2KXXA

Nmr structure of escherichia coli bame, a lipoprotein component of the beta-barrel assembly machinery complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
97
structure length
97
Chain Sequence
GSHMSTLERVVYRPDINQGNYLTANDVSKIRVGMTQQQVAYALGTPLMSDPFGTNTWFYVFRQQPGHEGVTQQTLTLTFNSSGVLTNIDNKPALSGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small protein A
publication title Structural Characterization of Escherichia coli BamE, a Lipoprotein Component of the beta-Barrel Assembly Machinery Complex.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein binding
total genus 15
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04355 SmpA_OmlA SmpA / OmlA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1450.10 Alpha Beta 2-Layer Sandwich Beta-lactamase Inhibitory Protein; Chain:B, domain 1 Beta-lactamase Inhibitory Protein; Chain:B, domain 1 2kxxA01
1JTGB 3C7UB 3D4EA 3C7VB 2PXGA 1XXMC 3E2KC 2KXXA 5EKQE 3GMUB 3N4IB 2YH9A 5AYWE 2KM7A 5D0OE 3C4OB 5D0QE 1S0WC 3E2LC 4DM5A 2B5RC 3C4PB 2G2WB 2G2UB
chains in the Genus database with same CATH superfamily
1JTGB 3C7UB 3D4EA 3NW8A 3C7VB 2PXGA 3NWFA 3NWDA 1XXMC 3NWAA 3E2KC 4HSIA 2KXXA 5EKQE 2GUMA 3GMUB 4L1RA 3N4IB 2YH9A 5AYWE 2KM7A 5D0OE 3C4OB 5D0QE 1S0WC 3E2LC 4DM5A 2B5RC 3FVCA 3C4PB 2G2WB 2G2UB
chains in the Genus database with same CATH topology
1JTGB 3C7UB 3D4EA 3NW8A 3C7VB 2PXGA 3NWFA 3NWDA 1XXMC 3NWAA 3E2KC 4HSIA 2KXXA 5EKQE 2GUMA 3GMUB 4L1RA 3N4IB 2YH9A 5AYWE 2KM7A 5D0OE 3C4OB 5D0QE 1S0WC 3E2LC 4DM5A 2B5RC 3FVCA 3C4PB 2G2WB 2G2UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTG B;  3C7U B;  3D4E A;  3C7V B;  2PXG A;  1XXM C;  3E2K C;  2KXX A;  5EKQ E;  3GMU B;  3N4I B;  2YH9 A;  5AYW E;  2KM7 A;  5D0O E;  3C4O B;  5D0Q E;  1S0W C;  3E2L C;  4DM5 A;  2B5R C;  3C4P B;  2G2W B;  2G2U B; 
#chains in the Genus database with same CATH topology
 1JTG B;  3C7U B;  3D4E A;  3NW8 A;  3C7V B;  2PXG A;  3NWF A;  3NWD A;  1XXM C;  3NWA A;  3E2K C;  4HSI A;  2KXX A;  5EKQ E;  2GUM A;  3GMU B;  4L1R A;  3N4I B;  2YH9 A;  5AYW E;  2KM7 A;  5D0O E;  3C4O B;  5D0Q E;  1S0W C;  3E2L C;  4DM5 A;  2B5R C;  3FVC A;  3C4P B;  2G2W B;  2G2U B; 
#chains in the Genus database with same CATH homology
 1JTG B;  3C7U B;  3D4E A;  3NW8 A;  3C7V B;  2PXG A;  3NWF A;  3NWD A;  1XXM C;  3NWA A;  3E2K C;  4HSI A;  2KXX A;  5EKQ E;  2GUM A;  3GMU B;  4L1R A;  3N4I B;  2YH9 A;  5AYW E;  2KM7 A;  5D0O E;  3C4O B;  5D0Q E;  1S0W C;  3E2L C;  4DM5 A;  2B5R C;  3FVC A;  3C4P B;  2G2W B;  2G2U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...