2KYHA

Solution structure of the voltage-sensing domain of kvap
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
147
structure length
147
Chain Sequence
b'LRGLSDLGGRVRNIGDVMEHPLVELGVSYAALLSVIVVVVEYTMQLSGEYLVRLYLVDLILVIILWADYAYRAYKSGDPAGYVKKTLYEIPALVPAGLLALIEGHLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-gated potassium channel
publication title Solution Structure and Phospholipid Interactions of the Isolated Voltage-Sensor Domain from KvAP.
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Membrane protein
total genus 52
structure length 147
sequence length 147
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.350 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Voltage-gated potassium channels. Chain C 2kyhA00
4MW8A 4MVRA 4MTOA 4JTCB 3LUTB 4MVUA 4MTFA 3RVZA 5EK0A 4DXWA 4MW3A 3LNMB 4MVMA 4MS2A 1ORSC 4MVQA 4JTAB 3RVYA 4EKWA 2R9RB 4JTDB 2KYHA 4MVSA 4MTGA 3RW0A 4MVOA 4MVZA
chains in the Genus database with same CATH superfamily
3JCUQ 2VCCA 1U6HA 3CEXA 2G3KA 3AG1C 2EPNA 1OW8A 1BDJB 2PX0A 3EFOB 4PJJA 1OKKD 3HNLA 1M57C 3KPHA 2OEVA 2H7OA 1Z7Qc 3RVZA 4D4XA 3RQEA 3M4CA 1RKEA 1SMYF 2M4EA 2LQGA 3RIPA 1LS4A 1TWHA 1VMAA 1Y6DA 1YAUO 2XM4A 5DVWA 2IXMA 3DWWA 4JCHA 3AG4C 3IQ5A 1APCA 5EHHA 4DVYP 2FAPB 2LSEA 4U9EA 3S29A 3NKEA 4BJ6A 1TWAA 3HNKA 5CI9A 3ZSUA 1ZW2A 3X1OA 3RKOF 4IGGA 4LDKA 4ANJA 1Z5ZA 5B1BC 2LFFA 3NMJA 2XL6A 2YHSA 3TOMA 4DRHB 3DE8A 4JURI 4IJJA 1EKYA 2Y3HA 5KYWA 4MVRA 1ZZPA 3KL4A 3WODF 4OIOF 2Q3TA 3B29A 3QTHA 1MQVA 4WGYA 4NTAA 1TWGA 1TFKB 4XEFA 1V4AA 2EPKX 1IZMA 1D1AA 1YJGA 2PBEA 3LNRA 3FAJA 5EK0A 1J8YF 1NZEA 4CJOA 4CX9A 2H7VC 1XZQA 1OR3A 2Y39A 4JTAB 4CIHA 5DLJA 1JMWA 1RKEB 1A7DA 2XL8A 4EIYA 3DE9A 2D4UA 1ZU4A 2X51A 1N1CA 5JS5A 4DRJB 3S84A 2A0BA 5T1DB 5A6BA 2XLEA 2WVQA 2JPUA 1ORJA 2R05A 1T5OA 4M63A 3PMRA 2EPMX 3RYLA 2IXNA 3U8PA 4K1OA 1C17M 2LD6A 2YEVA 4PJMA 1QKRA 3ZG1A 4H54A 4J7YA 3L0IA 1C03A 3W8HA 2Q9BA 1RMVA 4MVUA 2ZXRA 4EWCA 2ETSA 2YL1A 2GWWA 4BJ5C 5KYWB 2AWCA 2PNOA 4I3MA 1TWCA 4CDYA 4EUKB 5GPGB 4IB4A 5BQGA 2FGYA 1OW7A 2ZXWC 3NRHA 5L0DA 1ZU5A 1QPUA 3K1IA 4YT8A 1ZHTA 4BJTA 3RVYA 2NPUA 4U5EE 4EKWA 2J0WA 4JTDB 4KBLA 3SZRA 3EPVA 4NCQA 1DOVA 2PF4E 5L3QA 2YL7A 2NG1A 4Q4ZF 4N6CA 1FFTC 2XL4A 4N4WA 2A6HF 2HV6A 3QW0A 2P0NA 4GYTA 1Q0MA 4OINF 5F28E 2M64A 3Q7GA 2RD9A 3U8VA 4NY3A 5D92A 4E7SA 1JRAA 5KYXA 5KYUA 3CQZA 1YLMA 4R32A 2EILC 1KNYA 3EGXA 2HSQA 2UUIA 2EINC 3J06A 4Z9JA 2HKVA 1QLEC 1WGWA 4XEVA 2YRFA 4CBEA 5KYYA 1SF8A 4XLPF 1FMWA 4I44A 1V74B 1FR0A 1RJ9A 4JJGA 5CI8A 1H7IA 3RQGA 1ORSC 2L6HA 2ASRA 1T6UA 3T6JA 4FWVA 3JSEO 3UNGC 4CS8A 5A6AA 3JSZA 3ZWIA 3FOOA 5KYNA 2RSEB 5DQZA 1ZVZA 1WTYA 5AC5A 4XLNF 3FVYA 2V26A 3ZIBA 3WG7C 4CDVA 3MYFA 3EH2A 1FMVA 1LI5A 2XLHA 2YLIA 5E3AA 1YZCA 3U5SA 2HJMA 2HMQA 2XLDA 4YN0B 3AGTA 3L8IA 3E9VA 5TJ5E 4FAPB 1U0BB 3LAYA 4A4AA 4ER9A 3BRJA 1E85A 3GEEA 3MFNA 3V5ZA 1OCZC 2WB7A 4QI0A 2R7SA 2OU6A 1HW1A 4MQ9F 2C03A 3AG2C 2MWQA 5KYUB 2QE9A 1OCCC 4OD4A 1JOGA 3TQOA 2NSFA 3EGXB 5L0FA 3H2UA 4JIOA 1WASA 4C7OA 5FZTA 2CGEA 1K04A 3ASOC 1LE2A 1M2OA 4L6RA 3ZQYA 4CSAC 4PJLA 1RJ9B 3AQBA 5B3SC 3GANA 4KNVA 4U5DE 2J9VA 4J30B 2O9XA 3KMIA 2Q7RA 2VCBA 1TQGA 1D0XA 1PD0A 1T6IA 1LI7A 1YVIA 1YYJA 3GM3A 1LKXA 1PV3A 2CNWA 2J0XA 3JYHA 4FESA 3DJUB 4CS8C 1LM3B 3NYJA 1V54C 3QVYA 2R25A 1MMDA 3JYYA 3UGOA 5L3VA 3POVA 3HKKA 1FAPB 2KW3C 2PP4A 1VOMA 2KQ9A 4LLCA 3NKDA 3GWLA 4YT2A 4MNDA 2DI3A 1J8MF 3N0TA 2NUTA 3ZQVA 3LNMB 1Y4CA 3JRTA 4CS7A 3B9QA 3O6XA 3FOPA 3C63A 4C3DA 3M15A 3UGPA 5F5FA 4LLEA 4C7OB 2Q9AA 2XS1A 2IYLD 2HV7A 3A11A 2OKUA 3B0PA 2IBFA 3DD7A 1RKCA 1L7CA 2R03A 3EQLF 4JZAA 3U2LA 2OOCA 4P9FA 4BEMJ 1ST6A 1ZHZA 3ITFA 1TKNA 1VYKA 5JSLA 5JP7A 2R02A 4QDLA 3T6GB 1OCRC 4GEHA 4MTFA 5BQIA 1MNEA 2XSEA 4DVZA 5A6JA 4U5FE 3U9JA 2P1AA 4Q7CA 1JAFA 1OQCA 4U5BE 3VAYA 5A6BD 1SR2A 3SXZA 4JJFA 3UMHA 4N06A 1XZPA 3H65A 2Y3DA 2WVOA 1XWJA 3O10A 2NUTB 1YA9A 1QQ3A 4JE9A 3CSKA 4ONSA 3JT1A 1HMDA 3Q6MA 1OW6A 4WGZA 4X0RA 4OIRF 1QVXA 2R7RA 3PHF2 4BEJA 3C8ZA 3S90A 2IM8A 1NLXA 4MVOA 1LIHA 4UDVA 2OQMA 2DYSC 3FXHA 3DXJF 3LEOA 2DYRC 4BJ6C 3EG9A 3C62A 2ZD9A 3LESA 2D5RB 1WATA 2XRHA 1BBHA 4HE8D 5COFA 3LLIA 1K40A 3N2ZB 2HSBA 1HY5A 3ZVRA 2J46A 2CDQA 2HUJA 2J7PA 4KC9A 2XS8A 4ULVA 1AVOB 2AWYA 2Q4FA 2WZFA 2Z15A 1R5ID 2L9JA 4AE4A 5FCLA 2YVKA 4IRUA 3NDBB 2NUPA 1NU7D 2JX0A 1PD1A 1YA7O 4MVMA 4P9TA 3KYJA 1MMGA 5JVEA 5K0IA 3IQ6A 2P6VA 3B0VC 5B1AC 1FTSA 2EIJC 2HS5A 2W45A 3BEHA 1G4WR 2TMVP 1HW2A 5A6KA 1QSPA 1OCOC 2P7VA 256BA 2V3CC 1U89A 2R7UA 4YWQA 3M1CB 1WWPA 2QUPA 2G62A 2ZXPA 1D1BA 1AEPA 3C8GD 3GM2A 3G4XA 4JKVA 3V5YA 4DBQA 4AK9A 5AC4A 1TFOB 3MLGA 3NYMA 5B3IA 4O7GA 4Q5SF 4MTOA 4JTCB 5JUAA 4G7HF 2LK4A 2PFDA 3I4UA 3DJNB 3EG9B 4O79A 2L6GA 4A2NB 5E33A 3RQFA 3C8GA 3L1MA 1LPEA 2XLVA 2ICWG 2QNLA 1G4US 1NG1A 3K1HA 4LACB 3ABMC 1KU2A 1Q0FA 2J9WA 4MS2A 2R7QA 3RH3A 4E7ZA 1VTMP 1D0ZA 4JC7A 3AG3C 3HNJA 4AE4B 4DBRA 2HJ3A 2CYDA 2YL0A 2WL8A 4EBKA 2NUPB 3GORA 4RD9A 1VB5A 3DKAA 3A9CA 3LEVA 1I4YA 1OXBA 1R4TA 3M4BA 3O55A 4W8KA 3UR3C 1ZYRF 4JCZA 3OA1A 1PCXA 3ZTZA 3T9OA 1ORYA 1M2VA 3EGDA 3K1IC 3LS0A 5JT4A 4J7TA 4JEBA 4HFKB 4YL3A 2VCAA 4G0HA 3SNHA 4AX2A 2HZ8A 5HV9A 3L34A 4NTFA 2HFIA 3DI5A 1T9KA 1EQ1A 3VRCA 5L0CA 1GS9A 3NMIA 1I4ZA 4IAOA 4F4BA 4MW3A 5L0JA 1VLTA 3GWNA 2KC3A 3U9MA 3F47A 3IEEA 2CNWD 4MVQA 1NU9C 3NYLA 4U5HA 5L0IA 3TJ5A 3RFYA 1T6QA 2BL2A 1E84A 3R2PA 1Z3IX 4O6NA 1A41A 1WN0A 2B0HA 3ABLC 3C8GB 1GQAA 1YYXA 5KYYB 1DOWA 2EIMC 2R9RB 3HLZA 3S9OA 3FHDA 3PDMP 4JEAA 5T3WA 4EBBA 3AGUA 4D4NA 3WHNA 1WOLA 3V7OA 3GEHA 1EI7A 3IQTA 3JZ0A 4LDRA 4OIPF 2Q00A 1M56C 3OWTA 3HTKC 4NC3A 3M79A 4E0HA 2NSGA 3LUTB 2W4BA 3K66A 3S0XA 3ECSA 3GODA 1M2VB 3EGDB 3MBGA 3UMKA 4DRIB 2LFDA 4Z9HA 4PFPA 3N24A 2W4MA 1Z23A 3F46A 3E70C 3DZAA 5KYXB 4PJNA 2XLOA 1NFNA 1UG7A 2ZPAA 2DGJA 3S28A 4E17A 1H9TA 4OIQF 1VK5A 2A68F 3TJ6A 1O87A 2VC9A 4KNWA 3EH1A 4NTBA 1JPNA 1T01A 1JPJA 4JW1A 3US6A 3AQCA 2LP4A 4WABA 2Q9CA 1ZHYA 2MHRA 3K7DA 3VM6A 4MTGA 1UFBA 2OEXA 1O5HA 1BR2A 4K7BA 2OJQA 1AUEA 2PX3A 4MVZA 3TD7A 1QZXA 4Z9IA 5L0GA 1Z63A 1BR4A 1HE1A 2F22A 4G78A 1TR2A 1NSGB 2DB4A 4CJGA 4EHPA 3DM5A 2R7XA 3FDQA 2W9YA 3GEIA 4ULWA 4YT5A 3SP1A 5E2QA 2G3VA 3UMIA 1LVKA 4WJ0A 4CIPA 5HSWA 5DS5A 1S7ZA 1IW7F 3HNIA 2OG2A 3EHNA 1JR8A 3PCVA 3T4RA 1V55C 2GDCA 1ZW3A 3Q6NA 4YK5A 1LE4A 1OKKA 3JTLO 2AP3A 4XWJA 1D1CA 2H8AA 2XM0A 2UUHA 3ASNC 4HFFB 3ZDLA 5A69A 1CGME 3Q7LA 4PFOA 4BJ1A 2WVNA 2VH3A 2Y69C 3KH2A 3SXMA 3DAGA 4BJ5A 2CW0F 1Q0GA 2J7PD 2JD3A 3B0UX 3W4YA 1HMOA 3TULA 2R7WA 4G7ZF 3MYIA 1VYIA 3ZTMA 4ZLDA 5CIVA 4ZLCA 1E83A 1G5ZA 2AVKA 2GFHA 2QY9A 3FAPB 3IPMO 3KKBA 4BPMA 2XLWA 2YLDA 4JVSA 3O39A 3G4ZA 2L81A 1CGOA 1EA8A 1H6GA 3CZ6A 2BE5F 3SXKA 3V5XA 4DXWA 5L0HA 3ATPA 3QVZA 5DQTA 1E86A 4XEKA 4LDQA 1NBBA 2LIGA 1H9GA 3C7JA 3EZHA 2WZLA 4IARA 3G50A 4RDAA 5DS6A 4J32B 4PACA 3SXYA 5EGYA 1M6TA 1RXQA 3EZIA 3GM1A 3H2VA 3CAXA 2KJGA 2KNHA 4P6IC 4XTKA 5COMA 3U0CA 4G7OF 2KSFA 5BQHA 2EPLX 5IY5C 2L6FA 2IXOA 1BZ4A 2J8WA 2MYSA 1F1MA 2R7OA 3I5PA 1Q0DA 3U2MA 1FFHA 3DMDA 3IQCA 4C3EA 3RW0A 5T3TA 5DS4A 4EBJA 3LJBA 1FNTc 5F5HA 2GA0A 2LCHA 3QZCA 2KGOA 4I1MA 1GGQA 2ZXOA 3MX3A 4FX5A 4H4KC 5D91A 3NG1A 1G8XA 3DM9B 5JLIA 1K05A 3U3FA 2FFHA 3C18A 2A69F 2X0CA 3FMSA 1ZHWA 3KYIA 4DJ9A 3DAFA 1A7VA 2HMZA 3X2QC 2H7BA 1ZHXA 4K0DA 2OJED 2QLAA 2WZGA 2CCYA 2XLMA 2A1DD 4CS9A 3I5QA 1YARO 5E3CA 3RF3A 1OXKA 1C02A 1MMNA 3K33A 4O6MA 2YWAA 3NMKA 3QW1A 4XQ1A 3HJCA 4RBNA 4O6YA 2QTVA 4YJWA 1Q0KA 2R7VA 3W2WA 4QI2A 3S27A 2Y3BA 2J9BA 1CGNA 1MNDA 4NQFA 4AL1A 1Z6AA 1O3UA 2YL3A 4JRZA 4MW8A 3TK0A 2A0UA 1SYQA 1HE9A 2C04A 3QMKA 4IWBA 2XXAA 2I8BA 3W2VA 2KK1A 1E2XA 2OCCC 4DOZA 1LS1A 4PR9A 1CPRA 2AU5A 1BR1A 2GAQA 4CSAA 2Y3GA 4U9DA 3T6BA 3AOUA 4XPWA 4YT4A 1NFOA 1CPQA 2YQYA 2J9UA 3AJMA 4GQHA 4MVSA 3TOLA 4AL0A 4C3BA 3SEOA 2IOQA 4PK4A 4KI2A 4LERA 2J45A 4CDAA 4IAQA 4W8PA 4E0IA 4CS9C 1A0BA 3EHMA 3EFOA 4HEAJ 4XPXA 3U3BA 3WAQA 1RCPA 2P61A 2EIKC 3IHUA 4I1OB 4E18A 1L3PA 3L8JA 1A7EA 3R7CA 1I5NA 3B71A 4B6IA 4XPYA 3EJNA 1KTMA 2R7TA 1D0YA 1YZAA 2A6EF 1YDIA 1OR2A 4BG0A 5AGFA 2XXAB 2I15A 2L7AA 2YKZA 4U5CE 5BUOA 3LLKA 1SZIA 2EPOA 4N6HA 1GM5A 3ZC4A 2IXPA 3JRMO 2VB6A 2B0JA 2BC5A 3SYNA 1MMAA 2E87A 3K6BA 3ABKC 4OD5A 4YL1A 3LS1A 3VYWA 1B68A 4U5GA 2VASA 2YLGA 5JRAA 2YZSA 2KYHA 3W8IA 5COGA 3VF0A 1W2WA 3OEOA 1VLSA 4YL0A 1S05A
chains in the Genus database with same CATH topology
4MW8A 4MVRA 4MTOA 4JTCB 3LUTB 4MVUA 4MTFA 3RVZA 5EK0A 4DXWA 4MW3A 3LNMB 4MVMA 4MS2A 1ORSC 4MVQA 4JTAB 3RVYA 4EKWA 2R9RB 4JTDB 2KYHA 4MVSA 4MTGA 3RW0A 4MVOA 4MVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW8 A;  4MVR A;  4MTO A;  4JTC B;  3LUT B;  4MVU A;  4MTF A;  3RVZ A;  5EK0 A;  4DXW A;  4MW3 A;  3LNM B;  4MVM A;  4MS2 A;  1ORS C;  4MVQ A;  4JTA B;  3RVY A;  4EKW A;  2R9R B;  4JTD B;  2KYH A;  4MVS A;  4MTG A;  3RW0 A;  4MVO A;  4MVZ A; 
#chains in the Genus database with same CATH topology
 3JCU Q;  2VCC A;  1U6H A;  3CEX A;  2G3K A;  3AG1 C;  2EPN A;  1OW8 A;  1BDJ B;  2PX0 A;  3EFO B;  4PJJ A;  1OKK D;  3HNL A;  1M57 C;  3KPH A;  2OEV A;  2H7O A;  1Z7Q c;  3RVZ A;  4D4X A;  3RQE A;  3M4C A;  1RKE A;  1SMY F;  2M4E A;  2LQG A;  3RIP A;  1LS4 A;  1TWH A;  1VMA A;  1Y6D A;  1YAU O;  2XM4 A;  5DVW A;  2IXM A;  3DWW A;  4JCH A;  3AG4 C;  3IQ5 A;  1APC A;  5EHH A;  4DVY P;  2FAP B;  2LSE A;  4U9E A;  3S29 A;  3NKE A;  4BJ6 A;  1TWA A;  3HNK A;  5CI9 A;  3ZSU A;  1ZW2 A;  3X1O A;  3RKO F;  4IGG A;  4LDK A;  4ANJ A;  1Z5Z A;  5B1B C;  2LFF A;  3NMJ A;  2XL6 A;  2YHS A;  3TOM A;  4DRH B;  3DE8 A;  4JUR I;  4IJJ A;  1EKY A;  2Y3H A;  5KYW A;  4MVR A;  1ZZP A;  3KL4 A;  3WOD F;  4OIO F;  2Q3T A;  3B29 A;  3QTH A;  1MQV A;  4WGY A;  4NTA A;  1TWG A;  1TFK B;  4XEF A;  1V4A A;  2EPK X;  1IZM A;  1D1A A;  1YJG A;  2PBE A;  3LNR A;  3FAJ A;  5EK0 A;  1J8Y F;  1NZE A;  4CJO A;  4CX9 A;  2H7V C;  1XZQ A;  1OR3 A;  2Y39 A;  4JTA B;  4CIH A;  5DLJ A;  1JMW A;  1RKE B;  1A7D A;  2XL8 A;  4EIY A;  3DE9 A;  2D4U A;  1ZU4 A;  2X51 A;  1N1C A;  5JS5 A;  4DRJ B;  3S84 A;  2A0B A;  5T1D B;  5A6B A;  2XLE A;  2WVQ A;  2JPU A;  1ORJ A;  2R05 A;  1T5O A;  4M63 A;  3PMR A;  2EPM X;  3RYL A;  2IXN A;  3U8P A;  4K1O A;  1C17 M;  2LD6 A;  2YEV A;  4PJM A;  1QKR A;  3ZG1 A;  4H54 A;  4J7Y A;  3L0I A;  1C03 A;  3W8H A;  2Q9B A;  1RMV A;  4MVU A;  2ZXR A;  4EWC A;  2ETS A;  2YL1 A;  2GWW A;  4BJ5 C;  5KYW B;  2AWC A;  2PNO A;  4I3M A;  1TWC A;  4CDY A;  4EUK B;  5GPG B;  4IB4 A;  5BQG A;  2FGY A;  1OW7 A;  2ZXW C;  3NRH A;  5L0D A;  1ZU5 A;  1QPU A;  3K1I A;  4YT8 A;  1ZHT A;  4BJT A;  3RVY A;  2NPU A;  4U5E E;  4EKW A;  2J0W A;  4JTD B;  4KBL A;  3SZR A;  3EPV A;  4NCQ A;  1DOV A;  2PF4 E;  5L3Q A;  2YL7 A;  2NG1 A;  4Q4Z F;  4N6C A;  1FFT C;  2XL4 A;  4N4W A;  2A6H F;  2HV6 A;  3QW0 A;  2P0N A;  4GYT A;  1Q0M A;  4OIN F;  5F28 E;  2M64 A;  3Q7G A;  2RD9 A;  3U8V A;  4NY3 A;  5D92 A;  4E7S A;  1JRA A;  5KYX A;  5KYU A;  3CQZ A;  1YLM A;  4R32 A;  2EIL C;  1KNY A;  3EGX A;  2HSQ A;  2UUI A;  2EIN C;  3J06 A;  4Z9J A;  2HKV A;  1QLE C;  1WGW A;  4XEV A;  2YRF A;  4CBE A;  5KYY A;  1SF8 A;  4XLP F;  1FMW A;  4I44 A;  1V74 B;  1FR0 A;  1RJ9 A;  4JJG A;  5CI8 A;  1H7I A;  3RQG A;  1ORS C;  2L6H A;  2ASR A;  1T6U A;  3T6J A;  4FWV A;  3JSE O;  3UNG C;  4CS8 A;  5A6A A;  3JSZ A;  3ZWI A;  3FOO A;  5KYN A;  2RSE B;  5DQZ A;  1ZVZ A;  1WTY A;  5AC5 A;  4XLN F;  3FVY A;  2V26 A;  3ZIB A;  3WG7 C;  4CDV A;  3MYF A;  3EH2 A;  1FMV A;  1LI5 A;  2XLH A;  2YLI A;  5E3A A;  1YZC A;  3U5S A;  2HJM A;  2HMQ A;  2XLD A;  4YN0 B;  3AGT A;  3L8I A;  3E9V A;  5TJ5 E;  4FAP B;  1U0B B;  3LAY A;  4A4A A;  4ER9 A;  3BRJ A;  1E85 A;  3GEE A;  3MFN A;  3V5Z A;  1OCZ C;  2WB7 A;  4QI0 A;  2R7S A;  2OU6 A;  1HW1 A;  4MQ9 F;  2C03 A;  3AG2 C;  2MWQ A;  5KYU B;  2QE9 A;  1OCC C;  4OD4 A;  1JOG A;  3TQO A;  2NSF A;  3EGX B;  5L0F A;  3H2U A;  4JIO A;  1WAS A;  4C7O A;  5FZT A;  2CGE A;  1K04 A;  3ASO C;  1LE2 A;  1M2O A;  4L6R A;  3ZQY A;  4CSA C;  4PJL A;  1RJ9 B;  3AQB A;  5B3S C;  3GAN A;  4KNV A;  4U5D E;  2J9V A;  4J30 B;  2O9X A;  3KMI A;  2Q7R A;  2VCB A;  1TQG A;  1D0X A;  1PD0 A;  1T6I A;  1LI7 A;  1YVI A;  1YYJ A;  3GM3 A;  1LKX A;  1PV3 A;  2CNW A;  2J0X A;  3JYH A;  4FES A;  3DJU B;  4CS8 C;  1LM3 B;  3NYJ A;  1V54 C;  3QVY A;  2R25 A;  1MMD A;  3JYY A;  3UGO A;  5L3V A;  3POV A;  3HKK A;  1FAP B;  2KW3 C;  2PP4 A;  1VOM A;  2KQ9 A;  4LLC A;  3NKD A;  3GWL A;  4YT2 A;  4MND A;  2DI3 A;  1J8M F;  3N0T A;  2NUT A;  3ZQV A;  3LNM B;  1Y4C A;  3JRT A;  4CS7 A;  3B9Q A;  3O6X A;  3FOP A;  3C63 A;  4C3D A;  3M15 A;  3UGP A;  5F5F A;  4LLE A;  4C7O B;  2Q9A A;  2XS1 A;  2IYL D;  2HV7 A;  3A11 A;  2OKU A;  3B0P A;  2IBF A;  3DD7 A;  1RKC A;  1L7C A;  2R03 A;  3EQL F;  4JZA A;  3U2L A;  2OOC A;  4P9F A;  4BEM J;  1ST6 A;  1ZHZ A;  3ITF A;  1TKN A;  1VYK A;  5JSL A;  5JP7 A;  2R02 A;  4QDL A;  3T6G B;  1OCR C;  4GEH A;  4MTF A;  5BQI A;  1MNE A;  2XSE A;  4DVZ A;  5A6J A;  4U5F E;  3U9J A;  2P1A A;  4Q7C A;  1JAF A;  1OQC A;  4U5B E;  3VAY A;  5A6B D;  1SR2 A;  3SXZ A;  4JJF A;  3UMH A;  4N06 A;  1XZP A;  3H65 A;  2Y3D A;  2WVO A;  1XWJ A;  3O10 A;  2NUT B;  1YA9 A;  1QQ3 A;  4JE9 A;  3CSK A;  4ONS A;  3JT1 A;  1HMD A;  3Q6M A;  1OW6 A;  4WGZ A;  4X0R A;  4OIR F;  1QVX A;  2R7R A;  3PHF 2;  4BEJ A;  3C8Z A;  3S90 A;  2IM8 A;  1NLX A;  4MVO A;  1LIH A;  4UDV A;  2OQM A;  2DYS C;  3FXH A;  3DXJ F;  3LEO A;  2DYR C;  4BJ6 C;  3EG9 A;  3C62 A;  2ZD9 A;  3LES A;  2D5R B;  1WAT A;  2XRH A;  1BBH A;  4HE8 D;  5COF A;  3LLI A;  1K40 A;  3N2Z B;  2HSB A;  1HY5 A;  3ZVR A;  2J46 A;  2CDQ A;  2HUJ A;  2J7P A;  4KC9 A;  2XS8 A;  4ULV A;  1AVO B;  2AWY A;  2Q4F A;  2WZF A;  2Z15 A;  1R5I D;  2L9J A;  4AE4 A;  5FCL A;  2YVK A;  4IRU A;  3NDB B;  2NUP A;  1NU7 D;  2JX0 A;  1PD1 A;  1YA7 O;  4MVM A;  4P9T A;  3KYJ A;  1MMG A;  5JVE A;  5K0I A;  3IQ6 A;  2P6V A;  3B0V C;  5B1A C;  1FTS A;  2EIJ C;  2HS5 A;  2W45 A;  3BEH A;  1G4W R;  2TMV P;  1HW2 A;  5A6K A;  1QSP A;  1OCO C;  2P7V A;  256B A;  2V3C C;  1U89 A;  2R7U A;  4YWQ A;  3M1C B;  1WWP A;  2QUP A;  2G62 A;  2ZXP A;  1D1B A;  1AEP A;  3C8G D;  3GM2 A;  3G4X A;  4JKV A;  3V5Y A;  4DBQ A;  4AK9 A;  5AC4 A;  1TFO B;  3MLG A;  3NYM A;  5B3I A;  4O7G A;  4Q5S F;  4MTO A;  4JTC B;  5JUA A;  4G7H F;  2LK4 A;  2PFD A;  3I4U A;  3DJN B;  3EG9 B;  4O79 A;  2L6G A;  4A2N B;  5E33 A;  3RQF A;  3C8G A;  3L1M A;  1LPE A;  2XLV A;  2ICW G;  2QNL A;  1G4U S;  1NG1 A;  3K1H A;  4LAC B;  3ABM C;  1KU2 A;  1Q0F A;  2J9W A;  4MS2 A;  2R7Q A;  3RH3 A;  4E7Z A;  1VTM P;  1D0Z A;  4JC7 A;  3AG3 C;  3HNJ A;  4AE4 B;  4DBR A;  2HJ3 A;  2CYD A;  2YL0 A;  2WL8 A;  4EBK A;  2NUP B;  3GOR A;  4RD9 A;  1VB5 A;  3DKA A;  3A9C A;  3LEV A;  1I4Y A;  1OXB A;  1R4T A;  3M4B A;  3O55 A;  4W8K A;  3UR3 C;  1ZYR F;  4JCZ A;  3OA1 A;  1PCX A;  3ZTZ A;  3T9O A;  1ORY A;  1M2V A;  3EGD A;  3K1I C;  3LS0 A;  5JT4 A;  4J7T A;  4JEB A;  4HFK B;  4YL3 A;  2VCA A;  4G0H A;  3SNH A;  4AX2 A;  2HZ8 A;  5HV9 A;  3L34 A;  4NTF A;  2HFI A;  3DI5 A;  1T9K A;  1EQ1 A;  3VRC A;  5L0C A;  1GS9 A;  3NMI A;  1I4Z A;  4IAO A;  4F4B A;  4MW3 A;  5L0J A;  1VLT A;  3GWN A;  2KC3 A;  3U9M A;  3F47 A;  3IEE A;  2CNW D;  4MVQ A;  1NU9 C;  3NYL A;  4U5H A;  5L0I A;  3TJ5 A;  3RFY A;  1T6Q A;  2BL2 A;  1E84 A;  3R2P A;  1Z3I X;  4O6N A;  1A41 A;  1WN0 A;  2B0H A;  3ABL C;  3C8G B;  1GQA A;  1YYX A;  5KYY B;  1DOW A;  2EIM C;  2R9R B;  3HLZ A;  3S9O A;  3FHD A;  3PDM P;  4JEA A;  5T3W A;  4EBB A;  3AGU A;  4D4N A;  3WHN A;  1WOL A;  3V7O A;  3GEH A;  1EI7 A;  3IQT A;  3JZ0 A;  4LDR A;  4OIP F;  2Q00 A;  1M56 C;  3OWT A;  3HTK C;  4NC3 A;  3M79 A;  4E0H A;  2NSG A;  3LUT B;  2W4B A;  3K66 A;  3S0X A;  3ECS A;  3GOD A;  1M2V B;  3EGD B;  3MBG A;  3UMK A;  4DRI B;  2LFD A;  4Z9H A;  4PFP A;  3N24 A;  2W4M A;  1Z23 A;  3F46 A;  3E70 C;  3DZA A;  5KYX B;  4PJN A;  2XLO A;  1NFN A;  1UG7 A;  2ZPA A;  2DGJ A;  3S28 A;  4E17 A;  1H9T A;  4OIQ F;  1VK5 A;  2A68 F;  3TJ6 A;  1O87 A;  2VC9 A;  4KNW A;  3EH1 A;  4NTB A;  1JPN A;  1T01 A;  1JPJ A;  4JW1 A;  3US6 A;  3AQC A;  2LP4 A;  4WAB A;  2Q9C A;  1ZHY A;  2MHR A;  3K7D A;  3VM6 A;  4MTG A;  1UFB A;  2OEX A;  1O5H A;  1BR2 A;  4K7B A;  2OJQ A;  1AUE A;  2PX3 A;  4MVZ A;  3TD7 A;  1QZX A;  4Z9I A;  5L0G A;  1Z63 A;  1BR4 A;  1HE1 A;  2F22 A;  4G78 A;  1TR2 A;  1NSG B;  2DB4 A;  4CJG A;  4EHP A;  3DM5 A;  2R7X A;  3FDQ A;  2W9Y A;  3GEI A;  4ULW A;  4YT5 A;  3SP1 A;  5E2Q A;  2G3V A;  3UMI A;  1LVK A;  4WJ0 A;  4CIP A;  5HSW A;  5DS5 A;  1S7Z A;  1IW7 F;  3HNI A;  2OG2 A;  3EHN A;  1JR8 A;  3PCV A;  3T4R A;  1V55 C;  2GDC A;  1ZW3 A;  3Q6N A;  4YK5 A;  1LE4 A;  1OKK A;  3JTL O;  2AP3 A;  4XWJ A;  1D1C A;  2H8A A;  2XM0 A;  2UUH A;  3ASN C;  4HFF B;  3ZDL A;  5A69 A;  1CGM E;  3Q7L A;  4PFO A;  4BJ1 A;  2WVN A;  2VH3 A;  2Y69 C;  3KH2 A;  3SXM A;  3DAG A;  4BJ5 A;  2CW0 F;  1Q0G A;  2J7P D;  2JD3 A;  3B0U X;  3W4Y A;  1HMO A;  3TUL A;  2R7W A;  4G7Z F;  3MYI A;  1VYI A;  3ZTM A;  4ZLD A;  5CIV A;  4ZLC A;  1E83 A;  1G5Z A;  2AVK A;  2GFH A;  2QY9 A;  3FAP B;  3IPM O;  3KKB A;  4BPM A;  2XLW A;  2YLD A;  4JVS A;  3O39 A;  3G4Z A;  2L81 A;  1CGO A;  1EA8 A;  1H6G A;  3CZ6 A;  2BE5 F;  3SXK A;  3V5X A;  4DXW A;  5L0H A;  3ATP A;  3QVZ A;  5DQT A;  1E86 A;  4XEK A;  4LDQ A;  1NBB A;  2LIG A;  1H9G A;  3C7J A;  3EZH A;  2WZL A;  4IAR A;  3G50 A;  4RDA A;  5DS6 A;  4J32 B;  4PAC A;  3SXY A;  5EGY A;  1M6T A;  1RXQ A;  3EZI A;  3GM1 A;  3H2V A;  3CAX A;  2KJG A;  2KNH A;  4P6I C;  4XTK A;  5COM A;  3U0C A;  4G7O F;  2KSF A;  5BQH A;  2EPL X;  5IY5 C;  2L6F A;  2IXO A;  1BZ4 A;  2J8W A;  2MYS A;  1F1M A;  2R7O A;  3I5P A;  1Q0D A;  3U2M A;  1FFH A;  3DMD A;  3IQC A;  4C3E A;  3RW0 A;  5T3T A;  5DS4 A;  4EBJ A;  3LJB A;  1FNT c;  5F5H A;  2GA0 A;  2LCH A;  3QZC A;  2KGO A;  4I1M A;  1GGQ A;  2ZXO A;  3MX3 A;  4FX5 A;  4H4K C;  5D91 A;  3NG1 A;  1G8X A;  3DM9 B;  5JLI A;  1K05 A;  3U3F A;  2FFH A;  3C18 A;  2A69 F;  2X0C A;  3FMS A;  1ZHW A;  3KYI A;  4DJ9 A;  3DAF A;  1A7V A;  2HMZ A;  3X2Q C;  2H7B A;  1ZHX A;  4K0D A;  2OJE D;  2QLA A;  2WZG A;  2CCY A;  2XLM A;  2A1D D;  4CS9 A;  3I5Q A;  1YAR O;  5E3C A;  3RF3 A;  1OXK A;  1C02 A;  1MMN A;  3K33 A;  4O6M A;  2YWA A;  3NMK A;  3QW1 A;  4XQ1 A;  3HJC A;  4RBN A;  4O6Y A;  2QTV A;  4YJW A;  1Q0K A;  2R7V A;  3W2W A;  4QI2 A;  3S27 A;  2Y3B A;  2J9B A;  1CGN A;  1MND A;  4NQF A;  4AL1 A;  1Z6A A;  1O3U A;  2YL3 A;  4JRZ A;  4MW8 A;  3TK0 A;  2A0U A;  1SYQ A;  1HE9 A;  2C04 A;  3QMK A;  4IWB A;  2XXA A;  2I8B A;  3W2V A;  2KK1 A;  1E2X A;  2OCC C;  4DOZ A;  1LS1 A;  4PR9 A;  1CPR A;  2AU5 A;  1BR1 A;  2GAQ A;  4CSA A;  2Y3G A;  4U9D A;  3T6B A;  3AOU A;  4XPW A;  4YT4 A;  1NFO A;  1CPQ A;  2YQY A;  2J9U A;  3AJM A;  4GQH A;  4MVS A;  3TOL A;  4AL0 A;  4C3B A;  3SEO A;  2IOQ A;  4PK4 A;  4KI2 A;  4LER A;  2J45 A;  4CDA A;  4IAQ A;  4W8P A;  4E0I A;  4CS9 C;  1A0B A;  3EHM A;  3EFO A;  4HEA J;  4XPX A;  3U3B A;  3WAQ A;  1RCP A;  2P61 A;  2EIK C;  3IHU A;  4I1O B;  4E18 A;  1L3P A;  3L8J A;  1A7E A;  3R7C A;  1I5N A;  3B71 A;  4B6I A;  4XPY A;  3EJN A;  1KTM A;  2R7T A;  1D0Y A;  1YZA A;  2A6E F;  1YDI A;  1OR2 A;  4BG0 A;  5AGF A;  2XXA B;  2I15 A;  2L7A A;  2YKZ A;  4U5C E;  5BUO A;  3LLK A;  1SZI A;  2EPO A;  4N6H A;  1GM5 A;  3ZC4 A;  2IXP A;  3JRM O;  2VB6 A;  2B0J A;  2BC5 A;  3SYN A;  1MMA A;  2E87 A;  3K6B A;  3ABK C;  4OD5 A;  4YL1 A;  3LS1 A;  3VYW A;  1B68 A;  4U5G A;  2VAS A;  2YLG A;  5JRA A;  2YZS A;  2KYH A;  3W8I A;  5COG A;  3VF0 A;  1W2W A;  3OEO A;  1VLS A;  4YL0 A;  1S05 A; 
#chains in the Genus database with same CATH homology
 4MW8 A;  4MVR A;  4MTO A;  4JTC B;  3LUT B;  4MVU A;  4MTF A;  3RVZ A;  5EK0 A;  4DXW A;  4MW3 A;  3LNM B;  4MVM A;  4MS2 A;  1ORS C;  4MVQ A;  4JTA B;  3RVY A;  4EKW A;  2R9R B;  4JTD B;  2KYH A;  4MVS A;  4MTG A;  3RW0 A;  4MVO A;  4MVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...