2KXXA

Nmr structure of escherichia coli bame, a lipoprotein component of the beta-barrel assembly machinery complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
b'GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small protein A
publication title Structural Characterization of Escherichia coli BamE, a Lipoprotein Component of the beta-Barrel Assembly Machinery Complex.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein binding
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2kxxA01
5D0QE 1XXMC 3GMUB 3C4OB 3C4PB 5D0OE 3N4IB 2KM7A 5EKQE 2PXGA 3E2LC 4DM5A 3D4EA 3C7UB 2G2UB 2G2WB 1S0WC 2B5RC 5AYWE 1JTGB 3C7VB 3E2KC 2KXXA 2YH9A
chains in the Genus database with same CATH superfamily
4HSIA 5D0QE 1XXMC 3GMUB 3C4OB 3C4PB 3NWDA 5D0OE 3N4IB 2KM7A 2GUMA 3FVCA 5EKQE 3NWAA 2PXGA 3NWFA 3E2LC 4DM5A 3D4EA 3C7UB 2G2UB 2G2WB 1S0WC 2B5RC 4L1RA 5AYWE 1JTGB 3C7VB 3E2KC 3NW8A 2KXXA 2YH9A
chains in the Genus database with same CATH topology
4HSIA 5D0QE 1XXMC 3GMUB 3C4OB 3C4PB 3NWDA 5D0OE 3N4IB 2KM7A 2GUMA 3FVCA 5EKQE 3NWAA 2PXGA 3NWFA 3E2LC 4DM5A 3D4EA 3C7UB 2G2UB 2G2WB 1S0WC 2B5RC 4L1RA 5AYWE 1JTGB 3C7VB 3E2KC 3NW8A 2KXXA 2YH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0Q E;  1XXM C;  3GMU B;  3C4O B;  3C4P B;  5D0O E;  3N4I B;  2KM7 A;  5EKQ E;  2PXG A;  3E2L C;  4DM5 A;  3D4E A;  3C7U B;  2G2U B;  2G2W B;  1S0W C;  2B5R C;  5AYW E;  1JTG B;  3C7V B;  3E2K C;  2KXX A;  2YH9 A; 
#chains in the Genus database with same CATH topology
 4HSI A;  5D0Q E;  1XXM C;  3GMU B;  3C4O B;  3C4P B;  3NWD A;  5D0O E;  3N4I B;  2KM7 A;  2GUM A;  3FVC A;  5EKQ E;  3NWA A;  2PXG A;  3NWF A;  3E2L C;  4DM5 A;  3D4E A;  3C7U B;  2G2U B;  2G2W B;  1S0W C;  2B5R C;  4L1R A;  5AYW E;  1JTG B;  3C7V B;  3E2K C;  3NW8 A;  2KXX A;  2YH9 A; 
#chains in the Genus database with same CATH homology
 4HSI A;  5D0Q E;  1XXM C;  3GMU B;  3C4O B;  3C4P B;  3NWD A;  5D0O E;  3N4I B;  2KM7 A;  2GUM A;  3FVC A;  5EKQ E;  3NWA A;  2PXG A;  3NWF A;  3E2L C;  4DM5 A;  3D4E A;  3C7U B;  2G2U B;  2G2W B;  1S0W C;  2B5R C;  4L1R A;  5AYW E;  1JTG B;  3C7V B;  3E2K C;  3NW8 A;  2KXX A;  2YH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...