2KYHA

Solution structure of the voltage-sensing domain of kvap
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
LRGLSDLGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Solution Structure and Phospholipid Interactions of the Isolated Voltage-Sensor Domain from KvAP.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 52
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 2kyhA00
3RVYA 5EK0A 1ORSC 3RVZA 4DXWA 4MVSA 4MTFA 4MS2A 3LUTB 2KYHA 2R9RB 3LNMB 4MVRA 4MW8A 4MTOA 4JTAB 4MVOA 4JTCB 3RW0A 4MVZA 4MTGA 4EKWA 4JTDB 4MVQA 4MVMA 4MW3A 4MVUA
chains in the Genus database with same CATH superfamily
4JE9A 4KBLA 2ASRA 1EQ1A 3SXMA 4W8PA 1NU7D 4U5DE 1BR4A 2HMQA 5B3IA 3U0CA 1HY5A 3C62A 1OW7A 3EFOB 3HNLA 2NUTA 3C7JA 3QVZA 2Q9CA 2KSFA 2VASA 2XS1A 3IHUA 1QPUA 5KYUB 4NTAA 3EGDB 3TOMA 2CW0F 1ZZPA 2EIKC 1RCPA 1QSPA 1EKYA 2XL6A 1E84A 4Q4ZF 1CGOA 3BEHA 3AGUA 3M4BA 1TWHA 4U9EA 4H4KC 1G4WR 4F4BA 1CGME 3LESA 1U89A 3SZRA 3VYWA 2EPLX 4I1OB 2BC5A 2XS8A 3ZG1A 3KPHA 3TULA 5IY5C 3B9QA 1LE4A 4IRUA 4AE4B 1GGQA 2IM8A 3S27A 4ANJA 2DI3A 3LEOA 5JRAA 4C7OA 4YK5A 3DWWA 1T6QA 2A0BA 2X0CA 3W2VA 1YVIA 1Q0GA 3TQOA 1BDJB 3W4YA 1I5NA 1TWGA 2LIGA 4U5HA 4PJLA 2MYSA 4XEKA 1LPEA 2WZFA 3KKBA 3DE9A 3LNMB 5COMA 4MVRA 3QW1A 4L6RA 4YL0A 4OIPF 5L0IA 2C03A 2GDCA 1YAUO 2OEVA 3U3BA 1OR2A 3ZQYA 4CBEA 5DS4A 2Y3DA 2XLDA 4Q7CA 3TJ6A 2PBEA 2F22A 4AK9A 4RDAA 3ZC4A 1YA9A 3E9VA 3V5ZA 3X1OA 1Z23A 2XLEA 4N6CA 3NMIA 3DKAA 1NBBA 1SMYF 4J7TA 2ZPAA 3U3FA 1K40A 3AQCA 2Q00A 3GWLA 1G8XA 3SXZA 3EQLF 5JT4A 3E70C 1LIHA 4XPYA 4ONSA 3NMKA 4CS9C 3B0PA 4KI2A 1OCCC 1PD0A 2AU5A 2GAQA 2LD6A 4J7YA 1FFHA 1OKKD 3MYIA 4JW1A 3U9JA 3ZVRA 5HV9A 1RJ9B 1JPNA 5DVWA 4E7ZA 4CSAC 1NFNA 3DAFA 3DAGA 3HKKA 2IXMA 5CI9A 3FHDA 5A6BD 5COFA 1OKKA 4Z9JA 2OG2A 2Q4FA 3EFOA 4PACA 1A7EA 2V3CC 5TJ5E 4AX2A 2E87A 3MLGA 3B0UX 4JJGA 5K0IA 4OIRF 3UNGC 3EH2A 1AUEA 1BZ4A 3MYFA 5KYUA 3EGDA 4BJ6C 1RKEB 2W45A 4FESA 1WN0A 2CGEA 2QE9A 3ZSUA 1E2XA 1T6UA 3T6BA 3FMSA 1VOMA 1FAPB 3NYJA 5JVEA 1TR2A 4B6IA 4DBQA 2GFHA 4DRIB 2KQ9A 2XL4A 5A6JA 3ZIBA 3DZAA 5L0CA 3G50A 4E7SA 1JMWA 1Y4CA 3EZHA 3FOPA 3C8GD 3EG9B 3WHNA 4MTFA 4IJJA 4W8KA 1ZW3A 2Y69C 3KYIA 4MNDA 4RBNA 3EZIA 4FWVA 2VH3A 5FCLA 1FTSA 3SEOA 3JCUQ 1VYIA 4JTAB 2MHRA 3G4XA 3GM2A 1VLTA 4G0HA 4MVZA 3ZTZA 2XXAA 3NYMA 1EI7A 2P7VA 3C8ZA 1I4YA 3N0TA 2H7BA 1E85A 4C3EA 1LM3B 4CS8A 3Q6MA 4DRHB 1HE1A 4OIOF 1LS1A 5L3QA 1FMWA 3GWNA 1M2VB 1HMDA 2J8WA 2VCAA 1FMVA 1HW2A 4G78A 1PV3A 1ZVZA 4ER9A 3FAJA 1MQVA 3K7DA 3IQTA 3K66A 3GODA 1RMVA 1DOWA 1D1CA 4J32B 2R7RA 3R2PA 1FNTc 2O9XA 2RSEB 2OJED 3AGTA 1W2WA 4JCHA 1NU9C 4A4AA 2OOCA 5EHHA 2EPNA 3G4ZA 4GEHA 4UDVA 4OIQF 1XZQA 1QLEC 2M4EA 3B71A 2V26A 2RD9A 3I4UA 5DS5A 1HE9A 3UMHA 1T6IA 2NG1A 3F47A 1ORYA 4XEFA 3RW0A 4BEMJ 3GM1A 2AVKA 1H9TA 4KNVA 2HV6A 4P9TA 3U8PA 1S05A 2HS5A 3LLIA 2KNHA 3US6A 1ZYRF 3AG2C 4U5CE 3AOUA 2ICWG 4YT8A 4JEAA 2C04A 4XLPF 3LS0A 1C17M 2J7PD 3FAPB 3OA1A 2PFDA 3RVYA 1CGNA 2OQMA 2WZLA 4IAOA 3T6GB 3JSZA 3WODF 2NUPB 3TK0A 2QTVA 5KYWB 3MFNA 2J7PA 2YZSA 4C3DA 3FVYA 3QMKA 4MVSA 2J46A 1Q0MA 1ZW2A 3K6BA 4MS2A 1ZHWA 4ULWA 3POVA 2ZD9A 1KU2A 3S90A 2J9VA 1Z63A 3J06A 3RIPA 1GS9A 1A41A 2W9YA 1OXKA 2YL3A 4N4WA 3DM9B 1KNYA 1ZHTA 4XEVA 2QLAA 4DVZA 3AJMA 4QI0A 4IB4A 2XL8A 5CIVA 5KYXA 4JIOA 4M63A 3EJNA 3K33A 5B3SC 3TJ5A 4IAQA 3LJBA 4I1MA 5HSWA 4XLNF 4BJTA 1DOVA 3GORA 2PF4E 1OR3A 5JSLA 2R7OA 1ZU4A 2X51A 3LLKA 4EUKB 1FFTC 1V4AA 4YT4A 2FGYA 4LDQA 4PJMA 1D0XA 3GEIA 2WL8A 2R9RB 2R05A 3HNJA 5T3TA 3ASOC 2B0JA 3U2MA 2W4BA 4CS9A 2PP4A 4CX9A 1MMDA 4E17A 4CDVA 1M6TA 3NMJA 3S84A 4LDRA 3MX3A 1LE2A 3O10A 1Z6AA 4CSAA 3HLZA 2GA0A 2H7OA 4E18A 1K04A 4WGZA 4WGYA 5T3WA 3RFYA 4EKWA 3L8JA 5BUOA 1VB5A 2AWYA 1VK5A 2YVKA 4CS7A 4PK4A 1U6HA 4U5GA 4HEAJ 2XLHA 2HSQA 4D4NA 3DM5A 5E3AA 5E2QA 4BJ6A 4EIYA 2TMVP 4LDKA 5AC5A 5FZTA 2CNWD 4PR9A 5KYNA 3U2LA 1RKCA 3V5YA 2LFDA 3KYJA 2EILC 2CNWA 2UUHA 4AL1A 3EGXA 3UMKA 4U9DA 3W2WA 4DJ9A 1T01A 2GWWA 3PDMP 3SP1A 3ZWIA 1M57C 3AG4C 3CQZA 2Y3GA 3W8IA 3RQGA 1JOGA 4QDLA 3Q7GA 5BQIA 1YARO 3PCVA 3SXYA 2W4MA 3IEEA 4MVOA 1HW1A 4XTKA 2J0WA 3B0VC 3OEOA 1G5ZA 3VAYA 2XSEA 3ITFA 1UFBA 1ST6A 3IQ6A 2BL2A 3NKEA 5AGFA 4YT5A 2ZXRA 5JS5A 5L0HA 4BPMA 4K0DA 4YL3A 2EIMC 2YL1A 2YLGA 256BA 1IZMA 1MNEA 5E33A 3LNRA 3SNHA 1YDIA 3CEXA 4N6HA 5B1AC 3U8VA 2KGOA 3NYLA 3SXKA 4AE4A 3UR3C 3B29A 3CZ6A 5BQHA 4O6YA 2H8AA 2A6EF 5DQTA 4CJGA 1MMNA 2CCYA 2KYHA 3ZTMA 2YLDA 4XWJA 3U5SA 3DJUB 3N24A 2IXPA 1V54C 3K1IA 4JVSA 4MW8A 2DYRC 3WAQA 4EWCA 5L0JA 1E83A 3OWTA 2EIJC 2R02A 2I15A 1YLMA 2HFIA 4PJNA 1D1BA 2NSGA 3H65A 5L0DA 3O55A 3M79A 1O5HA 1SYQA 2LQGA 5D91A 3IQ5A 3JYHA 3M15A 1JAFA 3IQCA 4WJ0A 2NUTB 5COGA 1LI7A 2BE5F 2YHSA 3UMIA 3TOLA 4DRJB 4OD5A 2HUJA 2J0XA 4JURI 3ASNC 3KL4A 2L81A 1LVKA 3L0IA 3O6XA 4JKVA 5D92A 3L8IA 3C63A 4BG0A 3DXJF 3S28A 3L1MA 1EA8A 1LS4A 2WVQA 1SZIA 2Q9AA 4FX5A 2G62A 4K7BA 3EHMA 1V74B 2KC3A 3BRJA 5KYYB 4O7GA 2M64A 3NKDA 1VMAA 1Q0KA 2DB4A 1RJ9A 3VF0A 3V7OA 2YLIA 4H54A 3T9OA 1D1AA 4C7OB 1ORJA 3FXHA 3W8HA 1J8MF 1C03A 2FAPB 4U5EE 2ETSA 1OCOC 1Z3IX 1QKRA 1QQ3A 2WVNA 4NY3A 2UUIA 4R32A 2A6HF 4MW3A 4Z9HA 1YJGA 4QI2A 1NFOA 2YEVA 2R7UA 2CDQA 1RKEA 2EINC 1ORSC 1AEPA 4G7HF 4U5FE 2KK1A 4DXWA 1RXQA 2VC9A 2IYLD 2YL7A 4LERA 4ZLDA 2A1DD 2OEXA 2HJMA 1H7IA 1WATA 2P1AA 3AQBA 3LAYA 5JUAA 3NRHA 2OCCC 4HFKB 4IWBA 4DOZA 1LI5A 1LKXA 3GEEA 4WABA 3EG9A 4OINF 4BJ1A 3UGPA 3RKOF 1A7VA 3EH1A 1NSGB 2L6HA 2ZXOA 1M56C 2LP4A 5DS6A 3QTHA 1PD1A 3T4RA 2ZXPA 4NTFA 4XPXA 1T9KA 3V5XA 2PX3A 2VCBA 4CDAA 1L7CA 2PNOA 2Q9BA 3ABLC 4MVMA 1O3UA 5F28E 2AP3A 3AG3C 4Q5SF 1VLSA 2LSEA 5DQZA 2Z15A 3EHNA 1UG7A 5EK0A 2DYSC 5A6KA 5A69A 1N1CA 1YZCA 1F1MA 2HZ8A 3ABMC 4E0IA 2AWCA 1T5OA 4BJ5C 5JLIA 1GQAA 3ZDLA 1MMGA 1OCZC 1K05A 3M4CA 1M2VA 2LCHA 1L3PA 2R03A 4BEJA 2HJ3A 4FAPB 4DVYP 3GANA 3NG1A 4AL0A 1YZAA 2LFFA 5T1DB 3ECSA 3JRMO 3O39A 1YYXA 3FDQA 4PFPA 4MTGA 1ZHZA 2R7WA 5KYYA 4LACB 4ULVA 2IXOA 1S7ZA 2LK4A 2OU6A 4I44A 3HJCA 3RQFA 2EPOA 4XQ1A 1TFKB 1WOLA 2WVOA 3C8GB 2XLWA 4CIPA 2FFHA 2Q3TA 3CAXA 4IGGA 3IPMO 2R7XA 3C18A 2IBFA 3S29A 1WGWA 3RH3A 1O87A 2Y39A 5CI8A 1QVXA 2XXAB 2NUPA 2QY9A 3N2ZB 1I4ZA 4O79A 5KYWA 4LLEA 1Q0DA 1FR0A 5DLJA 2A0UA 2XLMA 3HTKC 2MWQA 2KJGA 4EBKA 1KTMA 1XZPA 2XLOA 1OXBA 4LLCA 2J9BA 2P61A 3K1HA 4YWQA 2J9WA 2H7VC 3HNIA 3I5QA 4CJOA 4XPWA 2QUPA 3RQEA 5EGYA 3EPVA 3DI5A 2EPMX 4CIHA 2KW3C 5E3CA 3U9MA 2OKUA 1Z5ZA 4E0HA 1BR2A 2XM4A 3QW0A 4K1OA 2L9JA 2WZGA 1MNDA 1HMOA 1WASA 2L7AA 3LS1A 4IARA 4NCQA 4OD4A 3RYLA 2A69F 3Q6NA 3RVZA 2YQYA 3WG7C 1E86A 1TQGA 3LEVA 1WWPA 2HSBA 4KNWA 3SYNA 1NLXA 1OQCA 1JR8A 2OJQA 1OW8A 2P0NA 2XM0A 4J30B 4U5BE 3RF3A 3S9OA 5A6AA 2R7SA 1J8YF 1TKNA 3LUTB 2R7VA 4PFOA 2NPUA 4HE8D 1MMAA 2XRHA 4YL1A 4X0RA 5F5HA 3GM3A 3JSEO 2QNLA 3L34A 4JC7A 1R4TA 2D5RB 5A6BA 1TFOB 3A9CA 4JCZA 3ZQVA 4O6MA 3F46A 4KC9A 3FOOA 4JRZA 2L6GA 3MBGA 4G7ZF 3DJNB 1V55C 2L6FA 1YA7O 1APCA 4MVUA 4EBJA 3PMRA 5L0FA 2J45A 2CYDA 1ZHYA 1CPRA 4NTBA 3JRTA 1XWJA 4NQFA 5AC4A 1IW7F 2PX0A 1JPJA 4HFFB 1TWCA 4YT2A 1Y6DA 1JRAA 2HV7A 2YRFA 3NDBB 4JJFA 5GPGB 1NG1A 1CPQA 1SF8A 1ZHXA 2I8BA 3ATPA 4PJJA 3C8GA 1QZXA 4MQ9F 3QZCA 4N06A 5BQGA 2G3VA 4RD9A 4GQHA 2DGJA 3HNKA 3T6JA 2HKVA 4EBBA 5KYXB 3H2VA 1GM5A 1M2OA 4I3MA 4DBRA 2YL0A 4CDYA 1SR2A 1H9GA 2VCCA 2XLVA 2G3KA 2VB6A 1ZU5A 1D0ZA 2JD3A 3I5PA 3JYYA 2R25A 4JEBA 4MVQA 4A2NB 1C02A 2ZXWC 3VRCA 1D0YA 1A7DA 4C3BA 1AVOB 3R7CA 1VTMP 1G4US 4EHPA 2NSFA 3QVYA 3KH2A 2EPKX 2J9UA 2A68F 3TD7A 3S0XA 4G7OF 5L0GA 3ABKC 3K1IC 3X2QC 1Q0FA 1R5ID 2Q7RA 1PCXA 4YN0B 1B68A 2IOQA 5L3VA 2Y3HA 1BBHA 4P9FA 3UGOA 3JZ0A 5F5FA 3VM6A 3EGXB 3A11A 1VYKA 1BR1A 2B0HA 3DD7A 3KMIA 4ZLCA 1H6GA 3H2UA 3PHF2 4BJ5A 2R7QA 3CSKA 3JTLO 2YWAA 2IXNA 3Q7LA 1A0BA 2YKZA 1TWAA 1Z7Qc 4MTOA 1OW6A 4CS8C 1OCRC 1U0BB 2P6VA 4JTCB 5B1BC 2R7TA 3JT1A 3M1CB 4D4XA 4P6IC 4YJWA 4JTDB 2WB7A 2JX0A 2D4UA 2JPUA 2Y3BA 4JZAA 4Z9IA 1NZEA 3DE8A 3GEHA 3DMDA 4GYTA 5JP7A 1YYJA 2HMZA 4O6NA 4NC3A 3AG1C 1WTYA
chains in the Genus database with same CATH topology
3RVYA 5EK0A 1ORSC 3RVZA 4DXWA 4MVSA 4MTFA 4MS2A 3LUTB 2KYHA 2R9RB 3LNMB 4MVRA 4MW8A 4MTOA 4JTAB 4MVOA 4JTCB 3RW0A 4MVZA 4MTGA 4EKWA 4JTDB 4MVQA 4MVMA 4MW3A 4MVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RVY A;  5EK0 A;  1ORS C;  3RVZ A;  4DXW A;  4MVS A;  4MTF A;  4MS2 A;  3LUT B;  2KYH A;  2R9R B;  3LNM B;  4MVR A;  4MW8 A;  4MTO A;  4JTA B;  4MVO A;  4JTC B;  3RW0 A;  4MVZ A;  4MTG A;  4EKW A;  4JTD B;  4MVQ A;  4MVM A;  4MW3 A;  4MVU A; 
#chains in the Genus database with same CATH topology
 4JE9 A;  4KBL A;  2ASR A;  1EQ1 A;  3SXM A;  4W8P A;  1NU7 D;  4U5D E;  1BR4 A;  2HMQ A;  5B3I A;  3U0C A;  1HY5 A;  3C62 A;  1OW7 A;  3EFO B;  3HNL A;  2NUT A;  3C7J A;  3QVZ A;  2Q9C A;  2KSF A;  2VAS A;  2XS1 A;  3IHU A;  1QPU A;  5KYU B;  4NTA A;  3EGD B;  3TOM A;  2CW0 F;  1ZZP A;  2EIK C;  1RCP A;  1QSP A;  1EKY A;  2XL6 A;  1E84 A;  4Q4Z F;  1CGO A;  3BEH A;  3AGU A;  3M4B A;  1TWH A;  4U9E A;  4H4K C;  1G4W R;  4F4B A;  1CGM E;  3LES A;  1U89 A;  3SZR A;  3VYW A;  2EPL X;  4I1O B;  2BC5 A;  2XS8 A;  3ZG1 A;  3KPH A;  3TUL A;  5IY5 C;  3B9Q A;  1LE4 A;  4IRU A;  4AE4 B;  1GGQ A;  2IM8 A;  3S27 A;  4ANJ A;  2DI3 A;  3LEO A;  5JRA A;  4C7O A;  4YK5 A;  3DWW A;  1T6Q A;  2A0B A;  2X0C A;  3W2V A;  1YVI A;  1Q0G A;  3TQO A;  1BDJ B;  3W4Y A;  1I5N A;  1TWG A;  2LIG A;  4U5H A;  4PJL A;  2MYS A;  4XEK A;  1LPE A;  2WZF A;  3KKB A;  3DE9 A;  3LNM B;  5COM A;  4MVR A;  3QW1 A;  4L6R A;  4YL0 A;  4OIP F;  5L0I A;  2C03 A;  2GDC A;  1YAU O;  2OEV A;  3U3B A;  1OR2 A;  3ZQY A;  4CBE A;  5DS4 A;  2Y3D A;  2XLD A;  4Q7C A;  3TJ6 A;  2PBE A;  2F22 A;  4AK9 A;  4RDA A;  3ZC4 A;  1YA9 A;  3E9V A;  3V5Z A;  3X1O A;  1Z23 A;  2XLE A;  4N6C A;  3NMI A;  3DKA A;  1NBB A;  1SMY F;  4J7T A;  2ZPA A;  3U3F A;  1K40 A;  3AQC A;  2Q00 A;  3GWL A;  1G8X A;  3SXZ A;  3EQL F;  5JT4 A;  3E70 C;  1LIH A;  4XPY A;  4ONS A;  3NMK A;  4CS9 C;  3B0P A;  4KI2 A;  1OCC C;  1PD0 A;  2AU5 A;  2GAQ A;  2LD6 A;  4J7Y A;  1FFH A;  1OKK D;  3MYI A;  4JW1 A;  3U9J A;  3ZVR A;  5HV9 A;  1RJ9 B;  1JPN A;  5DVW A;  4E7Z A;  4CSA C;  1NFN A;  3DAF A;  3DAG A;  3HKK A;  2IXM A;  5CI9 A;  3FHD A;  5A6B D;  5COF A;  1OKK A;  4Z9J A;  2OG2 A;  2Q4F A;  3EFO A;  4PAC A;  1A7E A;  2V3C C;  5TJ5 E;  4AX2 A;  2E87 A;  3MLG A;  3B0U X;  4JJG A;  5K0I A;  4OIR F;  3UNG C;  3EH2 A;  1AUE A;  1BZ4 A;  3MYF A;  5KYU A;  3EGD A;  4BJ6 C;  1RKE B;  2W45 A;  4FES A;  1WN0 A;  2CGE A;  2QE9 A;  3ZSU A;  1E2X A;  1T6U A;  3T6B A;  3FMS A;  1VOM A;  1FAP B;  3NYJ A;  5JVE A;  1TR2 A;  4B6I A;  4DBQ A;  2GFH A;  4DRI B;  2KQ9 A;  2XL4 A;  5A6J A;  3ZIB A;  3DZA A;  5L0C A;  3G50 A;  4E7S A;  1JMW A;  1Y4C A;  3EZH A;  3FOP A;  3C8G D;  3EG9 B;  3WHN A;  4MTF A;  4IJJ A;  4W8K A;  1ZW3 A;  2Y69 C;  3KYI A;  4MND A;  4RBN A;  3EZI A;  4FWV A;  2VH3 A;  5FCL A;  1FTS A;  3SEO A;  3JCU Q;  1VYI A;  4JTA B;  2MHR A;  3G4X A;  3GM2 A;  1VLT A;  4G0H A;  4MVZ A;  3ZTZ A;  2XXA A;  3NYM A;  1EI7 A;  2P7V A;  3C8Z A;  1I4Y A;  3N0T A;  2H7B A;  1E85 A;  4C3E A;  1LM3 B;  4CS8 A;  3Q6M A;  4DRH B;  1HE1 A;  4OIO F;  1LS1 A;  5L3Q A;  1FMW A;  3GWN A;  1M2V B;  1HMD A;  2J8W A;  2VCA A;  1FMV A;  1HW2 A;  4G78 A;  1PV3 A;  1ZVZ A;  4ER9 A;  3FAJ A;  1MQV A;  3K7D A;  3IQT A;  3K66 A;  3GOD A;  1RMV A;  1DOW A;  1D1C A;  4J32 B;  2R7R A;  3R2P A;  1FNT c;  2O9X A;  2RSE B;  2OJE D;  3AGT A;  1W2W A;  4JCH A;  1NU9 C;  4A4A A;  2OOC A;  5EHH A;  2EPN A;  3G4Z A;  4GEH A;  4UDV A;  4OIQ F;  1XZQ A;  1QLE C;  2M4E A;  3B71 A;  2V26 A;  2RD9 A;  3I4U A;  5DS5 A;  1HE9 A;  3UMH A;  1T6I A;  2NG1 A;  3F47 A;  1ORY A;  4XEF A;  3RW0 A;  4BEM J;  3GM1 A;  2AVK A;  1H9T A;  4KNV A;  2HV6 A;  4P9T A;  3U8P A;  1S05 A;  2HS5 A;  3LLI A;  2KNH A;  3US6 A;  1ZYR F;  3AG2 C;  4U5C E;  3AOU A;  2ICW G;  4YT8 A;  4JEA A;  2C04 A;  4XLP F;  3LS0 A;  1C17 M;  2J7P D;  3FAP B;  3OA1 A;  2PFD A;  3RVY A;  1CGN A;  2OQM A;  2WZL A;  4IAO A;  3T6G B;  3JSZ A;  3WOD F;  2NUP B;  3TK0 A;  2QTV A;  5KYW B;  3MFN A;  2J7P A;  2YZS A;  4C3D A;  3FVY A;  3QMK A;  4MVS A;  2J46 A;  1Q0M A;  1ZW2 A;  3K6B A;  4MS2 A;  1ZHW A;  4ULW A;  3POV A;  2ZD9 A;  1KU2 A;  3S90 A;  2J9V A;  1Z63 A;  3J06 A;  3RIP A;  1GS9 A;  1A41 A;  2W9Y A;  1OXK A;  2YL3 A;  4N4W A;  3DM9 B;  1KNY A;  1ZHT A;  4XEV A;  2QLA A;  4DVZ A;  3AJM A;  4QI0 A;  4IB4 A;  2XL8 A;  5CIV A;  5KYX A;  4JIO A;  4M63 A;  3EJN A;  3K33 A;  5B3S C;  3TJ5 A;  4IAQ A;  3LJB A;  4I1M A;  5HSW A;  4XLN F;  4BJT A;  1DOV A;  3GOR A;  2PF4 E;  1OR3 A;  5JSL A;  2R7O A;  1ZU4 A;  2X51 A;  3LLK A;  4EUK B;  1FFT C;  1V4A A;  4YT4 A;  2FGY A;  4LDQ A;  4PJM A;  1D0X A;  3GEI A;  2WL8 A;  2R9R B;  2R05 A;  3HNJ A;  5T3T A;  3ASO C;  2B0J A;  3U2M A;  2W4B A;  4CS9 A;  2PP4 A;  4CX9 A;  1MMD A;  4E17 A;  4CDV A;  1M6T A;  3NMJ A;  3S84 A;  4LDR A;  3MX3 A;  1LE2 A;  3O10 A;  1Z6A A;  4CSA A;  3HLZ A;  2GA0 A;  2H7O A;  4E18 A;  1K04 A;  4WGZ A;  4WGY A;  5T3W A;  3RFY A;  4EKW A;  3L8J A;  5BUO A;  1VB5 A;  2AWY A;  1VK5 A;  2YVK A;  4CS7 A;  4PK4 A;  1U6H A;  4U5G A;  4HEA J;  2XLH A;  2HSQ A;  4D4N A;  3DM5 A;  5E3A A;  5E2Q A;  4BJ6 A;  4EIY A;  2TMV P;  4LDK A;  5AC5 A;  5FZT A;  2CNW D;  4PR9 A;  5KYN A;  3U2L A;  1RKC A;  3V5Y A;  2LFD A;  3KYJ A;  2EIL C;  2CNW A;  2UUH A;  4AL1 A;  3EGX A;  3UMK A;  4U9D A;  3W2W A;  4DJ9 A;  1T01 A;  2GWW A;  3PDM P;  3SP1 A;  3ZWI A;  1M57 C;  3AG4 C;  3CQZ A;  2Y3G A;  3W8I A;  3RQG A;  1JOG A;  4QDL A;  3Q7G A;  5BQI A;  1YAR O;  3PCV A;  3SXY A;  2W4M A;  3IEE A;  4MVO A;  1HW1 A;  4XTK A;  2J0W A;  3B0V C;  3OEO A;  1G5Z A;  3VAY A;  2XSE A;  3ITF A;  1UFB A;  1ST6 A;  3IQ6 A;  2BL2 A;  3NKE A;  5AGF A;  4YT5 A;  2ZXR A;  5JS5 A;  5L0H A;  4BPM A;  4K0D A;  4YL3 A;  2EIM C;  2YL1 A;  2YLG A;  256B A;  1IZM A;  1MNE A;  5E33 A;  3LNR A;  3SNH A;  1YDI A;  3CEX A;  4N6H A;  5B1A C;  3U8V A;  2KGO A;  3NYL A;  3SXK A;  4AE4 A;  3UR3 C;  3B29 A;  3CZ6 A;  5BQH A;  4O6Y A;  2H8A A;  2A6E F;  5DQT A;  4CJG A;  1MMN A;  2CCY A;  2KYH A;  3ZTM A;  2YLD A;  4XWJ A;  3U5S A;  3DJU B;  3N24 A;  2IXP A;  1V54 C;  3K1I A;  4JVS A;  4MW8 A;  2DYR C;  3WAQ A;  4EWC A;  5L0J A;  1E83 A;  3OWT A;  2EIJ C;  2R02 A;  2I15 A;  1YLM A;  2HFI A;  4PJN A;  1D1B A;  2NSG A;  3H65 A;  5L0D A;  3O55 A;  3M79 A;  1O5H A;  1SYQ A;  2LQG A;  5D91 A;  3IQ5 A;  3JYH A;  3M15 A;  1JAF A;  3IQC A;  4WJ0 A;  2NUT B;  5COG A;  1LI7 A;  2BE5 F;  2YHS A;  3UMI A;  3TOL A;  4DRJ B;  4OD5 A;  2HUJ A;  2J0X A;  4JUR I;  3ASN C;  3KL4 A;  2L81 A;  1LVK A;  3L0I A;  3O6X A;  4JKV A;  5D92 A;  3L8I A;  3C63 A;  4BG0 A;  3DXJ F;  3S28 A;  3L1M A;  1EA8 A;  1LS4 A;  2WVQ A;  1SZI A;  2Q9A A;  4FX5 A;  2G62 A;  4K7B A;  3EHM A;  1V74 B;  2KC3 A;  3BRJ A;  5KYY B;  4O7G A;  2M64 A;  3NKD A;  1VMA A;  1Q0K A;  2DB4 A;  1RJ9 A;  3VF0 A;  3V7O A;  2YLI A;  4H54 A;  3T9O A;  1D1A A;  4C7O B;  1ORJ A;  3FXH A;  3W8H A;  1J8M F;  1C03 A;  2FAP B;  4U5E E;  2ETS A;  1OCO C;  1Z3I X;  1QKR A;  1QQ3 A;  2WVN A;  4NY3 A;  2UUI A;  4R32 A;  2A6H F;  4MW3 A;  4Z9H A;  1YJG A;  4QI2 A;  1NFO A;  2YEV A;  2R7U A;  2CDQ A;  1RKE A;  2EIN C;  1ORS C;  1AEP A;  4G7H F;  4U5F E;  2KK1 A;  4DXW A;  1RXQ A;  2VC9 A;  2IYL D;  2YL7 A;  4LER A;  4ZLD A;  2A1D D;  2OEX A;  2HJM A;  1H7I A;  1WAT A;  2P1A A;  3AQB A;  3LAY A;  5JUA A;  3NRH A;  2OCC C;  4HFK B;  4IWB A;  4DOZ A;  1LI5 A;  1LKX A;  3GEE A;  4WAB A;  3EG9 A;  4OIN F;  4BJ1 A;  3UGP A;  3RKO F;  1A7V A;  3EH1 A;  1NSG B;  2L6H A;  2ZXO A;  1M56 C;  2LP4 A;  5DS6 A;  3QTH A;  1PD1 A;  3T4R A;  2ZXP A;  4NTF A;  4XPX A;  1T9K A;  3V5X A;  2PX3 A;  2VCB A;  4CDA A;  1L7C A;  2PNO A;  2Q9B A;  3ABL C;  4MVM A;  1O3U A;  5F28 E;  2AP3 A;  3AG3 C;  4Q5S F;  1VLS A;  2LSE A;  5DQZ A;  2Z15 A;  3EHN A;  1UG7 A;  5EK0 A;  2DYS C;  5A6K A;  5A69 A;  1N1C A;  1YZC A;  1F1M A;  2HZ8 A;  3ABM C;  4E0I A;  2AWC A;  1T5O A;  4BJ5 C;  5JLI A;  1GQA A;  3ZDL A;  1MMG A;  1OCZ C;  1K05 A;  3M4C A;  1M2V A;  2LCH A;  1L3P A;  2R03 A;  4BEJ A;  2HJ3 A;  4FAP B;  4DVY P;  3GAN A;  3NG1 A;  4AL0 A;  1YZA A;  2LFF A;  5T1D B;  3ECS A;  3JRM O;  3O39 A;  1YYX A;  3FDQ A;  4PFP A;  4MTG A;  1ZHZ A;  2R7W A;  5KYY A;  4LAC B;  4ULV A;  2IXO A;  1S7Z A;  2LK4 A;  2OU6 A;  4I44 A;  3HJC A;  3RQF A;  2EPO A;  4XQ1 A;  1TFK B;  1WOL A;  2WVO A;  3C8G B;  2XLW A;  4CIP A;  2FFH A;  2Q3T A;  3CAX A;  4IGG A;  3IPM O;  2R7X A;  3C18 A;  2IBF A;  3S29 A;  1WGW A;  3RH3 A;  1O87 A;  2Y39 A;  5CI8 A;  1QVX A;  2XXA B;  2NUP A;  2QY9 A;  3N2Z B;  1I4Z A;  4O79 A;  5KYW A;  4LLE A;  1Q0D A;  1FR0 A;  5DLJ A;  2A0U A;  2XLM A;  3HTK C;  2MWQ A;  2KJG A;  4EBK A;  1KTM A;  1XZP A;  2XLO A;  1OXB A;  4LLC A;  2J9B A;  2P61 A;  3K1H A;  4YWQ A;  2J9W A;  2H7V C;  3HNI A;  3I5Q A;  4CJO A;  4XPW A;  2QUP A;  3RQE A;  5EGY A;  3EPV A;  3DI5 A;  2EPM X;  4CIH A;  2KW3 C;  5E3C A;  3U9M A;  2OKU A;  1Z5Z A;  4E0H A;  1BR2 A;  2XM4 A;  3QW0 A;  4K1O A;  2L9J A;  2WZG A;  1MND A;  1HMO A;  1WAS A;  2L7A A;  3LS1 A;  4IAR A;  4NCQ A;  4OD4 A;  3RYL A;  2A69 F;  3Q6N A;  3RVZ A;  2YQY A;  3WG7 C;  1E86 A;  1TQG A;  3LEV A;  1WWP A;  2HSB A;  4KNW A;  3SYN A;  1NLX A;  1OQC A;  1JR8 A;  2OJQ A;  1OW8 A;  2P0N A;  2XM0 A;  4J30 B;  4U5B E;  3RF3 A;  3S9O A;  5A6A A;  2R7S A;  1J8Y F;  1TKN A;  3LUT B;  2R7V A;  4PFO A;  2NPU A;  4HE8 D;  1MMA A;  2XRH A;  4YL1 A;  4X0R A;  5F5H A;  3GM3 A;  3JSE O;  2QNL A;  3L34 A;  4JC7 A;  1R4T A;  2D5R B;  5A6B A;  1TFO B;  3A9C A;  4JCZ A;  3ZQV A;  4O6M A;  3F46 A;  4KC9 A;  3FOO A;  4JRZ A;  2L6G A;  3MBG A;  4G7Z F;  3DJN B;  1V55 C;  2L6F A;  1YA7 O;  1APC A;  4MVU A;  4EBJ A;  3PMR A;  5L0F A;  2J45 A;  2CYD A;  1ZHY A;  1CPR A;  4NTB A;  3JRT A;  1XWJ A;  4NQF A;  5AC4 A;  1IW7 F;  2PX0 A;  1JPJ A;  4HFF B;  1TWC A;  4YT2 A;  1Y6D A;  1JRA A;  2HV7 A;  2YRF A;  3NDB B;  4JJF A;  5GPG B;  1NG1 A;  1CPQ A;  1SF8 A;  1ZHX A;  2I8B A;  3ATP A;  4PJJ A;  3C8G A;  1QZX A;  4MQ9 F;  3QZC A;  4N06 A;  5BQG A;  2G3V A;  4RD9 A;  4GQH A;  2DGJ A;  3HNK A;  3T6J A;  2HKV A;  4EBB A;  5KYX B;  3H2V A;  1GM5 A;  1M2O A;  4I3M A;  4DBR A;  2YL0 A;  4CDY A;  1SR2 A;  1H9G A;  2VCC A;  2XLV A;  2G3K A;  2VB6 A;  1ZU5 A;  1D0Z A;  2JD3 A;  3I5P A;  3JYY A;  2R25 A;  4JEB A;  4MVQ A;  4A2N B;  1C02 A;  2ZXW C;  3VRC A;  1D0Y A;  1A7D A;  4C3B A;  1AVO B;  3R7C A;  1VTM P;  1G4U S;  4EHP A;  2NSF A;  3QVY A;  3KH2 A;  2EPK X;  2J9U A;  2A68 F;  3TD7 A;  3S0X A;  4G7O F;  5L0G A;  3ABK C;  3K1I C;  3X2Q C;  1Q0F A;  1R5I D;  2Q7R A;  1PCX A;  4YN0 B;  1B68 A;  2IOQ A;  5L3V A;  2Y3H A;  1BBH A;  4P9F A;  3UGO A;  3JZ0 A;  5F5F A;  3VM6 A;  3EGX B;  3A11 A;  1VYK A;  1BR1 A;  2B0H A;  3DD7 A;  3KMI A;  4ZLC A;  1H6G A;  3H2U A;  3PHF 2;  4BJ5 A;  2R7Q A;  3CSK A;  3JTL O;  2YWA A;  2IXN A;  3Q7L A;  1A0B A;  2YKZ A;  1TWA A;  1Z7Q c;  4MTO A;  1OW6 A;  4CS8 C;  1OCR C;  1U0B B;  2P6V A;  4JTC B;  5B1B C;  2R7T A;  3JT1 A;  3M1C B;  4D4X A;  4P6I C;  4YJW A;  4JTD B;  2WB7 A;  2JX0 A;  2D4U A;  2JPU A;  2Y3B A;  4JZA A;  4Z9I A;  1NZE A;  3DE8 A;  3GEH A;  3DMD A;  4GYT A;  5JP7 A;  1YYJ A;  2HMZ A;  4O6N A;  4NC3 A;  3AG1 C;  1WTY A; 
#chains in the Genus database with same CATH homology
 3RVY A;  5EK0 A;  1ORS C;  3RVZ A;  4DXW A;  4MVS A;  4MTF A;  4MS2 A;  3LUT B;  2KYH A;  2R9R B;  3LNM B;  4MVR A;  4MW8 A;  4MTO A;  4JTA B;  4MVO A;  4JTC B;  3RW0 A;  4MVZ A;  4MTG A;  4EKW A;  4JTD B;  4MVQ A;  4MVM A;  4MW3 A;  4MVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...