2KYBA

Solution structure of cpr82g from clostridium perfringens. north east structural genomics consortium target cpr82g
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
60
structure length
60
Chain Sequence
MKTGIVNVSSSLNVRSSASTSSKVIGSLSGNTKVTIVGEEGAFYKIEYKGSHGYVAKEYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase doma
publication title Solution Structure of CpR82G
rcsb
source organism Clostridium perfringens
molecule tags Toxin
total genus 2
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kybA00
1KFZA 2LMJA 2OJ2A 2JXBA 1SHFA 1UHCA 1VYUA 2EYWA 1AZGB 3EG0A 2DL4A 1H3HA 1B07A 4LUDA 2DNUA 2EPDA 3VS3A 1Z9QA 2L3QA 1X2QA 2A36A 4LNPA 3VS7A 1GL5A 2JT4A 4K11A 2RF0A 1M27C 3PE0A 1NEGA 2EYZA 2EYXA 4F14A 1W1FA 1PRMC 2O9VA 2J6KA 4IIMA 4AG2C 4CC2A 1T3LA 4LN2A 2ROLA 3H0FA 1HD3A 1H8KA 2G6FX 3M0UA 4J9BA 2W0ZA 1QKXA 1HJDA 2A37A 1PKSA 2O9SA 2EGEA 4JJDA 1WLPB 2LJ0A 4Z8AA 2JW4A 1UJ0A 1V1CA 3I5SA 4JZ3A 1GFCA 2CT3A 3I35A 1J3TA 2HEQA 4Y92A 2DMOA 3O5ZA 1SHGA 1WX6A 1ZUKA 2M51A 2CSQA 1WYXA 5I22A 2ED1A 1NG2A 2FRWA 2RQUA 1NYGA 4ORZA 2DL7A 4J9FA 1ZSGA 1TG0A 5EC7A 3PVLA 1E6GA 2FRYA 2YUPA 2J05A 1ZUYA 2OI3A 1VA7A 2AZSA 2K9GA 1WXUA 2KE9A 1AVZC 2DF6A 5IHKA 2DL3A 4GLMA 1ARKA 3NHNA 1OV3A 4WCIA 3M0SA 1GCPA 3M0TA 3EG3A 4OMLA 3CQTA 1TUCA 2EVRA 2AZVA 2JMCA 3VS0A 2SEMA 1X2KA 5IXFA 2PNIA 1K76A 3UA6A 2K79A 4D8KA 3REAB 1MUZA 2FEIA 2F2VA 1I07A 1B3QA 2OAWA 2CH4W 1UE9A 5L23A 2BZXA 2DE0X 2EGCA 2E5KA 4HVVA 2A28A 2CH4A 1JO8A 1CKAA 2X3WD 2GQIA 1U3OA 2GBQA 2X3XD 4CC4B 2LQWA 4OMQA 2RPNA 2YSQA 2FPFA 2DL5A 4OMMA 2PZ1A 2VKNA 2KROA 1X69A 2J6OA 4D8DA 5FWBA 4R0KA 2M0YA 1X6BA 2DRKA 1BBZA 2D0NA 3EGUA 5IHIA 2HDAA 4A63B 1UUEA 2F2WA 1AEYA 1RUWA 3PVQA 1NLPC 1SSHA 1QWFA 4J9HA 1GCQC 4RTWA 2GTOA 2FO0A 4HVUA 2I0NA 2KEAA 2KYBA 1GCQA 1M3AA 2CT4A 2KRMA 2GGRA 2DJQA 4J9DA 4RTXA 4J9IA 1WI7A 2DLPA 3I9QA 2LJ3A 1RLQC 3GBQA 3I5RA 2O2OA 1MV3A 1XOVA 2EBPA 2K6DA 1JXOA 1G2BA 1E7OA 4Z89A 2CUBA 1RLPC 2MIOA 4F17A 3C0CA 1ZBJA 1YWOA 1N5ZA 1SRLA 1YN8A 2DM1A 2LZ6B 1A0NB 2DRMA 1QKWA 4OMNA 1NYFA 1WDXA 3NPFA 4E6RA 1ZLMA 3A98A 1AWWA 1KJWA 1G83A 3QWYA 1AWOA 1BK2A 4RUGA 1AOJA 1IO6A 2MOXA 2C0TA 2LX7A 2D8JA 1Y0MA 1S1NA 1OPLA 2ENMA 2DBMA 2ECZA 4OMOA 1GBRA 2DILA 2EKHA 1VYVA 2O31A 4M4ZA 1KIKA 1AD5A 1BU1A 2BZYA 2XMFA 2KXDA 2BZ8A 5IXBA 2B86A 4F16A 3EG2A 1NM7A 5FW9A 1WXTA 2DVJA 1UHFA 5GJWB 2V1QA 2V1RA 4RTUA 1FMKA 4OMPA 3M0QA 1M3BA 1SEMA 1CKBA 2YT6A 1OPKA 1MV0B 1AZEA 4AFQC 1GRIA 4RTTA 4JZ4A 4AFUC 2FPEA 4CC7A 1E6HA 1X6GA 2IIMA 2JS2A 1I1JA 1GFDA 3VS1A 4KRTA 3TSZA 1EFNA 1OEBA 3REBB 1TUDA 2VVKA 2LJ1A 4FSSA 2YUOA 1M3CA 2D8HA 2PTKA 2J06A 1YP5A 5IHNA 1QCFA 1UFFA 2L2PA 2RQVA 5ECAA 2A08A 2CREA 1UDLA 4EIKA 2AKLA 1T0JA 3M0PA 3IQLA 4DEXA 4LUEA 2J7IA 2GNCA 2KBTA 3LH5A 1ZX6A 2BTTA 3SHWA 1HSQA 1JQQA 2JTEA 3TSWA 1X27A 2K3BA 2LCSA 3U23A 1VYTA 2KT1A 2GTJA 1GBQA 2KRNA 4AFZC 1UECA 2ROTA 1U5SA 3R6NA 1ABOA 1PKTA 2KR3A 2EYYA 1K4US 3JV3A 1ZUUA 1WXBA 2LP5A 4Z88A 2K7AA 2RNAA 1T3SA 4ESRA 3EG1A 2HBWA 2DL8A 2C0IA 1BB9A 1UGVA 2W10A 4J9GA 2HCKA 1YCSB 2KRSA 1UTIA 1X43A 4J9EA 3KFVA 1YNZA 4CC3A 1PWTA 1RI9A 2NUZA 4RTZA 3SEMA 5IH2A 4RTVA 3TVTA 2KT8A 5I11A 1CSKA 2DYBA 1JXMA 1PRLC 2MCNA 3VS4A 3VS2A 2YUNA 5FWCA 2QDLA 2AKKA 3EHRA 1OOTA 5GJVB 1NLOC 1W6XA 3H41A 3VRYA 2JM8A 1M30A 2YUQA 3QWXX 1H92A 3H0IA 2JM9A 2RMOA 1WA7A 1UG1A 4AG1C 1JEGA 1AWJA 3VRZA 3M0RA 2YDLA 1SRMA 1K0XA 1SPKA 2ESWA 4QT7A 4X1VA 2H8HA 2DA9A 3NGPA 2C0OA 4HCKA 2CUDA 4AFSC 1T0HA 4HVWA 1PNJA 3VS6A 3VS5A 2EW3A 2K2MA 2D1XA 2HSPA 1K9AA 2DBKA 1WFWA 5HCKA 2ABLA 4GBQA 1PHTA 2SRCA 3UA7A 1QLYA 4JJCA 4HXJA 1I0CA 3EHQA 1U06A 1LCKA 2VWFA 3NMZC 2JS0A 1Z9ZA 2KGTA 3UATA 4JPBW 1Y57A 2L3SA 2P4RA 2O88A 4IIOA 1K1ZA 3THKA 2EGAA 1JU5C 1AWXA 1NEBA 2KNBB 2DX1A 1WIEA 2RQTA 2RQWA 3ULRB 3UF4A 1ABQA 3RNJA 2AK5A 4J9CA 2LNHB 2ED0A 2CDTA 2L0AA 2F2XA 2NWMA 3ZL7C 2FG0A 1KSWA 1QWEA 1M8MA 1FYNA 1YWPA 2RQRA 4DEYA 2RN8A 2FPDA 2EQIA 2LQNA 3RBBB 1K0SA 2L3PA 1W70A 4JJBA 2KYMA 2CSIA 3FJ5A 3H0HA 4RTYA 4ZNXA 2J6FA 4LE9A 2JMAA 2KXCA 1UJYA
chains in the Genus database with same CATH superfamily
5FLXE 1K9MC 3CCMQ 1VQ7T 3LGFA 1WQWA 4A4HA 1H3HA 1VQPA 3HKSA 2GQVA 4M75A 2RHZA 1K73C 1WPYA 4LUDA 2EPDA 5GAMe 2DZ9A 5GAN6 1GL5A 5GMKm 3ZFJA 4K11A 1VQNA 1M27C 1UGRB 2CP2A 3EFOB 3JB9D 2H3JA 5GANd 1OX8A 2EYZA 2QQRA 1PRMC 1Q82U 1I8FA 2EYQA 4FU6A 4M7AA 1LOJA 1ZSZB 2G6FX 4DOVA 4J9BA 3PFSA 1QKXA 4WF2A 3SFMA 3NTIA 2A37A 2JVVA 3QIIA 3I56Q 4NS5A 1LPLA 2VV5A 5D6XA 4HT8A 3CD6Q 3BFMA 4DBRA 5KYYB 3S3MA 1UJ0A 3P8BB 4A54A 1V1CA 2JZ2A 4KH1B 2P4TA 3WXMB 2HEQA 4E7HA 3O5ZA 1WX6A 4LDUA 3SWNA 4Z02A 2KI7A 5LJ3j 2X51A 2FRWA 2QQBA 5EC7A 2DTHA 2LDMA 4M78C 5CKDA 1ZUYA 3A8OB 5D7UA 5KCHA 1AVZC 2DF6A 8ATCB 3PIOA 4C92A 4WCIA 3L2QA 1YJ9A 4QVZA 3BW1A 1Y7XA 4CRIA 4PL6A 3EG3A 5CKBA 3CQTA 3QJ6A 1TUCA 1IGUA 3F70A 1IB8A 3M57A 3QBYA 3OMGA 1OZ3A 4D8KA 3JAME 1VQ6A 2JUFA 4C0GA 3CC7T 4XTWA 1D09B 2DVEA 2EQJA 2XHCA 1B3QA 2OAWA 1MNDA 1P92A 2YRCA 2M16A 4HVVA 1RI0A 2CH4A 2DPPB 1JO8A 3OA6A 1OX9A 1U3OA 1VQ7A 2E3HA 1FXXA 2LQWA 1XTDA 4ELYC 5GAMd 3C4SA 4N4IA 4F04B 4IUUA 4OMMA 3EFSA 4OB1B 4ZTJA 3G71T 2J6OA 5FWBA 2DIQA 4C0FA 2M0YA 3G4ST 2DRKA 1BBZA 5IHIA 3RUXA 3OYHA 2QA4T 5KYWB 3QDFA 3CBPA 3PVQA 2DEQA 3BE3A 1RAAB 2DAQA 2HMAA 2MK5A 2R58A 4EMKB 1GCQC 4JUVA 1M1KC 2HD0A 4UC4A 1M3AA 4HT9A 3X28B 5GAN7 2E41A 2Y4YA 4J8OA 1XOVA 2EBPA 1KQSP 3OW2A 1NJIU 3FDRA 2DXUA 4O5VA 4C0DB 4Z89A 2CUBA 3JCMb 1ZBJA 1YWOA 2KAFA 2DM1A 2RD1A 2DRMA 2QEXT 3JCMc 3G6EQ 3JB9F 1WHHA 1TXQA 1WJSA 2MMPA 3A98A 3CCEQ 1G83A 3VUBA 1IO6A 2IVWA 4FYXB 1Y0MA 1OPLA 2RHXA 1QCNA 2O31A 1ZSZA 5AT1B 5J3BA 1NJIR 2XG8D 3OYNA 1NM7A 4M77D 5FU7B 2V1QA 4RTUA 1FMKA 3A8HB 3M0QA 2CZ7B 1SEMA 2X35A 2YT6A 1BIAA 4J6XA 2E1HA 1OPKA 5KYYA 3JB9G 4AFQC 3OS1A 3CC7A 2PUOB 4JZ4A 2DIGA 1TTHB 2JS2A 3HRSA 1I1JA 4LXCA 3OYAA 3CCMT 4KRTA 5KE2A 1OEBA 2V8JA 2VVKA 1BI1A 4C8QC 3PNWC 4II1A 1M3CA 1VQ4Q 3BDLA 1QVGS 2LT4A 2FZGB 2L2PA 2RQVA 3A8GB 3OYDA 3CXCA 2CREA 1UDLA 1KQSS 1KG1A 3M0PA 1XNIA 3G71A 2VB6A 4LUEA 4OGCA 3JCMg 2RI5A 1KD1R 2PUKB 3ME9A 1JQQA 3TSWA 1VQLA 3L42A 1X27A 3RESA 3X25B 1VQOQ 3G4SA 4ZN1A 2RM4A 4FIBA 1D1AA 1ZA1B 2KT1A 2EWNA 2MF2A 3QYHB 2QA4A 3INZA 4N0AA 1UECA 2B8AA 3M59A 4QQDA 3I56T 3R6NA 1YJNT 2CZ0B 3CD6T 2RI3A 1G3YA 4DOWA 1ZUUA 1WXBA 4Z88A 1VQKQ 2K7AA 3EG1A 2HBWA 1Q95G 1KC8R 1VQ7Q 5LJ3f 4IUVA 1AT1B 1BCOA 2H3EB 2HCKA 3SDZA 1X43A 4XTVA 1WHMA 1C0MA 3UT1A 3HRUA 4E47A 1ZA2B 4J6YA 4R56A 1CSKA 2DYBA 4FYWB 1RL2A 3DKMA 1TSFA 2YUNA 4BUGA 4BB7A 1OOTA 1XQHA 2QEXA 1EZZB 1OU9A 4FM4B 2YUQA 2D6FA 3MEWA 2PVGB 2JM9A 1PM3A 1UG1A 1AWJA 1M5Q1 1I4K1 3EH1A 4LDYA 1HK9A 2EJGA 1SPKA 4QQGA 4J7IA 4AFSC 5FROA 3VS6A 4EMKA 1VQKT 2LRQA 2P0PA 2ZZDA 1K9AA 3SD4A 1Q81C 1RAHB 5LJ5j 1VQ9Q 2ZPHB 4JJCA 1I0CA 2BKDN 2CP0A 3OYLA 1LCKA 1YITQ 2VWFA 1B34B 2KGTA 3I55T 2CYZB 2P4RA 3CCMA 3QZ9B 3DB3A 2XD0A 2LCCA 1AWXA 1MMAA 5FU6B 3EH2A 2ZPBB 1ABQA 3RNJA 2AK5A 4C5EA 1PD1A 2ED0A 2CDTA 2L0AA 4QW2A 1I81A 1KSWA 2K3XA 2E70A 2RK2A 1M8MA 4KULA 1NPRA 3P8DA 1IRXA 2RN8A 3EGDA 2EQIA 3M4GA 3OYIA 2LQKA 2A3LA 1K0SA 4JDSA 3QZ5B 4JJBA 2KYMA 2CSIA 3H0HA 1D3BB 4M78D 4M77F 4RTYA 3FC3A 4LE9A 4DBQA 2KSSA 1MMNA 1U06A 5GMKe 3JCMP 1SHFA 3I56A 1YJNA 3CD6A 4M75C 3QSUA 4M77B 2XI9A 5GANj 3EG9B 1B07A 1U1TA 4XU2A 2VGMA 1M4ZA 2D9TA 5CAIA 3VJPA 1MNEA 2KVQG 2A36A 4E7SA 3HPWA 4KH0B 1KD1C 4LD9K 1PSEA 2JT4A 3OYEA 3PE0A 1JBMA 1AHJB 1NEGA 1PSFA 3CCRQ 4F14A 4M77G 5GAN2 5A0DA 5J26A 2J6KA 3M54A 4LN2A 2LNVA 1OULA 2ROLA 3H0FA 3G6ET 2FZKB 2W0ZA 5J39A 1HJDA 3CCET 1PKSA 4OGEA 2PQWA 2QA4Q 1KC8C 4Z8AA 2JW4A 2VUBA 4JRKA 3MP8A 4JRPA 1GFCA 1KQ1A 3JCMh 5CVIA 3I35A 1J3TA 5CO7A 1VQMQ 3MJXA 2ZPEB 4Y92A 2DMOA 1IZ6A 3JCMQ 4TVRA 4M7DE 1ZUKA 1KQ2A 2XK0A 2CSQA 3WVDB 1WYXA 4EPCA 2X9HA 4A4GA 2ED1A 4JRQA 2RQUA 1FMWA 1RAIB 4MZTA 2P0QA 4J9FA 1ZSGA 2P84A 4HCCA 4PJOF 5GAOm 1E6GA 2EIFA 1VA7A 1VQ4T 5D6YA 4DA4A 1RAFB 2X4XA 1ARKA 3NHNA 2WSFE 4XTUA 5LJ5d 4PJOB 3TEEA 3QKJA 2JN0A 4KT0E 4OMLA 1LVKA 4AT1B 2G3RA 3E19A 3VS0A 3CPFA 3FB9A 5IXFA 2WSCE 4M7DA 4J5YA 1VQOT 1TWBA 1UEBA 4PJOG 2M0OA 2RHIA 4E7LA 1DJ7B 2HNIA 5GAMj 4M7AE 2DFUA 3V7CA 3OMCA 9ATCB 2A28A 5CQXA 1HXDA 2X3WD 1PC0A 1K8AC 3HRTA 1BIBA 4OMQA 2RPNA 1Q86U 2YSQA 2MPXC 4IUTA 2VKNA 2QASA 4D8DA 3JCMJ 4Y91A 5IAYA 2YRDA 4R0KA 4JLIA 2AIRB 4BDZA 3WVEB 1X6BA 3CBMA 1M90C 1QQJA 5GAOn 2F2WA 1M2OA 1AEYA 1QVFP 2QK0A 4C8QD 3G6EA 3QO3A 1NLPC 3T9NA 5C6SA 1SSHA 1QWFA 3CCEA 1YHQQ 3DLMA 2QDYB 1Q86R 2DTIA 4ZN3A 2KYBA 4M78F 1M2VB 1YJNQ 2GGRA 4VUBA 2ATCB 4E7IA 2E12A 1D3BA 5LJ5f 4C92E 2LJ3A 1RLQC 2XU8A 1FWZA 3V8JA 4M78B 2OTLT 1D0YA 1RLPC 4X34A 2LVMA 2MWPA 4JLGA 3O8VA 1VQ9T 3C0CA 3AT1B 2JJ9A 5GAN4 3E9FA 1YJWT 1Q82R 2LZ6B 4WTOB 1YITT 1SG5A 1VIEA 1IXDA 1WDXA 1KQSA 4PJLA 4M78G 1ZLMA 1Q7YC 5HKCA 3QWYA 2NUPA 2MOXA 2C0TA 1VQ4A 2ENMA 1HYOA 1QP3A 2M9UA 2CGHA 3V8LA 2DILA 4M4ZA 1AD5A 1YIJQ 2BZYA 2RB6A 2E10A 1JRIA 3G1JA 3FLGA 1M1FA 3PTAA 5GJWB 3MCAB 3OBYA 1M3BA 3NFCA 3VV0A 2F5TX 1MV0B 4FW2A 3QYGB 1VQOA 5GANf 2ZPGB 1QVFS 2V8KA 4AFUC 2FPEA 1UGPB 3OB9A 3OS5A 1E6HA 2IIMA 3JB9J 3CMAT 1GFDA 3VS1A 2FHDA 4PKCC 3CEYA 2E6NA 5LL6S 3REBB 1X01A 1TUDA 2M1HA 5KCOA 2YUOA 2OTJQ 2JNGA 1VQKA 3I55Q 2D8HA 2L89A 2GFUA 3V7SA 2DD5A 1KHCA 3A8MB 2A08A 4D6WA 3BY7A 3LWIA 3CCRT 3PGGA 2BTTA 2RJCA 5FRMA 4BI4A 3NTHA 4AMCA 2JTEA 5CK9A 3GIBA 4N0AC 2FYKA 4PLLA 4AFZC 1U5SA 2DTOA 1ABOA 2KR3A 4MDXA 4XU0A 1T3SA 1BB9A 1VQMT 2W10A 2KRSA 1YCSB 1LJOA 4OF1A 1QVGP 2DD4A 2EJ9A 1MGQA 2GCXA 5HY6A 2OTLA 1PWTA 1Q81U 5IH2A 3CCVQ 2Z0WA 4RTVA 3ASKA 1VOMA 3OYKA 4MZPA 2KT8A 3JRZA 5EG2A 1VQ9A 1JXMA 3X24B 3NTKA 1YJWA 2L8DA 2X4WA 2AKKA 4M75D 3EHRA 5GJVB 3KUFA 1YITA 1ACMB 1M30A 3OYCA 3H0IA 1WA7A 5CIUA 5DY9A 4BY6C 3EFOA 2NUTB 4C8QF 4X1VA 4QT7A 3R6OA 3S3OA 2C0OA 2XDDA 4M7AD 1M9SA 2CUDA 2EQKA 5GAMf 4HVWA 1EIFA 2K2MA 3HL8A 2D1XA 1IREB 4C8QB 2DBKA 1WFWA 5HCKA 2ABLA 2YLCA 2SRCA 3UA7A 3FEOA 1QMCA 1U1SA 1M2VA 1BI0A 1TS9A 5LJ3h 2QGGA 5KYUB 3TCJA 2JS0A 1Z9ZA 4XTZA 1Y57A 3FJPA 4IIOA 3CMAA 1K1ZA 2VGNA 1NEBA 4C8QG 2KNBB 2VASA 1QVPA 2DX1A 3L1AA 2BE9B 3UF4A 4EDUA 2LNHB 3V8KA 1O75A 3FRNA 2F2XA 2E64A 5DLOA 1JJ2S 2DK3A 1X6OA 2K57A 1YWPA 3CCRA 4DEYA 3M53A 1YFNA 2L3PA 3FJ5A 4C5IA 3OS0A 2JMAA 2A0FB 4C92D 4PK4A 1EX4A 1KFZA 3H6ZA 4DBFA 2LMJA 1YHQT 2JXBA 2MYSA 2RJDA 2V8IA 3VYHB 1VYUA 1YCYA 2EYWA 3EG0A 2DL4A 3EGXB 5CR2A 1V29B 1OU8A 3TREA 2ZCFB 4BE0A 2DNUA 3VS3A 1O9SA 1Z9QA 1X2QA 2L3QA 3KXTA 2FL7A 4LNPA 1VQMA 6AT1B 2RF0A 3C12A 3CCUQ 2FZCB 3MP1A 4JRIA 1V76A 2EYXA 1W1FA 5GAOp 2QQ9A 2O9VA 2HL3A 3VYGA 4CC2A 4C5GA 4F7UF 1H8KA 3M0UA 1N8RU 3KBGA 2MI6A 2O9SA 3JCMV 4QKUA 4F7UB 2GF7A 3RMSA 1YIJT 2V26A 2QGFB 3HSBA 3HP9A 3I5SA 4JZ3A 1WJRA 2BUDA 2K5LA 3QHSA 4JS4A 2XDPA 3HFOA 2K5IA 1N27A 5KYWA 1SHGA 4IUPA 1N9RA 2R57A 4F7UG 2M51A 1W2BP 3C95A 3JCMe 1VUBA 5IT9E 1D0ZA 2OTLQ 4BACA 3HTRA 2M02A 2XKOC 4OB3B 5I22A 2DZCA 1N8RR 1TOVA 2DL7A 3E9GA 3V7RA 1YJWQ 1TG0A 3EAEA 1SF9A 1R8OB 2DEUA 2FRYA 3M55A 2EJFA 2OTJT 1K9MU 2K9GA 2AZSA 3M5AA 4XQ3A 4ZGDB 1WXUA 2KE9A 2WACA 4MZMA 2DL3A 1H641 4M75F 2BE7D 3CPWP 4HCBA 1WQ7A 1K73U 4E7JA 3M0TA 1NJIC 4M7DC 2AZVA 2YLBA 2RH2A 5GMKj 2SEMA 1X2KA 4M75B 3OY9A 3GPLA 2MWOA 2K79A 2OAUA 4C0ZA 3REAB 2E65A 3OW2S 4BE1A 4P5NA 2E3IA 4M7AF 4LDXA 2FEIA 2EAYA 2QQSA 2F2VA 5D6WA 2DXTA 5L8RE 2YWWA 1UE9A 3PMIA 2IG0A 5L23A 4A4KA 2EGCA 2E5KA 4Q5WA 1BI3A 2L5QA 4M75G 1YHQA 2QQAA 2GQIA 2GBQA 1VQ5Q 3MEAA 1WHKA 3CMAQ 4B9XA 1K73R 3Q1JA 1WNLA 1ZBXA 2COZA 2DL5A 1X69A 1GXIE 2RI2A 1W2BS 1D1CA 4YTLA 3CCVT 5M9OA 3JCMW 2D0QB 5CCAA 3L2UA 3CCLQ 2D0NA 4FCYA 3EGUA 3L2VA 4A63B 4M7AC 4KGVB 3N5BB 1YI2Q 4QVCA 1NBEB 4J9HA 3H9NA 1VQ8Q 4RTWA 2GTOA 3PT9A 2O01E 2F1LA 2R5MA 4HVUA 2I0NA 2YHTA 5C0MA 2CT4A 3CPWS 4C92F 1TH7A 4J9DA 3CMET 1YIJA 1WI7A 3OS2A 2DERA 2DLPA 4B6MA 3I5RA 1QVFA 2O2OA 3ER0A 1JXOA 1G2BA 3CXCS 3RIRA 3SWNC 2MIOA 3JCMd 4F17A 3EGXA 1G3SA 1N5ZA 2LT1A 1YN8A 4PJNA 1A0NB 3MKDA 1WHJA 1QKWA 3CC2Q 2E5QA 1NYFA 4N4HA 2DYIA 3NPFA 1RAEB 5CKHA 1G5VA 1BK2A 5KE3A 4BDYA 1AOJA 2OTJA 1Y07A 4KGZB 2D8JA 3I55A 5GAMg 2DBMA 4OMOA 4L59A 1GBRA 3OYYA 3CCQQ 1VYVA 4C92C 2KXDA 3MHXA 4F16A 2QG9B 3EG2A 5CKEA 5FW9A 1WXTA 2DVJA 1UHFA 5HK3A 4OB2B 2HQHA 4OMPA 1CKBA 1RAGB 5I21A 5GAOq 1AZEA 1GRIA 2K3YA 5LJ5h 4IUQA 2DXCA 3TSZA 1EFNA 4C5HA 4MMKA 2LJ1A 2K2VA 3META 3UPUA 2PTKA 1QP2A 1YP5A 1M1KU 4PJMA 5IHNA 2QTVA 1ZQ1A 5IN1A 2NYSA 4EIKA 1T0JA 3CCUT 4DEXA 8AT1B 2J7IA 2GNCA 2KBTA 4KGXB 1UGQB 3LH5A 1R77A 2HKNA 3CBOA 1B34A 4IURA 3SHWA 5GMKl 3CCVA 3H8ZA 5GAN3 2K3BA 1YBYA 2L3RA 2LC4A 4M77E 3U23A 2HQXA 2GTJA 1PD0A 3OYFA 2COYA 2RJEA 2ROTA 4BE2A 2IPOB 1PKTA 2EYYA 1M1KR 2AT1B 2YXYA 2LP5A 5LJ3g 2O4XB 4MMLA 4DQ2A 3QJYA 5GANh 2DL8A 3LX7A 3X26B 1U8RA 2JTFA 3CMEA 3J7AF 4J9GA 1S72Q 1UTIA 3KFVA 1IHWA 2JTMA 1YNZA 1WJQA 3UWNA 2QXFA 3HHTB 3CCSQ 4OP0A 5I11A 3SB2A 3L2WA 3VS4A 4M77A 3VS2A 3JSCA 3EG9A 5FWCA 2QDLA 1WHLA 4FSXA 3LW5E 1QVGA 2E4HA 2VXFA 3H41A 2JM8A 3M58A 5CKFA 3QWXX 1JJ2A 1WZOA 2RMOA 1G3TA 3RR6A 3G7ZA 4E2FB 3VRZA 1SRMA 4IKFA 1K0XA 1Y96B 1F1BB 1UGSB 2ESWA 5KH6A 1ZSZC 1QW1A 2DA9A 3DB4A 3RERA 4HCKA 3RMQA 1T0HA 2A7YA 1PNJA 4ELZC 2EW3A 1FMVA 3L2RA 2ZGWA 4RCBA 1QLYA 1FX7A 4HXJA 2HQEA 4N4GA 4PJOE 3UATA 2L3SA 2O88A 1VQ5T 1M1GA 4XTYA 3MP6A 5LJ3e 4RCCA 2OX7A 2K4YA 3ULRB 3RKWA 4J9CA 5GAOr 2Y4XA 3EFRA 4BD3A 2NWMA 2VXEA 3CCUA 3CCLT 1BI2A 4XU1A 2RQRA 4ZGEB 3RBBB 1TUGB 1W70A 2Y90A 2WSEE 3RKXA 4ZNXA 1YI2T 2CZ6B 2KQWA 2RHYA 2ZPFB 3M4YA 3CC4T 2LQ8A 2OJ2A 1VQ8T 4PJOA 5GAMh 4BI3A 1UHCA 1VIFA 3QDRB 4XK8E 1AZGB 3GOXA 1SKUB 5KYXB 4M7DD 4PJJA 2EQMA 3GLXA 3JCMX 3E1SA 4KBMB 3VS7A 1D0XA 1VQLT 2RHUA 2RK1A 4CI0C 2VYTA 4BY6B 3JB9I 2LX9A 4IIMA 3M56A 4AG2C 1JJ2P 1T3LA 3RDVA 2C06A 1R0CB 3CC2T 1HD3A 4ZTFA 2DXBA 4MDWA 3TU4K 3URGA 2XDBA 4Y28E 2EGEA 4M78E 4JJDA 1Q86C 3CCQT 1WLPB 4J6WA 1VQPQ 2LJ0A 4FL6A 3RKYA 3VKIA 4O6JA 2CT3A 2K5FA 4QQ6A 3OQ5A 1KK7A 2BIVA 4NOYA 3CMEQ 1VQNQ 4LDWA 4EMKC 2CP6A 1Q81R 4JS5A 2O4XA 4LD6A 1RABB 3LYIA 2CP3A 1Q82C 4J83A 2I2LA 1NG2A 5I2SA 1NYGA 2EQUA 4ORZA 4GLKA 3D7SB 3EGDB 3PVLA 4OMFB 2YUPA 2J05A 2PVOB 2OI3A 4C0DC 4NL2A 5LJ3d 1VQ5A 1W2BA 2MAMA 4RMOA 4M78A 5IHKA 4GLMA 3AHUA 3LH0A 1OV3A 3M0SA 2HSEB 1GCPA 1G8XA 1I5LA 3MEUA 3BDUA 2JOYA 2FVUA 2EVRA 2JMCA 3MO8A 1KD1U 5A0LA 2PNIA 1K76A 3CCJT 2HL5C 2QAZA 2XICA 3UA6A 3ZBDA 3CCLA 1MUZA 1IHVA 4A4EA 1Y96A 1B7TA 1LNXA 4FW1A 3CPWA 3VUZA 1N6AA 5A0GA 1I07A 2CH4W 1YI2A 2BZXA 2DE0X 4EMHA 2YRVA 2QI2A 5FU7C 3CC4A 2KK4A 1CKAA 1VQ8A 3OSVA 2X3XD 2AHJB 1NPPA 4CC4B 3E2UA 4PLIA 2CKKA 5HK0A 1KC8U 3FIFA 1YJ9Q 4OB0B 2FPFA 1OI1A 1S72T 2PZ1A 2KROA 1MHNA 4ZGJB 5A2QE 5FRNA 4JJNK 5KYNA 3PMTA 4PNOA 3S3NA 2R5AA 4FT4A 3CCST 1VQ6Q 4A4FA 2HDAA 3OYMA 1UUEA 1WHGA 3CC2A 1RUWA 4E7ZA 4PFPA 3OW2P 2DETA 2HAXA 3GF5A 2KY9A 2FO0A 3LGLA 4XTXA 2KEAA 3DLLA 1GCQA 5LJ5g 2FB7A 2KRMA 1I5OB 3CCQA 2DJQA 4RTXA 4J9IA 3I9QA 3GBQA 1RADB 2KDSA 1MV3A 2K6DA 4PJOD 2XIDA 1E7OA 2RJFA 4M7DF 1H3ZA 2E6ZA 1SSFA 2HZYA 2CP5A 3GNFB 5CQYA 5KYXA 3QXEB 1MMDA 1SRLA 1PCXA 4L5GA 4ANJA 2EKOA 4ATOA 4OMNA 4M7DB 1C1AA 1W4SA 4E6RA 2HKQB 1RACB 1AWWA 1KJWA 4X9CA 1AWOA 4RUGA 1BCMA 2LX7A 1KHIA 2QYZA 1S1NA 3HFNA 2ECZA 1K8AU 4C8QE 2NLUA 2EKHA 1KIKA 2F69A 1BU1A 2XMFA 3A1PA 2BZ8A 5IXBA 2B86A 4M7DG 1NE8A 2V1RA 2HBPA 4J7FA 2P0KA 5GANg 3CCJA 2ZPIB 1M90U 4RTTA 3CXCP 1N9SA 4CC7A 4PFOA 1X6GA 3J81E 4FT2A 2CP7A 5AYFA 2QTXA 2NUTA 1OQKA 1K8AR 1K9MR 4FSSA 4GY5A 1M8VA 4L6V5 2CS7A 5LJ5e 2J06A 4RG2A 1QCFA 1WGSA 4OVAA 1UFFA 4M7AB 4C8QA 5ECAA 4HA8A 1NZ9A 1S72A 2AKLA 4XAXB 2F5KA 3IQLA 3LLRA 3OYJA 5KYUA 1ZX6A 1TU0B 1HSQA 1M90R 3CCSA 5FU6C 5GMKi 2LCSA 3LWHA 5DM7R 4QVDA 1VYTA 4EMGA 3CC7Q 4M7AG 4HKEA 4ME7A 4E7KA 1Y71A 1GBQA 2KRNA 4V2SA 1JB0E 1K4US 3JV3A 4KUIA 3SWNB 4KUDK 4FYYB 2EFIA 1VQPT 1Q7YU 3CC4Q 2RA2A 2RNAA 4ESRA 2GFAA 3L2ZA 2C0IA 4RKUE 1UGVA 3ZEHA 1VQNT 4X9DA 2NUPB 3UDCA 3G71Q 1XJWB 2ZAEA 4J9EA 5GAN8 2X4JA 1UB4A 4CC3A 1RI9A 2NUZA 4RTZA 5GANe 3SEMA 4M77C 2LTOA 3TVTA 1VQLQ 1BYMA 4F7UE 4DBHA 4C92B 3G4SQ 1PRLC 2MCNA 3A8LB 4HCZA 5I2MA 1PG5B 1NLOC 3M9QA 1W6XA 3VRYA 1Q7YR 4FYVB 1H92A 3S6WA 3JB9H 2PU9B 4AG1C 5GAOl 1JEGA 3M0RA 2DO3A 2YDLA 4C92G 1OZ2A 3X20B 3P8HA 3A5ZB 2VC8A 3MEVA 3OYBA 2H8HA 3NGPA 5GAN5 3J80E 3QPHA 3VS5A 2HSPA 4GBQA 1PHTA 4B9WA 3C94A 4F7UA 3MPUB 3QG1A 3TQ7P 3EHQA 1N8RC 3OBWA 3NMZC 2CZ1B 4BI8B 1R0BG 4JPBW 2QEXQ 3THKA 1MMGA 2EGAA 1D1BA 1JU5C 2DKGA 4PFZA 1ZHIA 4LDVA 5DLQE 1WIEA 2RQTA 2RQWA 4M75E 1YJ9T 3VU3C 1BKBA 3GNGA 2X4YA 4RG8A 4XU3A 2FG0A 1G3WA 3ZL7C 3GP8A 2RO0A 7AT1B 1IGQA 4NL3A 4A53A 3OYGA 1QWEA 2COWA 4R55A 1FYNA 1C6VX 2PVDB 2DJZA 2KMTA 1VQ6T 5GMKh 2FPDA 3QUIA 3PIPA 2LQNA 1QCOA 3JCMf 3CCJQ 2J6FA 2LCLA 3OSSC 4PJOC 2KXCA 1UJYA 1X75C 1OYXA
chains in the Genus database with same CATH topology
1KFZA 2LMJA 2OJ2A 2JXBA 1SHFA 1UHCA 1VYUA 2EYWA 1AZGB 3EG0A 2DL4A 1H3HA 1B07A 4LUDA 2DNUA 2EPDA 3VS3A 1Z9QA 2L3QA 1X2QA 2A36A 4LNPA 3VS7A 1GL5A 2JT4A 4K11A 2RF0A 1M27C 3PE0A 1NEGA 2EYZA 2EYXA 4F14A 1W1FA 1PRMC 2O9VA 2J6KA 4IIMA 4AG2C 4CC2A 1T3LA 4LN2A 2ROLA 3H0FA 1HD3A 1H8KA 2G6FX 3M0UA 4J9BA 2W0ZA 1QKXA 1HJDA 2A37A 1PKSA 2O9SA 2EGEA 4JJDA 1WLPB 2LJ0A 4Z8AA 2JW4A 1UJ0A 1V1CA 3I5SA 4JZ3A 1GFCA 2CT3A 3I35A 1J3TA 2HEQA 4Y92A 2DMOA 3O5ZA 1SHGA 1WX6A 1ZUKA 2M51A 2CSQA 1WYXA 5I22A 2ED1A 1NG2A 2FRWA 2RQUA 1NYGA 4ORZA 2DL7A 4J9FA 1ZSGA 1TG0A 5EC7A 3PVLA 1E6GA 2FRYA 2YUPA 2J05A 1ZUYA 2OI3A 1VA7A 2AZSA 2K9GA 1WXUA 2KE9A 1AVZC 2DF6A 5IHKA 2DL3A 4GLMA 1ARKA 3NHNA 1OV3A 4WCIA 3M0SA 1GCPA 3M0TA 3EG3A 4OMLA 3CQTA 1TUCA 2EVRA 2AZVA 2JMCA 3VS0A 2SEMA 1X2KA 5IXFA 2PNIA 1K76A 3UA6A 2K79A 4D8KA 3REAB 1MUZA 2FEIA 2F2VA 1I07A 1B3QA 2OAWA 2CH4W 1UE9A 5L23A 2BZXA 2DE0X 2EGCA 2E5KA 4HVVA 2A28A 2CH4A 1JO8A 1CKAA 2X3WD 2GQIA 1U3OA 2GBQA 2X3XD 4CC4B 2LQWA 4OMQA 2RPNA 2YSQA 2FPFA 2DL5A 4OMMA 2PZ1A 2VKNA 2KROA 1X69A 2J6OA 4D8DA 5FWBA 4R0KA 2M0YA 1X6BA 2DRKA 1BBZA 2D0NA 3EGUA 5IHIA 2HDAA 4A63B 1UUEA 2F2WA 1AEYA 1RUWA 3PVQA 1NLPC 1SSHA 1QWFA 4J9HA 1GCQC 4RTWA 2GTOA 2FO0A 4HVUA 2I0NA 2KEAA 2KYBA 1GCQA 1M3AA 2CT4A 2KRMA 2GGRA 2DJQA 4J9DA 4RTXA 4J9IA 1WI7A 2DLPA 3I9QA 2LJ3A 1RLQC 3GBQA 3I5RA 2O2OA 1MV3A 1XOVA 2EBPA 2K6DA 1JXOA 1G2BA 1E7OA 4Z89A 2CUBA 1RLPC 2MIOA 4F17A 3C0CA 1ZBJA 1YWOA 1N5ZA 1SRLA 1YN8A 2DM1A 2LZ6B 1A0NB 2DRMA 1QKWA 4OMNA 1NYFA 1WDXA 3NPFA 4E6RA 1ZLMA 3A98A 1AWWA 1KJWA 1G83A 3QWYA 1AWOA 1BK2A 4RUGA 1AOJA 1IO6A 2MOXA 2C0TA 2LX7A 2D8JA 1Y0MA 1S1NA 1OPLA 2ENMA 2DBMA 2ECZA 4OMOA 1GBRA 2DILA 2EKHA 1VYVA 2O31A 4M4ZA 1KIKA 1AD5A 1BU1A 2BZYA 2XMFA 2KXDA 2BZ8A 5IXBA 2B86A 4F16A 3EG2A 1NM7A 5FW9A 1WXTA 2DVJA 1UHFA 5GJWB 2V1QA 2V1RA 4RTUA 1FMKA 4OMPA 3M0QA 1M3BA 1SEMA 1CKBA 2YT6A 1OPKA 1MV0B 1AZEA 4AFQC 1GRIA 4RTTA 4JZ4A 4AFUC 2FPEA 4CC7A 1E6HA 1X6GA 2IIMA 2JS2A 1I1JA 1GFDA 3VS1A 4KRTA 3TSZA 1EFNA 1OEBA 3REBB 1TUDA 2VVKA 2LJ1A 4FSSA 2YUOA 1M3CA 2D8HA 2PTKA 2J06A 1YP5A 5IHNA 1QCFA 1UFFA 2L2PA 2RQVA 5ECAA 2A08A 2CREA 1UDLA 4EIKA 2AKLA 1T0JA 3M0PA 3IQLA 4DEXA 4LUEA 2J7IA 2GNCA 2KBTA 3LH5A 1ZX6A 2BTTA 3SHWA 1HSQA 1JQQA 2JTEA 3TSWA 1X27A 2K3BA 2LCSA 3U23A 1VYTA 2KT1A 2GTJA 1GBQA 2KRNA 4AFZC 1UECA 2ROTA 1U5SA 3R6NA 1ABOA 1PKTA 2KR3A 2EYYA 1K4US 3JV3A 1ZUUA 1WXBA 2LP5A 4Z88A 2K7AA 2RNAA 1T3SA 4ESRA 3EG1A 2HBWA 2DL8A 2C0IA 1BB9A 1UGVA 2W10A 4J9GA 2HCKA 1YCSB 2KRSA 1UTIA 1X43A 4J9EA 3KFVA 1YNZA 4CC3A 1PWTA 1RI9A 2NUZA 4RTZA 3SEMA 5IH2A 4RTVA 3TVTA 2KT8A 5I11A 1CSKA 2DYBA 1JXMA 1PRLC 2MCNA 3VS4A 3VS2A 2YUNA 5FWCA 2QDLA 2AKKA 3EHRA 1OOTA 5GJVB 1NLOC 1W6XA 3H41A 3VRYA 2JM8A 1M30A 2YUQA 3QWXX 1H92A 3H0IA 2JM9A 2RMOA 1WA7A 1UG1A 4AG1C 1JEGA 1AWJA 3VRZA 3M0RA 2YDLA 1SRMA 1K0XA 1SPKA 2ESWA 4QT7A 4X1VA 2H8HA 2DA9A 3NGPA 2C0OA 4HCKA 2CUDA 4AFSC 1T0HA 4HVWA 1PNJA 3VS6A 3VS5A 2EW3A 2K2MA 2D1XA 2HSPA 1K9AA 2DBKA 1WFWA 5HCKA 2ABLA 4GBQA 1PHTA 2SRCA 3UA7A 1QLYA 4JJCA 4HXJA 1I0CA 3EHQA 1U06A 1LCKA 2VWFA 3NMZC 2JS0A 1Z9ZA 2KGTA 3UATA 4JPBW 1Y57A 2L3SA 2P4RA 2O88A 4IIOA 1K1ZA 3THKA 2EGAA 1JU5C 1AWXA 1NEBA 2KNBB 2DX1A 1WIEA 2RQTA 2RQWA 3ULRB 3UF4A 1ABQA 3RNJA 2AK5A 4J9CA 2LNHB 2ED0A 2CDTA 2L0AA 2F2XA 2NWMA 3ZL7C 2FG0A 1KSWA 1QWEA 1M8MA 1FYNA 1YWPA 2RQRA 4DEYA 2RN8A 2FPDA 2EQIA 2LQNA 3RBBB 1K0SA 2L3PA 1W70A 4JJBA 2KYMA 2CSIA 3FJ5A 3H0HA 4RTYA 4ZNXA 2J6FA 4LE9A 2JMAA 2KXCA 1UJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFZ A;  2LMJ A;  2OJ2 A;  2JXB A;  1SHF A;  1UHC A;  1VYU A;  2EYW A;  1AZG B;  3EG0 A;  2DL4 A;  1H3H A;  1B07 A;  4LUD A;  2DNU A;  2EPD A;  3VS3 A;  1Z9Q A;  2L3Q A;  1X2Q A;  2A36 A;  4LNP A;  3VS7 A;  1GL5 A;  2JT4 A;  4K11 A;  2RF0 A;  1M27 C;  3PE0 A;  1NEG A;  2EYZ A;  2EYX A;  4F14 A;  1W1F A;  1PRM C;  2O9V A;  2J6K A;  4IIM A;  4AG2 C;  4CC2 A;  1T3L A;  4LN2 A;  2ROL A;  3H0F A;  1HD3 A;  1H8K A;  2G6F X;  3M0U A;  4J9B A;  2W0Z A;  1QKX A;  1HJD A;  2A37 A;  1PKS A;  2O9S A;  2EGE A;  4JJD A;  1WLP B;  2LJ0 A;  4Z8A A;  2JW4 A;  1UJ0 A;  1V1C A;  3I5S A;  4JZ3 A;  1GFC A;  2CT3 A;  3I35 A;  1J3T A;  2HEQ A;  4Y92 A;  2DMO A;  3O5Z A;  1SHG A;  1WX6 A;  1ZUK A;  2M51 A;  2CSQ A;  1WYX A;  5I22 A;  2ED1 A;  1NG2 A;  2FRW A;  2RQU A;  1NYG A;  4ORZ A;  2DL7 A;  4J9F A;  1ZSG A;  1TG0 A;  5EC7 A;  3PVL A;  1E6G A;  2FRY A;  2YUP A;  2J05 A;  1ZUY A;  2OI3 A;  1VA7 A;  2AZS A;  2K9G A;  1WXU A;  2KE9 A;  1AVZ C;  2DF6 A;  5IHK A;  2DL3 A;  4GLM A;  1ARK A;  3NHN A;  1OV3 A;  4WCI A;  3M0S A;  1GCP A;  3M0T A;  3EG3 A;  4OML A;  3CQT A;  1TUC A;  2EVR A;  2AZV A;  2JMC A;  3VS0 A;  2SEM A;  1X2K A;  5IXF A;  2PNI A;  1K76 A;  3UA6 A;  2K79 A;  4D8K A;  3REA B;  1MUZ A;  2FEI A;  2F2V A;  1I07 A;  1B3Q A;  2OAW A;  2CH4 W;  1UE9 A;  5L23 A;  2BZX A;  2DE0 X;  2EGC A;  2E5K A;  4HVV A;  2A28 A;  2CH4 A;  1JO8 A;  1CKA A;  2X3W D;  2GQI A;  1U3O A;  2GBQ A;  2X3X D;  4CC4 B;  2LQW A;  4OMQ A;  2RPN A;  2YSQ A;  2FPF A;  2DL5 A;  4OMM A;  2PZ1 A;  2VKN A;  2KRO A;  1X69 A;  2J6O A;  4D8D A;  5FWB A;  4R0K A;  2M0Y A;  1X6B A;  2DRK A;  1BBZ A;  2D0N A;  3EGU A;  5IHI A;  2HDA A;  4A63 B;  1UUE A;  2F2W A;  1AEY A;  1RUW A;  3PVQ A;  1NLP C;  1SSH A;  1QWF A;  4J9H A;  1GCQ C;  4RTW A;  2GTO A;  2FO0 A;  4HVU A;  2I0N A;  2KEA A;  2KYB A;  1GCQ A;  1M3A A;  2CT4 A;  2KRM A;  2GGR A;  2DJQ A;  4J9D A;  4RTX A;  4J9I A;  1WI7 A;  2DLP A;  3I9Q A;  2LJ3 A;  1RLQ C;  3GBQ A;  3I5R A;  2O2O A;  1MV3 A;  1XOV A;  2EBP A;  2K6D A;  1JXO A;  1G2B A;  1E7O A;  4Z89 A;  2CUB A;  1RLP C;  2MIO A;  4F17 A;  3C0C A;  1ZBJ A;  1YWO A;  1N5Z A;  1SRL A;  1YN8 A;  2DM1 A;  2LZ6 B;  1A0N B;  2DRM A;  1QKW A;  4OMN A;  1NYF A;  1WDX A;  3NPF A;  4E6R A;  1ZLM A;  3A98 A;  1AWW A;  1KJW A;  1G83 A;  3QWY A;  1AWO A;  1BK2 A;  4RUG A;  1AOJ A;  1IO6 A;  2MOX A;  2C0T A;  2LX7 A;  2D8J A;  1Y0M A;  1S1N A;  1OPL A;  2ENM A;  2DBM A;  2ECZ A;  4OMO A;  1GBR A;  2DIL A;  2EKH A;  1VYV A;  2O31 A;  4M4Z A;  1KIK A;  1AD5 A;  1BU1 A;  2BZY A;  2XMF A;  2KXD A;  2BZ8 A;  5IXB A;  2B86 A;  4F16 A;  3EG2 A;  1NM7 A;  5FW9 A;  1WXT A;  2DVJ A;  1UHF A;  5GJW B;  2V1Q A;  2V1R A;  4RTU A;  1FMK A;  4OMP A;  3M0Q A;  1M3B A;  1SEM A;  1CKB A;  2YT6 A;  1OPK A;  1MV0 B;  1AZE A;  4AFQ C;  1GRI A;  4RTT A;  4JZ4 A;  4AFU C;  2FPE A;  4CC7 A;  1E6H A;  1X6G A;  2IIM A;  2JS2 A;  1I1J A;  1GFD A;  3VS1 A;  4KRT A;  3TSZ A;  1EFN A;  1OEB A;  3REB B;  1TUD A;  2VVK A;  2LJ1 A;  4FSS A;  2YUO A;  1M3C A;  2D8H A;  2PTK A;  2J06 A;  1YP5 A;  5IHN A;  1QCF A;  1UFF A;  2L2P A;  2RQV A;  5ECA A;  2A08 A;  2CRE A;  1UDL A;  4EIK A;  2AKL A;  1T0J A;  3M0P A;  3IQL A;  4DEX A;  4LUE A;  2J7I A;  2GNC A;  2KBT A;  3LH5 A;  1ZX6 A;  2BTT A;  3SHW A;  1HSQ A;  1JQQ A;  2JTE A;  3TSW A;  1X27 A;  2K3B A;  2LCS A;  3U23 A;  1VYT A;  2KT1 A;  2GTJ A;  1GBQ A;  2KRN A;  4AFZ C;  1UEC A;  2ROT A;  1U5S A;  3R6N A;  1ABO A;  1PKT A;  2KR3 A;  2EYY A;  1K4U S;  3JV3 A;  1ZUU A;  1WXB A;  2LP5 A;  4Z88 A;  2K7A A;  2RNA A;  1T3S A;  4ESR A;  3EG1 A;  2HBW A;  2DL8 A;  2C0I A;  1BB9 A;  1UGV A;  2W10 A;  4J9G A;  2HCK A;  1YCS B;  2KRS A;  1UTI A;  1X43 A;  4J9E A;  3KFV A;  1YNZ A;  4CC3 A;  1PWT A;  1RI9 A;  2NUZ A;  4RTZ A;  3SEM A;  5IH2 A;  4RTV A;  3TVT A;  2KT8 A;  5I11 A;  1CSK A;  2DYB A;  1JXM A;  1PRL C;  2MCN A;  3VS4 A;  3VS2 A;  2YUN A;  5FWC A;  2QDL A;  2AKK A;  3EHR A;  1OOT A;  5GJV B;  1NLO C;  1W6X A;  3H41 A;  3VRY A;  2JM8 A;  1M30 A;  2YUQ A;  3QWX X;  1H92 A;  3H0I A;  2JM9 A;  2RMO A;  1WA7 A;  1UG1 A;  4AG1 C;  1JEG A;  1AWJ A;  3VRZ A;  3M0R A;  2YDL A;  1SRM A;  1K0X A;  1SPK A;  2ESW A;  4QT7 A;  4X1V A;  2H8H A;  2DA9 A;  3NGP A;  2C0O A;  4HCK A;  2CUD A;  4AFS C;  1T0H A;  4HVW A;  1PNJ A;  3VS6 A;  3VS5 A;  2EW3 A;  2K2M A;  2D1X A;  2HSP A;  1K9A A;  2DBK A;  1WFW A;  5HCK A;  2ABL A;  4GBQ A;  1PHT A;  2SRC A;  3UA7 A;  1QLY A;  4JJC A;  4HXJ A;  1I0C A;  3EHQ A;  1U06 A;  1LCK A;  2VWF A;  3NMZ C;  2JS0 A;  1Z9Z A;  2KGT A;  3UAT A;  4JPB W;  1Y57 A;  2L3S A;  2P4R A;  2O88 A;  4IIO A;  1K1Z A;  3THK A;  2EGA A;  1JU5 C;  1AWX A;  1NEB A;  2KNB B;  2DX1 A;  1WIE A;  2RQT A;  2RQW A;  3ULR B;  3UF4 A;  1ABQ A;  3RNJ A;  2AK5 A;  4J9C A;  2LNH B;  2ED0 A;  2CDT A;  2L0A A;  2F2X A;  2NWM A;  3ZL7 C;  2FG0 A;  1KSW A;  1QWE A;  1M8M A;  1FYN A;  1YWP A;  2RQR A;  4DEY A;  2RN8 A;  2FPD A;  2EQI A;  2LQN A;  3RBB B;  1K0S A;  2L3P A;  1W70 A;  4JJB A;  2KYM A;  2CSI A;  3FJ5 A;  3H0H A;  4RTY A;  4ZNX A;  2J6F A;  4LE9 A;  2JMA A;  2KXC A;  1UJY A; 
#chains in the Genus database with same CATH topology
 5FLX E;  1K9M C;  3CCM Q;  1VQ7 T;  3LGF A;  1WQW A;  4A4H A;  1H3H A;  1VQP A;  3HKS A;  2GQV A;  4M75 A;  2RHZ A;  1K73 C;  1WPY A;  4LUD A;  2EPD A;  5GAM e;  2DZ9 A;  5GAN 6;  1GL5 A;  5GMK m;  3ZFJ A;  4K11 A;  1VQN A;  1M27 C;  1UGR B;  2CP2 A;  3EFO B;  3JB9 D;  2H3J A;  5GAN d;  1OX8 A;  2EYZ A;  2QQR A;  1PRM C;  1Q82 U;  1I8F A;  2EYQ A;  4FU6 A;  4M7A A;  1LOJ A;  1ZSZ B;  2G6F X;  4DOV A;  4J9B A;  3PFS A;  1QKX A;  4WF2 A;  3SFM A;  3NTI A;  2A37 A;  2JVV A;  3QII A;  3I56 Q;  4NS5 A;  1LPL A;  2VV5 A;  5D6X A;  4HT8 A;  3CD6 Q;  3BFM A;  4DBR A;  5KYY B;  3S3M A;  1UJ0 A;  3P8B B;  4A54 A;  1V1C A;  2JZ2 A;  4KH1 B;  2P4T A;  3WXM B;  2HEQ A;  4E7H A;  3O5Z A;  1WX6 A;  4LDU A;  3SWN A;  4Z02 A;  2KI7 A;  5LJ3 j;  2X51 A;  2FRW A;  2QQB A;  5EC7 A;  2DTH A;  2LDM A;  4M78 C;  5CKD A;  1ZUY A;  3A8O B;  5D7U A;  5KCH A;  1AVZ C;  2DF6 A;  8ATC B;  3PIO A;  4C92 A;  4WCI A;  3L2Q A;  1YJ9 A;  4QVZ A;  3BW1 A;  1Y7X A;  4CRI A;  4PL6 A;  3EG3 A;  5CKB A;  3CQT A;  3QJ6 A;  1TUC A;  1IGU A;  3F70 A;  1IB8 A;  3M57 A;  3QBY A;  3OMG A;  1OZ3 A;  4D8K A;  3JAM E;  1VQ6 A;  2JUF A;  4C0G A;  3CC7 T;  4XTW A;  1D09 B;  2DVE A;  2EQJ A;  2XHC A;  1B3Q A;  2OAW A;  1MND A;  1P92 A;  2YRC A;  2M16 A;  4HVV A;  1RI0 A;  2CH4 A;  2DPP B;  1JO8 A;  3OA6 A;  1OX9 A;  1U3O A;  1VQ7 A;  2E3H A;  1FXX A;  2LQW A;  1XTD A;  4ELY C;  5GAM d;  3C4S A;  4N4I A;  4F04 B;  4IUU A;  4OMM A;  3EFS A;  4OB1 B;  4ZTJ A;  3G71 T;  2J6O A;  5FWB A;  2DIQ A;  4C0F A;  2M0Y A;  3G4S T;  2DRK A;  1BBZ A;  5IHI A;  3RUX A;  3OYH A;  2QA4 T;  5KYW B;  3QDF A;  3CBP A;  3PVQ A;  2DEQ A;  3BE3 A;  1RAA B;  2DAQ A;  2HMA A;  2MK5 A;  2R58 A;  4EMK B;  1GCQ C;  4JUV A;  1M1K C;  2HD0 A;  4UC4 A;  1M3A A;  4HT9 A;  3X28 B;  5GAN 7;  2E41 A;  2Y4Y A;  4J8O A;  1XOV A;  2EBP A;  1KQS P;  3OW2 A;  1NJI U;  3FDR A;  2DXU A;  4O5V A;  4C0D B;  4Z89 A;  2CUB A;  3JCM b;  1ZBJ A;  1YWO A;  2KAF A;  2DM1 A;  2RD1 A;  2DRM A;  2QEX T;  3JCM c;  3G6E Q;  3JB9 F;  1WHH A;  1TXQ A;  1WJS A;  2MMP A;  3A98 A;  3CCE Q;  1G83 A;  3VUB A;  1IO6 A;  2IVW A;  4FYX B;  1Y0M A;  1OPL A;  2RHX A;  1QCN A;  2O31 A;  1ZSZ A;  5AT1 B;  5J3B A;  1NJI R;  2XG8 D;  3OYN A;  1NM7 A;  4M77 D;  5FU7 B;  2V1Q A;  4RTU A;  1FMK A;  3A8H B;  3M0Q A;  2CZ7 B;  1SEM A;  2X35 A;  2YT6 A;  1BIA A;  4J6X A;  2E1H A;  1OPK A;  5KYY A;  3JB9 G;  4AFQ C;  3OS1 A;  3CC7 A;  2PUO B;  4JZ4 A;  2DIG A;  1TTH B;  2JS2 A;  3HRS A;  1I1J A;  4LXC A;  3OYA A;  3CCM T;  4KRT A;  5KE2 A;  1OEB A;  2V8J A;  2VVK A;  1BI1 A;  4C8Q C;  3PNW C;  4II1 A;  1M3C A;  1VQ4 Q;  3BDL A;  1QVG S;  2LT4 A;  2FZG B;  2L2P A;  2RQV A;  3A8G B;  3OYD A;  3CXC A;  2CRE A;  1UDL A;  1KQS S;  1KG1 A;  3M0P A;  1XNI A;  3G71 A;  2VB6 A;  4LUE A;  4OGC A;  3JCM g;  2RI5 A;  1KD1 R;  2PUK B;  3ME9 A;  1JQQ A;  3TSW A;  1VQL A;  3L42 A;  1X27 A;  3RES A;  3X25 B;  1VQO Q;  3G4S A;  4ZN1 A;  2RM4 A;  4FIB A;  1D1A A;  1ZA1 B;  2KT1 A;  2EWN A;  2MF2 A;  3QYH B;  2QA4 A;  3INZ A;  4N0A A;  1UEC A;  2B8A A;  3M59 A;  4QQD A;  3I56 T;  3R6N A;  1YJN T;  2CZ0 B;  3CD6 T;  2RI3 A;  1G3Y A;  4DOW A;  1ZUU A;  1WXB A;  4Z88 A;  1VQK Q;  2K7A A;  3EG1 A;  2HBW A;  1Q95 G;  1KC8 R;  1VQ7 Q;  5LJ3 f;  4IUV A;  1AT1 B;  1BCO A;  2H3E B;  2HCK A;  3SDZ A;  1X43 A;  4XTV A;  1WHM A;  1C0M A;  3UT1 A;  3HRU A;  4E47 A;  1ZA2 B;  4J6Y A;  4R56 A;  1CSK A;  2DYB A;  4FYW B;  1RL2 A;  3DKM A;  1TSF A;  2YUN A;  4BUG A;  4BB7 A;  1OOT A;  1XQH A;  2QEX A;  1EZZ B;  1OU9 A;  4FM4 B;  2YUQ A;  2D6F A;  3MEW A;  2PVG B;  2JM9 A;  1PM3 A;  1UG1 A;  1AWJ A;  1M5Q 1;  1I4K 1;  3EH1 A;  4LDY A;  1HK9 A;  2EJG A;  1SPK A;  4QQG A;  4J7I A;  4AFS C;  5FRO A;  3VS6 A;  4EMK A;  1VQK T;  2LRQ A;  2P0P A;  2ZZD A;  1K9A A;  3SD4 A;  1Q81 C;  1RAH B;  5LJ5 j;  1VQ9 Q;  2ZPH B;  4JJC A;  1I0C A;  2BKD N;  2CP0 A;  3OYL A;  1LCK A;  1YIT Q;  2VWF A;  1B34 B;  2KGT A;  3I55 T;  2CYZ B;  2P4R A;  3CCM A;  3QZ9 B;  3DB3 A;  2XD0 A;  2LCC A;  1AWX A;  1MMA A;  5FU6 B;  3EH2 A;  2ZPB B;  1ABQ A;  3RNJ A;  2AK5 A;  4C5E A;  1PD1 A;  2ED0 A;  2CDT A;  2L0A A;  4QW2 A;  1I81 A;  1KSW A;  2K3X A;  2E70 A;  2RK2 A;  1M8M A;  4KUL A;  1NPR A;  3P8D A;  1IRX A;  2RN8 A;  3EGD A;  2EQI A;  3M4G A;  3OYI A;  2LQK A;  2A3L A;  1K0S A;  4JDS A;  3QZ5 B;  4JJB A;  2KYM A;  2CSI A;  3H0H A;  1D3B B;  4M78 D;  4M77 F;  4RTY A;  3FC3 A;  4LE9 A;  4DBQ A;  2KSS A;  1MMN A;  1U06 A;  5GMK e;  3JCM P;  1SHF A;  3I56 A;  1YJN A;  3CD6 A;  4M75 C;  3QSU A;  4M77 B;  2XI9 A;  5GAN j;  3EG9 B;  1B07 A;  1U1T A;  4XU2 A;  2VGM A;  1M4Z A;  2D9T A;  5CAI A;  3VJP A;  1MNE A;  2KVQ G;  2A36 A;  4E7S A;  3HPW A;  4KH0 B;  1KD1 C;  4LD9 K;  1PSE A;  2JT4 A;  3OYE A;  3PE0 A;  1JBM A;  1AHJ B;  1NEG A;  1PSF A;  3CCR Q;  4F14 A;  4M77 G;  5GAN 2;  5A0D A;  5J26 A;  2J6K A;  3M54 A;  4LN2 A;  2LNV A;  1OUL A;  2ROL A;  3H0F A;  3G6E T;  2FZK B;  2W0Z A;  5J39 A;  1HJD A;  3CCE T;  1PKS A;  4OGE A;  2PQW A;  2QA4 Q;  1KC8 C;  4Z8A A;  2JW4 A;  2VUB A;  4JRK A;  3MP8 A;  4JRP A;  1GFC A;  1KQ1 A;  3JCM h;  5CVI A;  3I35 A;  1J3T A;  5CO7 A;  1VQM Q;  3MJX A;  2ZPE B;  4Y92 A;  2DMO A;  1IZ6 A;  3JCM Q;  4TVR A;  4M7D E;  1ZUK A;  1KQ2 A;  2XK0 A;  2CSQ A;  3WVD B;  1WYX A;  4EPC A;  2X9H A;  4A4G A;  2ED1 A;  4JRQ A;  2RQU A;  1FMW A;  1RAI B;  4MZT A;  2P0Q A;  4J9F A;  1ZSG A;  2P84 A;  4HCC A;  4PJO F;  5GAO m;  1E6G A;  2EIF A;  1VA7 A;  1VQ4 T;  5D6Y A;  4DA4 A;  1RAF B;  2X4X A;  1ARK A;  3NHN A;  2WSF E;  4XTU A;  5LJ5 d;  4PJO B;  3TEE A;  3QKJ A;  2JN0 A;  4KT0 E;  4OML A;  1LVK A;  4AT1 B;  2G3R A;  3E19 A;  3VS0 A;  3CPF A;  3FB9 A;  5IXF A;  2WSC E;  4M7D A;  4J5Y A;  1VQO T;  1TWB A;  1UEB A;  4PJO G;  2M0O A;  2RHI A;  4E7L A;  1DJ7 B;  2HNI A;  5GAM j;  4M7A E;  2DFU A;  3V7C A;  3OMC A;  9ATC B;  2A28 A;  5CQX A;  1HXD A;  2X3W D;  1PC0 A;  1K8A C;  3HRT A;  1BIB A;  4OMQ A;  2RPN A;  1Q86 U;  2YSQ A;  2MPX C;  4IUT A;  2VKN A;  2QAS A;  4D8D A;  3JCM J;  4Y91 A;  5IAY A;  2YRD A;  4R0K A;  4JLI A;  2AIR B;  4BDZ A;  3WVE B;  1X6B A;  3CBM A;  1M90 C;  1QQJ A;  5GAO n;  2F2W A;  1M2O A;  1AEY A;  1QVF P;  2QK0 A;  4C8Q D;  3G6E A;  3QO3 A;  1NLP C;  3T9N A;  5C6S A;  1SSH A;  1QWF A;  3CCE A;  1YHQ Q;  3DLM A;  2QDY B;  1Q86 R;  2DTI A;  4ZN3 A;  2KYB A;  4M78 F;  1M2V B;  1YJN Q;  2GGR A;  4VUB A;  2ATC B;  4E7I A;  2E12 A;  1D3B A;  5LJ5 f;  4C92 E;  2LJ3 A;  1RLQ C;  2XU8 A;  1FWZ A;  3V8J A;  4M78 B;  2OTL T;  1D0Y A;  1RLP C;  4X34 A;  2LVM A;  2MWP A;  4JLG A;  3O8V A;  1VQ9 T;  3C0C A;  3AT1 B;  2JJ9 A;  5GAN 4;  3E9F A;  1YJW T;  1Q82 R;  2LZ6 B;  4WTO B;  1YIT T;  1SG5 A;  1VIE A;  1IXD A;  1WDX A;  1KQS A;  4PJL A;  4M78 G;  1ZLM A;  1Q7Y C;  5HKC A;  3QWY A;  2NUP A;  2MOX A;  2C0T A;  1VQ4 A;  2ENM A;  1HYO A;  1QP3 A;  2M9U A;  2CGH A;  3V8L A;  2DIL A;  4M4Z A;  1AD5 A;  1YIJ Q;  2BZY A;  2RB6 A;  2E10 A;  1JRI A;  3G1J A;  3FLG A;  1M1F A;  3PTA A;  5GJW B;  3MCA B;  3OBY A;  1M3B A;  3NFC A;  3VV0 A;  2F5T X;  1MV0 B;  4FW2 A;  3QYG B;  1VQO A;  5GAN f;  2ZPG B;  1QVF S;  2V8K A;  4AFU C;  2FPE A;  1UGP B;  3OB9 A;  3OS5 A;  1E6H A;  2IIM A;  3JB9 J;  3CMA T;  1GFD A;  3VS1 A;  2FHD A;  4PKC C;  3CEY A;  2E6N A;  5LL6 S;  3REB B;  1X01 A;  1TUD A;  2M1H A;  5KCO A;  2YUO A;  2OTJ Q;  2JNG A;  1VQK A;  3I55 Q;  2D8H A;  2L89 A;  2GFU A;  3V7S A;  2DD5 A;  1KHC A;  3A8M B;  2A08 A;  4D6W A;  3BY7 A;  3LWI A;  3CCR T;  3PGG A;  2BTT A;  2RJC A;  5FRM A;  4BI4 A;  3NTH A;  4AMC A;  2JTE A;  5CK9 A;  3GIB A;  4N0A C;  2FYK A;  4PLL A;  4AFZ C;  1U5S A;  2DTO A;  1ABO A;  2KR3 A;  4MDX A;  4XU0 A;  1T3S A;  1BB9 A;  1VQM T;  2W10 A;  2KRS A;  1YCS B;  1LJO A;  4OF1 A;  1QVG P;  2DD4 A;  2EJ9 A;  1MGQ A;  2GCX A;  5HY6 A;  2OTL A;  1PWT A;  1Q81 U;  5IH2 A;  3CCV Q;  2Z0W A;  4RTV A;  3ASK A;  1VOM A;  3OYK A;  4MZP A;  2KT8 A;  3JRZ A;  5EG2 A;  1VQ9 A;  1JXM A;  3X24 B;  3NTK A;  1YJW A;  2L8D A;  2X4W A;  2AKK A;  4M75 D;  3EHR A;  5GJV B;  3KUF A;  1YIT A;  1ACM B;  1M30 A;  3OYC A;  3H0I A;  1WA7 A;  5CIU A;  5DY9 A;  4BY6 C;  3EFO A;  2NUT B;  4C8Q F;  4X1V A;  4QT7 A;  3R6O A;  3S3O A;  2C0O A;  2XDD A;  4M7A D;  1M9S A;  2CUD A;  2EQK A;  5GAM f;  4HVW A;  1EIF A;  2K2M A;  3HL8 A;  2D1X A;  1IRE B;  4C8Q B;  2DBK A;  1WFW A;  5HCK A;  2ABL A;  2YLC A;  2SRC A;  3UA7 A;  3FEO A;  1QMC A;  1U1S A;  1M2V A;  1BI0 A;  1TS9 A;  5LJ3 h;  2QGG A;  5KYU B;  3TCJ A;  2JS0 A;  1Z9Z A;  4XTZ A;  1Y57 A;  3FJP A;  4IIO A;  3CMA A;  1K1Z A;  2VGN A;  1NEB A;  4C8Q G;  2KNB B;  2VAS A;  1QVP A;  2DX1 A;  3L1A A;  2BE9 B;  3UF4 A;  4EDU A;  2LNH B;  3V8K A;  1O75 A;  3FRN A;  2F2X A;  2E64 A;  5DLO A;  1JJ2 S;  2DK3 A;  1X6O A;  2K57 A;  1YWP A;  3CCR A;  4DEY A;  3M53 A;  1YFN A;  2L3P A;  3FJ5 A;  4C5I A;  3OS0 A;  2JMA A;  2A0F B;  4C92 D;  4PK4 A;  1EX4 A;  1KFZ A;  3H6Z A;  4DBF A;  2LMJ A;  1YHQ T;  2JXB A;  2MYS A;  2RJD A;  2V8I A;  3VYH B;  1VYU A;  1YCY A;  2EYW A;  3EG0 A;  2DL4 A;  3EGX B;  5CR2 A;  1V29 B;  1OU8 A;  3TRE A;  2ZCF B;  4BE0 A;  2DNU A;  3VS3 A;  1O9S A;  1Z9Q A;  1X2Q A;  2L3Q A;  3KXT A;  2FL7 A;  4LNP A;  1VQM A;  6AT1 B;  2RF0 A;  3C12 A;  3CCU Q;  2FZC B;  3MP1 A;  4JRI A;  1V76 A;  2EYX A;  1W1F A;  5GAO p;  2QQ9 A;  2O9V A;  2HL3 A;  3VYG A;  4CC2 A;  4C5G A;  4F7U F;  1H8K A;  3M0U A;  1N8R U;  3KBG A;  2MI6 A;  2O9S A;  3JCM V;  4QKU A;  4F7U B;  2GF7 A;  3RMS A;  1YIJ T;  2V26 A;  2QGF B;  3HSB A;  3HP9 A;  3I5S A;  4JZ3 A;  1WJR A;  2BUD A;  2K5L A;  3QHS A;  4JS4 A;  2XDP A;  3HFO A;  2K5I A;  1N27 A;  5KYW A;  1SHG A;  4IUP A;  1N9R A;  2R57 A;  4F7U G;  2M51 A;  1W2B P;  3C95 A;  3JCM e;  1VUB A;  5IT9 E;  1D0Z A;  2OTL Q;  4BAC A;  3HTR A;  2M02 A;  2XKO C;  4OB3 B;  5I22 A;  2DZC A;  1N8R R;  1TOV A;  2DL7 A;  3E9G A;  3V7R A;  1YJW Q;  1TG0 A;  3EAE A;  1SF9 A;  1R8O B;  2DEU A;  2FRY A;  3M55 A;  2EJF A;  2OTJ T;  1K9M U;  2K9G A;  2AZS A;  3M5A A;  4XQ3 A;  4ZGD B;  1WXU A;  2KE9 A;  2WAC A;  4MZM A;  2DL3 A;  1H64 1;  4M75 F;  2BE7 D;  3CPW P;  4HCB A;  1WQ7 A;  1K73 U;  4E7J A;  3M0T A;  1NJI C;  4M7D C;  2AZV A;  2YLB A;  2RH2 A;  5GMK j;  2SEM A;  1X2K A;  4M75 B;  3OY9 A;  3GPL A;  2MWO A;  2K79 A;  2OAU A;  4C0Z A;  3REA B;  2E65 A;  3OW2 S;  4BE1 A;  4P5N A;  2E3I A;  4M7A F;  4LDX A;  2FEI A;  2EAY A;  2QQS A;  2F2V A;  5D6W A;  2DXT A;  5L8R E;  2YWW A;  1UE9 A;  3PMI A;  2IG0 A;  5L23 A;  4A4K A;  2EGC A;  2E5K A;  4Q5W A;  1BI3 A;  2L5Q A;  4M75 G;  1YHQ A;  2QQA A;  2GQI A;  2GBQ A;  1VQ5 Q;  3MEA A;  1WHK A;  3CMA Q;  4B9X A;  1K73 R;  3Q1J A;  1WNL A;  1ZBX A;  2COZ A;  2DL5 A;  1X69 A;  1GXI E;  2RI2 A;  1W2B S;  1D1C A;  4YTL A;  3CCV T;  5M9O A;  3JCM W;  2D0Q B;  5CCA A;  3L2U A;  3CCL Q;  2D0N A;  4FCY A;  3EGU A;  3L2V A;  4A63 B;  4M7A C;  4KGV B;  3N5B B;  1YI2 Q;  4QVC A;  1NBE B;  4J9H A;  3H9N A;  1VQ8 Q;  4RTW A;  2GTO A;  3PT9 A;  2O01 E;  2F1L A;  2R5M A;  4HVU A;  2I0N A;  2YHT A;  5C0M A;  2CT4 A;  3CPW S;  4C92 F;  1TH7 A;  4J9D A;  3CME T;  1YIJ A;  1WI7 A;  3OS2 A;  2DER A;  2DLP A;  4B6M A;  3I5R A;  1QVF A;  2O2O A;  3ER0 A;  1JXO A;  1G2B A;  3CXC S;  3RIR A;  3SWN C;  2MIO A;  3JCM d;  4F17 A;  3EGX A;  1G3S A;  1N5Z A;  2LT1 A;  1YN8 A;  4PJN A;  1A0N B;  3MKD A;  1WHJ A;  1QKW A;  3CC2 Q;  2E5Q A;  1NYF A;  4N4H A;  2DYI A;  3NPF A;  1RAE B;  5CKH A;  1G5V A;  1BK2 A;  5KE3 A;  4BDY A;  1AOJ A;  2OTJ A;  1Y07 A;  4KGZ B;  2D8J A;  3I55 A;  5GAM g;  2DBM A;  4OMO A;  4L59 A;  1GBR A;  3OYY A;  3CCQ Q;  1VYV A;  4C92 C;  2KXD A;  3MHX A;  4F16 A;  2QG9 B;  3EG2 A;  5CKE A;  5FW9 A;  1WXT A;  2DVJ A;  1UHF A;  5HK3 A;  4OB2 B;  2HQH A;  4OMP A;  1CKB A;  1RAG B;  5I21 A;  5GAO q;  1AZE A;  1GRI A;  2K3Y A;  5LJ5 h;  4IUQ A;  2DXC A;  3TSZ A;  1EFN A;  4C5H A;  4MMK A;  2LJ1 A;  2K2V A;  3MET A;  3UPU A;  2PTK A;  1QP2 A;  1YP5 A;  1M1K U;  4PJM A;  5IHN A;  2QTV A;  1ZQ1 A;  5IN1 A;  2NYS A;  4EIK A;  1T0J A;  3CCU T;  4DEX A;  8AT1 B;  2J7I A;  2GNC A;  2KBT A;  4KGX B;  1UGQ B;  3LH5 A;  1R77 A;  2HKN A;  3CBO A;  1B34 A;  4IUR A;  3SHW A;  5GMK l;  3CCV A;  3H8Z A;  5GAN 3;  2K3B A;  1YBY A;  2L3R A;  2LC4 A;  4M77 E;  3U23 A;  2HQX A;  2GTJ A;  1PD0 A;  3OYF A;  2COY A;  2RJE A;  2ROT A;  4BE2 A;  2IPO B;  1PKT A;  2EYY A;  1M1K R;  2AT1 B;  2YXY A;  2LP5 A;  5LJ3 g;  2O4X B;  4MML A;  4DQ2 A;  3QJY A;  5GAN h;  2DL8 A;  3LX7 A;  3X26 B;  1U8R A;  2JTF A;  3CME A;  3J7A F;  4J9G A;  1S72 Q;  1UTI A;  3KFV A;  1IHW A;  2JTM A;  1YNZ A;  1WJQ A;  3UWN A;  2QXF A;  3HHT B;  3CCS Q;  4OP0 A;  5I11 A;  3SB2 A;  3L2W A;  3VS4 A;  4M77 A;  3VS2 A;  3JSC A;  3EG9 A;  5FWC A;  2QDL A;  1WHL A;  4FSX A;  3LW5 E;  1QVG A;  2E4H A;  2VXF A;  3H41 A;  2JM8 A;  3M58 A;  5CKF A;  3QWX X;  1JJ2 A;  1WZO A;  2RMO A;  1G3T A;  3RR6 A;  3G7Z A;  4E2F B;  3VRZ A;  1SRM A;  4IKF A;  1K0X A;  1Y96 B;  1F1B B;  1UGS B;  2ESW A;  5KH6 A;  1ZSZ C;  1QW1 A;  2DA9 A;  3DB4 A;  3RER A;  4HCK A;  3RMQ A;  1T0H A;  2A7Y A;  1PNJ A;  4ELZ C;  2EW3 A;  1FMV A;  3L2R A;  2ZGW A;  4RCB A;  1QLY A;  1FX7 A;  4HXJ A;  2HQE A;  4N4G A;  4PJO E;  3UAT A;  2L3S A;  2O88 A;  1VQ5 T;  1M1G A;  4XTY A;  3MP6 A;  5LJ3 e;  4RCC A;  2OX7 A;  2K4Y A;  3ULR B;  3RKW A;  4J9C A;  5GAO r;  2Y4X A;  3EFR A;  4BD3 A;  2NWM A;  2VXE A;  3CCU A;  3CCL T;  1BI2 A;  4XU1 A;  2RQR A;  4ZGE B;  3RBB B;  1TUG B;  1W70 A;  2Y90 A;  2WSE E;  3RKX A;  4ZNX A;  1YI2 T;  2CZ6 B;  2KQW A;  2RHY A;  2ZPF B;  3M4Y A;  3CC4 T;  2LQ8 A;  2OJ2 A;  1VQ8 T;  4PJO A;  5GAM h;  4BI3 A;  1UHC A;  1VIF A;  3QDR B;  4XK8 E;  1AZG B;  3GOX A;  1SKU B;  5KYX B;  4M7D D;  4PJJ A;  2EQM A;  3GLX A;  3JCM X;  3E1S A;  4KBM B;  3VS7 A;  1D0X A;  1VQL T;  2RHU A;  2RK1 A;  4CI0 C;  2VYT A;  4BY6 B;  3JB9 I;  2LX9 A;  4IIM A;  3M56 A;  4AG2 C;  1JJ2 P;  1T3L A;  3RDV A;  2C06 A;  1R0C B;  3CC2 T;  1HD3 A;  4ZTF A;  2DXB A;  4MDW A;  3TU4 K;  3URG A;  2XDB A;  4Y28 E;  2EGE A;  4M78 E;  4JJD A;  1Q86 C;  3CCQ T;  1WLP B;  4J6W A;  1VQP Q;  2LJ0 A;  4FL6 A;  3RKY A;  3VKI A;  4O6J A;  2CT3 A;  2K5F A;  4QQ6 A;  3OQ5 A;  1KK7 A;  2BIV A;  4NOY A;  3CME Q;  1VQN Q;  4LDW A;  4EMK C;  2CP6 A;  1Q81 R;  4JS5 A;  2O4X A;  4LD6 A;  1RAB B;  3LYI A;  2CP3 A;  1Q82 C;  4J83 A;  2I2L A;  1NG2 A;  5I2S A;  1NYG A;  2EQU A;  4ORZ A;  4GLK A;  3D7S B;  3EGD B;  3PVL A;  4OMF B;  2YUP A;  2J05 A;  2PVO B;  2OI3 A;  4C0D C;  4NL2 A;  5LJ3 d;  1VQ5 A;  1W2B A;  2MAM A;  4RMO A;  4M78 A;  5IHK A;  4GLM A;  3AHU A;  3LH0 A;  1OV3 A;  3M0S A;  2HSE B;  1GCP A;  1G8X A;  1I5L A;  3MEU A;  3BDU A;  2JOY A;  2FVU A;  2EVR A;  2JMC A;  3MO8 A;  1KD1 U;  5A0L A;  2PNI A;  1K76 A;  3CCJ T;  2HL5 C;  2QAZ A;  2XIC A;  3UA6 A;  3ZBD A;  3CCL A;  1MUZ A;  1IHV A;  4A4E A;  1Y96 A;  1B7T A;  1LNX A;  4FW1 A;  3CPW A;  3VUZ A;  1N6A A;  5A0G A;  1I07 A;  2CH4 W;  1YI2 A;  2BZX A;  2DE0 X;  4EMH A;  2YRV A;  2QI2 A;  5FU7 C;  3CC4 A;  2KK4 A;  1CKA A;  1VQ8 A;  3OSV A;  2X3X D;  2AHJ B;  1NPP A;  4CC4 B;  3E2U A;  4PLI A;  2CKK A;  5HK0 A;  1KC8 U;  3FIF A;  1YJ9 Q;  4OB0 B;  2FPF A;  1OI1 A;  1S72 T;  2PZ1 A;  2KRO A;  1MHN A;  4ZGJ B;  5A2Q E;  5FRN A;  4JJN K;  5KYN A;  3PMT A;  4PNO A;  3S3N A;  2R5A A;  4FT4 A;  3CCS T;  1VQ6 Q;  4A4F A;  2HDA A;  3OYM A;  1UUE A;  1WHG A;  3CC2 A;  1RUW A;  4E7Z A;  4PFP A;  3OW2 P;  2DET A;  2HAX A;  3GF5 A;  2KY9 A;  2FO0 A;  3LGL A;  4XTX A;  2KEA A;  3DLL A;  1GCQ A;  5LJ5 g;  2FB7 A;  2KRM A;  1I5O B;  3CCQ A;  2DJQ A;  4RTX A;  4J9I A;  3I9Q A;  3GBQ A;  1RAD B;  2KDS A;  1MV3 A;  2K6D A;  4PJO D;  2XID A;  1E7O A;  2RJF A;  4M7D F;  1H3Z A;  2E6Z A;  1SSF A;  2HZY A;  2CP5 A;  3GNF B;  5CQY A;  5KYX A;  3QXE B;  1MMD A;  1SRL A;  1PCX A;  4L5G A;  4ANJ A;  2EKO A;  4ATO A;  4OMN A;  4M7D B;  1C1A A;  1W4S A;  4E6R A;  2HKQ B;  1RAC B;  1AWW A;  1KJW A;  4X9C A;  1AWO A;  4RUG A;  1BCM A;  2LX7 A;  1KHI A;  2QYZ A;  1S1N A;  3HFN A;  2ECZ A;  1K8A U;  4C8Q E;  2NLU A;  2EKH A;  1KIK A;  2F69 A;  1BU1 A;  2XMF A;  3A1P A;  2BZ8 A;  5IXB A;  2B86 A;  4M7D G;  1NE8 A;  2V1R A;  2HBP A;  4J7F A;  2P0K A;  5GAN g;  3CCJ A;  2ZPI B;  1M90 U;  4RTT A;  3CXC P;  1N9S A;  4CC7 A;  4PFO A;  1X6G A;  3J81 E;  4FT2 A;  2CP7 A;  5AYF A;  2QTX A;  2NUT A;  1OQK A;  1K8A R;  1K9M R;  4FSS A;  4GY5 A;  1M8V A;  4L6V 5;  2CS7 A;  5LJ5 e;  2J06 A;  4RG2 A;  1QCF A;  1WGS A;  4OVA A;  1UFF A;  4M7A B;  4C8Q A;  5ECA A;  4HA8 A;  1NZ9 A;  1S72 A;  2AKL A;  4XAX B;  2F5K A;  3IQL A;  3LLR A;  3OYJ A;  5KYU A;  1ZX6 A;  1TU0 B;  1HSQ A;  1M90 R;  3CCS A;  5FU6 C;  5GMK i;  2LCS A;  3LWH A;  5DM7 R;  4QVD A;  1VYT A;  4EMG A;  3CC7 Q;  4M7A G;  4HKE A;  4ME7 A;  4E7K A;  1Y71 A;  1GBQ A;  2KRN A;  4V2S A;  1JB0 E;  1K4U S;  3JV3 A;  4KUI A;  3SWN B;  4KUD K;  4FYY B;  2EFI A;  1VQP T;  1Q7Y U;  3CC4 Q;  2RA2 A;  2RNA A;  4ESR A;  2GFA A;  3L2Z A;  2C0I A;  4RKU E;  1UGV A;  3ZEH A;  1VQN T;  4X9D A;  2NUP B;  3UDC A;  3G71 Q;  1XJW B;  2ZAE A;  4J9E A;  5GAN 8;  2X4J A;  1UB4 A;  4CC3 A;  1RI9 A;  2NUZ A;  4RTZ A;  5GAN e;  3SEM A;  4M77 C;  2LTO A;  3TVT A;  1VQL Q;  1BYM A;  4F7U E;  4DBH A;  4C92 B;  3G4S Q;  1PRL C;  2MCN A;  3A8L B;  4HCZ A;  5I2M A;  1PG5 B;  1NLO C;  3M9Q A;  1W6X A;  3VRY A;  1Q7Y R;  4FYV B;  1H92 A;  3S6W A;  3JB9 H;  2PU9 B;  4AG1 C;  5GAO l;  1JEG A;  3M0R A;  2DO3 A;  2YDL A;  4C92 G;  1OZ2 A;  3X20 B;  3P8H A;  3A5Z B;  2VC8 A;  3MEV A;  3OYB A;  2H8H A;  3NGP A;  5GAN 5;  3J80 E;  3QPH A;  3VS5 A;  2HSP A;  4GBQ A;  1PHT A;  4B9W A;  3C94 A;  4F7U A;  3MPU B;  3QG1 A;  3TQ7 P;  3EHQ A;  1N8R C;  3OBW A;  3NMZ C;  2CZ1 B;  4BI8 B;  1R0B G;  4JPB W;  2QEX Q;  3THK A;  1MMG A;  2EGA A;  1D1B A;  1JU5 C;  2DKG A;  4PFZ A;  1ZHI A;  4LDV A;  5DLQ E;  1WIE A;  2RQT A;  2RQW A;  4M75 E;  1YJ9 T;  3VU3 C;  1BKB A;  3GNG A;  2X4Y A;  4RG8 A;  4XU3 A;  2FG0 A;  1G3W A;  3ZL7 C;  3GP8 A;  2RO0 A;  7AT1 B;  1IGQ A;  4NL3 A;  4A53 A;  3OYG A;  1QWE A;  2COW A;  4R55 A;  1FYN A;  1C6V X;  2PVD B;  2DJZ A;  2KMT A;  1VQ6 T;  5GMK h;  2FPD A;  3QUI A;  3PIP A;  2LQN A;  1QCO A;  3JCM f;  3CCJ Q;  2J6F A;  2LCL A;  3OSS C;  4PJO C;  2KXC A;  1UJY A;  1X75 C;  1OYX A; 
#chains in the Genus database with same CATH homology
 1KFZ A;  2LMJ A;  2OJ2 A;  2JXB A;  1SHF A;  1UHC A;  1VYU A;  2EYW A;  1AZG B;  3EG0 A;  2DL4 A;  1H3H A;  1B07 A;  4LUD A;  2DNU A;  2EPD A;  3VS3 A;  1Z9Q A;  2L3Q A;  1X2Q A;  2A36 A;  4LNP A;  3VS7 A;  1GL5 A;  2JT4 A;  4K11 A;  2RF0 A;  1M27 C;  3PE0 A;  1NEG A;  2EYZ A;  2EYX A;  4F14 A;  1W1F A;  1PRM C;  2O9V A;  2J6K A;  4IIM A;  4AG2 C;  4CC2 A;  1T3L A;  4LN2 A;  2ROL A;  3H0F A;  1HD3 A;  1H8K A;  2G6F X;  3M0U A;  4J9B A;  2W0Z A;  1QKX A;  1HJD A;  2A37 A;  1PKS A;  2O9S A;  2EGE A;  4JJD A;  1WLP B;  2LJ0 A;  4Z8A A;  2JW4 A;  1UJ0 A;  1V1C A;  3I5S A;  4JZ3 A;  1GFC A;  2CT3 A;  3I35 A;  1J3T A;  2HEQ A;  4Y92 A;  2DMO A;  3O5Z A;  1SHG A;  1WX6 A;  1ZUK A;  2M51 A;  2CSQ A;  1WYX A;  5I22 A;  2ED1 A;  1NG2 A;  2FRW A;  2RQU A;  1NYG A;  4ORZ A;  2DL7 A;  4J9F A;  1ZSG A;  1TG0 A;  5EC7 A;  3PVL A;  1E6G A;  2FRY A;  2YUP A;  2J05 A;  1ZUY A;  2OI3 A;  1VA7 A;  2AZS A;  2K9G A;  1WXU A;  2KE9 A;  1AVZ C;  2DF6 A;  5IHK A;  2DL3 A;  4GLM A;  1ARK A;  3NHN A;  1OV3 A;  4WCI A;  3M0S A;  1GCP A;  3M0T A;  3EG3 A;  4OML A;  3CQT A;  1TUC A;  2EVR A;  2AZV A;  2JMC A;  3VS0 A;  2SEM A;  1X2K A;  5IXF A;  2PNI A;  1K76 A;  3UA6 A;  2K79 A;  4D8K A;  3REA B;  1MUZ A;  2FEI A;  2F2V A;  1I07 A;  1B3Q A;  2OAW A;  2CH4 W;  1UE9 A;  5L23 A;  2BZX A;  2DE0 X;  2EGC A;  2E5K A;  4HVV A;  2A28 A;  2CH4 A;  1JO8 A;  1CKA A;  2X3W D;  2GQI A;  1U3O A;  2GBQ A;  2X3X D;  4CC4 B;  2LQW A;  4OMQ A;  2RPN A;  2YSQ A;  2FPF A;  2DL5 A;  4OMM A;  2PZ1 A;  2VKN A;  2KRO A;  1X69 A;  2J6O A;  4D8D A;  5FWB A;  4R0K A;  2M0Y A;  1X6B A;  2DRK A;  1BBZ A;  2D0N A;  3EGU A;  5IHI A;  2HDA A;  4A63 B;  1UUE A;  2F2W A;  1AEY A;  1RUW A;  3PVQ A;  1NLP C;  1SSH A;  1QWF A;  4J9H A;  1GCQ C;  4RTW A;  2GTO A;  2FO0 A;  4HVU A;  2I0N A;  2KEA A;  2KYB A;  1GCQ A;  1M3A A;  2CT4 A;  2KRM A;  2GGR A;  2DJQ A;  4J9D A;  4RTX A;  4J9I A;  1WI7 A;  2DLP A;  3I9Q A;  2LJ3 A;  1RLQ C;  3GBQ A;  3I5R A;  2O2O A;  1MV3 A;  1XOV A;  2EBP A;  2K6D A;  1JXO A;  1G2B A;  1E7O A;  4Z89 A;  2CUB A;  1RLP C;  2MIO A;  4F17 A;  3C0C A;  1ZBJ A;  1YWO A;  1N5Z A;  1SRL A;  1YN8 A;  2DM1 A;  2LZ6 B;  1A0N B;  2DRM A;  1QKW A;  4OMN A;  1NYF A;  1WDX A;  3NPF A;  4E6R A;  1ZLM A;  3A98 A;  1AWW A;  1KJW A;  1G83 A;  3QWY A;  1AWO A;  1BK2 A;  4RUG A;  1AOJ A;  1IO6 A;  2MOX A;  2C0T A;  2LX7 A;  2D8J A;  1Y0M A;  1S1N A;  1OPL A;  2ENM A;  2DBM A;  2ECZ A;  4OMO A;  1GBR A;  2DIL A;  2EKH A;  1VYV A;  2O31 A;  4M4Z A;  1KIK A;  1AD5 A;  1BU1 A;  2BZY A;  2XMF A;  2KXD A;  2BZ8 A;  5IXB A;  2B86 A;  4F16 A;  3EG2 A;  1NM7 A;  5FW9 A;  1WXT A;  2DVJ A;  1UHF A;  5GJW B;  2V1Q A;  2V1R A;  4RTU A;  1FMK A;  4OMP A;  3M0Q A;  1M3B A;  1SEM A;  1CKB A;  2YT6 A;  1OPK A;  1MV0 B;  1AZE A;  4AFQ C;  1GRI A;  4RTT A;  4JZ4 A;  4AFU C;  2FPE A;  4CC7 A;  1E6H A;  1X6G A;  2IIM A;  2JS2 A;  1I1J A;  1GFD A;  3VS1 A;  4KRT A;  3TSZ A;  1EFN A;  1OEB A;  3REB B;  1TUD A;  2VVK A;  2LJ1 A;  4FSS A;  2YUO A;  1M3C A;  2D8H A;  2PTK A;  2J06 A;  1YP5 A;  5IHN A;  1QCF A;  1UFF A;  2L2P A;  2RQV A;  5ECA A;  2A08 A;  2CRE A;  1UDL A;  4EIK A;  2AKL A;  1T0J A;  3M0P A;  3IQL A;  4DEX A;  4LUE A;  2J7I A;  2GNC A;  2KBT A;  3LH5 A;  1ZX6 A;  2BTT A;  3SHW A;  1HSQ A;  1JQQ A;  2JTE A;  3TSW A;  1X27 A;  2K3B A;  2LCS A;  3U23 A;  1VYT A;  2KT1 A;  2GTJ A;  1GBQ A;  2KRN A;  4AFZ C;  1UEC A;  2ROT A;  1U5S A;  3R6N A;  1ABO A;  1PKT A;  2KR3 A;  2EYY A;  1K4U S;  3JV3 A;  1ZUU A;  1WXB A;  2LP5 A;  4Z88 A;  2K7A A;  2RNA A;  1T3S A;  4ESR A;  3EG1 A;  2HBW A;  2DL8 A;  2C0I A;  1BB9 A;  1UGV A;  2W10 A;  4J9G A;  2HCK A;  1YCS B;  2KRS A;  1UTI A;  1X43 A;  4J9E A;  3KFV A;  1YNZ A;  4CC3 A;  1PWT A;  1RI9 A;  2NUZ A;  4RTZ A;  3SEM A;  5IH2 A;  4RTV A;  3TVT A;  2KT8 A;  5I11 A;  1CSK A;  2DYB A;  1JXM A;  1PRL C;  2MCN A;  3VS4 A;  3VS2 A;  2YUN A;  5FWC A;  2QDL A;  2AKK A;  3EHR A;  1OOT A;  5GJV B;  1NLO C;  1W6X A;  3H41 A;  3VRY A;  2JM8 A;  1M30 A;  2YUQ A;  3QWX X;  1H92 A;  3H0I A;  2JM9 A;  2RMO A;  1WA7 A;  1UG1 A;  4AG1 C;  1JEG A;  1AWJ A;  3VRZ A;  3M0R A;  2YDL A;  1SRM A;  1K0X A;  1SPK A;  2ESW A;  4QT7 A;  4X1V A;  2H8H A;  2DA9 A;  3NGP A;  2C0O A;  4HCK A;  2CUD A;  4AFS C;  1T0H A;  4HVW A;  1PNJ A;  3VS6 A;  3VS5 A;  2EW3 A;  2K2M A;  2D1X A;  2HSP A;  1K9A A;  2DBK A;  1WFW A;  5HCK A;  2ABL A;  4GBQ A;  1PHT A;  2SRC A;  3UA7 A;  1QLY A;  4JJC A;  4HXJ A;  1I0C A;  3EHQ A;  1U06 A;  1LCK A;  2VWF A;  3NMZ C;  2JS0 A;  1Z9Z A;  2KGT A;  3UAT A;  4JPB W;  1Y57 A;  2L3S A;  2P4R A;  2O88 A;  4IIO A;  1K1Z A;  3THK A;  2EGA A;  1JU5 C;  1AWX A;  1NEB A;  2KNB B;  2DX1 A;  1WIE A;  2RQT A;  2RQW A;  3ULR B;  3UF4 A;  1ABQ A;  3RNJ A;  2AK5 A;  4J9C A;  2LNH B;  2ED0 A;  2CDT A;  2L0A A;  2F2X A;  2NWM A;  3ZL7 C;  2FG0 A;  1KSW A;  1QWE A;  1M8M A;  1FYN A;  1YWP A;  2RQR A;  4DEY A;  2RN8 A;  2FPD A;  2EQI A;  2LQN A;  3RBB B;  1K0S A;  2L3P A;  1W70 A;  4JJB A;  2KYM A;  2CSI A;  3FJ5 A;  3H0H A;  4RTY A;  4ZNX A;  2J6F A;  4LE9 A;  2JMA A;  2KXC A;  1UJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...