2KXYA

Solution structure of sur18c from streptococcus thermophilus. northeast structural genomics consortium target sur18c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
100
structure length
100
Chain Sequence
KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQPSTVKVNLKVTQKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C
rcsb
source organism Streptococcus thermophilus
molecule tags Structural genomics, unknown function
total genus 10
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.40 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kxyA01
2KXYA
chains in the Genus database with same CATH superfamily
4C3HC 2JA7C 3PIOS 4BY7C 4OIRA 2Y0SD 4ZH4A 2WAQD 1Y1WC 5IP9C 3I4MC 4YG2A 3GTOC 2VUMC 4A3DC 2NVXC 3HOZC 4XLPA 5DM6S 4QIWD 4AYBD 3I4NC 4Y52C 4C3IC 3EQLA 3DXJA 4WFBS 2KQ1A 3RZDC 3CQZC 4BBRC 1R9TC 4C3JC 1TWAC 2WB1D 2BE5A 4MEXA 2NVTC 4OIOA 4MEYA 2L5NA 4G7OA 3HOXC 1I3QC 4WFNS 4G7ZA 4BY1C 3GTQC 4LLGA 4YFNA 3S1QC 1I6VA 4IOAS 4KMUA 2PPBA 3S17C 4A3LC 4LJZA 4A3JC 4WFAS 3M3YC 5C4JC 3S15C 1I6HC 5DM7S 2A68A 5C4XC 4A3MC 4X6AC 4BBSC 2KXYA 1FEUA 5TMFA 4Y7NC 3GTPC 4YFXA 5IYBC 2PMZD 5C44C 2NVQC 3S2HC 4Q4ZA 1SFOC 2A6EA 1ZYRA 4OINA 4A3CC 1HQMA 5IYDC 3S2DC 3S16C 1TWGC 4A3FC 3S14C 1WCMC 4LK1A 3LYWA 1SMYA 3H3VD 5D4DA 2A6HA 3M4OC 2O5JA 3K7AC 4XLNA 4A3EC 2A69A 4XSZA 3S1MC 2JA6C 2CW0A 4YFKA 4JK1A 4A3IC 5TMCA 4G7HA 2JA8C 3GTLC 1Y1VC 3CF5S 4IO9S 1YNJA 4A93C 5IP7C 2KPUA 4XSXA 2B63C 4WF9S 2NVYC 2R7ZC 4GZYA 2YU9C 3PO3C 4NOIA 1TWCC 4U67S 4OIQA 4A3KC 5JVHS 4QJVA 3DLLS 2ZJRS 3HOYC 5HL7S 3HKZD 4MQ9A 2E2JC 3GTKC 5FLMC 1TWFC 2R92C 3S1NC 1YNNA 2PA8D 3PIPS 3HOWC 3RZOC 4A3BC 3GTGC 4KN4A 2L3UA 4IOCS 3HOUC 1BDFA 4OIPA 4BXXC 1I50C 4KN7A 5JVGS 1TWHC 3GTMC 3PO2C 2ZJPS 4C2MC 4WCES 5HQHA 1K83C 4LK0A 3H0GC 2R93C 5IYCC 1IW7A 2E2IC 3FKIC 3S1RC 2E2HC 4Q5SA 3HOVC 2O5IA 3GTJC 2JA5C 2ZJQS 5C3EC 4A3GC 3WODA
chains in the Genus database with same CATH topology
2KQ1A 2KXYA 2KPUA 3LYWA 5HQHA 2L5NA 2L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXY A; 
#chains in the Genus database with same CATH topology
 4C3H C;  2JA7 C;  3PIO S;  4BY7 C;  4OIR A;  2Y0S D;  4ZH4 A;  2WAQ D;  1Y1W C;  5IP9 C;  3I4M C;  4YG2 A;  3GTO C;  2VUM C;  4A3D C;  2NVX C;  3HOZ C;  4XLP A;  5DM6 S;  4QIW D;  4AYB D;  3I4N C;  4Y52 C;  4C3I C;  3EQL A;  3DXJ A;  4WFB S;  2KQ1 A;  3RZD C;  3CQZ C;  4BBR C;  1R9T C;  4C3J C;  1TWA C;  2WB1 D;  2BE5 A;  4MEX A;  2NVT C;  4OIO A;  4MEY A;  2L5N A;  4G7O A;  3HOX C;  1I3Q C;  4WFN S;  4G7Z A;  4BY1 C;  3GTQ C;  4LLG A;  4YFN A;  3S1Q C;  1I6V A;  4IOA S;  4KMU A;  2PPB A;  3S17 C;  4A3L C;  4LJZ A;  4A3J C;  4WFA S;  3M3Y C;  5C4J C;  3S15 C;  1I6H C;  5DM7 S;  2A68 A;  5C4X C;  4A3M C;  4X6A C;  4BBS C;  2KXY A;  1FEU A;  5TMF A;  4Y7N C;  3GTP C;  4YFX A;  5IYB C;  2PMZ D;  5C44 C;  2NVQ C;  3S2H C;  4Q4Z A;  1SFO C;  2A6E A;  1ZYR A;  4OIN A;  4A3C C;  1HQM A;  5IYD C;  3S2D C;  3S16 C;  1TWG C;  4A3F C;  3S14 C;  1WCM C;  4LK1 A;  3LYW A;  1SMY A;  3H3V D;  5D4D A;  2A6H A;  3M4O C;  2O5J A;  3K7A C;  4XLN A;  4A3E C;  2A69 A;  4XSZ A;  3S1M C;  2JA6 C;  2CW0 A;  4YFK A;  4JK1 A;  4A3I C;  5TMC A;  4G7H A;  2JA8 C;  3GTL C;  1Y1V C;  3CF5 S;  4IO9 S;  1YNJ A;  4A93 C;  5IP7 C;  2KPU A;  4XSX A;  2B63 C;  4WF9 S;  2NVY C;  2R7Z C;  4GZY A;  2YU9 C;  3PO3 C;  4NOI A;  1TWC C;  4U67 S;  4OIQ A;  4A3K C;  5JVH S;  4QJV A;  3DLL S;  2ZJR S;  3HOY C;  5HL7 S;  3HKZ D;  4MQ9 A;  2E2J C;  3GTK C;  5FLM C;  1TWF C;  2R92 C;  3S1N C;  1YNN A;  2PA8 D;  3PIP S;  3HOW C;  3RZO C;  4A3B C;  3GTG C;  4KN4 A;  2L3U A;  4IOC S;  3HOU C;  1BDF A;  4OIP A;  4BXX C;  1I50 C;  4KN7 A;  5JVG S;  1TWH C;  3GTM C;  3PO2 C;  2ZJP S;  4C2M C;  4WCE S;  5HQH A;  1K83 C;  4LK0 A;  3H0G C;  2R93 C;  5IYC C;  1IW7 A;  2E2I C;  3FKI C;  3S1R C;  2E2H C;  4Q5S A;  3HOV C;  2O5I A;  3GTJ C;  2JA5 C;  2ZJQ S;  5C3E C;  4A3G C;  3WOD A; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  2KXY A;  2KPU A;  3LYW A;  5HQH A;  2L5N A;  2L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...