2KXYA

Solution structure of sur18c from streptococcus thermophilus. northeast structural genomics consortium target sur18c
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
100
structure length
100
Chain Sequence
b'KISLRKLSKSVPVKLELTGDKASNVSSISYSFDRGHVTIVGSQEAMDKIDSITVPVDISQVTEDTSKTLELKAEGVTVQPSTVKVNLKVTQKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution structure of SuR18C from Streptococcus thermophilus. Northeast Structural Genomics Consortium Target SuR18C
rcsb
source organism Streptococcus thermophilus
molecule tags Structural genomics, unknown function
total genus 10
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07949 YbbR YbbR-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.120.40 Mainly Beta Beta Complex RNA Polymerase Alpha Subunit; Chain A, domain 2 RNA Polymerase Alpha Subunit; Chain A, domain 2 2kxyA01
2KXYA
chains in the Genus database with same CATH superfamily
4OIQA 3LYWA 2ZJRS 4G7HA 4QIWD 2O5IA 3S15C 5IYBC 2KQ1A 4IOAS 4A3MC 3M4OC 2R93C 4A3FC 4XSZA 2KXYA 4A3KC 1R9TC 3S2HC 4A3CC 5D4DA 4U67S 3PIPS 2CW0A 1IW7A 3PIOS 4ZH4A 3GTGC 2WAQD 2E2IC 4GZYA 2BE5A 3HOUC 2A6EA 4LK1A 2VUMC 3GTPC 4Q4ZA 4MQ9A 4G7ZA 3HOXC 4A3IC 3PO3C 2PMZD 5TMFA 3GTJC 4WCES 3FKIC 4LK0A 1TWGC 3S1RC 1I6VA 4YG2A 3GTKC 1FEUA 4BBSC 5JVGS 4KN4A 5TMCA 3EQLA 3S1NC 4LJZA 2L5NA 1I50C 5JVHS 2JA5C 3S2DC 2E2JC 4LLGA 3RZDC 4WF9S 3S1QC 4YFNA 5DM6S 5HL7S 4YFXA 2YU9C 3WODA 4WFAS 5C44C 3DLLS 1K83C 1TWCC 2O5JA 3H0GC 3GTOC 3I4MC 4OIRA 4Y7NC 3HOWC 4NOIA 4Y52C 2NVQC 1YNJA 2NVYC 3PO2C 4Q5SA 2JA7C 4C3JC 4JK1A 4G7OA 2E2HC 3GTLC 1SMYA 4KN7A 4XSXA 3S17C 3I4NC 4A3JC 5C3EC 5DM7S 4BY1C 4BY7C 4IOCS 4WFNS 5IP7C 1Y1WC 2A69A 2L3UA 1TWFC 4YFKA 4C3HC 4A93C 2A68A 4QJVA 3S16C 4AYBD 4XLPA 1I3QC 2PA8D 3S1MC 4WFBS 4OINA 3GTMC 4MEXA 1TWHC 3RZOC 1BDFA 2WB1D 1ZYRA 1Y1VC 2R7ZC 4A3GC 2Y0SD 1SFOC 3M3YC 4A3DC 4MEYA 5FLMC 2JA8C 1TWAC 1HQMA 3CQZC 3HOVC 2NVXC 4BXXC 5C4XC 1YNNA 5C4JC 2JA6C 3K7AC 3GTQC 2NVTC 2KPUA 4KMUA 5IYDC 2ZJPS 4IO9S 2A6HA 4XLNA 4C2MC 3H3VD 4OIPA 4A3EC 3S14C 4X6AC 4BBRC 4A3BC 5HQHA 4OIOA 1WCMC 3DXJA 3HKZD 2R92C 2ZJQS 3HOYC 2PPBA 5IYCC 1I6HC 5IP9C 3HOZC 4A3LC 3CF5S 4C3IC 2B63C
chains in the Genus database with same CATH topology
2KQ1A 2L5NA 3LYWA 2KPUA 2KXYA 5HQHA 2L3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXY A; 
#chains in the Genus database with same CATH topology
 4OIQ A;  3LYW A;  2ZJR S;  4G7H A;  4QIW D;  2O5I A;  3S15 C;  5IYB C;  2KQ1 A;  4IOA S;  4A3M C;  3M4O C;  2R93 C;  4A3F C;  4XSZ A;  2KXY A;  4A3K C;  1R9T C;  3S2H C;  4A3C C;  5D4D A;  4U67 S;  3PIP S;  2CW0 A;  1IW7 A;  3PIO S;  4ZH4 A;  3GTG C;  2WAQ D;  2E2I C;  4GZY A;  2BE5 A;  3HOU C;  2A6E A;  4LK1 A;  2VUM C;  3GTP C;  4Q4Z A;  4MQ9 A;  4G7Z A;  3HOX C;  4A3I C;  3PO3 C;  2PMZ D;  5TMF A;  3GTJ C;  4WCE S;  3FKI C;  4LK0 A;  1TWG C;  3S1R C;  1I6V A;  4YG2 A;  3GTK C;  1FEU A;  4BBS C;  5JVG S;  4KN4 A;  5TMC A;  3EQL A;  3S1N C;  4LJZ A;  2L5N A;  1I50 C;  5JVH S;  2JA5 C;  3S2D C;  2E2J C;  4LLG A;  3RZD C;  4WF9 S;  3S1Q C;  4YFN A;  5DM6 S;  5HL7 S;  4YFX A;  2YU9 C;  3WOD A;  4WFA S;  5C44 C;  3DLL S;  1K83 C;  1TWC C;  2O5J A;  3H0G C;  3GTO C;  3I4M C;  4OIR A;  4Y7N C;  3HOW C;  4NOI A;  4Y52 C;  2NVQ C;  1YNJ A;  2NVY C;  3PO2 C;  4Q5S A;  2JA7 C;  4C3J C;  4JK1 A;  4G7O A;  2E2H C;  3GTL C;  1SMY A;  4KN7 A;  4XSX A;  3S17 C;  3I4N C;  4A3J C;  5C3E C;  5DM7 S;  4BY1 C;  4BY7 C;  4IOC S;  4WFN S;  5IP7 C;  1Y1W C;  2A69 A;  2L3U A;  1TWF C;  4YFK A;  4C3H C;  4A93 C;  2A68 A;  4QJV A;  3S16 C;  4AYB D;  4XLP A;  1I3Q C;  2PA8 D;  3S1M C;  4WFB S;  4OIN A;  3GTM C;  4MEX A;  1TWH C;  3RZO C;  1BDF A;  2WB1 D;  1ZYR A;  1Y1V C;  2R7Z C;  4A3G C;  2Y0S D;  1SFO C;  3M3Y C;  4A3D C;  4MEY A;  5FLM C;  2JA8 C;  1TWA C;  1HQM A;  3CQZ C;  3HOV C;  2NVX C;  4BXX C;  5C4X C;  1YNN A;  5C4J C;  2JA6 C;  3K7A C;  3GTQ C;  2NVT C;  2KPU A;  4KMU A;  5IYD C;  2ZJP S;  4IO9 S;  2A6H A;  4XLN A;  4C2M C;  3H3V D;  4OIP A;  4A3E C;  3S14 C;  4X6A C;  4BBR C;  4A3B C;  5HQH A;  4OIO A;  1WCM C;  3DXJ A;  3HKZ D;  2R92 C;  2ZJQ S;  3HOY C;  2PPB A;  5IYC C;  1I6H C;  5IP9 C;  3HOZ C;  4A3L C;  3CF5 S;  4C3I C;  2B63 C; 
#chains in the Genus database with same CATH homology
 2KQ1 A;  2L5N A;  3LYW A;  2KPU A;  2KXY A;  5HQH A;  2L3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...