2KYMA

Solution structure of the bem1p sh3-ci domain from l.elongisporus in complex with ste20p peptide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
120
structure length
120
Chain Sequence
MAPLFAVTLYEFKAERDDELDVSPGENLSICAHYDYEWFIAKPINRLGGPGLVPVSYVRIIDLMDPAKYASVDTYDREQVMKIIDEFKIPTVEQWKDQTRRYKESSIQIGNGHGQSQGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bud emergence protein 1
publication title Structural and functional characterization of an unusual SH3 domain from the fungal scaffold protein, Bem1p
rcsb
source organism Lodderomyces elongisporus
molecule tags Signaling protein
total genus 15
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2kymA01
1YCSB 2LMJA 4RTUA 1ABQA 3ULRB 4OMMA 1ZUUA 2GBQA 1U06A 2F2WA 1T0JA 1E6HA 1X6GA 2HCKA 2KRNA 1K0SA 2KT1A 4CC7A 2C0TA 2L2PA 1I1JA 1BB9A 4WCIA 3QWXX 4EIKA 1B07A 3EG2A 2J06A 2W10A 2DL8A 1S1NA 2I0NA 1ZUYA 4Z89A 2CREA 5GJVB 2AK5A 1FMKA 2CUBA 1JO8A 1WLPB 1T0HA 1H3HA 2M51A 2FPEA 2J05A 2KXCA 4DEYA 2AZVA 1G2BA 1WA7A 2E5KA 2KR3A 1TUCA 2L3SA 3H0FA 3H0IA 4J9EA 3TSWA 2EKHA 1AWWA 2YDLA 4JJCA 1VYUA 1B3QA 1ABOA 1GCQA 2D8JA 5IHKA 3M0PA 2ROTA 1W1FA 2RNAA 2CSIA 2RQVA 3I5RA 3LH5A 1VA7A 2DL3A 5EC7A 1GL5A 4J9DA 2DVJA 4HVWA 1GCQC 1X2QA 3VS1A 1J3TA 2JS2A 3QWYA 2HBWA 1HD3A 2LJ3A 2H8HA 4RTZA 2OI3A 4IIMA 2KRSA 3PVLA 1N5ZA 2L3QA 2PZ1A 2V1RA 2GNCA 2XMFA 4ORZA 2DRKA 1SRMA 2KT8A 2CT3A 2MOXA 1PKTA 1AWXA 4E6RA 1WIEA 4AFZC 5L23A 5FWCA 1U5SA 1MV0B 1WX6A 2J7IA 2EYZA 1NLPC 4J9GA 1MUZA 2C0IA 1AZGB 1PNJA 2GTJA 4J9IA 2SEMA 4A63B 2JS0A 2K7AA 2K79A 1CKBA 1UDLA 3UA6A 1U3OA 4AFQC 1AOJA 3PVQA 2D8HA 4J9CA 1SHFA 1K76A 3M0QA 3VS6A 2JW4A 4RTTA 1NEBA 2KROA 4OMNA 1PRMC 2DILA 1GFDA 2BZXA 3U23A 3NPFA 1OPKA 1NG2A 3EHQA 2JM8A 2YSQA 2A36A 1AWJA 2W0ZA 3NMZC 2EBPA 2F2XA 2LCSA 1BK2A 1PWTA 1UJ0A 4CC3A 1UGVA 2KBTA 2RQWA 2VWFA 2JM9A 2O9SA 1Y0MA 4JJDA 2AKLA 1LCKA 2VVKA 2O2OA 1UHCA 2OAWA 1HJDA 1PHTA 1FYNA 2RN8A 2V1QA 2NWMA 2DL4A 3ZL7C 1NLOC 1NEGA 1XOVA 2LP5A 2MIOA 1X27A 2KYBA 3H0HA 3VRZA 2CDTA 1X2KA 3UF4A 5IHIA 4LUEA 3UA7A 4D8KA 4RTWA 1A0NB 1WXUA 2CT4A 3EHRA 4JPBW 3C0CA 3M0TA 2J6OA 4RTXA 5FW9A 3VS5A 1WI7A 2DX1A 2EGEA 2BZ8A 1NYFA 1RUWA 3VS3A 4J9BA 1SRLA 5IHNA 1UECA 2PNIA 4OMQA 1CSKA 2FPFA 5I22A 4QT7A 3VS0A 1ZLMA 1X43A 4Z8AA 4CC2A 4LE9A 1RLPC 2D0NA 2RMOA 2LJ0A 1ZX6A 1GCPA 1H92A 3R6NA 2LNHB 3NHNA 2ENMA 2KXDA 1K1ZA 2JMCA 1UFFA 5ECAA 2YT6A 4IIOA 1M30A 5IH2A 2IIMA 2PTKA 1QKWA 3M0UA 4ESRA 1SHGA 1YWOA 2ESWA 4K11A 3CQTA 2X3XD 4CC4B 1UE9A 2RQUA 2AZSA 2GGRA 2LJ1A 2KGTA 2BTTA 2F2VA 2BZYA 1YNZA 4HCKA 1AD5A 2LQNA 1AVZC 1NM7A 1QWEA 2ED1A 1SSHA 2YUQA 3NGPA 2K9GA 1WXBA 2O88A 1OPLA 1JU5C 1I07A 1T3LA 2ECZA 1VYTA 2KYMA 2DLPA 4F17A 3UATA 3EG0A 3IQLA 1JQQA 1KJWA 5GJWB 1RI9A 4KRTA 1OV3A 4RUGA 1UTIA 2EYXA 2K6DA 3VS2A 1ZBJA 2RF0A 2CH4W 1WXTA 1GBQA 2EGCA 2DF6A 4OMOA 1RLQC 2CUDA 4Z88A 1X69A 2CH4A 2AKKA 4GLMA 2DJQA 2SRCA 4M4ZA 5IXBA 1CKAA 1PKSA 2A28A 2M0YA 2EVRA 4JZ3A 1Y57A 2FRYA 2EPDA 3JV3A 2RQTA 1K9AA 1AWOA 1Z9QA 2O9VA 4D8DA 3RBBB 1KIKA 4LN2A 3I35A 2A08A 2YUNA 3EG1A 3VS4A 2X3WD 2JTEA 1AEYA 4OMPA 2J6FA 1W70A 1ARKA 1IO6A 4JJBA 1TUDA 1HSQA 1WDXA 5FWBA 4ZNXA 3PE0A 3EG3A 4OMLA 2FO0A 3SHWA 1E7OA 2G6FX 1H8KA 1OEBA 2DL7A 1QKXA 3TSZA 2A37A 4RTVA 2HDAA 2DL5A 3TVTA 3EGUA 2D1XA 1W6XA 1TG0A 1JEGA 4AG1C 1G83A 1WYXA 1SPKA 1GRIA 1YP5A 1KFZA 4J9HA 2DM1A 1YWPA 4Y92A 1E6GA 1ZUKA 2KRMA 1KSWA 1SEMA 3M0SA 4DEXA 1ZSGA 2QDLA 1M3BA 1BBZA 3M0RA 2RPNA 2GTOA 1EFNA 3I5SA 1BU1A 2DRMA 2EYWA 2OJ2A 4J9FA 3REBB 3FJ5A 2LQWA 2VKNA 3VRYA 3THKA 4GBQA 2ED0A 1UG1A 1MV3A 1YN8A 4AFUC 1K4US 2ABLA 2FRWA 2EQIA 4R0KA 2CSQA 1UUEA 4X1VA 2KEAA 2L0AA 2HSPA 1UJYA 2K3BA 2RQRA 2DMOA 4JZ4A 1JXMA 4FSSA 1M3CA 4F14A 3KFVA 2ROLA 1X6BA 2DBKA 1VYVA 1UHFA 4LNPA 2P4RA 2GQIA 1WFWA 1M8MA 1NYGA 3O5ZA 2B86A 5I11A 2J6KA 1PRLC 2DNUA 2LX7A 3GBQA 4F16A 3SEMA 2DA9A 2DE0X 5HCKA 3I9QA 1GFCA 3A98A 2KNBB 2DBMA 2YUOA 4AG2C 4HXJA 2NUZA 2EW3A 3VS7A 2MCNA 1AZEA 2EYYA 2DYBA 4LUDA 1Z9ZA 2C0OA 2LZ6B 4AFSC 1OOTA 4HVVA 2EGAA 1I0CA 1K0XA 2HEQA 1QLYA 1QWFA 1V1CA 3RNJA 3H41A 2JXBA 2FG0A 2O31A 2L3PA 4RTYA 1QCFA 2JT4A 4HVUA 1GBRA 1M27C 2YUPA 2JMAA 5IXFA 2K2MA 2FEIA 3REAB 1M3AA 1T3SA 2KE9A 2FPDA 1JXOA
chains in the Genus database with same CATH superfamily
1VQPQ 4RTUA 3JAME 2PVDB 2Y90A 3ULRB 4OMMA 5CQXA 4ELYC 2K2VA 1E6HA 1PCXA 5CKBA 2EFIA 3JRZA 2KRNA 1YJ9T 4MDXA 1Q81U 1IREB 4ZGEB 3RKWA 3M53A 1I1JA 1C0MA 1VQMT 1JJ2P 5LJ3d 4NS5A 1QVPA 1H641 2J06A 2W10A 2DL8A 4NL3A 2YHTA 1WPYA 2I0NA 3JCMQ 3NTKA 1K9MU 1UB4A 4C0DC 2CUBA 4II1A 1D3BA 3OS2A 3KBGA 1VIEA 3CC2A 3P8DA 2KXCA 2EQJA 4C0DB 5GAMd 1G2BA 1WQWA 4M75E 2BUDA 4DBQA 2E6NA 2EKHA 2HSEB 3VU3C 2E70A 3JCMf 2WSFE 5IHKA 1WQ7A 1B34A 4EMGA 2ROTA 3HPWA 2RNAA 3OYIA 2FZGB 2RQVA 3I5RA 4LXCA 5IN1A 4C8QC 3CD6A 2RB6A 4J9DA 2DVJA 4C92E 1VQ4A 4QQ6A 2JS2A 2ZPFB 5GAOn 2HBWA 2H8HA 2OI3A 4E47A 4QKUA 4C8QB 2P0PA 4KT0E 1SSFA 1VQOQ 2QQBA 3EFRA 2BKDN 3SD4A 4XTZA 2MI6A 3QUIA 4XTWA 2COWA 3TQ7P 4J7IA 1NPPA 1AWXA 1U5SA 2JJ9A 1FWZA 1MV0B 1WX6A 3CMEQ 4A4FA 2J7IA 2EYZA 2XDDA 1K73U 2VASA 3M55A 1VQ8Q 4A54A 4FL6A 4FM4B 5KYYA 4A63B 2K7AA 3H6ZA 2QAZA 2K79A 2HMAA 3HRSA 4L5GA 1U3OA 3OMGA 4FW2A 3CC2T 2RH2A 4ELZC 3M0QA 4IUVA 2JW4A 2K5LA 4DOWA 3G71Q 4RTTA 1QVGP 4OMNA 4BD3A 1VIFA 1GFDA 4FIBA 3CXCA 3I56Q 3U23A 5J3BA 1RAIB 5GMKl 5A0LA 2JM8A 5DLQE 3NMZC 2EBPA 1BKBA 3G6EA 1EX4A 3CD6T 1PWTA 2CP0A 1VQ4T 2GQVA 2QK0A 2O9SA 1XQHA 1LOJA 5M9OA 1MHNA 3OYBA 1KHCA 4HKEA 3MP1A 2OAWA 1ZSZA 2CGHA 1IXDA 2V1QA 2NWMA 1XTDA 2X4WA 1DJ7B 2LP5A 1R0BG 2MIOA 1X27A 3VUZA 3H0HA 3VRZA 5DLOA 1X75C 1G5VA 4Y91A 4X9CA 4LDYA 1PC0A 5IHIA 3OYHA 2CT4A 1WHHA 3EHRA 1JJ2A 3M0TA 4M7AC 2J6OA 4A53A 3WVDB 1WZOA 5GANe 1Q82U 2BZ8A 1NYFA 2EIFA 3VS3A 3A5ZB 4M7AB 4C0FA 3OYAA 2EQMA 1CSKA 2K4YA 3A1PA 4QT7A 3CCSA 1ZLMA 5GANj 4Z8AA 4CC2A 1YFNA 1RLPC 1V76A 2RMOA 1ZX6A 1VQ9Q 1YHQA 1AT1B 3R6OA 1MNEA 3A8OB 3EFOB 1TSFA 3NHNA 2KXDA 3HFNA 4X34A 1OULA 4C5IA 3CC4A 3JCMd 2JVVA 2EQUA 2LNVA 3E9FA 3CPWS 3PIPA 3HRUA 4PLIA 1WHJA 3BY7A 3G6ET 1KD1C 1NJIC 2KGTA 4EMHA 4LDVA 2BTTA 2R57A 1HXDA 1YNZA 4QVCA 1AD5A 1AVZC 3A8GB 3A8HB 1QWEA 2YUQA 3PTAA 5LJ5g 2K9GA 1KQ2A 2X4JA 4LD6A 1G3WA 1G8XA 4C0ZA 4RMOA 1VYTA 2KYMA 1TUGB 4J6XA 3UATA 1JQQA 1O9SA 4EPCA 1KG1A 1AHJB 1I4K1 3C95A 2K6DA 2ZPEB 2F1LA 5CCAA 2AT1B 1WXTA 1GBQA 3CCRA 2EAYA 3INZA 4Z88A 2AKKA 3CCST 1TU0B 4M4ZA 4PJNA 4KH0B 2MMPA 4Q5WA 5IT9E 2DZ9A 2EPDA 1ZHIA 1YHQT 3JV3A 1AWOA 1QVGA 4FW1A 1KIKA 2RHYA 2A08A 3CC4T 3OW2S 2F5TX 1TUDA 3PFSA 3OY9A 3JCMP 5FWBA 4OVAA 3CCVA 3UDCA 3SHWA 1N8RC 4QVZA 1HYOA 2E41A 2L8DA 1MNDA 5I21A 2HDAA 3JSCA 2EQKA 2XU8A 3TVTA 2GFAA 3HL8A 1TG0A 1JEGA 1IHVA 1G83A 1WYXA 5EG2A 1K8AU 2DM1A 4IUQA 4Y92A 5GANf 3KXTA 3OYGA 2RPNA 2JZ2A 3BDLA 4Y28E 7AT1B 3I5SA 3M56A 2EJGA 4CRIA 1Q86R 3FJ5A 1K9MR 4J5YA 4GBQA 4RG8A 2ED0A 1MV3A 2HBPA 3CCRT 4R0KA 2CSQA 3C94A 3FC3A 2L0AA 1UJYA 2RQRA 4KULA 4JZ4A 4PJOG 4JLIA 4M77C 4Z02A 1X6BA 3M4YA 1QP3A 1JRIA 1VYVA 3GF5A 1M1KC 1OQKA 2GQIA 3EGDB 5CVIA 1M8MA 2YXYA 3ME9A 3GBQA 3SEMA 2CP5A 2DA9A 1QP2A 3SWNA 4RG2A 3QYGB 1KQSS 2EJFA 1I5LA 2YUOA 3CCVT 2NUZA 2EW3A 5CKFA 1YJWA 4OGCA 3VUBA 3QO3A 1GXIE 2RJEA 1ZA1B 1G3YA 2C0OA 4M7DG 9ATCB 2EGAA 1OZ2A 3JB9F 2NUTB 2GF7A 5CKEA 3RUXA 2O31A 4F7UB 1W4SA 4XAXB 3OYFA 4OMFB 3QBYA 2JUFA 3EGXA 2L3RA 1VQLQ 1M3AA 1LJOA 1S72A 4GLKA 1WHKA 4C8QE 2QQSA 1X6GA 3RMSA 2DXTA 2E4HA 2MYSA 1ZA2B 1VQPA 1BB9A 4WCIA 2CZ7B 3QWXX 3E19A 4EIKA 3QDFA 3BE3A 3F70A 3G7ZA 1WNLA 3LH0A 4Z89A 5GJVB 3JCMX 2AK5A 3ASKA 3C12A 3EG9B 1X6OA 4E7KA 1H3HA 2M51A 1M2VA 4KGXB 1YJNQ 2CZ6B 2E5KA 2KR3A 3H0FA 3H0IA 2IVWA 2D0QB 2ZPBB 5CAIA 1NZ9A 1N9SA 3JB9D 1AWWA 2RM4A 1YJWT 2VGMA 2LCCA 2CYZB 1B3QA 3QZ9B 2KDSA 5GANd 4C0GA 1W1FA 4RKUE 1BI3A 3CCQQ 2NYSA 1FXXA 1O75A 3TEEA 1GCQC 1X2QA 4BB7A 3BDUA 4IUTA 1Q82R 2XK0A 2DTHA 2QXFA 2EKOA 1S72T 2PZ1A 5I2SA 3LWIA 4EMKC 4ORZA 4M75G 2DRKA 3T9NA 3LX7A 2MOXA 4AFZC 3L1AA 1MMAA 1VQOA 1VQPT 2FZKB 4XTXA 2K5IA 3P8BB 5LJ5e 2C0IA 5KE3A 4C92G 4E7IA 3CMEA 4O5VA 3CPFA 2V8IA 1CKBA 1UDLA 2HNIA 3BFMA 3UA6A 5LJ5j 1M9SA 4O6JA 3FLGA 3ER0A 3M9QA 1VQ8A 2CZ0B 1NEBA 2KROA 1UGRB 3D7SB 4BACA 4XK8E 2XHCA 4FYVB 2VV5A 5C0MA 1NG2A 4P5NA 1U8RA 3G71A 1M2OA 2A36A 2W0ZA 3I56A 4M77F 5LJ5h 1BCMA 2LCSA 1BK2A 4CC3A 1UGVA 1KD1U 1NJIU 2JM9A 1HK9A 4EDUA 2EJ9A 4JJDA 2AKLA 2VVKA 2O2OA 1UHCA 4NL2A 3M57A 2KQWA 3ZEHA 3ZL7C 1W2BA 4PNOA 4DOVA 4JLGA 2CDTA 1VUBA 1MMDA 3UF4A 3GNGA 2COYA 2DEUA 4RTWA 1A0NB 3GOXA 2DTOA 4J8OA 1VQOT 3AT1B 5FW9A 3VYGA 3VS5A 1WI7A 2K5FA 4PKCC 4RCBA 2PNIA 4OMQA 3VKIA 1EZZB 1TOVA 5J39A 3CMET 1X43A 5KCHA 2M1HA 1VQ8T 1Y7XA 2M0OA 3R6NA 1D09B 2O4XB 3QJ6A 5ECAA 1K8AR 4M77D 5IH2A 2IIMA 3HFOA 1QKWA 3M0UA 1VQ9A 2WSEE 4D6WA 4N4IA 2VUBA 4M77A 1OI1A 1YWOA 2ESWA 2GFUA 3G4SA 2X3XD 3G71T 3MP6A 1SKUB 1RAEB 2M9UA 3E2UA 2RQUA 2GGRA 3I56T 3CCJQ 3FJPA 3PNWC 1YITA 3OS0A 4X9DA 1EIFA 1R77A 2E5QA 1NM7A 1U1SA 2DXUA 3OYNA 2XICA 3NGPA 2NUPB 1QCOA 4KBMB 2DO3A 5LJ5f 1JU5C 2K57A 2PUOB 5FROA 3HP9A 3BW1A 2RI2A 1JB0E 1N27A 3IQLA 3VV0A 1KJWA 1OV3A 1UTIA 2DEQA 4A4HA 3V8JA 3META 3VS2A 5CKHA 2EGCA 1QVFS 3RDVA 1RLQC 2CH4A 4GLMA 3EAEA 4L59A 5IXBA 5KCOA 2M0YA 2EVRA 2OAUA 5KYWB 1Y57A 2HZYA 3WXMB 4F04B 1NE8A 2HL5C 2DXBA 3V7SA 4BI4A 2KY9A 3RBBB 3GNFB 4LN2A 5A2QE 4BI8B 1M1KU 3VS4A 4MMLA 2E3HA 3CCMQ 1VQ9T 2J6FA 5CO7A 5KYXB 4JJBA 4M77E 2QASA 1Q7YU 3G4ST 1HSQA 1VQ7Q 1WDXA 2JTFA 3PE0A 3EG3A 4OMLA 4PLLA 2G6FX 2X51A 3H9NA 1YITT 1PSEA 3MHXA 4E7HA 1V29B 3CBOA 3EGUA 2D9TA 2D1XA 2GCXA 3DLMA 1W6XA 2IG0A 3HRTA 1Y96B 4OB1B 1SPKA 1WJRA 1YWPA 1E6GA 4IUUA 2HL3A 2KRMA 2EWNA 1RAFB 4C5HA 1BBZA 4JRQA 2R5AA 1BU1A 4F7UE 1RACB 1M8VA 2VKNA 4OGEA 3VRYA 4FU6A 2P84A 1UG1A 4AFUC 1QVFP 1K4US 2ABLA 5I2MA 4ZGJB 2EQIA 4E7ZA 1TTHB 4ME7A 2CZ1B 4PJJA 2KEAA 3UWNA 1JXMA 4F14A 1PD1A 3M58A 1RL2A 1VQNQ 4EMKA 2WACA 1D1AA 3OMCA 3X26B 3HSBA 2RI3A 4LNPA 2P4RA 1KHIA 2QG9B 3DLLA 2OTJQ 1VOMA 2MK5A 3A8LB 2B86A 2J6KA 1PRLC 2ZAEA 3V8KA 2DNUA 2LX7A 4F16A 1BCOA 1M90C 2DIGA 2DD4A 1PD0A 2QEXA 4E7LA 2OTLQ 2E65A 3VS7A 3X24B 4M78C 4PL6A 1Q86C 4FYWB 3QXEB 1K9MC 4LUDA 3JCMV 3QKJA 1OOTA 4HVVA 3MO8A 4M78B 1RAHB 4QQGA 5LJ5d 1QLYA 4PFOA 4M75B 4C8QF 2VGNA 4LDUA 2BE7D 2PUKB 1GBRA 4N0AC 5GMKh 4E7SA 1T3SA 1B7TA 1D0YA 5AYFA 1YCSB 4LD9K 3CC7Q 5GAN4 2GBQA 4C92B 1BIBA 4IURA 1I5OB 2LVMA 2HCKA 1VQLA 3CPWP 4BDYA 2KT1A 3LW5E 4ATOA 2KVQG 3FB9A 4ANJA 2E1HA 3M59A 3MEUA 3EG2A 2QA4Q 2L5QA 1FX7A 1S1NA 1FMVA 2KSSA 1ZUYA 4PJLA 4UC4A 2HKNA 1FMKA 1JO8A 2M02A 2LX9A 2V8KA 3L2WA 2HAXA 2QGGA 1Q81R 2J05A 4OP0A 4DEYA 2AZVA 2PVOB 1NJIR 5FRMA 2RA2A 2L3SA 1YCYA 2QEXT 4J9EA 4C8QG 1UGPB 2YDLA 4DBFA 4JJCA 2P0QA 1VYUA 4C8QD 2O4XA 4PJMA 2LCLA 1YHQQ 4C8QA 1YJNA 1D3BB 4V2SA 2CSIA 5EC7A 2DL3A 1KC8C 1UEBA 1QMCA 1GL5A 4HVWA 1PSFA 2R58A 3VS1A 2WSCE 1J3TA 5GAMh 4LDWA 2LQ8A 2LJ3A 4IIMA 3CCQA 1BI1A 1VQKQ 5A0DA 3RERA 5D7UA 2LT1A 1B34B 2L3QA 2V1RA 3HKSA 2XMFA 2QQ9A 3OW2P 2KT8A 4JRKA 1JBMA 2DD5A 2VC8A 1VQLT 2DPPB 1PKTA 1WIEA 5L23A 3VJPA 3SB2A 5A0GA 2LT4A 4M7AF 3I55Q 2HQHA 2CP3A 4J9GA 4OB3B 1AZGB 3JCMc 3CMAQ 1PNJA 3QYHB 4J9IA 2JS0A 3L2QA 2MF2A 4AFQC 3NFCA 5FU7B 3CEYA 1WJSA 2D8HA 1K76A 1UGQB 1K73R 3QG1A 1Q82C 2RK1A 2MAMA 1YBYA 2DILA 1VQ5Q 4XU1A 1OU8A 4DQ2A 2K3YA 3NPFA 2C06A 3EHQA 4BDZA 1YJNT 2XDPA 4ZTJA 1OU9A 2YSQA 3CBPA 4NOYA 2EYQA 3M5AA 1UJ0A 2KBTA 2RQWA 2VWFA 2ZZDA 2RHUA 2PQWA 1Y0MA 1YIJQ 2FB7A 1LCKA 3CCQT 2LRQA 5KYNA 2LTOA 1PHTA 4M7AG 2RN8A 3MJXA 2DERA 2HQXA 2DL4A 2D6FA 4M7AD 2LDMA 1NEGA 1XOVA 4M7AA 1YI2Q 3CPWA 1XJWB 1ZSZC 3OBWA 5CR2A 2H3EB 1VQ6Q 1LVKA 4D8KA 1TXQA 1NPRA 2DXCA 1KQSP 3JB9G 4JPBW 5CQYA 2CP6A 1ZSZB 4A4EA 4C5EA 1M1KR 5GAN7 2DX1A 3CXCS 2EGEA 3EFOA 1RUWA 1SRLA 5IHNA 3PGGA 4N4GA 1LPLA 4ZN1A 1Q7YR 5I22A 5CIUA 3G1JA 4LE9A 5KYUB 2QGFB 2JN0A 1KK7A 1H92A 3LLRA 3E9GA 2LNHB 1H3ZA 4E2FB 2QQRA 4J6WA 3OYDA 2JMCA 2YT6A 1M5Q1 2PTKA 3MEWA 3PMTA 4ESRA 2K3XA 4OB2B 1I81A 4K11A 3JB9H 4CC4B 4DBRA 5HK3A 4PFZA 1OX9A 1N9RA 1IGQA 3H8ZA 1JJ2S 2F2VA 2BZYA 4JS4A 2KMTA 1WGSA 2CS7A 2RO0A 3CCJA 1SSHA 2XDBA 1WXBA 4JJNK 4M78D 3JCMh 1YJWQ 1OPLA 3OW2A 3CCLQ 1UGSB 4M7AE 2ECZA 2XI9A 2DLPA 3OS5A 3J80E 4C5GA 3GLXA 4QQDA 4KRTA 2EYXA 4MZMA 2A3LA 2M16A 3O8VA 3LGLA 1BI0A 1ZBJA 1D0ZA 2DF6A 4WTOB 4OMOA 1BI2A 2CUDA 3X25B 2DJQA 1IGUA 2SRCA 1CKAA 1PKSA 2QQAA 2YRDA 3SDZA 2QTVA 2FRYA 2RQTA 5LJ3g 1Z9QA 4ZTFA 3C4SA 2XIDA 2FVUA 2X3WD 1AEYA 3PIOA 1W70A 3CCEQ 1TS9A 5D6WA 5GAMg 5HK0A 4DA4A 1LNXA 1C6VX 3LYIA 5L8RE 3TREA 1M90U 3CCMA 1E7OA 3S3MA 3OYJA 1QKXA 3TSZA 2DYIA 2DL5A 2G3RA 5C6SA 1VQ7A 4HCCA 1Q86U 4F7UF 3X20B 3ZBDA 4AMCA 5GAN5 3CCJT 2E64A 1GRIA 5FU6C 4XU2A 3CCUQ 5GAOr 2VXFA 1ZUKA 3M0SA 2LC4A 4M78E 1ZSGA 2QDLA 1M3BA 3M0RA 5FU6B 1KQSA 1EFNA 1QVGS 3S3OA 3OYYA 2DRMA 2EYWA 2DZCA 2OJ2A 4J9FA 4M77G 3M4GA 2LQWA 3DB3A 1YJ9Q 3SFMA 2DKGA 4PK4A 4JRIA 1VQMQ 3VYHB 2RJDA 3EGDA 2FRWA 3OSVA 2P0KA 4JUVA 3QHSA 2ZPIB 4X1VA 2HKQB 2DMOA 3N5BB 3RKXA 2Y4YA 2QDYB 4FSSA 3KFVA 3J81E 4KUDK 1N8RU 1IB8A 2OX7A 4BY6C 3OYCA 1NYGA 4VUBA 1MMGA 1FMWA 1VQNA 5I11A 4PJOC 2VB6A 3OB9A 4F7UG 4BY6B 2NUTA 2OTJA 3L2RA 3HHTB 2IPOB 3I9QA 1ZBXA 1SG5A 4PJOB 4HXJA 4F7UA 3CCMT 4MZTA 3SWNC 4J83A 2MCNA 2EYYA 3OYKA 1RABB 4IKFA 2QI2A 1VQ7T 3P8HA 1Z9ZA 4AFSC 3PMIA 1K0XA 2XG8D 4KGVB 3SWNB 2OTLA 1QWFA 3QIIA 5GMKi 3RNJA 3H41A 5GAN2 2X9HA 4J6YA 2JXBA 2FG0A 1OX8A 4RTYA 1QCFA 1KC8U 2YUPA 4M7DC 2K2MA 4KGZB 1QQJA 8ATCB 8AT1B 3S6WA 1OZ3A 2FPDA 2RI5A 1NBEB 3WVEB 1JXOA 4J7FA 2B8AA 2AHJB 2LMJA 1ABQA 1ZUUA 4M7DB 1U06A 2F2WA 4XTYA 1T0JA 2COZA 3JCMJ 3OA6A 3EG9A 1K0SA 3Q1JA 5GAN8 4CC7A 2C0TA 2L2PA 3EGXB 3CC7A 1B07A 4CI0C 3JB9J 1IZ6A 4QW2A 2JTMA 4B9WA 3CC2Q 2YLBA 3QSUA 2CREA 3UT1A 1N6AA 5D6XA 1WLPB 2E3IA 1T0HA 3JCMW 1WHGA 2FPEA 1VQNT 3A8MB 2QA4A 2FYKA 2QTXA 1WA7A 2OTJT 3MP8A 5KYUA 2FL7A 1TUCA 1M1FA 3TSWA 3V7CA 4JS5A 3JCMg 3OYEA 3CD6Q 4MDWA 1VQ4Q 1ABOA 1G3TA 1KQ1A 2L89A 4LDXA 3RIRA 1GCQA 2D8JA 3L2ZA 3M0PA 2OTLT 1M2VB 3LH5A 1VA7A 3E1SA 5GMKm 3QWYA 4RTZA 1HD3A 4FT2A 3G4SQ 2DTIA 2KRSA 2V26A 3PVLA 1N5ZA 1I8FA 2DVEA 3QJYA 2GNCA 1YITQ 4XU3A 5GMKe 1U1TA 5KE2A 1SRMA 4A4GA 2CT3A 1VQKA 5GANh 1Q81C 4E6RA 4FCYA 5AT1B 4RCCA 5FWCA 5GMKj 2Z0WA 2E10A 5LL6S 1G3SA 3CC7T 2VXEA 4BE2A 5CKDA 1NLPC 4TVRA 3QDRB 1MUZA 2F5KA 4M75C 1F1BB 2GTJA 2R5MA 1R0CB 3AHUA 1PM3A 2SEMA 3LGFA 3I55A 1MGQA 2MWPA 3UPUA 1PG5B 1D1CA 4ZGDB 4YTLA 2QA4T 3CMAA 1AOJA 2MPXC 3PVQA 4J9CA 3TU4K 1SHFA 4L6V5 3VS6A 4XU0A 1P92A 4C92C 3DB4A 4HT9A 1BYMA 5GAOq 1PRMC 2BZXA 2RHIA 3G6EQ 1Y71A 3JCMb 1OPKA 2MWOA 1OYXA 1AWJA 4FYYB 1VQ5A 2KI7A 1TH7A 2F2XA 5LJ3e 2DK3A 3NTIA 3CBMA 5LJ3j 1HJDA 1FYNA 3RMQA 1D0XA 4PJOF 4HT8A 2PU9B 5GAMe 1NLOC 3MEVA 2KYBA 1YIJA 2DJZA 1VQKT 1X2KA 4LUEA 3UA7A 1KD1R 1WXUA 5GAMj 2NLUA 3V7RA 3C0CA 1K73C 4RTXA 5IAYA 3URGA 3CCSQ 1RADB 1XNIA 1YI2A 3FDRA 2CP7A 2P4TA 2RK2A 3NTHA 4HCBA 2ZCFB 1VQ6A 4J9BA 4B6MA 1UECA 5LJ3h 3L2VA 5FLXE 5GAOp 2FPFA 4MMKA 3I55T 1M90R 3VS0A 2BE9B 2D0NA 3CC4Q 1WHMA 2LJ0A 3CMAT 4M7DF 1GCPA 3FIFA 4FT4A 4MZPA 2ENMA 1K1ZA 4BI3A 1UFFA 4IIOA 3GP8A 1M30A 4GY5A 1RAAB 4XQ3A 1SHGA 1QVFA 5D6YA 5CK9A 1W2BS 5DY9A 2NUPA 3CQTA 3TCJA 1UE9A 1ACMB 4HCZA 1VQ5T 4AT1B 2AZSA 2YRCA 3MKDA 1IRXA 2RJCA 2YRVA 2LJ1A 4PJOD 4PFPA 3GPLA 4HCKA 2LQNA 4PJOA 4OF1A 3DKMA 1R8OB 2FZCB 4XTUA 3J7AF 5FRNA 4M77B 2YWWA 3L42A 1MMNA 2E6ZA 2ED1A 3GIBA 1X01A 3QZ5B 2QEXQ 1Y07A 5FU7C 2CP2A 1Q7YC 3X28B 2O88A 3EFSA 1ZQ1A 2X4YA 1I07A 1RAGB 1T3LA 2DETA 1YIJT 3CCRQ 1N8RR 4F17A 4XTVA 2X35A 3EG0A 5KYWA 2A7YA 3JB9I 5GJWB 2HD0A 1RI9A 2CKKA 4RUGA 3CCLA 4KH1B 1YI2T 5KYYB 2RF0A 2CH4W 2RHZA 1RI0A 1VQ6T 4B9XA 4M7DD 1X69A 3LWHA 4R56A 4M7DA 4A4KA 3MCAB 2A28A 5KYXA 4JZ3A 2DFUA 5GAN6 3M54A 4JRPA 2Y4XA 5HKCA 4BUGA 2ZPGB 1K9AA 4D8DA 2O9VA 3RR6A 3RESA 5LJ3f 3I35A 1BIAA 4ZN3A 2YUNA 3EG1A 4KUIA 2JTEA 4IUPA 3CCVQ 4OMPA 2V8JA 3QPHA 1W2BP 1ARKA 1IO6A 1Y96A 5GAOl 1KC8R 2JOYA 1QW1A 1IHWA 2ATCB 2RHXA 3HTRA 4ZNXA 5GAMf 2FO0A 3OYMA 4M78F 1H8KA 2KAFA 3OSSC 3V8LA 3CCEA 1OEBA 2DL7A 1M1GA 2A37A 4M75F 3MPUB 4RTVA 3FRNA 4PJOE 2XD0A 3RKYA 4AG1C 5GANg 4BE0A 3EH2A 1YP5A 5HY6A 1KFZA 4J9HA 1C1AA 1KSWA 1SEMA 2XKOC 2YLCA 4DEXA 3OS1A 3OQ5A 2AIRB 2GTOA 3CCUA 3JCMe 6AT1B 3ZFJA 1SF9A 4C92F 3KUFA 3OBYA 2E12A 4DBHA 3REBB 3THKA 3CCLT 4FSXA 2VYTA 1YN8A 2H3JA 3PT9A 1WJQA 2I2LA 2F69A 1YJ9A 3EH1A 1UUEA 4OB0B 4BE1A 4M7DE 4HA8A 2HSPA 2K3BA 2RD1A 1VQMA 1M3CA 5GAN3 2ROLA 2BIVA 2DBKA 5GAOm 1UHFA 3L2UA 1WFWA 1Q95G 4M78G 2PVGB 2QYZA 3O5ZA 2JNGA 2A0FB 2LQKA 1TWBA 2ZPHB 4M78A 2ZGWA 4M75D 2DE0X 5HCKA 4M75A 3MEAA 4EMKB 2DIQA 1GFCA 3A98A 2KNBB 2DBMA 2FHDA 4AG2C 4QVDA 5KH6A 1QCNA 2DAQA 3CCET 1D1BA 3S3NA 1AZEA 2KK4A 3CXCP 2DYBA 2X4XA 1K8AC 2LZ6B 4E7JA 1WHLA 1I0CA 2HEQA 4C92D 2O01E 4N0AA 4WF2A 1V1CA 3FEOA 5DM7R 4C92A 2L3PA 1S72Q 2JT4A 4JDSA 4HVUA 4FYXB 4R55A 3OYLA 5J26A 1M27C 2RJFA 3CCUT 2JMAA 4N4HA 2HQEA 5IXFA 2FEIA 3REAB 1M4ZA 2KE9A
chains in the Genus database with same CATH topology
1YCSB 2LMJA 4RTUA 1ABQA 3ULRB 4OMMA 1ZUUA 2GBQA 1U06A 2F2WA 1T0JA 1E6HA 1X6GA 2HCKA 2KRNA 1K0SA 2KT1A 4CC7A 2C0TA 2L2PA 1I1JA 1BB9A 4WCIA 3QWXX 4EIKA 1B07A 3EG2A 2J06A 2W10A 2DL8A 1S1NA 2I0NA 1ZUYA 4Z89A 2CREA 5GJVB 2AK5A 1FMKA 2CUBA 1JO8A 1WLPB 1T0HA 1H3HA 2M51A 2FPEA 2J05A 2KXCA 4DEYA 2AZVA 1G2BA 1WA7A 2E5KA 2KR3A 1TUCA 2L3SA 3H0FA 3H0IA 4J9EA 3TSWA 2EKHA 1AWWA 2YDLA 4JJCA 1VYUA 1B3QA 1ABOA 1GCQA 2D8JA 5IHKA 3M0PA 2ROTA 1W1FA 2RNAA 2CSIA 2RQVA 3I5RA 3LH5A 1VA7A 2DL3A 5EC7A 1GL5A 4J9DA 2DVJA 4HVWA 1GCQC 1X2QA 3VS1A 1J3TA 2JS2A 3QWYA 2HBWA 1HD3A 2LJ3A 2H8HA 4RTZA 2OI3A 4IIMA 2KRSA 3PVLA 1N5ZA 2L3QA 2PZ1A 2V1RA 2GNCA 2XMFA 4ORZA 2DRKA 1SRMA 2KT8A 2CT3A 2MOXA 1PKTA 1AWXA 4E6RA 1WIEA 4AFZC 5L23A 5FWCA 1U5SA 1MV0B 1WX6A 2J7IA 2EYZA 1NLPC 4J9GA 1MUZA 2C0IA 1AZGB 1PNJA 2GTJA 4J9IA 2SEMA 4A63B 2JS0A 2K7AA 2K79A 1CKBA 1UDLA 3UA6A 1U3OA 4AFQC 1AOJA 3PVQA 2D8HA 4J9CA 1SHFA 1K76A 3M0QA 3VS6A 2JW4A 4RTTA 1NEBA 2KROA 4OMNA 1PRMC 2DILA 1GFDA 2BZXA 3U23A 3NPFA 1OPKA 1NG2A 3EHQA 2JM8A 2YSQA 2A36A 1AWJA 2W0ZA 3NMZC 2EBPA 2F2XA 2LCSA 1BK2A 1PWTA 1UJ0A 4CC3A 1UGVA 2KBTA 2RQWA 2VWFA 2JM9A 2O9SA 1Y0MA 4JJDA 2AKLA 1LCKA 2VVKA 2O2OA 1UHCA 2OAWA 1HJDA 1PHTA 1FYNA 2RN8A 2V1QA 2NWMA 2DL4A 3ZL7C 1NLOC 1NEGA 1XOVA 2LP5A 2MIOA 1X27A 2KYBA 3H0HA 3VRZA 2CDTA 1X2KA 3UF4A 5IHIA 4LUEA 3UA7A 4D8KA 4RTWA 1A0NB 1WXUA 2CT4A 3EHRA 4JPBW 3C0CA 3M0TA 2J6OA 4RTXA 5FW9A 3VS5A 1WI7A 2DX1A 2EGEA 2BZ8A 1NYFA 1RUWA 3VS3A 4J9BA 1SRLA 5IHNA 1UECA 2PNIA 4OMQA 1CSKA 2FPFA 5I22A 4QT7A 3VS0A 1ZLMA 1X43A 4Z8AA 4CC2A 4LE9A 1RLPC 2D0NA 2RMOA 2LJ0A 1ZX6A 1GCPA 1H92A 3R6NA 2LNHB 3NHNA 2ENMA 2KXDA 1K1ZA 2JMCA 1UFFA 5ECAA 2YT6A 4IIOA 1M30A 5IH2A 2IIMA 2PTKA 1QKWA 3M0UA 4ESRA 1SHGA 1YWOA 2ESWA 4K11A 3CQTA 2X3XD 4CC4B 1UE9A 2RQUA 2AZSA 2GGRA 2LJ1A 2KGTA 2BTTA 2F2VA 2BZYA 1YNZA 4HCKA 1AD5A 2LQNA 1AVZC 1NM7A 1QWEA 2ED1A 1SSHA 2YUQA 3NGPA 2K9GA 1WXBA 2O88A 1OPLA 1JU5C 1I07A 1T3LA 2ECZA 1VYTA 2KYMA 2DLPA 4F17A 3UATA 3EG0A 3IQLA 1JQQA 1KJWA 5GJWB 1RI9A 4KRTA 1OV3A 4RUGA 1UTIA 2EYXA 2K6DA 3VS2A 1ZBJA 2RF0A 2CH4W 1WXTA 1GBQA 2EGCA 2DF6A 4OMOA 1RLQC 2CUDA 4Z88A 1X69A 2CH4A 2AKKA 4GLMA 2DJQA 2SRCA 4M4ZA 5IXBA 1CKAA 1PKSA 2A28A 2M0YA 2EVRA 4JZ3A 1Y57A 2FRYA 2EPDA 3JV3A 2RQTA 1K9AA 1AWOA 1Z9QA 2O9VA 4D8DA 3RBBB 1KIKA 4LN2A 3I35A 2A08A 2YUNA 3EG1A 3VS4A 2X3WD 2JTEA 1AEYA 4OMPA 2J6FA 1W70A 1ARKA 1IO6A 4JJBA 1TUDA 1HSQA 1WDXA 5FWBA 4ZNXA 3PE0A 3EG3A 4OMLA 2FO0A 3SHWA 1E7OA 2G6FX 1H8KA 1OEBA 2DL7A 1QKXA 3TSZA 2A37A 4RTVA 2HDAA 2DL5A 3TVTA 3EGUA 2D1XA 1W6XA 1TG0A 1JEGA 4AG1C 1G83A 1WYXA 1SPKA 1GRIA 1YP5A 1KFZA 4J9HA 2DM1A 1YWPA 4Y92A 1E6GA 1ZUKA 2KRMA 1KSWA 1SEMA 3M0SA 4DEXA 1ZSGA 2QDLA 1M3BA 1BBZA 3M0RA 2RPNA 2GTOA 1EFNA 3I5SA 1BU1A 2DRMA 2EYWA 2OJ2A 4J9FA 3REBB 3FJ5A 2LQWA 2VKNA 3VRYA 3THKA 4GBQA 2ED0A 1UG1A 1MV3A 1YN8A 4AFUC 1K4US 2ABLA 2FRWA 2EQIA 4R0KA 2CSQA 1UUEA 4X1VA 2KEAA 2L0AA 2HSPA 1UJYA 2K3BA 2RQRA 2DMOA 4JZ4A 1JXMA 4FSSA 1M3CA 4F14A 3KFVA 2ROLA 1X6BA 2DBKA 1VYVA 1UHFA 4LNPA 2P4RA 2GQIA 1WFWA 1M8MA 1NYGA 3O5ZA 2B86A 5I11A 2J6KA 1PRLC 2DNUA 2LX7A 3GBQA 4F16A 3SEMA 2DA9A 2DE0X 5HCKA 3I9QA 1GFCA 3A98A 2KNBB 2DBMA 2YUOA 4AG2C 4HXJA 2NUZA 2EW3A 3VS7A 2MCNA 1AZEA 2EYYA 2DYBA 4LUDA 1Z9ZA 2C0OA 2LZ6B 4AFSC 1OOTA 4HVVA 2EGAA 1I0CA 1K0XA 2HEQA 1QLYA 1QWFA 1V1CA 3RNJA 3H41A 2JXBA 2FG0A 2O31A 2L3PA 4RTYA 1QCFA 2JT4A 4HVUA 1GBRA 1M27C 2YUPA 2JMAA 5IXFA 2K2MA 2FEIA 3REAB 1M3AA 1T3SA 2KE9A 2FPDA 1JXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YCS B;  2LMJ A;  4RTU A;  1ABQ A;  3ULR B;  4OMM A;  1ZUU A;  2GBQ A;  1U06 A;  2F2W A;  1T0J A;  1E6H A;  1X6G A;  2HCK A;  2KRN A;  1K0S A;  2KT1 A;  4CC7 A;  2C0T A;  2L2P A;  1I1J A;  1BB9 A;  4WCI A;  3QWX X;  4EIK A;  1B07 A;  3EG2 A;  2J06 A;  2W10 A;  2DL8 A;  1S1N A;  2I0N A;  1ZUY A;  4Z89 A;  2CRE A;  5GJV B;  2AK5 A;  1FMK A;  2CUB A;  1JO8 A;  1WLP B;  1T0H A;  1H3H A;  2M51 A;  2FPE A;  2J05 A;  2KXC A;  4DEY A;  2AZV A;  1G2B A;  1WA7 A;  2E5K A;  2KR3 A;  1TUC A;  2L3S A;  3H0F A;  3H0I A;  4J9E A;  3TSW A;  2EKH A;  1AWW A;  2YDL A;  4JJC A;  1VYU A;  1B3Q A;  1ABO A;  1GCQ A;  2D8J A;  5IHK A;  3M0P A;  2ROT A;  1W1F A;  2RNA A;  2CSI A;  2RQV A;  3I5R A;  3LH5 A;  1VA7 A;  2DL3 A;  5EC7 A;  1GL5 A;  4J9D A;  2DVJ A;  4HVW A;  1GCQ C;  1X2Q A;  3VS1 A;  1J3T A;  2JS2 A;  3QWY A;  2HBW A;  1HD3 A;  2LJ3 A;  2H8H A;  4RTZ A;  2OI3 A;  4IIM A;  2KRS A;  3PVL A;  1N5Z A;  2L3Q A;  2PZ1 A;  2V1R A;  2GNC A;  2XMF A;  4ORZ A;  2DRK A;  1SRM A;  2KT8 A;  2CT3 A;  2MOX A;  1PKT A;  1AWX A;  4E6R A;  1WIE A;  4AFZ C;  5L23 A;  5FWC A;  1U5S A;  1MV0 B;  1WX6 A;  2J7I A;  2EYZ A;  1NLP C;  4J9G A;  1MUZ A;  2C0I A;  1AZG B;  1PNJ A;  2GTJ A;  4J9I A;  2SEM A;  4A63 B;  2JS0 A;  2K7A A;  2K79 A;  1CKB A;  1UDL A;  3UA6 A;  1U3O A;  4AFQ C;  1AOJ A;  3PVQ A;  2D8H A;  4J9C A;  1SHF A;  1K76 A;  3M0Q A;  3VS6 A;  2JW4 A;  4RTT A;  1NEB A;  2KRO A;  4OMN A;  1PRM C;  2DIL A;  1GFD A;  2BZX A;  3U23 A;  3NPF A;  1OPK A;  1NG2 A;  3EHQ A;  2JM8 A;  2YSQ A;  2A36 A;  1AWJ A;  2W0Z A;  3NMZ C;  2EBP A;  2F2X A;  2LCS A;  1BK2 A;  1PWT A;  1UJ0 A;  4CC3 A;  1UGV A;  2KBT A;  2RQW A;  2VWF A;  2JM9 A;  2O9S A;  1Y0M A;  4JJD A;  2AKL A;  1LCK A;  2VVK A;  2O2O A;  1UHC A;  2OAW A;  1HJD A;  1PHT A;  1FYN A;  2RN8 A;  2V1Q A;  2NWM A;  2DL4 A;  3ZL7 C;  1NLO C;  1NEG A;  1XOV A;  2LP5 A;  2MIO A;  1X27 A;  2KYB A;  3H0H A;  3VRZ A;  2CDT A;  1X2K A;  3UF4 A;  5IHI A;  4LUE A;  3UA7 A;  4D8K A;  4RTW A;  1A0N B;  1WXU A;  2CT4 A;  3EHR A;  4JPB W;  3C0C A;  3M0T A;  2J6O A;  4RTX A;  5FW9 A;  3VS5 A;  1WI7 A;  2DX1 A;  2EGE A;  2BZ8 A;  1NYF A;  1RUW A;  3VS3 A;  4J9B A;  1SRL A;  5IHN A;  1UEC A;  2PNI A;  4OMQ A;  1CSK A;  2FPF A;  5I22 A;  4QT7 A;  3VS0 A;  1ZLM A;  1X43 A;  4Z8A A;  4CC2 A;  4LE9 A;  1RLP C;  2D0N A;  2RMO A;  2LJ0 A;  1ZX6 A;  1GCP A;  1H92 A;  3R6N A;  2LNH B;  3NHN A;  2ENM A;  2KXD A;  1K1Z A;  2JMC A;  1UFF A;  5ECA A;  2YT6 A;  4IIO A;  1M30 A;  5IH2 A;  2IIM A;  2PTK A;  1QKW A;  3M0U A;  4ESR A;  1SHG A;  1YWO A;  2ESW A;  4K11 A;  3CQT A;  2X3X D;  4CC4 B;  1UE9 A;  2RQU A;  2AZS A;  2GGR A;  2LJ1 A;  2KGT A;  2BTT A;  2F2V A;  2BZY A;  1YNZ A;  4HCK A;  1AD5 A;  2LQN A;  1AVZ C;  1NM7 A;  1QWE A;  2ED1 A;  1SSH A;  2YUQ A;  3NGP A;  2K9G A;  1WXB A;  2O88 A;  1OPL A;  1JU5 C;  1I07 A;  1T3L A;  2ECZ A;  1VYT A;  2KYM A;  2DLP A;  4F17 A;  3UAT A;  3EG0 A;  3IQL A;  1JQQ A;  1KJW A;  5GJW B;  1RI9 A;  4KRT A;  1OV3 A;  4RUG A;  1UTI A;  2EYX A;  2K6D A;  3VS2 A;  1ZBJ A;  2RF0 A;  2CH4 W;  1WXT A;  1GBQ A;  2EGC A;  2DF6 A;  4OMO A;  1RLQ C;  2CUD A;  4Z88 A;  1X69 A;  2CH4 A;  2AKK A;  4GLM A;  2DJQ A;  2SRC A;  4M4Z A;  5IXB A;  1CKA A;  1PKS A;  2A28 A;  2M0Y A;  2EVR A;  4JZ3 A;  1Y57 A;  2FRY A;  2EPD A;  3JV3 A;  2RQT A;  1K9A A;  1AWO A;  1Z9Q A;  2O9V A;  4D8D A;  3RBB B;  1KIK A;  4LN2 A;  3I35 A;  2A08 A;  2YUN A;  3EG1 A;  3VS4 A;  2X3W D;  2JTE A;  1AEY A;  4OMP A;  2J6F A;  1W70 A;  1ARK A;  1IO6 A;  4JJB A;  1TUD A;  1HSQ A;  1WDX A;  5FWB A;  4ZNX A;  3PE0 A;  3EG3 A;  4OML A;  2FO0 A;  3SHW A;  1E7O A;  2G6F X;  1H8K A;  1OEB A;  2DL7 A;  1QKX A;  3TSZ A;  2A37 A;  4RTV A;  2HDA A;  2DL5 A;  3TVT A;  3EGU A;  2D1X A;  1W6X A;  1TG0 A;  1JEG A;  4AG1 C;  1G83 A;  1WYX A;  1SPK A;  1GRI A;  1YP5 A;  1KFZ A;  4J9H A;  2DM1 A;  1YWP A;  4Y92 A;  1E6G A;  1ZUK A;  2KRM A;  1KSW A;  1SEM A;  3M0S A;  4DEX A;  1ZSG A;  2QDL A;  1M3B A;  1BBZ A;  3M0R A;  2RPN A;  2GTO A;  1EFN A;  3I5S A;  1BU1 A;  2DRM A;  2EYW A;  2OJ2 A;  4J9F A;  3REB B;  3FJ5 A;  2LQW A;  2VKN A;  3VRY A;  3THK A;  4GBQ A;  2ED0 A;  1UG1 A;  1MV3 A;  1YN8 A;  4AFU C;  1K4U S;  2ABL A;  2FRW A;  2EQI A;  4R0K A;  2CSQ A;  1UUE A;  4X1V A;  2KEA A;  2L0A A;  2HSP A;  1UJY A;  2K3B A;  2RQR A;  2DMO A;  4JZ4 A;  1JXM A;  4FSS A;  1M3C A;  4F14 A;  3KFV A;  2ROL A;  1X6B A;  2DBK A;  1VYV A;  1UHF A;  4LNP A;  2P4R A;  2GQI A;  1WFW A;  1M8M A;  1NYG A;  3O5Z A;  2B86 A;  5I11 A;  2J6K A;  1PRL C;  2DNU A;  2LX7 A;  3GBQ A;  4F16 A;  3SEM A;  2DA9 A;  2DE0 X;  5HCK A;  3I9Q A;  1GFC A;  3A98 A;  2KNB B;  2DBM A;  2YUO A;  4AG2 C;  4HXJ A;  2NUZ A;  2EW3 A;  3VS7 A;  2MCN A;  1AZE A;  2EYY A;  2DYB A;  4LUD A;  1Z9Z A;  2C0O A;  2LZ6 B;  4AFS C;  1OOT A;  4HVV A;  2EGA A;  1I0C A;  1K0X A;  2HEQ A;  1QLY A;  1QWF A;  1V1C A;  3RNJ A;  3H41 A;  2JXB A;  2FG0 A;  2O31 A;  2L3P A;  4RTY A;  1QCF A;  2JT4 A;  4HVU A;  1GBR A;  1M27 C;  2YUP A;  2JMA A;  5IXF A;  2K2M A;  2FEI A;  3REA B;  1M3A A;  1T3S A;  2KE9 A;  2FPD A;  1JXO A; 
#chains in the Genus database with same CATH topology
 1VQP Q;  4RTU A;  3JAM E;  2PVD B;  2Y90 A;  3ULR B;  4OMM A;  5CQX A;  4ELY C;  2K2V A;  1E6H A;  1PCX A;  5CKB A;  2EFI A;  3JRZ A;  2KRN A;  1YJ9 T;  4MDX A;  1Q81 U;  1IRE B;  4ZGE B;  3RKW A;  3M53 A;  1I1J A;  1C0M A;  1VQM T;  1JJ2 P;  5LJ3 d;  4NS5 A;  1QVP A;  1H64 1;  2J06 A;  2W10 A;  2DL8 A;  4NL3 A;  2YHT A;  1WPY A;  2I0N A;  3JCM Q;  3NTK A;  1K9M U;  1UB4 A;  4C0D C;  2CUB A;  4II1 A;  1D3B A;  3OS2 A;  3KBG A;  1VIE A;  3CC2 A;  3P8D A;  2KXC A;  2EQJ A;  4C0D B;  5GAM d;  1G2B A;  1WQW A;  4M75 E;  2BUD A;  4DBQ A;  2E6N A;  2EKH A;  2HSE B;  3VU3 C;  2E70 A;  3JCM f;  2WSF E;  5IHK A;  1WQ7 A;  1B34 A;  4EMG A;  2ROT A;  3HPW A;  2RNA A;  3OYI A;  2FZG B;  2RQV A;  3I5R A;  4LXC A;  5IN1 A;  4C8Q C;  3CD6 A;  2RB6 A;  4J9D A;  2DVJ A;  4C92 E;  1VQ4 A;  4QQ6 A;  2JS2 A;  2ZPF B;  5GAO n;  2HBW A;  2H8H A;  2OI3 A;  4E47 A;  4QKU A;  4C8Q B;  2P0P A;  4KT0 E;  1SSF A;  1VQO Q;  2QQB A;  3EFR A;  2BKD N;  3SD4 A;  4XTZ A;  2MI6 A;  3QUI A;  4XTW A;  2COW A;  3TQ7 P;  4J7I A;  1NPP A;  1AWX A;  1U5S A;  2JJ9 A;  1FWZ A;  1MV0 B;  1WX6 A;  3CME Q;  4A4F A;  2J7I A;  2EYZ A;  2XDD A;  1K73 U;  2VAS A;  3M55 A;  1VQ8 Q;  4A54 A;  4FL6 A;  4FM4 B;  5KYY A;  4A63 B;  2K7A A;  3H6Z A;  2QAZ A;  2K79 A;  2HMA A;  3HRS A;  4L5G A;  1U3O A;  3OMG A;  4FW2 A;  3CC2 T;  2RH2 A;  4ELZ C;  3M0Q A;  4IUV A;  2JW4 A;  2K5L A;  4DOW A;  3G71 Q;  4RTT A;  1QVG P;  4OMN A;  4BD3 A;  1VIF A;  1GFD A;  4FIB A;  3CXC A;  3I56 Q;  3U23 A;  5J3B A;  1RAI B;  5GMK l;  5A0L A;  2JM8 A;  5DLQ E;  3NMZ C;  2EBP A;  1BKB A;  3G6E A;  1EX4 A;  3CD6 T;  1PWT A;  2CP0 A;  1VQ4 T;  2GQV A;  2QK0 A;  2O9S A;  1XQH A;  1LOJ A;  5M9O A;  1MHN A;  3OYB A;  1KHC A;  4HKE A;  3MP1 A;  2OAW A;  1ZSZ A;  2CGH A;  1IXD A;  2V1Q A;  2NWM A;  1XTD A;  2X4W A;  1DJ7 B;  2LP5 A;  1R0B G;  2MIO A;  1X27 A;  3VUZ A;  3H0H A;  3VRZ A;  5DLO A;  1X75 C;  1G5V A;  4Y91 A;  4X9C A;  4LDY A;  1PC0 A;  5IHI A;  3OYH A;  2CT4 A;  1WHH A;  3EHR A;  1JJ2 A;  3M0T A;  4M7A C;  2J6O A;  4A53 A;  3WVD B;  1WZO A;  5GAN e;  1Q82 U;  2BZ8 A;  1NYF A;  2EIF A;  3VS3 A;  3A5Z B;  4M7A B;  4C0F A;  3OYA A;  2EQM A;  1CSK A;  2K4Y A;  3A1P A;  4QT7 A;  3CCS A;  1ZLM A;  5GAN j;  4Z8A A;  4CC2 A;  1YFN A;  1RLP C;  1V76 A;  2RMO A;  1ZX6 A;  1VQ9 Q;  1YHQ A;  1AT1 B;  3R6O A;  1MNE A;  3A8O B;  3EFO B;  1TSF A;  3NHN A;  2KXD A;  3HFN A;  4X34 A;  1OUL A;  4C5I A;  3CC4 A;  3JCM d;  2JVV A;  2EQU A;  2LNV A;  3E9F A;  3CPW S;  3PIP A;  3HRU A;  4PLI A;  1WHJ A;  3BY7 A;  3G6E T;  1KD1 C;  1NJI C;  2KGT A;  4EMH A;  4LDV A;  2BTT A;  2R57 A;  1HXD A;  1YNZ A;  4QVC A;  1AD5 A;  1AVZ C;  3A8G B;  3A8H B;  1QWE A;  2YUQ A;  3PTA A;  5LJ5 g;  2K9G A;  1KQ2 A;  2X4J A;  4LD6 A;  1G3W A;  1G8X A;  4C0Z A;  4RMO A;  1VYT A;  2KYM A;  1TUG B;  4J6X A;  3UAT A;  1JQQ A;  1O9S A;  4EPC A;  1KG1 A;  1AHJ B;  1I4K 1;  3C95 A;  2K6D A;  2ZPE B;  2F1L A;  5CCA A;  2AT1 B;  1WXT A;  1GBQ A;  3CCR A;  2EAY A;  3INZ A;  4Z88 A;  2AKK A;  3CCS T;  1TU0 B;  4M4Z A;  4PJN A;  4KH0 B;  2MMP A;  4Q5W A;  5IT9 E;  2DZ9 A;  2EPD A;  1ZHI A;  1YHQ T;  3JV3 A;  1AWO A;  1QVG A;  4FW1 A;  1KIK A;  2RHY A;  2A08 A;  3CC4 T;  3OW2 S;  2F5T X;  1TUD A;  3PFS A;  3OY9 A;  3JCM P;  5FWB A;  4OVA A;  3CCV A;  3UDC A;  3SHW A;  1N8R C;  4QVZ A;  1HYO A;  2E41 A;  2L8D A;  1MND A;  5I21 A;  2HDA A;  3JSC A;  2EQK A;  2XU8 A;  3TVT A;  2GFA A;  3HL8 A;  1TG0 A;  1JEG A;  1IHV A;  1G83 A;  1WYX A;  5EG2 A;  1K8A U;  2DM1 A;  4IUQ A;  4Y92 A;  5GAN f;  3KXT A;  3OYG A;  2RPN A;  2JZ2 A;  3BDL A;  4Y28 E;  7AT1 B;  3I5S A;  3M56 A;  2EJG A;  4CRI A;  1Q86 R;  3FJ5 A;  1K9M R;  4J5Y A;  4GBQ A;  4RG8 A;  2ED0 A;  1MV3 A;  2HBP A;  3CCR T;  4R0K A;  2CSQ A;  3C94 A;  3FC3 A;  2L0A A;  1UJY A;  2RQR A;  4KUL A;  4JZ4 A;  4PJO G;  4JLI A;  4M77 C;  4Z02 A;  1X6B A;  3M4Y A;  1QP3 A;  1JRI A;  1VYV A;  3GF5 A;  1M1K C;  1OQK A;  2GQI A;  3EGD B;  5CVI A;  1M8M A;  2YXY A;  3ME9 A;  3GBQ A;  3SEM A;  2CP5 A;  2DA9 A;  1QP2 A;  3SWN A;  4RG2 A;  3QYG B;  1KQS S;  2EJF A;  1I5L A;  2YUO A;  3CCV T;  2NUZ A;  2EW3 A;  5CKF A;  1YJW A;  4OGC A;  3VUB A;  3QO3 A;  1GXI E;  2RJE A;  1ZA1 B;  1G3Y A;  2C0O A;  4M7D G;  9ATC B;  2EGA A;  1OZ2 A;  3JB9 F;  2NUT B;  2GF7 A;  5CKE A;  3RUX A;  2O31 A;  4F7U B;  1W4S A;  4XAX B;  3OYF A;  4OMF B;  3QBY A;  2JUF A;  3EGX A;  2L3R A;  1VQL Q;  1M3A A;  1LJO A;  1S72 A;  4GLK A;  1WHK A;  4C8Q E;  2QQS A;  1X6G A;  3RMS A;  2DXT A;  2E4H A;  2MYS A;  1ZA2 B;  1VQP A;  1BB9 A;  4WCI A;  2CZ7 B;  3QWX X;  3E19 A;  4EIK A;  3QDF A;  3BE3 A;  3F70 A;  3G7Z A;  1WNL A;  3LH0 A;  4Z89 A;  5GJV B;  3JCM X;  2AK5 A;  3ASK A;  3C12 A;  3EG9 B;  1X6O A;  4E7K A;  1H3H A;  2M51 A;  1M2V A;  4KGX B;  1YJN Q;  2CZ6 B;  2E5K A;  2KR3 A;  3H0F A;  3H0I A;  2IVW A;  2D0Q B;  2ZPB B;  5CAI A;  1NZ9 A;  1N9S A;  3JB9 D;  1AWW A;  2RM4 A;  1YJW T;  2VGM A;  2LCC A;  2CYZ B;  1B3Q A;  3QZ9 B;  2KDS A;  5GAN d;  4C0G A;  1W1F A;  4RKU E;  1BI3 A;  3CCQ Q;  2NYS A;  1FXX A;  1O75 A;  3TEE A;  1GCQ C;  1X2Q A;  4BB7 A;  3BDU A;  4IUT A;  1Q82 R;  2XK0 A;  2DTH A;  2QXF A;  2EKO A;  1S72 T;  2PZ1 A;  5I2S A;  3LWI A;  4EMK C;  4ORZ A;  4M75 G;  2DRK A;  3T9N A;  3LX7 A;  2MOX A;  4AFZ C;  3L1A A;  1MMA A;  1VQO A;  1VQP T;  2FZK B;  4XTX A;  2K5I A;  3P8B B;  5LJ5 e;  2C0I A;  5KE3 A;  4C92 G;  4E7I A;  3CME A;  4O5V A;  3CPF A;  2V8I A;  1CKB A;  1UDL A;  2HNI A;  3BFM A;  3UA6 A;  5LJ5 j;  1M9S A;  4O6J A;  3FLG A;  3ER0 A;  3M9Q A;  1VQ8 A;  2CZ0 B;  1NEB A;  2KRO A;  1UGR B;  3D7S B;  4BAC A;  4XK8 E;  2XHC A;  4FYV B;  2VV5 A;  5C0M A;  1NG2 A;  4P5N A;  1U8R A;  3G71 A;  1M2O A;  2A36 A;  2W0Z A;  3I56 A;  4M77 F;  5LJ5 h;  1BCM A;  2LCS A;  1BK2 A;  4CC3 A;  1UGV A;  1KD1 U;  1NJI U;  2JM9 A;  1HK9 A;  4EDU A;  2EJ9 A;  4JJD A;  2AKL A;  2VVK A;  2O2O A;  1UHC A;  4NL2 A;  3M57 A;  2KQW A;  3ZEH A;  3ZL7 C;  1W2B A;  4PNO A;  4DOV A;  4JLG A;  2CDT A;  1VUB A;  1MMD A;  3UF4 A;  3GNG A;  2COY A;  2DEU A;  4RTW A;  1A0N B;  3GOX A;  2DTO A;  4J8O A;  1VQO T;  3AT1 B;  5FW9 A;  3VYG A;  3VS5 A;  1WI7 A;  2K5F A;  4PKC C;  4RCB A;  2PNI A;  4OMQ A;  3VKI A;  1EZZ B;  1TOV A;  5J39 A;  3CME T;  1X43 A;  5KCH A;  2M1H A;  1VQ8 T;  1Y7X A;  2M0O A;  3R6N A;  1D09 B;  2O4X B;  3QJ6 A;  5ECA A;  1K8A R;  4M77 D;  5IH2 A;  2IIM A;  3HFO A;  1QKW A;  3M0U A;  1VQ9 A;  2WSE E;  4D6W A;  4N4I A;  2VUB A;  4M77 A;  1OI1 A;  1YWO A;  2ESW A;  2GFU A;  3G4S A;  2X3X D;  3G71 T;  3MP6 A;  1SKU B;  1RAE B;  2M9U A;  3E2U A;  2RQU A;  2GGR A;  3I56 T;  3CCJ Q;  3FJP A;  3PNW C;  1YIT A;  3OS0 A;  4X9D A;  1EIF A;  1R77 A;  2E5Q A;  1NM7 A;  1U1S A;  2DXU A;  3OYN A;  2XIC A;  3NGP A;  2NUP B;  1QCO A;  4KBM B;  2DO3 A;  5LJ5 f;  1JU5 C;  2K57 A;  2PUO B;  5FRO A;  3HP9 A;  3BW1 A;  2RI2 A;  1JB0 E;  1N27 A;  3IQL A;  3VV0 A;  1KJW A;  1OV3 A;  1UTI A;  2DEQ A;  4A4H A;  3V8J A;  3MET A;  3VS2 A;  5CKH A;  2EGC A;  1QVF S;  3RDV A;  1RLQ C;  2CH4 A;  4GLM A;  3EAE A;  4L59 A;  5IXB A;  5KCO A;  2M0Y A;  2EVR A;  2OAU A;  5KYW B;  1Y57 A;  2HZY A;  3WXM B;  4F04 B;  1NE8 A;  2HL5 C;  2DXB A;  3V7S A;  4BI4 A;  2KY9 A;  3RBB B;  3GNF B;  4LN2 A;  5A2Q E;  4BI8 B;  1M1K U;  3VS4 A;  4MML A;  2E3H A;  3CCM Q;  1VQ9 T;  2J6F A;  5CO7 A;  5KYX B;  4JJB A;  4M77 E;  2QAS A;  1Q7Y U;  3G4S T;  1HSQ A;  1VQ7 Q;  1WDX A;  2JTF A;  3PE0 A;  3EG3 A;  4OML A;  4PLL A;  2G6F X;  2X51 A;  3H9N A;  1YIT T;  1PSE A;  3MHX A;  4E7H A;  1V29 B;  3CBO A;  3EGU A;  2D9T A;  2D1X A;  2GCX A;  3DLM A;  1W6X A;  2IG0 A;  3HRT A;  1Y96 B;  4OB1 B;  1SPK A;  1WJR A;  1YWP A;  1E6G A;  4IUU A;  2HL3 A;  2KRM A;  2EWN A;  1RAF B;  4C5H A;  1BBZ A;  4JRQ A;  2R5A A;  1BU1 A;  4F7U E;  1RAC B;  1M8V A;  2VKN A;  4OGE A;  3VRY A;  4FU6 A;  2P84 A;  1UG1 A;  4AFU C;  1QVF P;  1K4U S;  2ABL A;  5I2M A;  4ZGJ B;  2EQI A;  4E7Z A;  1TTH B;  4ME7 A;  2CZ1 B;  4PJJ A;  2KEA A;  3UWN A;  1JXM A;  4F14 A;  1PD1 A;  3M58 A;  1RL2 A;  1VQN Q;  4EMK A;  2WAC A;  1D1A A;  3OMC A;  3X26 B;  3HSB A;  2RI3 A;  4LNP A;  2P4R A;  1KHI A;  2QG9 B;  3DLL A;  2OTJ Q;  1VOM A;  2MK5 A;  3A8L B;  2B86 A;  2J6K A;  1PRL C;  2ZAE A;  3V8K A;  2DNU A;  2LX7 A;  4F16 A;  1BCO A;  1M90 C;  2DIG A;  2DD4 A;  1PD0 A;  2QEX A;  4E7L A;  2OTL Q;  2E65 A;  3VS7 A;  3X24 B;  4M78 C;  4PL6 A;  1Q86 C;  4FYW B;  3QXE B;  1K9M C;  4LUD A;  3JCM V;  3QKJ A;  1OOT A;  4HVV A;  3MO8 A;  4M78 B;  1RAH B;  4QQG A;  5LJ5 d;  1QLY A;  4PFO A;  4M75 B;  4C8Q F;  2VGN A;  4LDU A;  2BE7 D;  2PUK B;  1GBR A;  4N0A C;  5GMK h;  4E7S A;  1T3S A;  1B7T A;  1D0Y A;  5AYF A;  1YCS B;  4LD9 K;  3CC7 Q;  5GAN 4;  2GBQ A;  4C92 B;  1BIB A;  4IUR A;  1I5O B;  2LVM A;  2HCK A;  1VQL A;  3CPW P;  4BDY A;  2KT1 A;  3LW5 E;  4ATO A;  2KVQ G;  3FB9 A;  4ANJ A;  2E1H A;  3M59 A;  3MEU A;  3EG2 A;  2QA4 Q;  2L5Q A;  1FX7 A;  1S1N A;  1FMV A;  2KSS A;  1ZUY A;  4PJL A;  4UC4 A;  2HKN A;  1FMK A;  1JO8 A;  2M02 A;  2LX9 A;  2V8K A;  3L2W A;  2HAX A;  2QGG A;  1Q81 R;  2J05 A;  4OP0 A;  4DEY A;  2AZV A;  2PVO B;  1NJI R;  5FRM A;  2RA2 A;  2L3S A;  1YCY A;  2QEX T;  4J9E A;  4C8Q G;  1UGP B;  2YDL A;  4DBF A;  4JJC A;  2P0Q A;  1VYU A;  4C8Q D;  2O4X A;  4PJM A;  2LCL A;  1YHQ Q;  4C8Q A;  1YJN A;  1D3B B;  4V2S A;  2CSI A;  5EC7 A;  2DL3 A;  1KC8 C;  1UEB A;  1QMC A;  1GL5 A;  4HVW A;  1PSF A;  2R58 A;  3VS1 A;  2WSC E;  1J3T A;  5GAM h;  4LDW A;  2LQ8 A;  2LJ3 A;  4IIM A;  3CCQ A;  1BI1 A;  1VQK Q;  5A0D A;  3RER A;  5D7U A;  2LT1 A;  1B34 B;  2L3Q A;  2V1R A;  3HKS A;  2XMF A;  2QQ9 A;  3OW2 P;  2KT8 A;  4JRK A;  1JBM A;  2DD5 A;  2VC8 A;  1VQL T;  2DPP B;  1PKT A;  1WIE A;  5L23 A;  3VJP A;  3SB2 A;  5A0G A;  2LT4 A;  4M7A F;  3I55 Q;  2HQH A;  2CP3 A;  4J9G A;  4OB3 B;  1AZG B;  3JCM c;  3CMA Q;  1PNJ A;  3QYH B;  4J9I A;  2JS0 A;  3L2Q A;  2MF2 A;  4AFQ C;  3NFC A;  5FU7 B;  3CEY A;  1WJS A;  2D8H A;  1K76 A;  1UGQ B;  1K73 R;  3QG1 A;  1Q82 C;  2RK1 A;  2MAM A;  1YBY A;  2DIL A;  1VQ5 Q;  4XU1 A;  1OU8 A;  4DQ2 A;  2K3Y A;  3NPF A;  2C06 A;  3EHQ A;  4BDZ A;  1YJN T;  2XDP A;  4ZTJ A;  1OU9 A;  2YSQ A;  3CBP A;  4NOY A;  2EYQ A;  3M5A A;  1UJ0 A;  2KBT A;  2RQW A;  2VWF A;  2ZZD A;  2RHU A;  2PQW A;  1Y0M A;  1YIJ Q;  2FB7 A;  1LCK A;  3CCQ T;  2LRQ A;  5KYN A;  2LTO A;  1PHT A;  4M7A G;  2RN8 A;  3MJX A;  2DER A;  2HQX A;  2DL4 A;  2D6F A;  4M7A D;  2LDM A;  1NEG A;  1XOV A;  4M7A A;  1YI2 Q;  3CPW A;  1XJW B;  1ZSZ C;  3OBW A;  5CR2 A;  2H3E B;  1VQ6 Q;  1LVK A;  4D8K A;  1TXQ A;  1NPR A;  2DXC A;  1KQS P;  3JB9 G;  4JPB W;  5CQY A;  2CP6 A;  1ZSZ B;  4A4E A;  4C5E A;  1M1K R;  5GAN 7;  2DX1 A;  3CXC S;  2EGE A;  3EFO A;  1RUW A;  1SRL A;  5IHN A;  3PGG A;  4N4G A;  1LPL A;  4ZN1 A;  1Q7Y R;  5I22 A;  5CIU A;  3G1J A;  4LE9 A;  5KYU B;  2QGF B;  2JN0 A;  1KK7 A;  1H92 A;  3LLR A;  3E9G A;  2LNH B;  1H3Z A;  4E2F B;  2QQR A;  4J6W A;  3OYD A;  2JMC A;  2YT6 A;  1M5Q 1;  2PTK A;  3MEW A;  3PMT A;  4ESR A;  2K3X A;  4OB2 B;  1I81 A;  4K11 A;  3JB9 H;  4CC4 B;  4DBR A;  5HK3 A;  4PFZ A;  1OX9 A;  1N9R A;  1IGQ A;  3H8Z A;  1JJ2 S;  2F2V A;  2BZY A;  4JS4 A;  2KMT A;  1WGS A;  2CS7 A;  2RO0 A;  3CCJ A;  1SSH A;  2XDB A;  1WXB A;  4JJN K;  4M78 D;  3JCM h;  1YJW Q;  1OPL A;  3OW2 A;  3CCL Q;  1UGS B;  4M7A E;  2ECZ A;  2XI9 A;  2DLP A;  3OS5 A;  3J80 E;  4C5G A;  3GLX A;  4QQD A;  4KRT A;  2EYX A;  4MZM A;  2A3L A;  2M16 A;  3O8V A;  3LGL A;  1BI0 A;  1ZBJ A;  1D0Z A;  2DF6 A;  4WTO B;  4OMO A;  1BI2 A;  2CUD A;  3X25 B;  2DJQ A;  1IGU A;  2SRC A;  1CKA A;  1PKS A;  2QQA A;  2YRD A;  3SDZ A;  2QTV A;  2FRY A;  2RQT A;  5LJ3 g;  1Z9Q A;  4ZTF A;  3C4S A;  2XID A;  2FVU A;  2X3W D;  1AEY A;  3PIO A;  1W70 A;  3CCE Q;  1TS9 A;  5D6W A;  5GAM g;  5HK0 A;  4DA4 A;  1LNX A;  1C6V X;  3LYI A;  5L8R E;  3TRE A;  1M90 U;  3CCM A;  1E7O A;  3S3M A;  3OYJ A;  1QKX A;  3TSZ A;  2DYI A;  2DL5 A;  2G3R A;  5C6S A;  1VQ7 A;  4HCC A;  1Q86 U;  4F7U F;  3X20 B;  3ZBD A;  4AMC A;  5GAN 5;  3CCJ T;  2E64 A;  1GRI A;  5FU6 C;  4XU2 A;  3CCU Q;  5GAO r;  2VXF A;  1ZUK A;  3M0S A;  2LC4 A;  4M78 E;  1ZSG A;  2QDL A;  1M3B A;  3M0R A;  5FU6 B;  1KQS A;  1EFN A;  1QVG S;  3S3O A;  3OYY A;  2DRM A;  2EYW A;  2DZC A;  2OJ2 A;  4J9F A;  4M77 G;  3M4G A;  2LQW A;  3DB3 A;  1YJ9 Q;  3SFM A;  2DKG A;  4PK4 A;  4JRI A;  1VQM Q;  3VYH B;  2RJD A;  3EGD A;  2FRW A;  3OSV A;  2P0K A;  4JUV A;  3QHS A;  2ZPI B;  4X1V A;  2HKQ B;  2DMO A;  3N5B B;  3RKX A;  2Y4Y A;  2QDY B;  4FSS A;  3KFV A;  3J81 E;  4KUD K;  1N8R U;  1IB8 A;  2OX7 A;  4BY6 C;  3OYC A;  1NYG A;  4VUB A;  1MMG A;  1FMW A;  1VQN A;  5I11 A;  4PJO C;  2VB6 A;  3OB9 A;  4F7U G;  4BY6 B;  2NUT A;  2OTJ A;  3L2R A;  3HHT B;  2IPO B;  3I9Q A;  1ZBX A;  1SG5 A;  4PJO B;  4HXJ A;  4F7U A;  3CCM T;  4MZT A;  3SWN C;  4J83 A;  2MCN A;  2EYY A;  3OYK A;  1RAB B;  4IKF A;  2QI2 A;  1VQ7 T;  3P8H A;  1Z9Z A;  4AFS C;  3PMI A;  1K0X A;  2XG8 D;  4KGV B;  3SWN B;  2OTL A;  1QWF A;  3QII A;  5GMK i;  3RNJ A;  3H41 A;  5GAN 2;  2X9H A;  4J6Y A;  2JXB A;  2FG0 A;  1OX8 A;  4RTY A;  1QCF A;  1KC8 U;  2YUP A;  4M7D C;  2K2M A;  4KGZ B;  1QQJ A;  8ATC B;  8AT1 B;  3S6W A;  1OZ3 A;  2FPD A;  2RI5 A;  1NBE B;  3WVE B;  1JXO A;  4J7F A;  2B8A A;  2AHJ B;  2LMJ A;  1ABQ A;  1ZUU A;  4M7D B;  1U06 A;  2F2W A;  4XTY A;  1T0J A;  2COZ A;  3JCM J;  3OA6 A;  3EG9 A;  1K0S A;  3Q1J A;  5GAN 8;  4CC7 A;  2C0T A;  2L2P A;  3EGX B;  3CC7 A;  1B07 A;  4CI0 C;  3JB9 J;  1IZ6 A;  4QW2 A;  2JTM A;  4B9W A;  3CC2 Q;  2YLB A;  3QSU A;  2CRE A;  3UT1 A;  1N6A A;  5D6X A;  1WLP B;  2E3I A;  1T0H A;  3JCM W;  1WHG A;  2FPE A;  1VQN T;  3A8M B;  2QA4 A;  2FYK A;  2QTX A;  1WA7 A;  2OTJ T;  3MP8 A;  5KYU A;  2FL7 A;  1TUC A;  1M1F A;  3TSW A;  3V7C A;  4JS5 A;  3JCM g;  3OYE A;  3CD6 Q;  4MDW A;  1VQ4 Q;  1ABO A;  1G3T A;  1KQ1 A;  2L89 A;  4LDX A;  3RIR A;  1GCQ A;  2D8J A;  3L2Z A;  3M0P A;  2OTL T;  1M2V B;  3LH5 A;  1VA7 A;  3E1S A;  5GMK m;  3QWY A;  4RTZ A;  1HD3 A;  4FT2 A;  3G4S Q;  2DTI A;  2KRS A;  2V26 A;  3PVL A;  1N5Z A;  1I8F A;  2DVE A;  3QJY A;  2GNC A;  1YIT Q;  4XU3 A;  5GMK e;  1U1T A;  5KE2 A;  1SRM A;  4A4G A;  2CT3 A;  1VQK A;  5GAN h;  1Q81 C;  4E6R A;  4FCY A;  5AT1 B;  4RCC A;  5FWC A;  5GMK j;  2Z0W A;  2E10 A;  5LL6 S;  1G3S A;  3CC7 T;  2VXE A;  4BE2 A;  5CKD A;  1NLP C;  4TVR A;  3QDR B;  1MUZ A;  2F5K A;  4M75 C;  1F1B B;  2GTJ A;  2R5M A;  1R0C B;  3AHU A;  1PM3 A;  2SEM A;  3LGF A;  3I55 A;  1MGQ A;  2MWP A;  3UPU A;  1PG5 B;  1D1C A;  4ZGD B;  4YTL A;  2QA4 T;  3CMA A;  1AOJ A;  2MPX C;  3PVQ A;  4J9C A;  3TU4 K;  1SHF A;  4L6V 5;  3VS6 A;  4XU0 A;  1P92 A;  4C92 C;  3DB4 A;  4HT9 A;  1BYM A;  5GAO q;  1PRM C;  2BZX A;  2RHI A;  3G6E Q;  1Y71 A;  3JCM b;  1OPK A;  2MWO A;  1OYX A;  1AWJ A;  4FYY B;  1VQ5 A;  2KI7 A;  1TH7 A;  2F2X A;  5LJ3 e;  2DK3 A;  3NTI A;  3CBM A;  5LJ3 j;  1HJD A;  1FYN A;  3RMQ A;  1D0X A;  4PJO F;  4HT8 A;  2PU9 B;  5GAM e;  1NLO C;  3MEV A;  2KYB A;  1YIJ A;  2DJZ A;  1VQK T;  1X2K A;  4LUE A;  3UA7 A;  1KD1 R;  1WXU A;  5GAM j;  2NLU A;  3V7R A;  3C0C A;  1K73 C;  4RTX A;  5IAY A;  3URG A;  3CCS Q;  1RAD B;  1XNI A;  1YI2 A;  3FDR A;  2CP7 A;  2P4T A;  2RK2 A;  3NTH A;  4HCB A;  2ZCF B;  1VQ6 A;  4J9B A;  4B6M A;  1UEC A;  5LJ3 h;  3L2V A;  5FLX E;  5GAO p;  2FPF A;  4MMK A;  3I55 T;  1M90 R;  3VS0 A;  2BE9 B;  2D0N A;  3CC4 Q;  1WHM A;  2LJ0 A;  3CMA T;  4M7D F;  1GCP A;  3FIF A;  4FT4 A;  4MZP A;  2ENM A;  1K1Z A;  4BI3 A;  1UFF A;  4IIO A;  3GP8 A;  1M30 A;  4GY5 A;  1RAA B;  4XQ3 A;  1SHG A;  1QVF A;  5D6Y A;  5CK9 A;  1W2B S;  5DY9 A;  2NUP A;  3CQT A;  3TCJ A;  1UE9 A;  1ACM B;  4HCZ A;  1VQ5 T;  4AT1 B;  2AZS A;  2YRC A;  3MKD A;  1IRX A;  2RJC A;  2YRV A;  2LJ1 A;  4PJO D;  4PFP A;  3GPL A;  4HCK A;  2LQN A;  4PJO A;  4OF1 A;  3DKM A;  1R8O B;  2FZC B;  4XTU A;  3J7A F;  5FRN A;  4M77 B;  2YWW A;  3L42 A;  1MMN A;  2E6Z A;  2ED1 A;  3GIB A;  1X01 A;  3QZ5 B;  2QEX Q;  1Y07 A;  5FU7 C;  2CP2 A;  1Q7Y C;  3X28 B;  2O88 A;  3EFS A;  1ZQ1 A;  2X4Y A;  1I07 A;  1RAG B;  1T3L A;  2DET A;  1YIJ T;  3CCR Q;  1N8R R;  4F17 A;  4XTV A;  2X35 A;  3EG0 A;  5KYW A;  2A7Y A;  3JB9 I;  5GJW B;  2HD0 A;  1RI9 A;  2CKK A;  4RUG A;  3CCL A;  4KH1 B;  1YI2 T;  5KYY B;  2RF0 A;  2CH4 W;  2RHZ A;  1RI0 A;  1VQ6 T;  4B9X A;  4M7D D;  1X69 A;  3LWH A;  4R56 A;  4M7D A;  4A4K A;  3MCA B;  2A28 A;  5KYX A;  4JZ3 A;  2DFU A;  5GAN 6;  3M54 A;  4JRP A;  2Y4X A;  5HKC A;  4BUG A;  2ZPG B;  1K9A A;  4D8D A;  2O9V A;  3RR6 A;  3RES A;  5LJ3 f;  3I35 A;  1BIA A;  4ZN3 A;  2YUN A;  3EG1 A;  4KUI A;  2JTE A;  4IUP A;  3CCV Q;  4OMP A;  2V8J A;  3QPH A;  1W2B P;  1ARK A;  1IO6 A;  1Y96 A;  5GAO l;  1KC8 R;  2JOY A;  1QW1 A;  1IHW A;  2ATC B;  2RHX A;  3HTR A;  4ZNX A;  5GAM f;  2FO0 A;  3OYM A;  4M78 F;  1H8K A;  2KAF A;  3OSS C;  3V8L A;  3CCE A;  1OEB A;  2DL7 A;  1M1G A;  2A37 A;  4M75 F;  3MPU B;  4RTV A;  3FRN A;  4PJO E;  2XD0 A;  3RKY A;  4AG1 C;  5GAN g;  4BE0 A;  3EH2 A;  1YP5 A;  5HY6 A;  1KFZ A;  4J9H A;  1C1A A;  1KSW A;  1SEM A;  2XKO C;  2YLC A;  4DEX A;  3OS1 A;  3OQ5 A;  2AIR B;  2GTO A;  3CCU A;  3JCM e;  6AT1 B;  3ZFJ A;  1SF9 A;  4C92 F;  3KUF A;  3OBY A;  2E12 A;  4DBH A;  3REB B;  3THK A;  3CCL T;  4FSX A;  2VYT A;  1YN8 A;  2H3J A;  3PT9 A;  1WJQ A;  2I2L A;  2F69 A;  1YJ9 A;  3EH1 A;  1UUE A;  4OB0 B;  4BE1 A;  4M7D E;  4HA8 A;  2HSP A;  2K3B A;  2RD1 A;  1VQM A;  1M3C A;  5GAN 3;  2ROL A;  2BIV A;  2DBK A;  5GAO m;  1UHF A;  3L2U A;  1WFW A;  1Q95 G;  4M78 G;  2PVG B;  2QYZ A;  3O5Z A;  2JNG A;  2A0F B;  2LQK A;  1TWB A;  2ZPH B;  4M78 A;  2ZGW A;  4M75 D;  2DE0 X;  5HCK A;  4M75 A;  3MEA A;  4EMK B;  2DIQ A;  1GFC A;  3A98 A;  2KNB B;  2DBM A;  2FHD A;  4AG2 C;  4QVD A;  5KH6 A;  1QCN A;  2DAQ A;  3CCE T;  1D1B A;  3S3N A;  1AZE A;  2KK4 A;  3CXC P;  2DYB A;  2X4X A;  1K8A C;  2LZ6 B;  4E7J A;  1WHL A;  1I0C A;  2HEQ A;  4C92 D;  2O01 E;  4N0A A;  4WF2 A;  1V1C A;  3FEO A;  5DM7 R;  4C92 A;  2L3P A;  1S72 Q;  2JT4 A;  4JDS A;  4HVU A;  4FYX B;  4R55 A;  3OYL A;  5J26 A;  1M27 C;  2RJF A;  3CCU T;  2JMA A;  4N4H A;  2HQE A;  5IXF A;  2FEI A;  3REA B;  1M4Z A;  2KE9 A; 
#chains in the Genus database with same CATH homology
 1YCS B;  2LMJ A;  4RTU A;  1ABQ A;  3ULR B;  4OMM A;  1ZUU A;  2GBQ A;  1U06 A;  2F2W A;  1T0J A;  1E6H A;  1X6G A;  2HCK A;  2KRN A;  1K0S A;  2KT1 A;  4CC7 A;  2C0T A;  2L2P A;  1I1J A;  1BB9 A;  4WCI A;  3QWX X;  4EIK A;  1B07 A;  3EG2 A;  2J06 A;  2W10 A;  2DL8 A;  1S1N A;  2I0N A;  1ZUY A;  4Z89 A;  2CRE A;  5GJV B;  2AK5 A;  1FMK A;  2CUB A;  1JO8 A;  1WLP B;  1T0H A;  1H3H A;  2M51 A;  2FPE A;  2J05 A;  2KXC A;  4DEY A;  2AZV A;  1G2B A;  1WA7 A;  2E5K A;  2KR3 A;  1TUC A;  2L3S A;  3H0F A;  3H0I A;  4J9E A;  3TSW A;  2EKH A;  1AWW A;  2YDL A;  4JJC A;  1VYU A;  1B3Q A;  1ABO A;  1GCQ A;  2D8J A;  5IHK A;  3M0P A;  2ROT A;  1W1F A;  2RNA A;  2CSI A;  2RQV A;  3I5R A;  3LH5 A;  1VA7 A;  2DL3 A;  5EC7 A;  1GL5 A;  4J9D A;  2DVJ A;  4HVW A;  1GCQ C;  1X2Q A;  3VS1 A;  1J3T A;  2JS2 A;  3QWY A;  2HBW A;  1HD3 A;  2LJ3 A;  2H8H A;  4RTZ A;  2OI3 A;  4IIM A;  2KRS A;  3PVL A;  1N5Z A;  2L3Q A;  2PZ1 A;  2V1R A;  2GNC A;  2XMF A;  4ORZ A;  2DRK A;  1SRM A;  2KT8 A;  2CT3 A;  2MOX A;  1PKT A;  1AWX A;  4E6R A;  1WIE A;  4AFZ C;  5L23 A;  5FWC A;  1U5S A;  1MV0 B;  1WX6 A;  2J7I A;  2EYZ A;  1NLP C;  4J9G A;  1MUZ A;  2C0I A;  1AZG B;  1PNJ A;  2GTJ A;  4J9I A;  2SEM A;  4A63 B;  2JS0 A;  2K7A A;  2K79 A;  1CKB A;  1UDL A;  3UA6 A;  1U3O A;  4AFQ C;  1AOJ A;  3PVQ A;  2D8H A;  4J9C A;  1SHF A;  1K76 A;  3M0Q A;  3VS6 A;  2JW4 A;  4RTT A;  1NEB A;  2KRO A;  4OMN A;  1PRM C;  2DIL A;  1GFD A;  2BZX A;  3U23 A;  3NPF A;  1OPK A;  1NG2 A;  3EHQ A;  2JM8 A;  2YSQ A;  2A36 A;  1AWJ A;  2W0Z A;  3NMZ C;  2EBP A;  2F2X A;  2LCS A;  1BK2 A;  1PWT A;  1UJ0 A;  4CC3 A;  1UGV A;  2KBT A;  2RQW A;  2VWF A;  2JM9 A;  2O9S A;  1Y0M A;  4JJD A;  2AKL A;  1LCK A;  2VVK A;  2O2O A;  1UHC A;  2OAW A;  1HJD A;  1PHT A;  1FYN A;  2RN8 A;  2V1Q A;  2NWM A;  2DL4 A;  3ZL7 C;  1NLO C;  1NEG A;  1XOV A;  2LP5 A;  2MIO A;  1X27 A;  2KYB A;  3H0H A;  3VRZ A;  2CDT A;  1X2K A;  3UF4 A;  5IHI A;  4LUE A;  3UA7 A;  4D8K A;  4RTW A;  1A0N B;  1WXU A;  2CT4 A;  3EHR A;  4JPB W;  3C0C A;  3M0T A;  2J6O A;  4RTX A;  5FW9 A;  3VS5 A;  1WI7 A;  2DX1 A;  2EGE A;  2BZ8 A;  1NYF A;  1RUW A;  3VS3 A;  4J9B A;  1SRL A;  5IHN A;  1UEC A;  2PNI A;  4OMQ A;  1CSK A;  2FPF A;  5I22 A;  4QT7 A;  3VS0 A;  1ZLM A;  1X43 A;  4Z8A A;  4CC2 A;  4LE9 A;  1RLP C;  2D0N A;  2RMO A;  2LJ0 A;  1ZX6 A;  1GCP A;  1H92 A;  3R6N A;  2LNH B;  3NHN A;  2ENM A;  2KXD A;  1K1Z A;  2JMC A;  1UFF A;  5ECA A;  2YT6 A;  4IIO A;  1M30 A;  5IH2 A;  2IIM A;  2PTK A;  1QKW A;  3M0U A;  4ESR A;  1SHG A;  1YWO A;  2ESW A;  4K11 A;  3CQT A;  2X3X D;  4CC4 B;  1UE9 A;  2RQU A;  2AZS A;  2GGR A;  2LJ1 A;  2KGT A;  2BTT A;  2F2V A;  2BZY A;  1YNZ A;  4HCK A;  1AD5 A;  2LQN A;  1AVZ C;  1NM7 A;  1QWE A;  2ED1 A;  1SSH A;  2YUQ A;  3NGP A;  2K9G A;  1WXB A;  2O88 A;  1OPL A;  1JU5 C;  1I07 A;  1T3L A;  2ECZ A;  1VYT A;  2KYM A;  2DLP A;  4F17 A;  3UAT A;  3EG0 A;  3IQL A;  1JQQ A;  1KJW A;  5GJW B;  1RI9 A;  4KRT A;  1OV3 A;  4RUG A;  1UTI A;  2EYX A;  2K6D A;  3VS2 A;  1ZBJ A;  2RF0 A;  2CH4 W;  1WXT A;  1GBQ A;  2EGC A;  2DF6 A;  4OMO A;  1RLQ C;  2CUD A;  4Z88 A;  1X69 A;  2CH4 A;  2AKK A;  4GLM A;  2DJQ A;  2SRC A;  4M4Z A;  5IXB A;  1CKA A;  1PKS A;  2A28 A;  2M0Y A;  2EVR A;  4JZ3 A;  1Y57 A;  2FRY A;  2EPD A;  3JV3 A;  2RQT A;  1K9A A;  1AWO A;  1Z9Q A;  2O9V A;  4D8D A;  3RBB B;  1KIK A;  4LN2 A;  3I35 A;  2A08 A;  2YUN A;  3EG1 A;  3VS4 A;  2X3W D;  2JTE A;  1AEY A;  4OMP A;  2J6F A;  1W70 A;  1ARK A;  1IO6 A;  4JJB A;  1TUD A;  1HSQ A;  1WDX A;  5FWB A;  4ZNX A;  3PE0 A;  3EG3 A;  4OML A;  2FO0 A;  3SHW A;  1E7O A;  2G6F X;  1H8K A;  1OEB A;  2DL7 A;  1QKX A;  3TSZ A;  2A37 A;  4RTV A;  2HDA A;  2DL5 A;  3TVT A;  3EGU A;  2D1X A;  1W6X A;  1TG0 A;  1JEG A;  4AG1 C;  1G83 A;  1WYX A;  1SPK A;  1GRI A;  1YP5 A;  1KFZ A;  4J9H A;  2DM1 A;  1YWP A;  4Y92 A;  1E6G A;  1ZUK A;  2KRM A;  1KSW A;  1SEM A;  3M0S A;  4DEX A;  1ZSG A;  2QDL A;  1M3B A;  1BBZ A;  3M0R A;  2RPN A;  2GTO A;  1EFN A;  3I5S A;  1BU1 A;  2DRM A;  2EYW A;  2OJ2 A;  4J9F A;  3REB B;  3FJ5 A;  2LQW A;  2VKN A;  3VRY A;  3THK A;  4GBQ A;  2ED0 A;  1UG1 A;  1MV3 A;  1YN8 A;  4AFU C;  1K4U S;  2ABL A;  2FRW A;  2EQI A;  4R0K A;  2CSQ A;  1UUE A;  4X1V A;  2KEA A;  2L0A A;  2HSP A;  1UJY A;  2K3B A;  2RQR A;  2DMO A;  4JZ4 A;  1JXM A;  4FSS A;  1M3C A;  4F14 A;  3KFV A;  2ROL A;  1X6B A;  2DBK A;  1VYV A;  1UHF A;  4LNP A;  2P4R A;  2GQI A;  1WFW A;  1M8M A;  1NYG A;  3O5Z A;  2B86 A;  5I11 A;  2J6K A;  1PRL C;  2DNU A;  2LX7 A;  3GBQ A;  4F16 A;  3SEM A;  2DA9 A;  2DE0 X;  5HCK A;  3I9Q A;  1GFC A;  3A98 A;  2KNB B;  2DBM A;  2YUO A;  4AG2 C;  4HXJ A;  2NUZ A;  2EW3 A;  3VS7 A;  2MCN A;  1AZE A;  2EYY A;  2DYB A;  4LUD A;  1Z9Z A;  2C0O A;  2LZ6 B;  4AFS C;  1OOT A;  4HVV A;  2EGA A;  1I0C A;  1K0X A;  2HEQ A;  1QLY A;  1QWF A;  1V1C A;  3RNJ A;  3H41 A;  2JXB A;  2FG0 A;  2O31 A;  2L3P A;  4RTY A;  1QCF A;  2JT4 A;  4HVU A;  1GBR A;  1M27 C;  2YUP A;  2JMA A;  5IXF A;  2K2M A;  2FEI A;  3REA B;  1M3A A;  1T3S A;  2KE9 A;  2FPD A;  1JXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...