GPK A;  3B13 A;  2QYU A;  3VLE A;  4I6G A;  4EZJ A;  1P5Q A;  2WXP A;  5CMY A;  4JHR A;  2AJA A;  2XGO A;  3FH5 A;  3QK0 A;  3ZYL A;  2VGE A;  3Q4A B;  3CKC A;  4DI4 A;  3URZ A;  4DJA A;  1B89 A;  3SHF A;  1A17 A;  4JB8 P;  2VTB B;  3ZGQ A;  3B7U X;  5CRV A;  1S64 A;  5LCW J;  1INZ A;  2QYJ A;  2WQ7 A;  5JA4 D;  4TV3 A;  4UI9 C;  2EIN E;  2QY7 A;  2ZIS A;  4Q96 A;  2AW6 A;  4DX2 A;  4K5C A;  2VSX E;  4F53 A;  3PS6 A;  2ZIR A;  3FUI A;  3HYM B;  1Q2Z A;  3PVL A;  4G1T A;  2I6H A;  4GML A;  3CST A;  3W9F A;  2DZN A;  1TYQ G;  3KEA A;  3TWS A;  2VGX A;  4HRN A;  3HVE A;  2GRR B;  3PRZ A;  3NOC D;  3JCK C;  4IYP A;  4HLL A;  1SZ9 A;  2AWI A;  4U04 A;  4GB9 A;  4OVU A;  3OXF A;  5D66 A;  4XI9 A;  4F7A A;  4N5Q A;  3FUJ A;  3LY7 A;  4B93 B;  5EIL A;  4YVQ C;  3FTZ A;  3QAQ A;  1EF1 C;  3FUN A;  3T9K A;  5HS0 A;  4GZD A;  4MLP A;  3OTN A;  3DXK G;  3HVE B;  5LP0 A;  5FT9 A;  1D8D A;  1FVF A;  5BXO A;  5JHB A;  3TG4 A;  5EIB E;  3KAE A;  4WNE A;  3NOG D;  3RRM B;  1JWF A;  2VQ2 A;  1UOH A;  3FHE A;  3HG0 D;  3UUX A;  3Q79 A;  4ATG A;  4QQI A;  1WDY A;  3SF4 A;  1W3B A;  4WNG A;  2GRQ B;  2HYZ A;  1G3N B;  3G2V A;  3B7T A;  1KT0 A;  4HOS A;  1NFI E;  3T8M A;  5H7P A;  3L08 A;  4FUL A;  3X2Q E;  4U0U A;  1SA5 A;  5AQ9 A;  3MJW A;  3VTX A;  2VSY A;  1H6O A;  3PZ3 A;  5EX0 A;  2HE0 A;  1GW6 A;  2WXF A;  4JEU A;  2RFA A;  1DC2 A;  3T5V A;  4A55 A;  2WQH A;  3UM1 A;  5KBA A;  3ASO E;  3C3Q A;  2DWZ A;  4DLQ A;  4HB5 A;  3PH0 C;  4BY6 A;  2HM8 A;  4B8C B;  3D9J A;  3JQ0 A;  4DLO A;  5ANR A;  3JYS A;  4GZ6 A;  1O5M A;  4GA2 A;  4L2Y A;  3D9K A;  4ACK A;  4Y6W A;  4HI8 A;  5ENN A;  2P9S G;  4NRH B;  2HR2 A;  5BT1 A;  2OVF A;  3LXU X;  3GW4 A;  1S0P A;  4HOQ A;  2GRO B;  2R02 A;  2WXH A;  3CVY A;  3GYZ A;  4YVO A;  3FH7 A;  4FC8 A;  1E7U A;  1TJF A;  1U3C A;  4GTM A;  4AV7 A;  1D8E A;  4PS3 A;  3JUE A;  4ACL A;  4J8Y A;  3HXF A;  5E76 A;  3HDX A;  1KT1 A;  3RSE G;  2XHE A;  1O1T A;  3HRA A;  1N54 A;  4GTP A;  4EZK A;  4EEC A;  3LS8 A;  2R5S A;  3JXJ A;  1DCE A;  3FUH A;  4XKB A;  3TWT A;  2X6K A;  2R17 C;  4DUI A;  4B8A A;  3AS4 A;  4L23 A;  4XZ4 A;  3TWW A;  3R9A B;  1TNZ A;  2CFU A;  2E2E A;  3OXG A;  2KM4 A;  4WWP A;  3CK9 A;  4HNA D;  3APD A;  2CFZ A;  4WNF A;  2XRY A;  4GTR A;  4TXR A;  4M3O A;  3FTY A;  2CHZ A;  1PAQ A;  3B7B A;  3C3R A;  1Z5S C;  4EQF A;  1Z3Y A;  1UW4 B;  3AU5 A;  3NQP A;  1Y6I A;  4GA0 A;  1YA0 A;  4J8D A;  3SO8 A;  3FU6 A;  5ANL A;  3PE3 A;  4N5C A;  1JWG A;  4GTS A;  3EHM A;  3NF1 A;  2WXM A;  3S2A A;  3UT7 A;  3EUV A;  3N71 A;  2GRN B;  1FVH A;  4BER A;  2C2L A;  2RD0 A;  2XS1 A;  4PH4 B;  3FTU A;  3UM0 A;  3ZW3 A;  2EQX A;  2ILR A;  2P58 C;  2F8Y A;  4Z68 A;  3VTY A;  4CZ2 D;  3EHR A;  2YQ8 A;  5FQ8 A;  1UN8 A;  1PC2 A;  3BG1 B;  2J4D A;  4ILH B;  4LNU D;  2FEZ A;  2GRM A;  3FUL A;  3FTV A;  3EJN A;  3QWW A;  3ABM E;  4N39 A;  4BSX A;  5KCM A;  4BSZ B;  4HQD A;  3TWR A;  4KZC A;  2V5Q C;  4J8F A;  2L9B A;  3DXM G;  3FU3 A;  2V4H C;  3Q7A A;  3D9L A;  3Q9U C;  4R7L A;  4HXI A;  4JXT A;  3UIO C;  4N3B A;  4E6H A;  4EZL A;  2F0Y A;  3FP3 A;  4GTV A;  3EU5 A;  3UXG A;  2CHX A;  3RK6 A;  4U07 A;  4I17 A;  2IO2 C;  2R03 A;  1RW2 A;  3ASF A;  3FWV A;  3FUF A;  3LJ3 A;  2Y4U A;  4CCA A;  1SVX A;  3RO3 A;  5ARF A;  3UT4 A;  3U3W A;  5CBN A;  3TXM A;  2ETB A;  3ZFW A;  2KCK A;  1QQE A;  3Q15 A;  3V31 A;  3LY8 A;  1LD7 A;  5G05 J;  1N52 A;  4UWF A;  2QC9 A;  1NA0 A;  1HFA A;  3ZXS A;  1OT8 A;  4JW1 A;  2P9K G;  5G55 A;  3V79 K;  2DZO A;  3DSV A;  1NP7 A;  2UY1 B;  3ZUV B;  4CGV A;  5AAR A;  1TNU A;  3QAR A;  1E8Z A;  3AU4 A;  4GYW A;  3LVR E;  5LCW C;  3ABK E;  4ZFH A;  4URK A;  3J5P A;  3G2W A;  2PZI A;  1HX8 A;  4HRM B;  1N4P A;  4O60 A;  3MKR A;  4RG9 A;  3U66 A;  4PDX A;  3U64 A;  3CVP A;  2XQ0 A;  3OXL A;  2XPY A;  4CYM D;  5HKP A;  3MV2 B;  4GZ3 A;  4LEU A;  2MYO A;  4WUY A;  2EIK E;  3RO2 A;  5CEC B;  4J8E A;  1EDU A;  4LNG A;  2Y4T A;  1TNO A;  2WQ6 A;  4ANW A;  4LRZ A;  3ZXP A;  5E75 A;  1OCC E;  4A3T A;  2FI7 A;  3UM2 A;  5FZQ A;  2WMO A;  4HBD A;  2VGY A;  2Y1L E;  5AQA A;  1BD8 A;  2RG8 A;  4RSY A;  3K9I A;  3Q78 A;  4U63 A;  3ULE G;  3F6Q A;  4AY5 A;  3R7Q A;  4IUL A;  5FZR A;  1V55 E;  3I3N A;  4CGW A;  3IKO B;  4GCO A;  3DWL G;  5ARG A;  4G2V A;  2WXN A;  4I43 A;  3D9P A;  3KS2 A;  5EX3 A;  2X3M A;  3UI2 A;  4RQI A;  4UQZ A;  1PY1 A;  2WXR A;  4D10 C;  4LSZ E;  1ELK A;  4K0R A;  5ENP D;  5BPP A;  3DPD A;  4A3V A;  4CEM A;  2J09 A;  3RJV A;  3ASH A;  1ELW A;  1AWC B;  3D9I A;  2WB2 A;  2J07 A;  2PM6 A;  3UQ3 A;  2OVB A;  1MX6 A;  4B0Z A;  1S63 A;  3FTS A;  1BI8 B;  3EU9 A;  4KYO B;  1N0R A;  3ENE A;  3G2U A;  1UN9 A;  3EHN A;  1MX2 A;  4MS6 A;  3MGB A;  5FZS A;  4V3I A;  5LFA A;  3PUK A;  2A5E A;  2V5F A;  3LEW A;  3Q9N C;  3ZPJ A;  3RRN B;  4NIK A;  2OV8 A;  2R2L A;  4J8S A;  1ZB1 A;  4GA1 A;  5DIZ A;  2LO6 A;  4GTQ A;  3FUK A;  3G2S A;  1IHG A;  3W9G A;  1E90 A;  3CK7 A;  3MKQ A;  2KAT A;  2V0P A;  4Y6C A;  5AN8 A;  1WG0 A;  2KC7 A;  5AIJ A;  5HRY A;  1K3Z D;  4NUR A;  2RFM A;  3L16 A;  4BX9 A;  1MX4 A;  4AXH A;  1IQR A;  5KJK A;  2XRZ A;  2OND A;  3UPV A;  3HHM A;  2YNQ A;  2DVW A;  4LCT A;  1E96 B;  1MYO A;  3E4B A;  2P9I G;  4TXP A;  5G04 C;  1MJ0 A;  4F3V A;  5FWQ A;  2LAH A;  4BWR A;  1NZN A;  1FPP A;  1H19 A;  3LVQ E;  1TN8 A;  3APF A;  1TEZ A;  1OY3 D;  3JUI A;  5AEN A;  3BUA A;  3FH8 A;  3PEV B;  2ZGD A;  4BTB A;  5BV0 A;  2KZT A;  2UWJ G;  4AIF A;  3CVN A;  2C0M A;  4GTT A;  4YDY A;  3HXB A;  2XPI A;  1Z3X A;  2XEN A;  1SW6 A;  3ZIM A;  3BU8 A;  2KCL A;  1V54 E;  1N95 A;  3LJN A;  3APC A;  3PZ4 A;  4U0Z A;  5FQ7 A;  4JA7 A;  4N3C A;  2PQR A;  2BKK B;  3UT8 A;  1QZ2 A;  3CQC B;  1L5J A;  1YCS B;  5JJT A;  2J8S D;  4U7E B;  3FU0 A;  3FTW A;  3NB2 A;  5EDS A;  2KXP C;  5BXU A;  4I6J A;  2MHK A;  4AVX A;  3CVL A;  3CVX A;  2DYR E;  4KXK B;  4GMR A;  4MKT A;  2P9P G;  2PM7 A;  3B95 A;  4H7Y A;  1FT2 A;  2XEH A;  4FU3 A;  2VYI A;  5AAO A;  4ZHB A;  1YMP A;  4G24 A;  5JJ6 A;  3TWV A;  2YHE A;  2WM9 A;  4NQ0 A;  3ONK A;  2P9N G;  5J08 A;  1LD8 A;  3AG1 E;  1OWN A;  4G23 A;  2XCC A;  1E8X A;  3UM3 A;  5D0O D;  2BED A;  5AJL A;  2XGM A;  2QZA A;  2Y0B G;  2A5U A;  2L0I A;  2ZXW E;  4N3A A;  3V2O A;  3V2X A;  4O1P A;  2PQN A;  3GZS A;  3E30 A;  4PUC A;  5KNG A;  4AJW A;  2X6F A;  4A1S A;  4U8V D;  3BG0 B;  3DSW A;  4XI0 A;  4G11 A;  2RKK A;  3PZD A;  3Q49 B;  3DSU A;  4HRL A;  1DVP A;  4HOT A;  2ZU6 B;  1TNY A;  4BFR A;  2Q7F A;  2GRP B;  3LPZ A;  4HLE A;  5FTP A;  4U0S A;  5D0Q D;  4LNB A;  3MX3 A;  3FEX A;  1FCH A;  1E8Y A;  3ZN3 A;  4GZC A;  5BUZ A;  1SQM A;  2WMN A;  4K5A B;  4I1A A;  3AG2 E;  4AOF A;  3PNL B;  2AXZ A;  1DCQ A;  2JAB A;  2JLB A;  3ZVV A;  4IN3 B;  3ZEF A;  1QYM A;  3GZ1 A;  2IOL A;  3HXD A;  4JPS A;  4F1P A;  3Q75 A;  2XEV A;  1NI1 A;  5JMN D;  4CDN A;  3PZ2 A;  2B6C A;  4GYY A;  1K1B A;  2XGS A;  5G04 J;  2ION A;  4BES A;  2IJG X;  5KJL A;  2V4L A;  3D9H A;  4J6I A;  4LG6 A;  3QC1 A;  4HOR A;  1OXJ A;  4EBA G;  4K03 A;  4XIF A;  4TXQ A;  3IXE A;  4AM9 A;  4I1O B;  1NA3 A;  4ATZ D;  3EDT B;  4DX5 D;  5EYL A;  4B89 A;  3DPY A;  5BW8 C;  5B1B E;  4M7C A;  4OVV A;  4RLY A;  3ML9 A;  5JHA A;  2CHW A;  3CV0 A;  2X6I A;  4I6E A;  3CHP A;  3D3M A;  3QB2 A;  2BKG A;  4RG6 A;  2WXJ A;  3C5R A;  2MRI A;  1BPO A;  3SFX A;  4NAC A;  4EPZ A;  2YHC A;  3G2T A;  3RRU A;  3T5X A;  2H6G A;  3PEU B;  4PS7 A;  2NC9 A;  2DCP A;  2WXG A;  4GAA A;  2NYJ A;  1TR4 A;  2J08 A;  3IHY A;  2DIW A;  5C2Y A;  5FIN A;  3TGO A;  4JVS A;  5IY5 E;  1TN7 A;  2MOW A;  4YND A;  3QWV A;  3V30 A;  4GU5 A;  1Y8M A;  3CHS A;  2L6J A;  3AG4 E;  1H2T C;  3J5Q B;  4BX8 A;  3FUD A;  3AS8 A;  1OWM A;  2OOE A;  4RVB A;  4JHJ A;  1D9S A;  3PZ1 A;  1QNF A;  1HZ4 A;  3ESK A;  2BTD A;  3E37 A;  4YDO A;  2L6B A;  3L82 A;  2IY0 C;  3NZS A;  3CVV A;  3R7R A;  3FEY A;  3TG5 A;  1S70 B;  4I1M A;  4I2W A;  2OCC E;  2AXV A;  4FA6 A;  4U8Y D;  2XZT G;  1SZA A;  4AEZ C;  4OAV B;  4HI9 A;  3VLD A;  1OCO E;  3ABL E;  3O48 A;  3VLF A;  2BF0 X;  1N4R A;  5HI7 A;  2FF4 A;  3DST A;  3LCA A;  1JCR A;  4JA9 A;  5CRU A;  3L13 A;  5AQ7 A;  1JUQ A;  2XS8 A;  4GPM A;  3JQ1 A;  4XEI G;  1ZU2 A;  3C3O A;  4ANV A;  3CVQ A;  5BV1 A;  5ENR D;  2KZT B;  3L9T A;  1E7V A;  3MZL B;  5D2M C;  2LXL A;  2P9U G;  3UKR G;  1O1S A;  1LF8 A;  3Q47 B;  3D9M A;  4HS2 A;  3MEK A;  5LX8 A;  1U3D A;  5HQ8 A;  4JEH A;  4AY6 A;  3SGH A;  3UTM A;  2CG3 A;  1OWP A;  4FJY A;  5AQB A;  3IBE A;  5KJN A;  4P29 A;  3R9M A;  5JJ7 A;  3LYA A;  4GCN A;  3TXN A;  5FQ6 A;  5FQ4 A;  1IHB A;  3ZHE B;  2Y69 E;  3KSQ A;  4F1S A;  3DRA A;  4L1B A;  1ELR A;  2BUG A;  3AG3 E;  3ASG A;  1X5B A;  3ZYM A;  4CT4 A;  4F6R D;  2NXP A;  5KNH D;  4UWL A;  3TJP A;  3SBT B;  3Q5M A;  3UIN C;  3KD7 A;  2H6I A;  4GMJ A;  2ZGG A;  4FLB A;  5EID A;  4I2Z A;  2B0O E;  3U9W A;  5ENQ D;  1MHQ A;  5AYW D;  2F37 A;  2A4Z A;  3B7R L;  2FO1 E;  5ENT D;  3QJZ A;  4DX1 A;  3TWQ A;  3B7S A;  2XEE A;  5A23 A; 
#chains in the Genus database with same CATH homology
 2F8X K;  3C5R A;  1G3N B;  1K3Z D;  4GMR A;  4BET A;  2ETC A;  3TWX A;  2RFM A;  2XZD G;  3B95 A;  2F8Y A;  1MX4 A;  4Z68 A;  3DEP A;  2QC9 A;  4CZ2 D;  4BEP A;  5ENR D;  3UI2 A;  1NFI E;  4TUM A;  4K5A B;  3EHR A;  3JUE A;  2DVW A;  2XEH A;  4U96 D;  1OT8 A;  4J8Y A;  4U95 D;  4DX7 D;  5ENO D;  5AAO A;  5ENS D;  1YMP A;  4ZHB A;  4LSZ E;  1MYO A;  4OAU C;  1DCQ A;  2JAB A;  3W9F A;  3V79 K;  2DZN A;  3HRA A;  3KEA A;  2DZO A;  3TWV A;  4LNU D;  2NYJ A;  5ENP D;  3TWS A;  4HRN A;  1MJ0 A;  3JXJ A;  1TR4 A;  5AQ9 A;  3ZUV B;  3T8K A;  1QYM A;  4C48 B;  2ETA A;  3NOC D;  5AAR A;  1IXV A;  3TWT A;  4F1P A;  2KBX A;  4DRX E;  5FIN A;  4HLL A;  4DUI A;  3UTM A;  1AWC B;  4A63 B;  3V30 A;  3TWW A;  5D66 A;  3JXI A;  5CER B;  2HE0 A;  5JMN D;  4ZFH A;  4N5Q A;  1OY3 D;  1K1B A;  4B93 B;  1MX6 A;  5EIL A;  5AQB A;  2RFA A;  3J5P A;  2ZGD A;  4BSZ B;  1DC2 A;  4HQD A;  1IKN D;  3TWR A;  4HRM B;  5KBA A;  3ZNG A;  4O60 A;  3NBN B;  4YDY A;  1BI8 B;  3EU9 A;  2Y0B G;  1N0R A;  2DWZ A;  4HNA D;  2V5Q C;  2P2C P;  3J5Q B;  1IHB A;  4HB5 A;  3T9K A;  2V4H C;  4YDW A;  4K5B A;  5HS0 A;  5CED B;  3AAA C;  2XEN A;  3TWU A;  1MX2 A;  3Q9U C;  1SW6 A;  2PNN A;  4G8K A;  4BES A;  4CYM D;  1BLX B;  5HKP A;  4DX2 A;  3ZU7 B;  5EN5 D;  3V2O A;  3LJN A;  3V2X A;  5ITZ F;  1D9S A;  4UUC A;  3ZKJ A;  1N0Q A;  1N11 A;  2MYO A;  3D9H A;  4G8L A;  3B7B A;  5BXO A;  2A5E A;  2L6B A;  4LG6 A;  1BU9 A;  5CEC B;  4O1P A;  4F6R D;  2AJA A;  2BKK B;  5KNH D;  4HI8 A;  3UXG A;  3Q9N C;  5CBO A;  5EIB E;  1S70 B;  4NIK A;  2VGE A;  3IXE A;  5KNG A;  1YCS B;  3SO8 A;  4U8V D;  4JB8 P;  4ATZ D;  1YYH A;  4U8Y D;  4QFV A;  4DX5 D;  2XZT G;  4HBD A;  5EYL A;  5HRY A;  2Y1L E;  5FIO A;  4OAV B;  2J8S D;  2ZGG A;  3NOG D;  4HRL A;  5EID A;  3EHQ A;  4HI9 A;  1BD8 A;  3AJI A;  5AQA A;  2QYJ A;  2B0O E;  5ENQ D;  1UOH A;  1A5E A;  3HG0 D;  4O1O A;  5CEA A;  3W9G A;  2F37 A;  1AP7 A;  1SVX A;  4QQI A;  4RLY A;  3DEO A;  1WDY A;  5JA4 D;  4DX6 D;  2FO1 E;  3F6Q A;  5ENT D;  4BER A;  5AN8 A;  5CBN A;  5KWD A;  2ETB A;  1K1A A;  4J7W A;  1WG0 A;  2KXP C;  5BXU A;  4DX1 A;  3TWQ A;  1BI7 B;  5AQ7 A;  3V31 A;  2XEE A;  2BKG A;  4GPM A;  4K5C A;  5EYP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...