2KYHA

Solution structure of the voltage-sensing domain of kvap
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
LRGLSDLGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure and Phospholipid Interactions of the Isolated Voltage-Sensor Domain from KvAP.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
molecule keywords Voltage-gated potassium channel
total genus 52
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 2kyhA00
1ORSC 4DXWA 4MVSA 4EKWA 3RVYA 4MTFA 3LUTB 4MVZA 3LNMB 3RVZA 4JTDB 4MTGA 4MVQA 5EK0A 4JTCB 4MTOA 4JTAB 3RW0A 2KYHA 4MVUA 4MVOA 4MVRA 4MS2A 2R9RB 4MW3A 4MVMA 4MW8A
chains in the Genus database with same CATH superfamily
4JZAA 2I15A 3GORA 4J7TA 4I1OB 2R7XA 3T6JA 2EPKX 2RSEB 3IHUA 3MYIA 4NTBA 1Q0MA 3U0CA 1YLMA 4FAPB 1LIHA 3RFYA 1TKNA 2HS5A 2EPNA 2GWWA 1TWGA 3QW1A 2BL2A 2EPOA 1VLTA 4LACB 3ZVRA 1R4TA 2IXPA 1T5OA 3JT1A 3QMKA 5AGFA 5TJ5E 3US6A 4QI2A 3K1HA 4H54A 2JX0A 4FESA 4DVZA 3VM6A 4NQFA 4EBBA 1OXKA 1QLEC 1OCCC 1AEPA 2Y69C 3C18A 4EWCA 2RD9A 1PD1A 3F47A 1OKKA 1Q0DA 1RXQA 2XL4A 3DI5A 3HNJA 2EPLX 3NG1A 2J45A 4JRZA 2ETSA 3ABMC 1IW7F 3NMIA 3JRTA 4Z9IA 1NLXA 2EIMC 1NZEA 3AJMA 3FOOA 3HNIA 5D92A 4CDYA 2D5RB 3U3BA 2Z15A 1QZXA 2WZGA 1WOLA 1NSGB 3LEVA 4U9DA 1H9TA 1V54C 4EKWA 2Q00A 2WL8A 4IB4A 4DJ9A 1OW7A 3DMDA 3LJBA 2LSEA 4G0HA 2YL3A 3C8ZA 4JVSA 2LFDA 2XRHA 3HJCA 4W8PA 5L3VA 2OJED 1KNYA 1M2VA 2H7BA 3A11A 1WWPA 4E0HA 3DAFA 4CS8C 1OW6A 4RD9A 2GDCA 2Y3BA 2ZXOA 3EHMA 1UG7A 3EGXA 3JZ0A 2HUJA 2ICWG 1ZZPA 1Y4CA 2WB7A 1JMWA 3RIPA 4E7SA 2CGEA 3UR3C 2QNLA 2H7OA 3UNGC 4HFFB 3LLKA 4C7OA 1QQ3A 3LESA 3GODA 2UUHA 3QZCA 2OJQA 3GWNA 3RQGA 3U9JA 2VC9A 5F28E 4XPWA 2XM4A 3SXMA 2A0UA 2HFIA 1D1CA 2G3KA 1CGNA 2LD6A 3NRHA 1VMAA 2ZXWC 1HMOA 1M56C 2YRFA 1NFOA 1M2VB 4FWVA 3V7OA 1LE2A 2O9XA 2KK1A 4ANJA 2HJMA 2J8WA 5JSLA 4CIHA 2VCAA 2WVOA 4YL3A 2XLOA 3M79A 3HNKA 1Q0FA 5EK0A 1YA9A 1A7VA 5EHHA 1Z23A 2KQ9A 3ZQYA 5CIVA 2XLEA 1D0XA 1G8XA 1HE1A 1OQCA 4I1MA 4KNWA 3GM1A 4MVUA 4MVOA 5DS4A 1TQGA 1OCZC 5E2QA 1I4ZA 3UMKA 3GM3A 2J7PD 1K04A 1SR2A 2R7SA 2A1DD 1ZHYA 4O79A 3KKBA 1EI7A 3N2ZB 2M64A 3O55A 4U5EE 2R7VA 3DD7A 1CGOA 5E3CA 3I5PA 1GM5A 3E70C 3E9VA 1YDIA 4PJMA 4BJ5A 3SNHA 3M15A 5BQIA 1QSPA 4U5DE 5KYNA 1ZVZA 1D1AA 4J30B 2CNWA 4ULVA 2HKVA 3U2MA 2QUPA 2XXAA 3QTHA 4LLEA 4P9FA 3OA1A 1APCA 3WHNA 1VYKA 4E7ZA 2V26A 1G5ZA 2L6GA 2J7PA 3U3FA 4H4KC 1V55C 4XLNF 3U2LA 1OR2A 2J9UA 4EIYA 1M2OA 1B68A 1NU7D 2HZ8A 2ZD9A 3QW0A 1A0BA 5FCLA 3UGOA 3RH3A 1JR8A 4YJWA 4MW3A 4BEJA 1YYJA 4MVMA 2WVQA 1RKEB 3V5XA 3HKKA 2R7WA 2PF4E 2GAQA 1H7IA 1T01A 3DE9A 2GA0A 1JRAA 4U5BE 4U5HA 3SEOA 1GGQA 2D4UA 3LLIA 1D0YA 3B29A 2DYRC 3MYFA 4N06A 3ZQVA 4EHPA 1OR3A 4MTFA 1U6HA 2NSFA 1PD0A 4K7BA 5DS6A 1Q0GA 2L6FA 3DM5A 1AVOB 2EIJC 3DXJF 5COFA 2XLWA 3O39A 1OKKD 2Y3HA 5CI9A 2R7OA 5JRAA 3AGTA 4HEAJ 1XZPA 2W45A 4O6MA 3DM9B 3V5YA 2NUPA 4JTAB 4DBRA 2OOCA 2Q4FA 2Y39A 2JPUA 4Z9HA 1LM3B 3QVZA 2YHSA 3ASOC 4D4NA 1RMVA 3IQ6A 3U5SA 1F1MA 5T3WA 3KH2A 1MNEA 2R25A 2R02A 3PHF2 4X0RA 3JTLO 2XL6A 4ULWA 3HNLA 1ST6A 3S29A 1Z3IX 2JD3A 4CBEA 1TFKB 4JC7A 1TWHA 2YLDA 2VB6A 2X0CA 2QE9A 2NG1A 5KYWB 4DOZA 2QY9A 2YVKA 2KSFA 2A69F 4XPYA 3LUTB 3LS0A 2XXAB 3MFNA 1V4AA 1ZHZA 4YT8A 5L3QA 4JTDB 2OG2A 3JYYA 1VYIA 1OCOC 3IEEA 4MVQA 3LEOA 5F5HA 1KU2A 4OD4A 2VASA 1BR2A 2HV6A 3H2VA 3M4CA 4JTCB 4B6IA 3FXHA 3RW0A 1TWAA 1ZHXA 3EH2A 3S84A 4BPMA 2L81A 4E17A 4F4BA 5DVWA 2OU6A 4OINF 1GQAA 1YARO 2IOQA 2P1AA 1CGME 3DJNB 1MNDA 2KNHA 3EQLF 3C63A 3TQOA 1YAUO 3PDMP 3TJ6A 1EA8A 2AVKA 3R7CA 2YL0A 4BEMJ 1VOMA 2PX0A 4IJJA 4DXWA 4MVSA 1ORYA 2H8AA 2ZPAA 3A9CA 2YKZA 4IAOA 4Q5SF 3KPHA 3S9OA 4XEVA 1MQVA 1I4YA 2CW0F 2L7AA 1FNTc 3TOLA 3TK0A 2MHRA 3C8GA 3RVZA 2L6HA 4ZLCA 3K1IA 3C62A 2LP4A 2P6VA 1S05A 3ZWIA 3PMRA 3ECSA 3G50A 2P61A 3EZIA 2IBFA 4ONSA 2W4BA 3JCUQ 3KMIA 4CJOA 4YL0A 5A6KA 2BC5A 3UMIA 1S7ZA 5L0DA 1A41A 1LE4A 3ZTMA 4AL1A 4YT4A 5KYYB 1PCXA 5JT4A 3RF3A 1ZU5A 3HLZA 3TD7A 1SMYF 1SF8A 2LFFA 3B0PA 4NTAA 1W2WA 5T3TA 3FDQA 4J7YA 2VCBA 1BZ4A 2KW3C 1TWCA 4KC9A 1L3PA 5JS5A 4RBNA 2XLHA 2HMZA 3MX3A 4JE9A 2R7QA 2XLVA 3L8JA 2PNOA 1WASA 5KYYA 1DOVA 4OD5A 3ZDLA 3ZC4A 4JW1A 1L7CA 2G3VA 4WABA 1A7EA 1QPUA 3AGUA 3FVYA 2J0XA 1JOGA 5IY5C 1E86A 4NC3A 2C04A 1OCRC 2IYLD 4Q4ZF 1FR0A 2E87A 1OW8A 1M57C 4AK9A 4DBQA 4AE4A 4PJNA 3OEOA 5COMA 5A6AA 5BQGA 2HMQA 2R05A 3NKDA 4IGGA 4BJ6C 3LS1A 1J8MF 3HTKC 4BJ6A 2B0HA 2IXNA 1BDJB 1G4US 3ZG1A 4O6YA 2M4EA 3B9QA 2WZFA 1RJ9A 3SXZA 3X1OA 1WTYA 4NTFA 3Q6MA 1IZMA 4XPXA 3RVYA 1HY5A 2NPUA 3H2UA 5L0JA 3S90A 3DKAA 1WGWA 2WZLA 4U9EA 1YJGA 1K05A 3LNMB 4L6RA 4CS9A 4PACA 1E84A 1FFTC 4IRUA 1EQ1A 4FX5A 2Q7RA 1RJ9B 3ABKC 3SXKA 3GEHA 5L0FA 1ZYRF 2EIKC 1J8YF 2EILC 2J46A 3C7JA 3Q6NA 2NUTA 2AU5A 4I44A 4P9TA 4G78A 2V3CC 3RYLA 1HMDA 3JSZA 5KYXA 3VAYA 3FAPB 1LPEA 5B1AC 3W2VA 1ZW2A 2MYSA 2HSQA 2I8BA 4YT2A 3BEHA 1WATA 1Z6AA 2L9JA 1R5ID 4N6HA 5E3AA 4LDRA 5JP7A 2R7UA 1YVIA 4JURI 5JVEA 1M6TA 3S0XA 1D0ZA 1G4WR 3GEEA 4BJTA 3U8VA 3POVA 4CS9C 1NBBA 1HW2A 1QKRA 2AWCA 1ZU4A 2AP3A 3EGDB 3AQCA 3GM2A 5COGA 5A6BD 3EG9A 3L0IA 3Q7GA 2DGJA 3S28A 1AUEA 3FHDA 4ER9A 3ASNC 4WGYA 4YWQA 3NDBB 4JEBA 4E18A 4QDLA 2ASRA 4JJGA 2OQMA 2Q3TA 4LLCA 4YN0B 4OIOF 2YEVA 3U8PA 1DOWA 2J9WA 4MS2A 3SXYA 3VF0A 3DZAA 3KL4A 1ZHTA 4JCHA 1JPJA 2CDQA 3AG3C 4CJGA 3JYHA 1ORSC 4JIOA 2KJGA 4LERA 1MMGA 2LK4A 1FFHA 4P6IC 3FAJA 4U5FE 2XLMA 4KNVA 2DB4A 4J32B 2FGYA 1MMDA 4OIPF 1Z63A 3RKOF 2YZSA 3W2WA 1Z5ZA 2CCYA 1RKEA 3EH1A 1YA7O 3JRMO 4EUKB 3TULA 4JCZA 4WJ0A 5L0CA 2R7RA 2YL1A 1UFBA 3V5ZA 1N1CA 3W4YA 3T6BA 2XSEA 4LDKA 1C03A 4Z9JA 4C3BA 3NMJA 1E85A 1C17M 1XZQA 1U89A 2HV7A 2OCCC 2OEXA 4HE8D 4PK4A 3EFOB 4YL1A 3GANA 3ZSUA 4ZLDA 2Q9CA 4CX9A 5L0IA 1BBHA 1LS4A 3T6GB 3B0VC 5DS5A 3WG7C 4G7OF 1NU9C 3BRJA 5F5FA 1VB5A 1LI7A 2B0JA 3NYMA 4MVRA 5AC4A 3NYLA 1H9GA 2PX3A 4YT5A 2KGOA 1TFOB 4A2NB 3F46A 4C3EA 2A6HF 2LIGA 2R03A 3T9OA 4D4XA 1T9KA 3K33A 2P7VA 4CS8A 1A7DA 1Y6DA 3NKEA 3DAGA 2XL8A 3ATPA 1Q0KA 1VLSA 4OIQF 2DYSC 3DE8A 3N24A 2FFHA 5KYUA 1JAFA 3CEXA 2F22A 3EPVA 1NFNA 1I5NA 2LCHA 3G4XA 3NMKA 1JPNA 4RDAA 5T1DB 5DQTA 5KYWA 1MMNA 1XWJA 2A0BA 3ITFA 1E2XA 4BJ1A 4CSAC 2A68F 2J9VA 4XTKA 1U0BB 2KC3A 4JJFA 5EGYA 3AG2C 3QVYA 2XS1A 3UGPA 2FAPB 3MLGA 4CS7A 1YYXA 4MQ9F 1ORJA 3O6XA 3R2PA 2UUIA 4CDAA 5AC5A 5KYXB 4PFOA 1FMWA 3CQZA 2Y3DA 1YZCA 3M4BA 2CNWD 4CDVA 2NUTB 3U9MA 4IARA 5JLIA 2ZXRA 2OEVA 2Q9AA 4AX2A 1FMVA 1E83A 1SZIA 4C7OB 3AQBA 3T4RA 3B71A 5DLJA 3I5QA 3J06A 4XEFA 4C3DA 2OKUA 2X51A 1EKYA 3K1IC 1SYQA 4A4AA 4WGZA 1NG1A 4EBJA 3VRCA 5A69A 4JKVA 5BUOA 3EGXB 5K0IA 3DWWA 5A6JA 1O3UA 1CPRA 4K1OA 5JUAA 4LDQA 3FMSA 3EG9B 3H65A 2EINC 4XLPF 5HSWA 1GS9A 3W8IA 2R9RB 3LAYA 4R32A 1OXBA 1K40A 4MVZA 3IQCA 1V74B 4CSAA 3FOPA 2XM0A 3AOUA 2XS8A 3CAXA 3L8IA 3UMHA 3AG4C 2YLIA 4BG0A 1O87A 1MMAA 2Y3GA 2ZXPA 4N4WA 4NY3A 5D91A 5A6BA 1LVKA 4IAQA 5CI8A 4BJ5C 4Q7CA 4GYTA 2PP4A 1YZAA 2VCCA 1KTMA 2IM8A 3C8GB 1FAPB 2WVNA 3KYJA 4GEHA 4PR9A 5B3SC 5KYUB 1D1BA 4MTGA 4PFPA 3ZTZA 4G7ZF 3Q7LA 3GWLA 2G62A 2BE5F 4MNDA 1PV3A 4I3MA 2A6EF 2J0WA 3C8GD 3W8HA 4O7GA 3EHNA 1TR2A 2PFDA 2QTVA 4XEKA 1CPQA 3ZIBA 5L0HA 3SP1A 4JEAA 4XQ1A 5B3IA 2Q9BA 1FTSA 2EPMX 1RKCA 3EZHA 2AWYA 2DI3A 2YQYA 3EFOA 2IXOA 3IPMO 2J9BA 4QI0A 3LNRA 1Z7Qc 4DRJB 5HV9A 3RQFA 2YLGA 3PCVA 4DRIB 4GQHA 5E33A 3NYJA 4N6CA 4W8KA 4AE4B 2TMVP 2LQGA 2XLDA 2NUPB 3O10A 3EJNA 1T6QA 1BR4A 2HJ3A 3M1CB 5B1BC 4KBLA 3L34A 3SZRA 4U5CE 4IWBA 3X2QC 3TJ5A 2KYHA 4G7HF 1WN0A 3IQ5A 4PJLA 1VTMP 2NSGA 2QLAA 2VH3A 3GEIA 3TOMA 3K66A 4M63A 2W4MA 1HW1A 4CIPA 1ZHWA 3N0TA 3B0UX 1BR1A 2MWQA 2GFHA 3RQEA 3WODF 4EBKA 2R7TA 5BQHA 1O5HA 3IQTA 4OIRF 4AL0A 4NCQA 3VYWA 1LKXA 1C02A 3EGDA 2PBEA 3SYNA 4K0DA 4YK5A 2CYDA 3S27A 256BA 2HSBA 3CZ6A 4DRHB 3L1MA 1VK5A 4PJJA 4HFKB 1HE9A 3KYIA 1RCPA 1LI5A 3AG1C 2YL7A 3ABLC 4E0IA 4U5GA 1T6UA 3I4UA 1T6IA 4MTOA 4XWJA 5FZTA 3DJUB 3G4ZA 5GPGB 3WAQA 2YWAA 3CSKA 3MBGA 3OWTA 2P0NA 5DQZA 4KI2A 4UDVA 5L0GA 2H7VC 2W9YA 3K7DA 1ZW3A 4DVYP 3JSEO 3K6BA 1H6GA 2C03A 2IXMA 1QVXA 4MW8A 1LS1A 4O6NA
chains in the Genus database with same CATH topology
1ORSC 4DXWA 4MVSA 4EKWA 3RVYA 4MTFA 3LUTB 4MVZA 3LNMB 3RVZA 4JTDB 4MTGA 4MVQA 5EK0A 4JTCB 4MTOA 4JTAB 3RW0A 2KYHA 4MVUA 4MVOA 4MVRA 4MS2A 2R9RB 4MW3A 4MVMA 4MW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORS C;  4DXW A;  4MVS A;  4EKW A;  3RVY A;  4MTF A;  3LUT B;  4MVZ A;  3LNM B;  3RVZ A;  4JTD B;  4MTG A;  4MVQ A;  5EK0 A;  4JTC B;  4MTO A;  4JTA B;  3RW0 A;  2KYH A;  4MVU A;  4MVO A;  4MVR A;  4MS2 A;  2R9R B;  4MW3 A;  4MVM A;  4MW8 A; 
#chains in the Genus database with same CATH topology
 4JZA A;  2I15 A;  3GOR A;  4J7T A;  4I1O B;  2R7X A;  3T6J A;  2EPK X;  2RSE B;  3IHU A;  3MYI A;  4NTB A;  1Q0M A;  3U0C A;  1YLM A;  4FAP B;  1LIH A;  3RFY A;  1TKN A;  2HS5 A;  2EPN A;  2GWW A;  1TWG A;  3QW1 A;  2BL2 A;  2EPO A;  1VLT A;  4LAC B;  3ZVR A;  1R4T A;  2IXP A;  1T5O A;  3JT1 A;  3QMK A;  5AGF A;  5TJ5 E;  3US6 A;  4QI2 A;  3K1H A;  4H54 A;  2JX0 A;  4FES A;  4DVZ A;  3VM6 A;  4NQF A;  4EBB A;  1OXK A;  1QLE C;  1OCC C;  1AEP A;  2Y69 C;  3C18 A;  4EWC A;  2RD9 A;  1PD1 A;  3F47 A;  1OKK A;  1Q0D A;  1RXQ A;  2XL4 A;  3DI5 A;  3HNJ A;  2EPL X;  3NG1 A;  2J45 A;  4JRZ A;  2ETS A;  3ABM C;  1IW7 F;  3NMI A;  3JRT A;  4Z9I A;  1NLX A;  2EIM C;  1NZE A;  3AJM A;  3FOO A;  3HNI A;  5D92 A;  4CDY A;  2D5R B;  3U3B A;  2Z15 A;  1QZX A;  2WZG A;  1WOL A;  1NSG B;  3LEV A;  4U9D A;  1H9T A;  1V54 C;  4EKW A;  2Q00 A;  2WL8 A;  4IB4 A;  4DJ9 A;  1OW7 A;  3DMD A;  3LJB A;  2LSE A;  4G0H A;  2YL3 A;  3C8Z A;  4JVS A;  2LFD A;  2XRH A;  3HJC A;  4W8P A;  5L3V A;  2OJE D;  1KNY A;  1M2V A;  2H7B A;  3A11 A;  1WWP A;  4E0H A;  3DAF A;  4CS8 C;  1OW6 A;  4RD9 A;  2GDC A;  2Y3B A;  2ZXO A;  3EHM A;  1UG7 A;  3EGX A;  3JZ0 A;  2HUJ A;  2ICW G;  1ZZP A;  1Y4C A;  2WB7 A;  1JMW A;  3RIP A;  4E7S A;  2CGE A;  3UR3 C;  2QNL A;  2H7O A;  3UNG C;  4HFF B;  3LLK A;  4C7O A;  1QQ3 A;  3LES A;  3GOD A;  2UUH A;  3QZC A;  2OJQ A;  3GWN A;  3RQG A;  3U9J A;  2VC9 A;  5F28 E;  4XPW A;  2XM4 A;  3SXM A;  2A0U A;  2HFI A;  1D1C A;  2G3K A;  1CGN A;  2LD6 A;  3NRH A;  1VMA A;  2ZXW C;  1HMO A;  1M56 C;  2YRF A;  1NFO A;  1M2V B;  4FWV A;  3V7O A;  1LE2 A;  2O9X A;  2KK1 A;  4ANJ A;  2HJM A;  2J8W A;  5JSL A;  4CIH A;  2VCA A;  2WVO A;  4YL3 A;  2XLO A;  3M79 A;  3HNK A;  1Q0F A;  5EK0 A;  1YA9 A;  1A7V A;  5EHH A;  1Z23 A;  2KQ9 A;  3ZQY A;  5CIV A;  2XLE A;  1D0X A;  1G8X A;  1HE1 A;  1OQC A;  4I1M A;  4KNW A;  3GM1 A;  4MVU A;  4MVO A;  5DS4 A;  1TQG A;  1OCZ C;  5E2Q A;  1I4Z A;  3UMK A;  3GM3 A;  2J7P D;  1K04 A;  1SR2 A;  2R7S A;  2A1D D;  1ZHY A;  4O79 A;  3KKB A;  1EI7 A;  3N2Z B;  2M64 A;  3O55 A;  4U5E E;  2R7V A;  3DD7 A;  1CGO A;  5E3C A;  3I5P A;  1GM5 A;  3E70 C;  3E9V A;  1YDI A;  4PJM A;  4BJ5 A;  3SNH A;  3M15 A;  5BQI A;  1QSP A;  4U5D E;  5KYN A;  1ZVZ A;  1D1A A;  4J30 B;  2CNW A;  4ULV A;  2HKV A;  3U2M A;  2QUP A;  2XXA A;  3QTH A;  4LLE A;  4P9F A;  3OA1 A;  1APC A;  3WHN A;  1VYK A;  4E7Z A;  2V26 A;  1G5Z A;  2L6G A;  2J7P A;  3U3F A;  4H4K C;  1V55 C;  4XLN F;  3U2L A;  1OR2 A;  2J9U A;  4EIY A;  1M2O A;  1B68 A;  1NU7 D;  2HZ8 A;  2ZD9 A;  3QW0 A;  1A0B A;  5FCL A;  3UGO A;  3RH3 A;  1JR8 A;  4YJW A;  4MW3 A;  4BEJ A;  1YYJ A;  4MVM A;  2WVQ A;  1RKE B;  3V5X A;  3HKK A;  2R7W A;  2PF4 E;  2GAQ A;  1H7I A;  1T01 A;  3DE9 A;  2GA0 A;  1JRA A;  4U5B E;  4U5H A;  3SEO A;  1GGQ A;  2D4U A;  3LLI A;  1D0Y A;  3B29 A;  2DYR C;  3MYF A;  4N06 A;  3ZQV A;  4EHP A;  1OR3 A;  4MTF A;  1U6H A;  2NSF A;  1PD0 A;  4K7B A;  5DS6 A;  1Q0G A;  2L6F A;  3DM5 A;  1AVO B;  2EIJ C;  3DXJ F;  5COF A;  2XLW A;  3O39 A;  1OKK D;  2Y3H A;  5CI9 A;  2R7O A;  5JRA A;  3AGT A;  4HEA J;  1XZP A;  2W45 A;  4O6M A;  3DM9 B;  3V5Y A;  2NUP A;  4JTA B;  4DBR A;  2OOC A;  2Q4F A;  2Y39 A;  2JPU A;  4Z9H A;  1LM3 B;  3QVZ A;  2YHS A;  3ASO C;  4D4N A;  1RMV A;  3IQ6 A;  3U5S A;  1F1M A;  5T3W A;  3KH2 A;  1MNE A;  2R25 A;  2R02 A;  3PHF 2;  4X0R A;  3JTL O;  2XL6 A;  4ULW A;  3HNL A;  1ST6 A;  3S29 A;  1Z3I X;  2JD3 A;  4CBE A;  1TFK B;  4JC7 A;  1TWH A;  2YLD A;  2VB6 A;  2X0C A;  2QE9 A;  2NG1 A;  5KYW B;  4DOZ A;  2QY9 A;  2YVK A;  2KSF A;  2A69 F;  4XPY A;  3LUT B;  3LS0 A;  2XXA B;  3MFN A;  1V4A A;  1ZHZ A;  4YT8 A;  5L3Q A;  4JTD B;  2OG2 A;  3JYY A;  1VYI A;  1OCO C;  3IEE A;  4MVQ A;  3LEO A;  5F5H A;  1KU2 A;  4OD4 A;  2VAS A;  1BR2 A;  2HV6 A;  3H2V A;  3M4C A;  4JTC B;  4B6I A;  3FXH A;  3RW0 A;  1TWA A;  1ZHX A;  3EH2 A;  3S84 A;  4BPM A;  2L81 A;  4E17 A;  4F4B A;  5DVW A;  2OU6 A;  4OIN F;  1GQA A;  1YAR O;  2IOQ A;  2P1A A;  1CGM E;  3DJN B;  1MND A;  2KNH A;  3EQL F;  3C63 A;  3TQO A;  1YAU O;  3PDM P;  3TJ6 A;  1EA8 A;  2AVK A;  3R7C A;  2YL0 A;  4BEM J;  1VOM A;  2PX0 A;  4IJJ A;  4DXW A;  4MVS A;  1ORY A;  2H8A A;  2ZPA A;  3A9C A;  2YKZ A;  4IAO A;  4Q5S F;  3KPH A;  3S9O A;  4XEV A;  1MQV A;  1I4Y A;  2CW0 F;  2L7A A;  1FNT c;  3TOL A;  3TK0 A;  2MHR A;  3C8G A;  3RVZ A;  2L6H A;  4ZLC A;  3K1I A;  3C62 A;  2LP4 A;  2P6V A;  1S05 A;  3ZWI A;  3PMR A;  3ECS A;  3G50 A;  2P61 A;  3EZI A;  2IBF A;  4ONS A;  2W4B A;  3JCU Q;  3KMI A;  4CJO A;  4YL0 A;  5A6K A;  2BC5 A;  3UMI A;  1S7Z A;  5L0D A;  1A41 A;  1LE4 A;  3ZTM A;  4AL1 A;  4YT4 A;  5KYY B;  1PCX A;  5JT4 A;  3RF3 A;  1ZU5 A;  3HLZ A;  3TD7 A;  1SMY F;  1SF8 A;  2LFF A;  3B0P A;  4NTA A;  1W2W A;  5T3T A;  3FDQ A;  4J7Y A;  2VCB A;  1BZ4 A;  2KW3 C;  1TWC A;  4KC9 A;  1L3P A;  5JS5 A;  4RBN A;  2XLH A;  2HMZ A;  3MX3 A;  4JE9 A;  2R7Q A;  2XLV A;  3L8J A;  2PNO A;  1WAS A;  5KYY A;  1DOV A;  4OD5 A;  3ZDL A;  3ZC4 A;  4JW1 A;  1L7C A;  2G3V A;  4WAB A;  1A7E A;  1QPU A;  3AGU A;  3FVY A;  2J0X A;  1JOG A;  5IY5 C;  1E86 A;  4NC3 A;  2C04 A;  1OCR C;  2IYL D;  4Q4Z F;  1FR0 A;  2E87 A;  1OW8 A;  1M57 C;  4AK9 A;  4DBQ A;  4AE4 A;  4PJN A;  3OEO A;  5COM A;  5A6A A;  5BQG A;  2HMQ A;  2R05 A;  3NKD A;  4IGG A;  4BJ6 C;  3LS1 A;  1J8M F;  3HTK C;  4BJ6 A;  2B0H A;  2IXN A;  1BDJ B;  1G4U S;  3ZG1 A;  4O6Y A;  2M4E A;  3B9Q A;  2WZF A;  1RJ9 A;  3SXZ A;  3X1O A;  1WTY A;  4NTF A;  3Q6M A;  1IZM A;  4XPX A;  3RVY A;  1HY5 A;  2NPU A;  3H2U A;  5L0J A;  3S90 A;  3DKA A;  1WGW A;  2WZL A;  4U9E A;  1YJG A;  1K05 A;  3LNM B;  4L6R A;  4CS9 A;  4PAC A;  1E84 A;  1FFT C;  4IRU A;  1EQ1 A;  4FX5 A;  2Q7R A;  1RJ9 B;  3ABK C;  3SXK A;  3GEH A;  5L0F A;  1ZYR F;  2EIK C;  1J8Y F;  2EIL C;  2J46 A;  3C7J A;  3Q6N A;  2NUT A;  2AU5 A;  4I44 A;  4P9T A;  4G78 A;  2V3C C;  3RYL A;  1HMD A;  3JSZ A;  5KYX A;  3VAY A;  3FAP B;  1LPE A;  5B1A C;  3W2V A;  1ZW2 A;  2MYS A;  2HSQ A;  2I8B A;  4YT2 A;  3BEH A;  1WAT A;  1Z6A A;  2L9J A;  1R5I D;  4N6H A;  5E3A A;  4LDR A;  5JP7 A;  2R7U A;  1YVI A;  4JUR I;  5JVE A;  1M6T A;  3S0X A;  1D0Z A;  1G4W R;  3GEE A;  4BJT A;  3U8V A;  3POV A;  4CS9 C;  1NBB A;  1HW2 A;  1QKR A;  2AWC A;  1ZU4 A;  2AP3 A;  3EGD B;  3AQC A;  3GM2 A;  5COG A;  5A6B D;  3EG9 A;  3L0I A;  3Q7G A;  2DGJ A;  3S28 A;  1AUE A;  3FHD A;  4ER9 A;  3ASN C;  4WGY A;  4YWQ A;  3NDB B;  4JEB A;  4E18 A;  4QDL A;  2ASR A;  4JJG A;  2OQM A;  2Q3T A;  4LLC A;  4YN0 B;  4OIO F;  2YEV A;  3U8P A;  1DOW A;  2J9W A;  4MS2 A;  3SXY A;  3VF0 A;  3DZA A;  3KL4 A;  1ZHT A;  4JCH A;  1JPJ A;  2CDQ A;  3AG3 C;  4CJG A;  3JYH A;  1ORS C;  4JIO A;  2KJG A;  4LER A;  1MMG A;  2LK4 A;  1FFH A;  4P6I C;  3FAJ A;  4U5F E;  2XLM A;  4KNV A;  2DB4 A;  4J32 B;  2FGY A;  1MMD A;  4OIP F;  1Z63 A;  3RKO F;  2YZS A;  3W2W A;  1Z5Z A;  2CCY A;  1RKE A;  3EH1 A;  1YA7 O;  3JRM O;  4EUK B;  3TUL A;  4JCZ A;  4WJ0 A;  5L0C A;  2R7R A;  2YL1 A;  1UFB A;  3V5Z A;  1N1C A;  3W4Y A;  3T6B A;  2XSE A;  4LDK A;  1C03 A;  4Z9J A;  4C3B A;  3NMJ A;  1E85 A;  1C17 M;  1XZQ A;  1U89 A;  2HV7 A;  2OCC C;  2OEX A;  4HE8 D;  4PK4 A;  3EFO B;  4YL1 A;  3GAN A;  3ZSU A;  4ZLD A;  2Q9C A;  4CX9 A;  5L0I A;  1BBH A;  1LS4 A;  3T6G B;  3B0V C;  5DS5 A;  3WG7 C;  4G7O F;  1NU9 C;  3BRJ A;  5F5F A;  1VB5 A;  1LI7 A;  2B0J A;  3NYM A;  4MVR A;  5AC4 A;  3NYL A;  1H9G A;  2PX3 A;  4YT5 A;  2KGO A;  1TFO B;  4A2N B;  3F46 A;  4C3E A;  2A6H F;  2LIG A;  2R03 A;  3T9O A;  4D4X A;  1T9K A;  3K33 A;  2P7V A;  4CS8 A;  1A7D A;  1Y6D A;  3NKE A;  3DAG A;  2XL8 A;  3ATP A;  1Q0K A;  1VLS A;  4OIQ F;  2DYS C;  3DE8 A;  3N24 A;  2FFH A;  5KYU A;  1JAF A;  3CEX A;  2F22 A;  3EPV A;  1NFN A;  1I5N A;  2LCH A;  3G4X A;  3NMK A;  1JPN A;  4RDA A;  5T1D B;  5DQT A;  5KYW A;  1MMN A;  1XWJ A;  2A0B A;  3ITF A;  1E2X A;  4BJ1 A;  4CSA C;  2A68 F;  2J9V A;  4XTK A;  1U0B B;  2KC3 A;  4JJF A;  5EGY A;  3AG2 C;  3QVY A;  2XS1 A;  3UGP A;  2FAP B;  3MLG A;  4CS7 A;  1YYX A;  4MQ9 F;  1ORJ A;  3O6X A;  3R2P A;  2UUI A;  4CDA A;  5AC5 A;  5KYX B;  4PFO A;  1FMW A;  3CQZ A;  2Y3D A;  1YZC A;  3M4B A;  2CNW D;  4CDV A;  2NUT B;  3U9M A;  4IAR A;  5JLI A;  2ZXR A;  2OEV A;  2Q9A A;  4AX2 A;  1FMV A;  1E83 A;  1SZI A;  4C7O B;  3AQB A;  3T4R A;  3B71 A;  5DLJ A;  3I5Q A;  3J06 A;  4XEF A;  4C3D A;  2OKU A;  2X51 A;  1EKY A;  3K1I C;  1SYQ A;  4A4A A;  4WGZ A;  1NG1 A;  4EBJ A;  3VRC A;  5A69 A;  4JKV A;  5BUO A;  3EGX B;  5K0I A;  3DWW A;  5A6J A;  1O3U A;  1CPR A;  4K1O A;  5JUA A;  4LDQ A;  3FMS A;  3EG9 B;  3H65 A;  2EIN C;  4XLP F;  5HSW A;  1GS9 A;  3W8I A;  2R9R B;  3LAY A;  4R32 A;  1OXB A;  1K40 A;  4MVZ A;  3IQC A;  1V74 B;  4CSA A;  3FOP A;  2XM0 A;  3AOU A;  2XS8 A;  3CAX A;  3L8I A;  3UMH A;  3AG4 C;  2YLI A;  4BG0 A;  1O87 A;  1MMA A;  2Y3G A;  2ZXP A;  4N4W A;  4NY3 A;  5D91 A;  5A6B A;  1LVK A;  4IAQ A;  5CI8 A;  4BJ5 C;  4Q7C A;  4GYT A;  2PP4 A;  1YZA A;  2VCC A;  1KTM A;  2IM8 A;  3C8G B;  1FAP B;  2WVN A;  3KYJ A;  4GEH A;  4PR9 A;  5B3S C;  5KYU B;  1D1B A;  4MTG A;  4PFP A;  3ZTZ A;  4G7Z F;  3Q7L A;  3GWL A;  2G62 A;  2BE5 F;  4MND A;  1PV3 A;  4I3M A;  2A6E F;  2J0W A;  3C8G D;  3W8H A;  4O7G A;  3EHN A;  1TR2 A;  2PFD A;  2QTV A;  4XEK A;  1CPQ A;  3ZIB A;  5L0H A;  3SP1 A;  4JEA A;  4XQ1 A;  5B3I A;  2Q9B A;  1FTS A;  2EPM X;  1RKC A;  3EZH A;  2AWY A;  2DI3 A;  2YQY A;  3EFO A;  2IXO A;  3IPM O;  2J9B A;  4QI0 A;  3LNR A;  1Z7Q c;  4DRJ B;  5HV9 A;  3RQF A;  2YLG A;  3PCV A;  4DRI B;  4GQH A;  5E33 A;  3NYJ A;  4N6C A;  4W8K A;  4AE4 B;  2TMV P;  2LQG A;  2XLD A;  2NUP B;  3O10 A;  3EJN A;  1T6Q A;  1BR4 A;  2HJ3 A;  3M1C B;  5B1B C;  4KBL A;  3L34 A;  3SZR A;  4U5C E;  4IWB A;  3X2Q C;  3TJ5 A;  2KYH A;  4G7H F;  1WN0 A;  3IQ5 A;  4PJL A;  1VTM P;  2NSG A;  2QLA A;  2VH3 A;  3GEI A;  3TOM A;  3K66 A;  4M63 A;  2W4M A;  1HW1 A;  4CIP A;  1ZHW A;  3N0T A;  3B0U X;  1BR1 A;  2MWQ A;  2GFH A;  3RQE A;  3WOD F;  4EBK A;  2R7T A;  5BQH A;  1O5H A;  3IQT A;  4OIR F;  4AL0 A;  4NCQ A;  3VYW A;  1LKX A;  1C02 A;  3EGD A;  2PBE A;  3SYN A;  4K0D A;  4YK5 A;  2CYD A;  3S27 A;  256B A;  2HSB A;  3CZ6 A;  4DRH B;  3L1M A;  1VK5 A;  4PJJ A;  4HFK B;  1HE9 A;  3KYI A;  1RCP A;  1LI5 A;  3AG1 C;  2YL7 A;  3ABL C;  4E0I A;  4U5G A;  1T6U A;  3I4U A;  1T6I A;  4MTO A;  4XWJ A;  5FZT A;  3DJU B;  3G4Z A;  5GPG B;  3WAQ A;  2YWA A;  3CSK A;  3MBG A;  3OWT A;  2P0N A;  5DQZ A;  4KI2 A;  4UDV A;  5L0G A;  2H7V C;  2W9Y A;  3K7D A;  1ZW3 A;  4DVY P;  3JSE O;  3K6B A;  1H6G A;  2C03 A;  2IXM A;  1QVX A;  4MW8 A;  1LS1 A;  4O6N A; 
#chains in the Genus database with same CATH homology
 1ORS C;  4DXW A;  4MVS A;  4EKW A;  3RVY A;  4MTF A;  3LUT B;  4MVZ A;  3LNM B;  3RVZ A;  4JTD B;  4MTG A;  4MVQ A;  5EK0 A;  4JTC B;  4MTO A;  4JTA B;  3RW0 A;  2KYH A;  4MVU A;  4MVO A;  4MVR A;  4MS2 A;  2R9R B;  4MW3 A;  4MVM A;  4MW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...