The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
36
|
sequence length |
108
|
structure length |
108
|
Chain Sequence |
b'MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIASEQQ'
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12, Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544
rcsb |
| molecule keywords |
Fructose-like phosphotransferase enzyme IIB component 1
|
| source organism |
Escherichia coli
|
| molecule tags |
Transferase
|
| total genus |
36
|
| structure length |
108
|
| sequence length |
108
|
| ec nomenclature |
ec
2.7.1.202: Protein-N(pi)-phosphohistidine--D-fructose phosphotransferase. |
| pdb deposition date | 2010-06-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02302 | PTS_IIB | PTS system, Lactose/Cellobiose specific IIB subunit |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
