2KY4A

Solution nmr structure of the pbs linker domain of phycobilisome linker polypeptide from anabaena sp. northeast structural genomics consortium target nsr123e
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
149
structure length
149
Chain Sequence
MKVFKRVAGIKDKAAIKTLISAAYRQIFERDIAPYIAQNEFSGWESKLGNGEITVKEFIEGLGYSNLYLKEFYTPYPNTKVIELGTKHFLGRAPIDQAEIRKYNQILATQGIRAFINALVNSQEYNEVFGEDTVPYRRFPTLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phycobilisome linker polypeptide
publication title Solution NMR structure of the PBS linker domain of phycobilisome linker polypeptide from Anabaena sp. Northeast Structural Genomics Consortium Target NsR123E
rcsb
source organism Nostoc sp.
molecule tags Photosynthesis
total genus 42
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00427 PBS_linker_poly Phycobilisome Linker polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.20 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 2ky4A01
3OHWA 3NPHB 2L06A 3PRUA 2L3WA 2KY4A 3OSJA 2L8VA
chains in the Genus database with same CATH superfamily
2L06A 4N6BA 4H7OA 3MC4A 4N69A 3F1XA 1SSMA 4N6AA 3GVDA 3PRUA 2KY4A 4HZCA 2L8VA 3OHWA 3P47A 3Q1XA 3NPHB 4HZDA 1T3DA 3P1BA 3OSJA 1SSQA 2L3WA 1S80A 1SSTA
chains in the Genus database with same CATH topology
2L06A 4N6BA 4H7OA 3MC4A 4N69A 3F1XA 1SSMA 4N6AA 3GVDA 3PRUA 2KY4A 4HZCA 2L8VA 3OHWA 3P47A 3Q1XA 3NPHB 4HZDA 1T3DA 3P1BA 3OSJA 1SSQA 2L3WA 1S80A 1SSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHW A;  3NPH B;  2L06 A;  3PRU A;  2L3W A;  2KY4 A;  3OSJ A;  2L8V A; 
#chains in the Genus database with same CATH topology
 2L06 A;  4N6B A;  4H7O A;  3MC4 A;  4N69 A;  3F1X A;  1SSM A;  4N6A A;  3GVD A;  3PRU A;  2KY4 A;  4HZC A;  2L8V A;  3OHW A;  3P47 A;  3Q1X A;  3NPH B;  4HZD A;  1T3D A;  3P1B A;  3OSJ A;  1SSQ A;  2L3W A;  1S80 A;  1SST A; 
#chains in the Genus database with same CATH homology
 2L06 A;  4N6B A;  4H7O A;  3MC4 A;  4N69 A;  3F1X A;  1SSM A;  4N6A A;  3GVD A;  3PRU A;  2KY4 A;  4HZC A;  2L8V A;  3OHW A;  3P47 A;  3Q1X A;  3NPH B;  4HZD A;  1T3D A;  3P1B A;  3OSJ A;  1SSQ A;  2L3W A;  1S80 A;  1SST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...