2KYRA

Solution structure of enzyme iib subunit of pts system from escherichia coli k12. northeast structural genomics consortium target er315/ontario center for structural proteomics target ec0544
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
108
structure length
108
Chain Sequence
b'MSKKLIALCACPMGLAHTFMAAQALEEAAVEAGYEVKIETQGADGIQNRLTAQDIAEATIIIHSVAVTPEDNERFESRDVYEITLQDAIKNAAGIIKEIEEMIASEQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose-like phosphotransferase enzyme IIB component 1
molecule tags Transferase
source organism Escherichia coli
publication title Solution structure of Enzyme IIB subunit of PTS system from Escherichia coli K12, Northeast Structural Genomics Consortium target ER315/Ontario Center for Structural Proteomics target ec0544
rcsb
total genus 36
structure length 108
sequence length 108
ec nomenclature ec 2.7.1.202: Protein-N(pi)-phosphohistidine--D-fructose phosphotransferase.
pdb deposition date 2010-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02302 PTS_IIB PTS system, Lactose/Cellobiose specific IIB subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2kyrA00
3RVJA 5TPWB 3W9SA 1XWWA 4P98A 1JHZA 3ILHA 3QX9A 4XASA 1PEYA 2FW0A 1J56A 5TQJA 4PZ0A 1VKRA 2OENG 4DADA 4W5RA 4NV3A 1A2OA 1U04A 4D6YA 5IULC 2FMHA 5C5EA 5ABPA 2FN8A 4LE1A 4W5QA 4D74A 3LUHA 4MS1A 4Z99A 5FWXB 2FQWA 4LDAA 4MS3A 1JH9A 1EAYA 3QLVA 4WWHA 2HJ9A 3IPCA 5DGCA 2YHBA 3NHZA 4KPYA 5DCLA 2AYXA 2DRIA 2IPAB 5JNUA 2FMFA 3I5AA 3N0XA 4RY0A 1ZGGA 4XFKA 2E4VA 3FFWA 4RK7A 1RZRD 1DCFA 3HVRA 1SXHA 1NXOA 2JVKA 1QKKA 1XHFA 3RVMA 2VK2A 2A9QA 3H1FA 2FLKA 4PICA 3F7NA 4RDCA 3GWGA 4O1IA 3HXMA 1GCGA 4HYEA 4IMJB 1APBA 1Z17A 1R8JA 1GUDA 4MLDA 3HEBA 2JRLA 3HCWA 3H5WA 1U8TA 1YVUA 1P8AA 3IP9A 1ABFA 4XARA 5IC5A 3NNDA 2PLNA 3CLKA 5IUKC 4RU1A 1PEAA 1GLGA 2FMKA 1MB3A 2LIVA 2GKGA 4NCAA 1RZRA 2LPMA 4G0YA 1EFAA 3F6PA 3I09A 3O75A 3HJFA 1NXXA 4HNSA 3RVSA 2PUAA 4W5NA 2J48A 1PNTA 1DCKA 5T7BA 2GI4A 3BILA 4RY8A 5TQ0B 3EDCA 2PUDA 3O1HB 3H6GA 4G0QA 3BBLA 1ZGZA 1E6MA 3CZ5A 1JL3A 4ZMSA 4G0PA 3OQOA 2R25B 2BGGA 2PUBA 3N75A 2H0AA 4YGXB 1SD5A 2FEWB 2FN9A 4N0QA 2E4YA 4Z9AA 1QPZA 5CNKA 4Q6BA 3I42A 4MR9B 3H6HA 4WUTA 3QEMB 1FFGA 4RKQA 3GT7A 4KZKA 2IPLA 1P6QA 3LUAA 3LFTA 3UUGA 1OXKB 4EGSA 3UK0A 1URPA 3GBPA 3ROTA 1SXIA 2HSGA 3OO1A 1NATA 3CNBA 3URMA 1BDHA 2IPMA 3O2SB 4N47A 4MR8A 3GBVA 2QR3A 3FMVA 1K66A 3N0RA 2RGYA 4MR7A 4PE5B 3C3MA 3QEKA 5HQJA 5TPWA 3H1EA 4TLMB 2O20A 2E4UA 2JK1A 2GBPA 3T8YA 4EYQA 3G1WA 8ABPA 4F3TA 1DZ3A 3KS9A 5EWJB 5GOTA 4JP1A 3SQNA 5DLEA 3O1JC 1JFVA 4RXUA 1JDPA 2FVYA 1GUBA 3SM9A 1LK0A 1Z13A 4OATA 3OMWA 1ABEA 3FDFA 3LOPA 2HQBA 3H5TA 4IRXA 4EVRA 1D2AA 2GWRA 1QP0A 3DZDA 1ZVVA 4G86A 4YO7A 2WWVD 3OQMA 3IP7A 1BAPA 1D5WA 2MYTA 1CHNA 4ZPJA 1USGA 1VPWA 1YMUA 1E6LA 4MPTA 3F73A 1M2EA 1YK0A 5CNJA 3QEMA 4NICA 2H3HA 1U2QA 4EYKA 4KQ9A 4RZSA 1WETA 5TPZD 5IBQA 3EODA 1FFWA 1Z26A 2X7XA 4YWHA 1EWKA 3SY8A 3LKBA 3QELA 3RVKA 4KNYA 4KQCA 3LUGA 5PNTA 1PUXA 3JPWA 4WXMA 1QP4A 1JBEA 3QLUC 4QICA 4QYWA 3RVNA 5JNRA 2PL1A 3RQIA 3A0UA 3JPYA 3GYBA 1MIHA 4DN6A 2M1ZA 4Q6WA 1Z15A 5KQLA 1Y1LA 3VNAA 1D4ZA 4KK3A 3OLYA 2AYZA 4JA2A 1Z2EA 4L85A 1ZH2A 2WB4A 4MQFA 5KQPA 2HQOA 1C4WA 1C0EA 4Z4GA 4G97A 4RKRA 1LJUA 2L18A 4P1ZA 5E3JA 1DBWA 3SNKA 2FTKE 1ZAYA 2CHFA 2B1JA 3ROFA 3FGZA 3T6KA 4JAVC 4EYOA 5F64A 5IEBA 1F51E 3HZHA 5IUNC 1JWLA 3ILYA 3BREA 5KQGA 1NXSA 3A0RB 1P6UA 3H5VA 4E7PA 5IX8A 3OLWA 1JFTA 2FXIA 3CTPA 3OM0A 4OTZA 4S04A 3OQNA 3MF4A 5JNSA 2MYNA 2CD7A 2FSPA 1CEYA 3LMKA 2R48A 3KLNA 3OO0A 4KVFA 4Z4IA 1T34A 3N53A 3RVOA 2IYNA 2VUIB 2WY2D 1MAVA 2PL9A 5D2CA 2PUFA 1NXTA 4G0MA 2L19A 3OLXA 3H5OA 2WMYA 5EWMA 2NZVG 1JF8A 4YV7A 1JYEA 4JASB 5HM6A 2A9PA 4LE2A 5I4CA 4G0ZA 1DJMA 1QNLA 4MGEA 4QYMA 1PHRA 2Q5CA 3HDVA 3CU5A 3HM9A 5JNTA 2HPHA 2P9HA 1VLZA 1YTUA 2HQRA 3QLUA 4NQRA 1BA2A 1E6KA 4N76A 5IEJA 2F8SA 1FSPA 3KG2A 3Q9SA 6ABPA 1RNLA 4JOQA 3C6QA 2PJUA 4RS3A 2QZJA 1DCMA 4RY9A 3KJXA 4N0PA 2A9RA 4YR7A 4IMIB 1DP4A 3O21A 3L6UA 4Z0NA 3O74A 3S99A 3KYJB 4D6XA 3P9YA 2LBPA 3H5IA 4MLCA 4RXMA 1RXIA 4MS4B 1TJYA 9ABPA 5EWJA 3JTEA 2N9UA 4LDZA 4UHKA 2PE5A 3DLHA 1KGSA 3CS3A 4Z4EA 3O2JA 2QSJA 4H60A 1USKA 3F6CA 3Q41A 2PUEA 1DBQA 1GCAA 3MM4A 4G0XA 4MRMA 3QK7A 4LE0A 4TMYA 5DTEA 3Q15C 3HS3A 4MR9A 3EJWA 5DKFA 3RVLA 2FQXA 3CG4A 2MYPA 1BDIA 3MA0A 4NCBA 1ZDMA 1VRVA 1YMVA 2I6FA 2VYCA 2L17A 5EWLB 1QO0D 1FFSA 2B4AA 1M2FA 1A04A 3CG0A 1LJLA 3GA5A 1Z25A 3JVIA 3M9WA 3LUFA 4M88A 2R47A 5TQ2A 1SXGA 4F8JA 5IUJC 1H9CA 4H3KB 2RJNA 3TB6A 4S05A 3GRCA 4RK1A 5EWMB 3T95A 2E4WA 4G0OA 4JB2A 4EVSA 4MR8B 1CYEA 3GL9A 3MQ4A 2QVCA 1NY5A 3SG0A 4B09A 2IPNA 4PYRA 4ETIA 6CHYA 1M5UA 1EWTA 4PEVA 2CWDA 3K4HA 1OXBB 2OQRA 1I3CA 3H5LA 4ZJPA 2FEPA 1JYFA 4Z4HA 4F12A 2RJOA 1AB5A 4HNRA 4EY3A 3HK2A 3N8IA 1ZY2A 4RK5A 3SAJA 4O1HA 5TPZA 2LUOA 4LX8A 2V0NA 3BRSA 5HSGA 2FMIA 5KQMA 1Z18A 3IDOA 3LUDA 5JS1A 3MMNA 2JVJA 4YCSA 2JVIA 4LZLA 4ETMA 4EVQA 1NXVA 5BR1A 5KC8A 4Z4CA 5FBHA 1MVOA 1ZHHA 1HEYA 4ZMRA 3RVQA 4H3HB 5HKOA 2NT4A 1DC8A 3EULA 3D02A 2TMYA 3IP6A 1TLFA 3NHMA 4MS1B 4JB0A 1TVMA 1L5YA 3N0WA 4OLBA 2NUBA 2GX6A 2WJAA 3O2QB 3RH0A 2PUCA 3VNBA 3E61A 3HDGA 3DGFC 3OMXA 4KRFA 3GV0A 2PMCA 3H1GA 2WJWA 5TQ2B 3K9CA 4WXEA 2RDMA 4KK4A 2VUHB 3N6VA 4EUKA 3RVRA 1MB0A 4E7OA 3KCNA 1ZH4A 4GNRA 4KREA 4Q7EA 4MQEB 1DBPA 3QX8A 3DGEC 1USIA 3FFXA 4L4UA 2ZWMA 1XHEA 2IOYA 2NT3A 1UDRA 4GPAA 3EGCA 1RPJA 3KSMA 3G85A 4IILA 3JVDA 1JDNA 1EHCA 5B3JC 1B00A 2XDYA 3KHTA 5TE9A 2ID7A 2KYRA 2ZAYA 1ZESA 3Q7TA 3OLZA 4Z9BA 2R4QA 1NTRA 5FWYB 5JS2A 5BQ3A 3LUKA 3T38A 3M9XA 1QQAA 3EQZA 2FEKA 3JY6A 4MYRA 1DC7A 5BRJA 5CHYA 3BRQA 1U0SY 3HUTA 3TO5A 1A0OA 3IPAA 5C5CA 4F11A 3CHYA 3KYIB 3QLVC 1IIBA 1QQBA 4RK6A 2QU7A 3TD9A 4OLAA 1KMIY 2IKSA 4RWEA 5JNVA 1DG9A 4N03A 3NNNA 3CZCA 1ZN2A 3E3MA 1ISRA 4ML3A 4HNQA 1LBHA 3KKEA 4MS4A 3OM1A 4YRZA 1YIOA 1PNRA 1W25A 3A3KA 4XAQA 3O1IC 4KMRA 3HUUA 4MRMB 4W5TA 1TMYA 1S8NA 2LP4Y 4Z4FA 2JB9A 3LTEA 4ZYLA 5KC9A 5FWXA 4UHJA 1DRJA 1QMPA 5ED4A 1M5TA 5CNMA 2L2QA 7ABPA 4RK4A 3B2NA 4XXHA 2MYUA 4OBBA 5EWLA 5B3JA 3TMYA 2MSKA 4O5AA 2W42A 1AB6A 1ZITA 1RXEA 4TLLB 4MR7B 1QP7A 3HO1A 3I45A 1DRKA 2IDMA 1YS7A 2JBAA 4W5OA 1P2FA 1U2PA 2PKXA 3MYYA 1QO0A 3HSYA 3A10A 1YS6A 3LUJA 1NXPA 5FWYA 2PUGA 1Z16A 3MIZA 1TM2A 4F06A 4WZZA 4EYGA 3Q7RA 1Z12A 5JNWA 2QW1A 4N41A 3HV2A 2F8TA 5KWSA 3IP5A 1ISSA 2QVGA 3C3WA 3KTOA 3CKMA 5KI6A 3DBIA 3RVPA 4IGAA 3CFYA 1NXWA 3LKVA 3NBMA 1EWVA 3FFTA 3LUCA 1W9HA 1YK1A 4FE4A 4IF4A 4MS3B 3D8UA 4RK0A 4WT7A 5T3YA 1E2BA 4RV5A 3EQ2A 4FB4A 5TQ0A 1SRRA 4LRQA 2MSWA 3QLTA 1LBIA 1KRWA 4MAAA 3EAFA 4KFCA 4MQEA 3DLBA 3CRNA 4QPJC 3R0JA 4Y9TA 4RXTA 1JX6A 2MSLA 4TN5A 4YLEA 1Z2DA 2JCGA 2NZUG 3M6MD 2FQYA 4CBVA 4DQDA 2P4UA 3OLVA 1D1QA 3JS5A 1JLKA 1JFSA 1FQWA 3QELB 2E4ZA 2ID9A 3KLOA 4ETNA 2QV0A 1BVHA 4XLTA 4RSMA 1BDJA 1D1PA 1F4VA 2CHEA 5CNIA 3C97A 2A9OA 2QXYA 2FKAA 5GQSA 3UKJA 2WRZA 1KRXA 2YHAA 1K68A 2E4XA 4KV7A 2PAFA 4OG2A 2FLWA 4YS6A 2JBAB 3C3KA 5FBKA 2M98A 3NNSA 1L5ZA 4MQFB 4FE7A 4YP9A 3Q7SA 5BRAA 3H75A 3L49A 3TX6A
chains in the Genus database with same CATH superfamily
5AJWA 1JPUA 4ZOQI 4I8DA 3CO5A 1JB1A 4NBNA 2FI1A 1Z82A 3AEKB 3DAFA 4UJ5A 1S3GA 3SS9X 2I4OA 1HK7A 2FW0A 5AM5A 1RS0A 1MJGM 2O6LA 4GOJA 3T15A 1UK7A 3TLJA 1DI0A 5AW2A 2VWGA 2CVOA 4KQIA 2D13A 3HSKA 5IDVA 1GA1A 1Y1SA 3FTFA 5IJZA 5BWCA 3GVHA 3PCTA 3B20A 4FWIB 4Q1AA 4UVHA 3VNSA 4C0LA 3DTNA 3FAZA 4MS1A 5AKLA 5TXGA 4HVCA 3EK2A 1VG0B 3UJCA 4MRNA 5HFNA 3T0GA 4AZ0A 1O94C 3KLPX 1JA9A 2V0GA 3DKIA 3ZXIA 1TL7C 4LSMA 3LSYA 4RCVA 2QT0A 2C92A 3AHJA 5DO9A 5J43A 2J5BA 3H04A 4MQ5A 1TQ8A 3GGPA 4Z9FA 1A4IA 4DUZB 3ABZA 5J5CA 3VDRA 1MUUA 1BQ4A 1QKKA 2QJWA 1R50A 1T4GA 4QUAA 3NBAA 4MVJD 5CA1A 4PONA 1RQXA 1CHDA 3GXBA 3WWCA 4H7DA 2R8EA 4PICA 1BKDR 4O1IA 3SF0A 1GCGA 3FJYA 5J23A 1Q3HA 4NY1A 4EF6A 1QGAA 1O77A 2WWIA 4GXQA 5CFOA 2IUEA 4WD3A 3HEBA 1IM5A 2Z08A 3ZTYA 4DT1A 3WYAA 5I7OA 2VYVA 4X8HA 1L4FA 1YIAA 5COQA 3HCPA 1K06A 1Z3IX 3NZEA 2HPVA 2PWBA 3FTQA 1F1BA 3N8GA 4JZYA 3HJNA 2VJYA 4LHZA 5INTA 3I3SR 1EFAA 2JD1A 4A82A 1KY5A 3P97A 5GZ3A 3M4YA 3LY8A 2C77A 1EKXA 2H2IA 1NBMD 3RVSA 3SD7A 1DQYA 4Y2RA 3T9CA 4JLMA 5F1OA 3B6MA 3FYSA 2GI4A 2IUTA 3C5VA 3LKZA 3C4VA 3WK9A 3H6GA 4PSCA 2N47A 1JL3A 1N77A 5BOVA 1YVPA 1P4RA 2HA5A 2VWHA 2AQ8A 4NONA 2G1JA 2ZM5A 3RUAA 3DNMA 3KPVA 2Q2VA 3OA0A 3HVIA 2J1LA 3T3NA 3R9WA 3H6HA 1ZL0A 1E9DA 4IICA 3TINA 2XYQA 2Z2ZA 4YAFA 3N2ZB 1UFVA 5AKZA 4CI9A 1QK5A 2VT6A 3OD5A 4HXYA 2BKEA 4B76A 5LYJF 1RRFA 5K3SA 3ET4A 1NM5C 1U7TA 1XIVA 3ZW7A 1R8QA 1XTUA 4HPXB 1DGQA 2C2GA 3CNBA 2JJYA 2EJUA 3SE0A 1RJWA 4QJBA 1ADJA 1H66A 3QVMA 4HLDA 1FRNA 3A1FA 2V7XA 2H29A 4NFYA 1KXZA 1CIVA 2IDJA 4UHBA 1GWNA 3U4MA 1VSTA 2EW8A 3HL4A 1N33B 2Z9DA 3U9TA 4NMHA 3H1EA 4FMPA 4DC9A 5HQTA 2BTOA 3OTIA 2JLSA 3O8OA 2E5FA 1RVDA 2W83A 3KS9A 2FPWA 5SZHB 3LZCA 1ACMA 3QF7A 3FLAA 3WLKX 3EGDA 1WXFA 2JKYA 1QQ5A 3KRTA 3MWDA 3D43A 4H7PA 3SM9A 2PMFA 4XM2A 2C4NA 5HA5A 3KBBA 4JSRA 4IUDS 3W5CA 2JHCA 4BRWA 4MQBA 1K4KA 4XJSA 4DGSA 3D7KA 1SU8A 1PEKE 4BFUA 1VFPA 5F2OA 4XFDA 4Z0PA 4JYAB 3BGSA 1X9IA 1CJKC 4J90A 4YLGA 4KPFC 4QE3A 1G0OA 1TXGA 3DW1X 2VHYA 4TLDA 1EUCA 4WKOA 4G5HA 4M53A 4MAFA 1TAUA 3HE3A 2YNMA 4J3FA 4R41A 1BH6A 3FROA 3QTBA 3QFFA 4AJNA 4QYSA 3A06A 2V6MA 4W63A 2WNIA 2OZLB 4H31A 1XTQA 2INGX 3EE6A 4M9QA 3E2PA 3FMOB 2QE6A 2IZ6A 3T35A 3SC2B 1IXZA 4LVUA 3V46A 3QOWA 3C3EA 5JASA 5BN3B 5LYJB 1D9ZA 4K2AA 5T41A 4WACA 4PANA 1Q83A 1XROA 2X8LA 3U3RA 3HHPA 2CJYA 1OLXB 3FYUA 2ZOSA 2HO5A 4RZIA 4U6QA 1UZLA 1Q2XA 1HE8B 3FCEA 1EA5A 1OREA 1Q44A 1A8QA 3NIFB 5CFNA 2ZYGA 4RJJA 3EA0A 2R3SA 2IK8A 5FUBA 2JDID 4AVYA 3SQOA 2DTXA 3H2HA 1X1BA 1HT3A 5EJ5A 1TAHA 3OLYA 1Z28A 2ZRDA 2C4VA 3QZUA 4LQ4A 2BCJQ 4L85A 4R2IA 4TSKA 1OV6A 1U28C 1SVKA 3LZDA 4DDHA 2GD1O 3FGNA 4F4UA 2V65A 2B4KA 1SPBS 3O8QA 4RTKA 1TYDE 5DM60 2VCYA 1W1WA 3EWSA 2Q46A 4LYEA 2R68A 4P1ZA 5E3JA 4JI5B 4E6PA 3RFTA 2JFGA 5ERGB 1JB9A 4G3XA 3EH1A 3NBXX 5A7GA 2VHUA 3NCTA 4N6OA 3HVKA 4PFSA 3QVOA 1T9GR 1IB0A 4PG8A 3G9QA 2B1RA 1ZLYA 1M8KA 2MWMA 3ND9A 3MWFA 4HNGA 3H5VA 3IERA 2C20A 3MWEB 5C0OE 1B26A 3O26A 3RR2A 2RGDA 4CM4B 4CM6A 4OFWA 5JQWA 2CCJA 2EKZA 2KLBA 3REGA 1Z2AA 3TSZA 1IU9A 3UJBA 3R20A 4ESOA 2VUIB 4BVJA 5CUQA 1LSUA 3AHIA 3LWZA 1ZW1A 3LVFO 3W5JA 4C04A 5CX4A 5EEHA 2IV3A 5TLSA 2WT4A 4NU5A 4OXRA 1FS5A 3JQFC 5ADHA 1PRYA 4IDBA 3N59A 3JAKA 4WADA 5CYOA 3I34X 2QDXA 4PQGA 5EPUA 5EWMA 3RSOA 5HS4A 1QYVA 4BFTA 4MUAA 1L5RA 3PS9A 4ICIA 2P8SA 4U7TB 2O7SA 4XIGS 4ZAVA 3UA4A 3ZWMA 3ORYA 1IUOA 5E7MA 3FHJA 4DTCA 4DDVA 4N9QA 5DBGA 2IYLD 3BMCA 5D5PA 3SLKA 1MW9X 4JVOA 4ZQCB 1QBGA 4LVOA 2Z04A 3D6NB 4QPCA 3Q0TA 3TZQA 3UPUA 3PXUA 4LKRA 3CLSC 4ZEXA 4BLRA 4RD1A 3ZG6A 1Z5PA 4HDNB 5E4YA 4RS3A 2XDQB 4JBNA 3AL2A 2DFKB 2RCYA 3PQ3A 1PJ3A 3H11B 2FE4A 3B38A 5KDLA 1IQRA 3WL8A 5JZMA 1UJ2A 5F78A 1PR6A 1XWFA 3TNLA 4TV9A 4A10A 3M1LA 4IIDA 1XLTC 1IUPA 2F43B 3O9MA 5BPFA 2WYUA 1X7WA 2HJRA 2IOFK 2Q0XA 2WF8A 1RLTA 1VIMA 1OD6A 3ENKA 3PLNA 3PUXA 1O57A 4MEAA 1E69A 5L4NA 5D8DA 2F17A 2DT5A 2NQ8A 3GGJA 3OOHA 5IM5A 1UC9A 3P4YA 4QT4A 3MB8A 1TB4A 5ICCA 2AWOA 1K8XB 3ADPA 4LE0A 4IDEA 2G0AA 5FNVB 4LHVA 3KYCB 5ALEA 1NKVA 5ITZA 1RRPA 4KAXA 1BDIA 1YUNA 1Q2UA 4HJRA 5F12A 1RJEA 4NCBA 4GLLA 1J5XA 2B61A 2C2YA 3K09C 3LDFA 4QTXA 3E0QA 1QO0D 3S7TA 3WIOA 1M2FA 3P9KA 1ID8A 2WZBA 1YDHA 5CPFA 1I1NA 1N25A 1RLUA 2P41A 1C81A 4D80A 5IAAA 4ZOLF 4ZO8A 2KI5A 2EL7A 1CJSA 2O0KA 1XD2B 3FPCA 4G0OA 1YZUA 3HDQA 2JHGA 3L7CA 4W1RA 4E5YA 2FPOA 2WWWA 1JR4A 1U3WA 1UBCA 3JQGA 1DDOA 3K2QA 2XQKA 3NEAA 4UMEA 4EABA 5JJIA 2FSGA 4HDQB 1N6HA 2Q07A 5HGXA 1U0BB 3NP9A 1EFHA 4FOOA 4RFVA 2GXAA 3VBCA 3FB1A 4JQCA 4RQAA 5TMPA 4PEVA 5ICFA 5EHXA 5T3UA 3SR0A 3ZWYA 1WUJS 1KP3A 3DVAB 2JFUA 3MTQA 3HK2A 4GM4A 1VG9B 2B83A 1JMVA 3PT5A 4Q82A 4W6ZA 3MLBA 3SN6A 3WJ1A 5TPZA 2FK7A 3EXAA 3PQCA 1QRUA 3WBJA 2LUOA 2J3QA 4CF5A 3UJ8A 4R2KA 2F8LA 3VR6H 2VHEA 4YGYA 1OZHA 1G21A 4WY5A 2C97A 5JHHB 3N05A 1MRZA 3LUDA 1LTQA 4LG1A 3LS2A 3GZ4A 4RPCA 2BDEA 1WU8A 1I9CA 3M34A 4GM0A 3VOTA 2Y4OA 3RT7A 1M66A 3BB3A 4C05A 1PEDA 3GF4A 1ODJA 1E5VA 1G6HA 3F78A 3HB5X 4G24A 5DNAA 5FQOA 4F9GA 5J4HA 2IYSA 4LJ8A 4XH9B 5HYVA 4W9NC 4ACAA 3L1IA 4OHBA 4BNFA 1SCUA 4XX0A 3AETA 3ZVRA 3ZWNA 2Q27A 1C9EA 1FX0B 4WK0B 2AQHA 4FNMA 4KSBA 5TRTA 3CZRA 2WJAA 3KJFA 1ULHA 3O2QB 3OA2A 1DAPA 2XYRA 4US0R 1KQOA 3RAEC 4YBRA 4DSZA 1R6UA 4BDSA 3P9RA 2GEKA 2BRUC 1KBZA 1HXHA 3E9DA 3AIMA 3NYRA 3X1WA 5B37A 4UBLA 1C7IA 4PPFA 4LPSA 3NHAA 2RHGB 4GHWA 3OHSX 5H4HA 4MHTA 5CH8A 1CBUA 4RA6A 4G67A 1KJWA 4GPAA 4AN1A 5F52A 1MXFA 1IHXA 1RQRA 2X7HA 4RA9A 4YCLA 4U2GA 1KYTA 1TT5B 2ZAYA 2QROA 1RAEA 4MYCA 5LB2A 3STXA 5FTNA 1O6BA 3ANXA 4H7JA 1FNNA 1ZBDA 4J75A 4J1SA 2R4QA 4DKXA 4C2UA 1Y9AA 1P5FA 3EHEA 2IE0A 4DQLA 2RFLA 4PSKA 3R8CA 5LDHA 3DW3X 2OCDA 2FXVA 2W6CX 1USVA 3TO5A 2MMCA 4WK2B 1F6DA 5HMMA 1L6RA 3NAMA 3K5IA 1H5UA 3OZUA 4I4TB 3G2PA 3GPCA 4LIPD 1QQBA 4G89A 1QWSA 4U8HA 1ACJA 1TZKA 4UNRA 2OBFA 4DPKA 3Q11A 5EUQB 2DBQA 1UZUA 1CYDA 1YZTA 2NADA 4MS4A 3UV6A 4AT1A 3QPCA 2OHFA 3G8BA 3GDGA 3B1KA 3DDCA 1W25A 4M0FA 1L9XA 4KG7A 1KAEA 3MB5A 1AXRA 4Y9DA 3NC0C 4M55A 1E4EA 2A1IA 1F0KA 1NC1A 1GG2A 2I4IA 1K8YB 1M73E 2OP1A 5FWXA 2GBLC 2ORVA 3MWGA 1E9BA 2ZR8A 1P7VA 1XVTA 4JLUA 4F7DA 3IMKA 4XXHA 3WICA 4BX8A 3LPAA 4LSWA 2PANA 3DLIA 3QUSA 3C14C 5JH7F 1NSTA 2BFPA 2MSKA 1A88A 2FUG1 4EKEA 3E1GA 1Z0ZA 3OJXA 4MR7B 3QHPA 4FJ1A 3LQ1A 2DF8A 4KNWA 1CVLA 1BXZA 1ODSA 3TJRA 4EM6A 3BFVA 3ZTTA 4DIDA 1KA9H 5C1BA 1JE1A 1Q14A 3KVOA 3LC0A 4U2KA 4YMWA 3UANA 1E5TA 4OMCA 4LJLA 4B8YA 2B2NA 1VE1A 3P2JA 4H16A 5IPFA 4PIPA 1O9BA 1REQB 4NZ9A 5DGDA 3T3DA 5EXDA 2A86A 3LXMA 3OQNA 1WDLA 4L4XA 5I3ZA 1OIVA 3L18A 4LBVA 1HOXA 1XCBA 3WGZA 2BGWA 1VCOA 4N41A 1WSDA 4IGIA 8ATCA 4YCAA 4C1BA 3ZV7A 4M36A 2PSSA 4F1WA 1MTZA 4MRAA 1W5BA 3L7NA 4PLZA 5LFAA 1ZSVA 4R2XA 1ETHA 3UJDA 1KJ9A 5FLKA 1VL5A 1YK1A 3DTTA 4OGWA 2QUAA 4DTIA 4ZKEA 3GJ0A 4F60A 4B7ZA 1K3TA 4YREA 1W87A 1HDOA 1SRRA 4D2IA 9MHTA 2MSWA 2HJGA 2ZIVB 4LCBA 2CNWD 1PR9A 3PB3A 2WSSA 5IVHA 3DHVA 4P0TA 4EKNB 4MB2A 4ZK2A 4UQPA 2FP3A 2VTVA 2GFQA 5LZ5A 1U1DA 3THYB 3K32A 2GYYA 3AEQA 3DAYA 3O4IA 4LKOA 1X77A 3GVXA 4QWMA 1C30B 3G8DA 1XZQA 4CTNA 4ETNA 2JNWA 1DOZA 1DO2A 1JI3A 2PS9A 2IV2X 1WAMA 3E22A 5JEEA 2A9OA 5DTIA 2EAUA 3KJQA 2A0UA 1QHXA 3EH2A 1DUIA 4NBTA 4PZCA 4TXHA 4YDRA 4CV1A 1G41A 2L69A 1G8PA 4N01A 1GP2A 3OIUA 3GEIA 1R6AA 3BQNB 3BQ9A 3ET5A 4XWTA 5DBIA 3V1KA 1XZCA 2M98A 4QTTB 2ZBFA 1ZAKA 4GZ5A 5KCZA 2A1TR 1LH0A 2AXNA 1HDZA 4MWSA 4ONEA 4LNAA 1E2DA 5H9WA 1E1MA 1A50B 3T3EA 3HYLA 3T9FA 4E3WA 2D2XA 1EM8B 5FA5A 4UJ3A 2PLFA 3OZVA 5B1SA 4EA6A 2R6ZA 4ZVLA 2PMKA 3OECA 5TY0A 2VSQA 4BWFB 4A5SA 4ZAYA 3C8HA 2P7HA 2C61A 3FJOA 3NTXA 2M32A 3CBGA 3IAM6 2RGEA 3N5KA 5ABPA 3OHPA 2Q5HA 3C16C 2FN8A 2HCFA 1RBYA 4GICA 2CL7X 4PVCA 2EX1A 4R69A 4CNQA 3U3KA 2J41A 3GDFA 2IZ1A 3TD2A 2ASEA 3O3OB 5IJ9B 3AF6A 2BEJA 1GADO 3MILA 3ZW8A 1AKWA 4EEZA 3GRZA 4ZDKA 5EE5B 2CXHA 2VPPA 3DDWA 1ZGGA 3DLAA 4RK7A 1FE8A 3GN2A 3JQDA 3K2EA 5IZCA 2OQIA 2APJA 1N8SA 4YRPA 2W2NA 2YY7A 2NGRA 3R7WA 1NI4A 5IU6A 4ND7A 4QFMA 4FGZA 1X1QA 4Q0MA 1V9LA 4HHEA 4BS9A 3B1JA 4RDCA 4IH1A 4JI1B 1N7JA 1SVSA 2PRKA 2B1GA 1DQZA 3E7PA 4ZOLA 1H6BA 2A84A 1LPNA 3CX4A 1RHUA 2W2PA 1DIRA 2LZ0A 4IXMA 1RWKA 2I6TA 3PI6A 4CEJA 1DPFA 1JKMA 3IO5A 4YMVA 4JC5A 5C1OA 4B3BA 4IIJB 1AK1A 2DFPA 3WZLA 3AUKA 5ALTA 1PEAA 2B0CA 1MB3A 5FUXA 3I9NA 3KKKA 1QVRA 2PYDA 4OBWA 4KOEC 5A9TA 2E0IA 4DLRA 4PQFA 2GCOA 4CKWA 1BXGB 3A26A 1QU3A 4GT1A 3E4DA 1F6BA 2DBVO 4FC7A 4C08A 3CPEA 3SMVA 2XR1A 2YXPX 1X3LA 4ZQFA 8ADHA 1C3JA 3DCYA 3ZD8A 4HTFA 2CY0A 1KDTA 3BAFA 1U28A 4RX1A 1L6IA 1WZIA 3T5MA 3U9LA 5KNCA 1GGNA 1GZSA 2RHJA 2Q3MA 3HO6A 4KFRA 3N70A 4QHYA 3EOBI 4GI1A 3FRHA 1BRMA 2Y0EA 4LWOA 1PW5A 5EIHA 1R4MA 1VZ3A 1XZIA 1JP7A 1QHIA 3AEUB 5LLDA 1Z8DA 3G79A 2GAIA 1PWEA 5KB3A 1N34B 1AGNA 1ISHA 2VA9A 2HRCA 3BH6A 3GUHA 3RS7A 4C22A 2UUCB 4Y1FA 4GWKA 3OU2A 3NATA 4RIHA 5EZSA 1U2DA 3NDJA 2AOWA 3UW1A 5CLHA 3DYIA 4Z2YA 1BX0A 2QTNA 4ABYA 4E1AA 5BYAA 2CYCA 4GGMX 1SZCA 2JF0A 3BB4A 1KMHB 3C3MA 1Z62A 2QI9F 1X1CA 1UJCA 2NO5A 3BWCA 2GCIA 3OIYA 3QUCA 5CEFA 2GBPA 3FPSA 1RYYA 3T8YA 3WQBA 3MUEA 3SBOA 4L4YA 4LYJA 4UVGA 1PL7A 1Y9JA 5GOTA 3ZLJA 4ZCSA 3EC7A 3G0OA 3VDXA 3ZYZA 4BNMA 1MLDA 1YRHA 3VR2D 1R4NB 4GZMA 1D3AA 1PLLA 2GHTA 4D43A 2ZEJA 1K6MA 1Q15A 2XW6A 1P2TA 1CS0A 2ORYA 3OMWA 4RD2A 4MRPA 2CT8A 4PINA 1WMEA 4O4JF 3DEIA 3GGOA 2CDRA 4NE2A 3W2IA 3O94A 4OP2A 5GY7A 1XBTA 3VNVA 3GLRA 4S3MA 1ZVVA 3DT8A 5ARBA 5JNLA 1FZQA 1X2EA 2GDJA 4ZPJA 3FNIA 4WJZA 4H4CA 4AQYB 5CFRA 1NN3A 1P80A 1UAGA 1UWKA 4QOJA 4RVOA 1RM5A 4MPTA 4W9NA 1V45E 2AOTB 1EFTA 3FNRA 2I1QA 2IYTA 3L8EA 2H3HA 4NICA 3RSGA 2ZIFA 3G88A 4EYKA 5TPZD 4YP1A 1JIIA 4FGKA 4NBWA 5C34B 2BP7A 4D0LB 3AB3A 5A03A 5CXQA 2G0NA 1OIWA 4UCFA 3V8BA 3SQLA 1HO3A 1QTIA 3DPUA 2XKAA 1XEWY 4GI7A 4Z86A 4XOUA 2MR6A 3RW9A 3V4VB 2GLXA 2GYVA 1FJXA 4XD7A 3OEYA 4EF4A 3C2QA 4QYWA 1CUCA 2O4CA 3JRNA 4FNGA 2X9QA 3EPKA 1PAUA 2QQFA 3OLCX 5IBPA 5KQLA 2H1RA 4F93B 2EKPA 1QLJA 3ZDXB 4AMYA 1E2EA 3B7WA 2CLHB 6GPBA 1C9JA 4GYYA 3WLNA 4C21A 2P2DA 5JS8A 1PGJA 2H5EA 2G09A 1SVWA 4DYHA 3KWJA 5JY6A 2DZDA 3EXHC 3ABIA 3WY9A 5AVTA 3V48A 4LJ4A 2A3RA 3VH1A 5KYWA 4BNTA 1NU8A 1FMLA 2IZ5A 3CWZA 4B6JA 3QP9A 4WK4B 4IDCA 1D6NA 1DJPA 3TOXA 4E7PA 5IX8A 2J9ZB 3PUZA 2FXIA 3CTPA 4LOHA 2CK3D 2W6ZA 5AIBA 4QQKA 1BIFA 4K9MA 2GB4A 3R24A 2FSPA 4Q18A 3LMKA 4HAZA 5ALNA 4CIVA 4ESHA 4IV8A 2ODWA 2HXGA 5EHGA 4GMGA 2IUUA 3RVOA 4AF7A 1QFYA 1LLCA 2VHQA 2WKSA 4TL8A 1TE2A 3A9WA 4LPKA 3PHGA 3QXSA 3W1VA 1TTTA 3PKIA 4XJXA 4O4LA 4FFNA 2FZ4A 4GXRA 3NWBA 1SU6A 4G5GA 5LL6P 5TGZA 1E1QA 5AVQA 4XRRA 5B7PA 3LRXA 3C8MA 4OI1A 3I9KA 3TOSA 4UXIA 4EGJA 2JZNA 4JASB 4TUYB 3V4RA 1DXQA 1U0RA 2AMLA 2ZRNA 3D4PA 3HH8A 4MGEA 2IYRA 4Q47A 1HE4A 4PV7A 4KACA 3SICE 2YOFA 3H9JA 1WVGA 1O03A 1N0IA 3LYHA 1JHQA 2FPUA 4MJLA 3W8RA 2X0RA 2HK9A 3OZEA 4NJMB 4A2PA 3VC7A 3MMXA 1OX5A 4URVR 5I3CA 1SBYA 2TMKA 2R79A 1WXHA 5C2JB 4U3JB 4HGRA 4JXJA 4ME6A 121PA 4FINA 4NBUA 3WNZA 1CEQA 2Z8XA 4B9AA 4ZOAA 4YJ2A 1M6EX 3PRYA 1VLHA 4RY9A 4EJ0A 3ITDA 3SHVA 2I1WA 3EVTA 4XFJA 3HCFA 4HDKA 4YR7A 1HLDA 3W2GA 4OQXA 1MJGA 4RSHA 2W00A 1ENZA 3OZWA 4TSFA 4DHEA 2Q9AA 2WJZB 1C8BA 1GVNB 2N9UA 3IOEA 4S1OA 3PFNA 1DJLA 4H7KA 4IIEA 2R7LA 3QA3E 2V5VA 4G4GA 1J9ZA 4ZVMA 3T7SA 4M76B 1W6RA 4IJMA 1MABB 4WOKA 2B36A 3UNXA 3HJAA 3I4LA 3AF4A 3GROA 4PLWA 1XTVA 2VJQA 3I2YX 1A76A 1FXUA 3QKRB 1S9DA 2VNAA 1DLIA 3BL8A 1DX4A 3JV7A 2I6FA 4M22A 4L4SA 4O02B 1A5SB 4QSHA 1DIOB 4C9BA 3QXHA 1QIGA 2BSQA 3Q4GA 1XZKA 4L3OA 4HEA1 4MLPA 3R0IA 3ZCPA 3AM3A 5A3QA 5M7EA 5DLDA 2NVWA 3TGPA 1OASA 2JIDA 4OUDA 2J4CA 3DR5A 1SOVA 1UBGA 3SLGA 4QUKA 3LQQA 1VMDA 3IEKA 3AM1A 3PEVA 1GSHA 4C43A 4DCOA 5JXHA 1UBJS 1HV8A 1RC0A 2ZS9A 1DKRA 3JQ8B 4UAVA 4C0JA 3TRJA 3ZZUA 2RJOA 4FYXA 1SG0A 3EGXB 4O4IA 5TDHA 1ENYA 1JXQA 1UDBA 2R8OA 2DWPA 5LA6B 1JLHA 3L2OB 2BN4A 1SUWA 2X5KO 3OAAD 3AI7A 3QYAA 2W6QA 1YQQA 1J2JA 3W6PA 1V5WA 2WSSD 5A2QA 3IOBA 3VOBA 5IWAB 2H3EA 3KXLA 1SIUA 4UOZA 4NESA 1LDYA 2JVJA 1AD2A 4UAUA 4YIHA 4JJEA 3RYTC 3KVRA 4ETMA 4N12A 3S68A 4TQUS 5I51A 4ZZ2A 1UK8A 2I7DA 1WB4A 3FPLA 5J4VA 3PNLA 1NIJA 5LP1A 2FR8C 4URFA 1P9OA 1DAOA 3L7JA 2CYAA 5KU1A 5H8WA 1NX6A 2AN5A 1TK2A 2GM5A 3B85A 3C24A 3ONFA 3WG9A 1D2MA 1R6VA 2PQ2A 3D02A 1FOEB 1H0RA 3EFOA 1NHWA 1P1FA 2Q41A 2OORC 2WIAA 4HKTA 3WLPA 1KZ7B 2C3UA 2HWXA 2FY8A 5AI0A 3V80A 4F92B 3RAFC 4HAOA 3H16A 4A73A 3VNBA 1IPHA 4CNBA 1N5RA 2PMCA 1B2RA 1IHOA 5D86A 5TQ2B 5LZ4A 2Z1NA 1MO6A 4TROA 5IH7A 2X1MA 4X8MA 3WKAA 1LTHR 1UXKA 1P3DA 3BHJA 2Q5QA 5CFPA 1NVDA 4DQKA 1E6EA 1TRKA 1G6OA 4QDKA 3OE5A 4YUXA 1ZQ1A 1DWOA 1WB6A 1WPRA 2GCGA 1JDZA 2C5EA 2JGIA 3GP3A 4B6QA 2XTNA 1FZTA 3AUYA 3VZPA 1MZVA 3OCZA 1QFJA 3TLZA 4Q4AB 1GQFA 4ZRDA 2W4IA 3NIWA 1QTRA 2FETA 5E8JA 3I9JA 3G9UA 2YJGA 3INRA 4F9TA 3NDPA 1V37A 1TUEA 3DE1X 3PCXA 5FCDA 4DJTA 5CVCA 4WRRA 2CZCA 3Q7TA 3CVUA 2DPXA 3SIRA 2HRZA 1M1ZA 1ZJ4A 1F9EA 1LZKA 1NTRA 1X87A 3DO8A 4DCTA 2R66A 2WAMA 1LI5A 1IUKA 2IODA 5CX1B 3B1FA 5MF6A 3IXLA 1NDUA 3LPDA 2ANCA 4I3HA 4BHTA 2QL9A 1NR1A 2I2BA 4HR7A 2EEPA 4C7BA 1KI7A 1XEWX 1EXDA 2UAGA 1KDPA 3AEZA 1PWHA 1T13A 4PNEA 3AVOA 3HSSA 3DNFA 2DR0A 2VYQA 3IAM1 1Z0SA 1V48A 2G08A 2H9AA 4UE2A 1W35A 3S2GA 3ZX5A 2XUHA 3N2KA 4HO1X 4UUBA 3NNNA 3RRNA 1NY6A 2VZ9A 3G2MA 1NUSA 1H6AA 1DX6A 2BGTA 3GEEA 4D98A 2Z98A 4I1VA 2DGDA 1HH4A 3M1YA 3L7AA 4FHGA 4OGLA 2H2GA 3IP1A 1R64A 2WABA 3PQ6A 3AR5A 2GTHA 1RYFA 2I2AA 1NBEA 4OQFA 2QRVB 2G1AA 3I05A 1QRDA 2JGFA 5EJ6A 5ELLA 2ZJ8A 2Q4BA 4IZHA 4L0CA 4NXNB 2G76A 1YZHA 3NORA 1Y8RA 2WIFA 2L2QA 2I76A 5T6BA 2QD1A 3U6BA 1TECE 1Y34E 3N74A 4B80A 4RSRA 16PKA 2QAJA 1F9AA 3DFUA 5IYZB 3E05A 5JROA 3CX6A 1E2GA 4R5HA 5E1DA 2R6CA 3E23A 3N0TA 2OE2A 4Y6GB 1U0GA 2GVNA 2X4IA 5FD8A 5AVWA 2ZVDA 2FW8A 4MW7A 3WZ2A 1ORDA 3NG1A 5KYKA 2NXWA 5SY4A 3EF3A 1FBNA 1ESNA 1D6SA 1U9IC 5FTWA 3RUEA 3A10A 2WTNA 2CBGA 3CSUA 4RAQA 1NV9A 3TEFA 3T3IA 3VRHA 5C4MA 1R5OA 1TO1E 1FTYA 2O14A 3K72B 3P27A 4QTZA 1QAMA 2PSJA 3ZE1B 4EYGA 1CY1A 3NGLA 1QV9A 1R2QA 3SFZA 1NBMA 2Z2YA 4GZ6A 3O3NB 2QVGA 1MPTA 2FYTA 2QW8A 1BG6A 3OKFA 3FIJA 2XWPA 4QLAA 1PE0A 1KI6B 1W9MA 1VIYA 4UU8A 1YJ8A 3RTBA 1RCFA 2IGBA 4I1IA 3C1AA 4BASA 1UP4A 4IQ4A 4EELA 3JARB 4CEIB 4WZBE 1Z06A 3IQIX 4FQ8A 1CUVA 1UZAA 2EKBA 1W9HA 1E2BA 4FE4A 3DZFA 3P9PA 1QYRA 3PKZA 4M3NA 4DA9A 2JIBA 2ZKIA 2OM6A 2RHRA 3NLLA 4E5SA 8OHMA 2V96A 2BGUA 3QV2A 1R9GA 1RJ9A 1RXYA 3JZAA 2ZBUA 4R9SA 1BD3A 3AC0A 1QCCA 3G5UA 5JD5A 3MXOA 2Q1XA 1GGHA 1RAAA 3P4UA 4OAOA 5EUBA 4Z1MA 3X1JA 5DN6D 5K3EA 5I8WA 2CDNA 3OLVA 4CCYB 4UM9D 4UNPA 1FUKA 5ERYA 2ET6A 3NWPA 2E4ZA 2HMYB 1ZX1A 3ASVA 3Q3JB 3SBXA 1RCUA 3Q3GE 4YMIA 5F21A 3VR5A 3KUUA 4YXWA 3CNEA 2F48A 3W2TA 5FORA 4RETA 3WLEA 5HBGA 2Y05A 1GR1A 3LQKA 3RIMA 1DBRA 1KERA 4AMZA 2XCTB 5D7NA 2D4HA 1MO2A 4BZQA 3SC4A 5BNZA 1U6KA 2BH2A 3OPNA 4JS0A 5BRAA 3AL0C 3E15A 3SJCA 2AI1A 2NUTB 3P2MA 2HWKA 3UXMA 1K4YA 3CE9A 4OMUA 2SCUA 3C70A 5JZBA 1IFXA 2W6JD 1KWGA 3RADC 1DC3A 3B5IA 3WJ2A 3MCVA 1KEPA 3K0KA 3NYQA 4W5RA 1SNYA 3RS8A 2PKYX 3MNFA 3PFIA 1QGUB 4CCAA 5ITSA 5LLTA 1WNTA 4QODA 3LTNC 5C5EA 4GMXA 2IDZA 2W6OA 4PSAA 4IIUA 3WGHA 4K0KB 1GUAA 1AN0A 3TZBA 2O5CA 2FZKA 2Y1WA 4QQRA 5ES3A 3DH0A 3IEVA 1JWAB 1CDEA 1DAFA 2E3JA 2C2ZA 3IDQA 1FNSA 4Y98A 3Q6MA 1E79A 4MKIA 4J7UA 3U80A 1J99A 2O8EA 2C7RA 3QMVA 1R88A 3I9FA 4ZPXA 2PFSA 4DNXA 4J0DA 3KNZA 3TF5A 3C15C 4DMGA 2GARA 2VH2A 1ZD4A 1MC1A 4CLHA 1T8TA 1HE3A 1Y81A 3C6MA 4YJGA 3N1UA 5TMBA 3W2HA 4D9GA 3ZCVA 4KPUB 1YGPA 3RHZA 3LD9A 3I01A 4YDQA 3DULA 4DNQA 1N3BA 3GFRA 3NTOA 3BD8A 1WNFA 3NWEA 1PLJA 3SDBA 2PUWA 2WJ6A 3ZZ1A 5LKRA 1AUVA 2QRHA 1K8RA 4PHGA 1R8JA 4UASA 3E7WA 3W5SA 3L41A 4B34A 3V4FA 1Z4QA 4GYKA 1E1KA 4Q12A 3AF5A 2Y1DA 3B51X 3QYFA 2O4UX 1YR6A 3AF0A 4PX9A 4U9HS 4YJFA 4ZAGA 5I9SA 2JDIA 1GD1O 1THTA 1JHPA 2YYZA 2ZRFA 2NPOA 1BN7A 1BU5A 4HQLA 3ZZTA 4QZVA 1CZUA 1WA5A 1XVAA 3GJ4A 1YJ5A 2LPMA 5ETJA 2R4UA 3MYRA 3UJPA 3KB6A 1MQ9A 4CKBB 1PJTA 4G81A 3UT5A 1HDIA 4IDFA 5AHKA 4MVJE 4C30A 4FLMA 1PNTA 4UBNA 1E1QD 3HFJA 1Y8QA 5D51S 2IXGA 2JGMA 3F2IA 4F1KA 1SKQA 2EJBA 2RH9B 3BBLA 4ZMSA 3S2SA 1T8UA 1ETUA 2N42A 4FHZA 1IWPB 5JQGB 3JWJA 1UK9A 3I0NA 1J23A 2FEWB 1YTLA 4EG5A 3KVNA 1HY3A 1RP1A 3GLHA 3R7FA 3STWA 2D3WA 5CNKA 4R3UC 3WB0A 1EEXB 1TAQA 3T7CA 3H19A 3UB4A 1Z5WA 5LSAA 3IE1A 5E2BA 4CU5A 3FWKA 1HM5A 4RKQA 3QF4B 3NIDB 4K6KA 1ECFA 4DDTA 1GT91 4DIOA 1N3YA 1T9CA 3QPAA 4ABTA 2XYPA 2AUNA 3D6HA 1T6YA 1VL2A 1YMQA 3VH4A 5IXJA 1KZ1A 2WFMA 3BXPA 5FP0A 3IBCA 3QUAA 5DHRA 4EKDA 5EXEA 5EUCA 4EPXA 1FU4A 2GM3A 2HH9A 2ILTA 1OH8A 2R86A 2C7GA 4BNGA 4N3BA 3H86A 2YWFA 3GBSA 1H4SA 5G1OA 3N0RA 3W06A 2GEJA 1XR3A 2PUJA 2HTEA 5KSZA 1KTIA 1ZIYA 2CKMA 5KJ6A 3A3NA 1HLFA 2ZYSA 3WRYC 5TT1A 2GLUA 4C2TA 3VC2A 1GUYA 1W48A 3C7CB 3FB4A 3L4EA 4FD2A 5IKPA 1ZP6A 3WMWA 4AKEA 1P39A 1J00A 3V7WA 5KOYA 2RK6A 1CQJB 1U4OA 3M70A 3UCFA 5KNDD 5AESA 4NP6A 4ZGBA 1VSVA 1DAKA 1TFUA 5ITWA 1YL5A 4YK7A 4X54A 1TQ4A 3IEXA 3TQCA 3HCEA 2F3TA 3HYCA 4ZJZA 4KE9A 2QJOA 2D8MA 4JWKA 2D54A 3H5TA 1Z6YA 1CCWA 1LI7A 1PLKA 4EEXA 1X3SA 5EJ8A 1VHDA 3R0QA 4G5XA 4MQ6A 4YHHB 5JXGA 5M2QA 2F55A 1WHTA 3AK4A 4KMMA 3VKVA 4BVLA 2BZGA 4QHSA 2E55A 4J4BA 5B4VA 4MV7A 3Q8KA 3F73A 1K6JA 3ODPA 1IN5A 1VPLA 4G25A 1SH7A 2PZEA 3RSZA 4B8WA 4CKYA 3DHNA 2EARA 4BKRA 4HUQB 1IYZA 2REXB 3QHAA 4JI3B 3QOYA 4BNUA 4HEA6 3V2GA 3S27A 5AMXA 1WW2A 4COOA 4C6TA 1A8SA 3LKBA 3A1DA 5K3FA 2NUPA 3HHEA 1CQIA 5DYGA 2FDCA 3LY7A 3A1VA 4O0MA 3SSOA 3OIVA 1JBEA 1FRVA 1GKKA 2GJSA 3HGMA 3M81A 4QICA 5IXSA 4LNUA 2ZJAA 1M8GA 1EBBA 1IAQA 1JSZA 2BC9A 2VP3A 4NATA 4P82A 1ZI9A 3OZGA 5GONA 3N07A 1Y1LA 3T3PB 2UYHA 4RUKA 2C4WA 2AYZA 1LXCA 3I53A 4I1SA 1KI2A 1JR2A 2WB4A 2ZYRA 2ONYA 1EWQA 3N6XA 2MINA 3U4QB 5LZ7A 4KR6A 4KQJA 2WD9A 3NH6A 4D96A 1A3CA 4Z4GA 2FWIA 4C7OA 1NYQA 2GYWA 3D64A 4MXDA 4Y6OA 4A36A 3S0JA 4YRMA 4EHAA 3T6KA 3TMAA 3DL2A 1T8YA 1SBTA 1ULAA 3WIUA 4ZO7A 5I01A 1NJGA 4HFNA 1JWLA 4Q4LA 4IS2A 3HFSA 4RABA 2JLXA 1BC5A 3WGJA 4DSUA 4PLVA 2AKYA 1CRQA 4EKYA 4R8RA 5ARDA 1OVGA 4M83A 3DE2X 1JEAA 2MYNA 4LXIA 4GLJA 4M9ZA 4RBNA 3LCUA 5DP2A 1P0IA 4Q19A 5CXSA 2HNAA 1I32A 4FFOA 3DMRA 4WECA 1SC4A 4KXQA 4RZUA 5JCXA 2FCRA 1GGMA 5BSFA 1RM4A 4BQQA 3WLIA 5D2CA 2C57A 3DKKA 2O2DA 4K8RB 3SZ3A 1VIDA 3E5HA 2JH3A 1AIPA 3C74A 4X6YA 5LNK6 2E9SA 3W4IA 5HCIA 3EVGA 1DQNA 3L82B 3NUQA 2I99A 4RKFA 5AK0A 4OHMA 3RRZA 3I4FA 4BNJA 3FBGA 3V4PB 1JF8A 4CG0A 3PRJA 2C83A 4Z7QB 1W96A 5T4EA 5HRCA 1TF7A 1QNLA 4IJWA 2A92A 4NF2A 4WKBA 1JJFA 1HDXA 4E4RA 4ZZ0A 1J8YF 3CT4A 3S5JA 4GP7A 2H4XA 2CV0A 1EFVB 1UDXA 4RL6A 3ZHBA 2HQRA 2XKBA 4Q1BA 1ZM9A 1BFKA 2RGWA 2QTVB 2WJPA 2VHJA 3PNPA 4JNKA 3SSAA 2XXAA 5DX1A 1M75A 2GZ2A 4QRDA 4Y8VA 4AY6A 4AZTA 1DIGA 3PQ4A 3GGDA 2N1BA 2P11A 3OMLA 1XQYA 5AICA 3S99A 3MINA 1CXZA 4N8DA 2B6HA 4EGQA 1XFAA 2HU5A 5DV9A 1RI1A 2BFCB 1A4XA 4QLOA 5L95A 1J8VA 3VR1A 2K4MA 1AQLA 4MJ7A 1GL6A 1HE5A 1Y0BA 3PL5A 4GRIA 3USZA 2NO1A 2A1UB 2A4MA 2NTNA 4UBMA 3RIEA 3RABA 1SKBA 1FDRA 4G8DA 2AFRA 2J45A 4TWZA 3TR5A 4BNDA 1GL7A 2DULA 3B60A 1ZINA 2AWNA 2OC9A 2Z83A 4W99A 4WLNA 2RAUA 3IULA 2B3DA 1YMVA 1A7KA 1L7OA 1EDEA 3BL6A 4L8VA 5CLLA 4C7XA 5GJBA 2W8BB 4W1PA 4BKUA 1LJLA 5FV7A 3PC7A 1H9CA 3HCOA 3VNRA 1U7HA 4TT3A 1QRAA 2ST1A 3TZLA 1Y7HA 1UUFA 3WNCA 4AWBA 4YHBA 1VDMA 2FJUA 4MR8B 1V6CA 3NUZA 1DT3A 4XIYA 2WHPA 3D4NA 2Z4RA 5EJIA 3ZLUA 3PZBA 4HFRA 2QVCA 1QS0A 3SG0A 1P0MA 3HB4X 4JX8A 1ENPA 2BZ1A 1MTOA 2P90A 2WA2A 1XKXA 3ENNA 3K96A 1GGFA 2BFEA 5A5VA 1EWTA 3O84A 4OYRA 4XQEA 3EEYA 4A8HA 2OQRA 3H2GA 1I3CA 1KEEA 3IVXA 4C7VA 1OBFO 1NYLA 1AB5A 1B6SA 1A97A 1U3FA 2EJVA 2JI4A 2XOXA 4HQRA 2HRDA 4ZQEA 3ZDCA 4AK9A 3RU9A 1NLZA 2Q0SA 3SDSA 3EVNA 3L7KA 1LNSA 3RIHA 3WQRA 2FZVA 2Q3FA 3KTDA 1DSSG 3L7BA 3RSQA 1ITZA 1WTAA 2GSDA 1AK2A 1DBSA 2FNAA 3DPSA 3TM5A 3S1LA 4EHIA 2G6BA 2IF0A 4R2WA 1D09A 4O4HA 1O4WA 4BZWA 2J6IA 2ZRAA 5KC8A 1OA1A 4ZK6A 4EMBA 4MGKR 2TMGA 2YXNA 3GR6A 1IXKA 3HY3A 3JX9A 2QGNA 3U4CA 1SC3A 1AVTA 2P75A 2R6DA 3O8BA 2CVFA 1M34E 1E89A 1C8KA 3EULA 1WZEA 3OKPA 3UB2A 1VHJA 1VLLA 1ZJ5A 3D8BA 3CSDA 3G1UA 2P2LA 3IJEB 4NAVA 1F8XA 4RELA 1Y4SA 1EZZA 4C1NA 1Y4AE 3TIXB 1U98A 1KP2A 1Z75A 2QBYB 4MYUA 4CXMA 3T7AA 3REQA 2HK7A 1KQGA 2VYND 3NBZC 1T4DA 4EJ6A 3OM9A 1EK1A 3FCCA 5BVGB 1OROA 1PG5A 2JLVA 1P1BA 3N6VA 5ENZA 5BURA 4DCSA 4WIAA 3G6WA 3T06B 521PA 2QTHA 2CHUA 3A6DA 1TM5E 4RH1A 1IB6A 4L8LA 1JU3A 1UP7A 2OO5C 2ZVQX 1USIA 2AVDA 3RJ9A 5JWRA 1KOJA 1YZLA 3ASUA 1E7SA 3OPXA 4HF7A 1B73A 1J9GA 3RKUA 3W6OA 4K26A 2F9MA 4BAUA 3G85A 4JVSB 3W5UA 2FPIB 2I3ZA 4Y0VA 2HDHA 3W7AA 2ZJ1A 4GWGA 4C0KA 1WW3A 1Q20A 4FIZA 2HWYA 4G1BA 3GAFA 1L5KA 2JS7A 3DF9A 2H1HA 4G6ZA 2EF1A 5JS2A 2WUEA 2RGBA 2RBEA 1Q84A 3DWIA 3GDWA 3LUKA 3BGWA 4FFBB 4ZAFA 1FDOA 2AKAB 2E21A 3CW8X 1RLJA 2GZSA 2GKSA 3TKAA 3LHDA 3HZRA 1U0SY 3FAKA 4WEOA 5FYQA 5LWQA 2UYYA 2C9ZA 4DV0B 1JA0A 1SOAA 2VDUE 1NJ2A 1VGRA 3L7YA 2C7VA 1K1EA 2QPLA 1SC6A 4LOAA 1XAIA 1RRGA 2ETVA 2JA1A 2OBLA 5L8VA 4OLAA 2IIBA 2AZXA 4RWEA 3RM3A 1KI1A 2AHOA 2FSFA 4YDHB 5J2UB 3WNDA 3CZCA 3ONVA 4M1YA 4JIGA 5DIZA 1BDBA 2RK4A 1OB2A 1UANA 4YRZA 4UEOA 1FDTA 1R8XA 2HA0A 3FLBA 3PA8A 3T12A 3ZDRA 4CV3A 3CUSA 4BQEA 4OK3A 4WOPA 2CNBA 4XAQA 4B1FA 2BY4A 4G0NA 2JZOA 4MRMB 4I1PA 4IQGA 1MRNA 3GUZA 1D8AA 3EPLA 1L1FA 2H00A 3OQIB 1ZEJA 2FCAA 5KC9A 1KO8A 2OZKA 3O83A 5BOSA 1XDBA 1HT2E 1R15A 4B2PA 2PV7A 2F3QA 4X62B 1A7AA 1IXSB 2WAXA 4PGGA 3JWHA 4CLXA 1GQYA 4B33A 2QTBA 2F3PA 4MKFA 4RD6A 4YP6A 1IHUA 2A59A 3ENZA 2GXQA 3HJGA 2XECA 4EH1A 4Y1RB 3L01A 1GLNA 2Y76A 5DISB 1U2GC 3LE8A 2EYQA 4TXNA 5K3DA 2WVGA 4JBGA 1ZNQO 3PNBA 4BIMA 3IYLW 4C4SA 3D31A 4I9HA 5J1TB 3I61A 4GFDA 1FDSA 1FYWA 1KH1A 1M1NA 2YJ5A 3GEDA 4K9DA 2IUFA 4BNVA 3HUDA 1SKYE 3I6IA 4B43A 5JYBA 4IOLA 1X8JA 1AKTA 4FLEA 3JQEA 5IABA 1OWOA 5G2OA 5BR8B 4AD8A 1NXPA 1GNTA 4TZ6A 3JAWB 4Q3LA 4LF4B 1YQTA 1GAEO 3MIZA 2ZWVA 2JAWA 3FBWA 3V4LA 5GTDA 2NU9A 4JLNA 5J9FA 2P35A 3RPEA 1ULBA 4FXPA 4CQMA 4K5QA 2IEAA 3R3VA 1YRAA 1GPH1 4XYGA 4YCCA 2ZAOA 1CVIA 2ZU0C 3SVTA 5HDQA 2I2WA 3KTOA 4KUGA 3UK2A 4BVHA 1C3OA 1OYVA 1JIXA 1GRQA 2AVNA 2J0EA 2Q3BA 1NAHA 3P0FA 3PVSA 4OBXA 3RBAA 3NQ41 4J2TA 3CVJA 4IIFA 1FRZA 2ESRA 2BFBB 5JWHA 4P22A 3RRBA 3SXJA 3K20A 4ID3A 1AJEA 5KNCD 1P1HA 1HZZA 2Z2IA 3PCRB 4AB1A 2WTXA 5F1YA 1NQVA 1LBIA 1Z8FA 4YYZA 3EAFA 2PS3A 3SHWA 4LCJA 2V58A 3KDAA 3MT7A 4M8NE 3RUDA 3ZHTA 4EPTA 1SFRA 4TN5A 1N78A 1OZGA 2ZE6A 3EF1A 4OH1A 1Z68A 4OQLA 3M6MD 1RAFA 2WZQA 4KO8A 3AERB 2OBYA 3QELB 2PMDA 1HTWA 3LP6A 4KO1S 2DH6A 3GMIA 4RIIA 5CGQB 3HXPA 1U0TA 3DFIA 1LNQA 2C5GA 3REFA 2DR3A 4FONA 4ARZB 1DAMA 1NBME 2CHEA 4L3VA 2C8KA 2CEAA 2X5JO 1NQAO 2WU4A 3IAHA 1K7FB 3ILXA 1DKUA 1JILA 1D4OA 2FRDA 2Q6LA 2WRZA 3C5CA 3NBKA 4YTEA 5FBVB 5AR1A 1W36B 4O2BA 2J7KA 3RYIB 3GGGA 1C1DB 3FWPA 2OZEA 3C3KA 4LWPA 6AT1A 2DY0A 2YASA 4XEHA 4EZBA 4B2LA 1K8ZB 3LP5A 1WDWB 1QE3A 1JIJA 2W6NA 3A58B 4YR9A 1Q12A 3PNKA 4CF3A 5FR1A 5E7JA 5JCOA 3ZVNA 1A8PA 4A2WA 4BV8A 4N1AA 1XWWA 3M2PA 5EI5A 3HGTA 1NSYA 5FUWA 1V8BA 4A7PA 3B8EA 1ZJWA 2BM0A 2ONZA 2YJ3A 3RFVA 3LLMA 1TUBB 1XVUA 1DEHA 5JVDF 2AFIE 4JI7B 3FKQA 1QO9A 2D2IA 3MELA 1I7SB 2QUIA 1A5BB 2P1RA 1OA0A 2XJ4A 3HP7A 4GS5A 3WXBA 5E6RB 3DXFA 1D7OA 3Q1KA 3QKSB 3ZIUA 4AX8A 2CMHA 1M7BA 3IOMA 4NV1A 4YJ3A 3S8YA 4NZMA 3Q9NA 5BWNA 1YD7A 4MS3A 4M1OA 3K9FC 5TVKA 1PL0A 3ZZMA 3AINA 3UUEA 2A0YA 4PLPA 3RJTA 2HHJA 621PA 1T4BA 3RSSA 3DZJA 2PIDA 1CUHA 1NDQA 2DRIA 2IPAB 1Y48E 4FKBA 3GUYA 4GZLA 4LHXA 5E9QA 5FUYA 4WXYB 1U31A 3PFKA 4Q1DA 3HBLA 4ZT6A 1JQLB 1VE9A 2DBYA 3EIFA 3M5WA 1VECA 4XCVA 5C3UA 1E1DA 1XHFA 4FSDA 1XTJA 3K9LA 3KSRA 5ECWA 3PFBA 1U7PA 3CVOA 3OJ0A 4WCFA 4BQRA 1G8HA 2FUG6 5HR5A 4HNAB 3A2MA 2FPKA 2ZIUB 3O8QB 3OQBA 1I3KA 1C4OA 3GNQA 1KNXA 4XD7D 4AZ3B 4CM8B 5IM4A 1II0A 3UAWA 2UUAB 4MWGA 1U9YA 4CM5A 4OA5A 4G1MB 3ID6C 3QVGB 4WW0A 5IUKC 5B64A 1Z0DA 2AC7A 3K4PA 4HAXA 4QGAA 4U2DA 3SYKA 3TW8A 4D5GA 2FN7A 2OXCA 4E2FA 3NHJA 3O8CA 1XXHA 2H7YA 4BQPA 4EJMA 3IILA 4HNSA 4LHYA 4WZAA 3KEOA 3OEHA 1T5OA 5DHFA 4LOJA 1JFFA 1QHGA 2EKQA 4PZZA 3M3DA 3U17A 1PWYE 4TKVB 1IONA 2LKCA 1ZCBA 1ZGZA 4ZVNA 5ICGA 1RYHA 1ULZA 4G0PA 2BUCA 3AFIA 2B8EA 4YRCA 1RIIA 5SZJA 2C9CA 4QGSA 2QN3A 3PFFA 1P29A 4OHKA 4Z9AA 5E6UB 1MG5A 2BUBA 1G5FA 3IIEA 5AQEA 3PHHA 1WCIB 1MVLA 1XK6A 3VISA 4F3RA 1ORHA 4YJKA 1KZHA 1Q0PA 1U1IA 1T9KA 1RXCA 1ZU5A 2H9YA 3D6FA 3I42A 2I1VB 3K5HA 3OCCA 5BUZA 1H1DA 1XX6A 5A3VA 1GR0A 5AFSA 5EQDA 1UOQA 1OBCA 3DE5X 3RANA 3ZDFA 1OUMA 3K8YA 4G01B 4PSVA 4RFSA 1B1CA 3UUGA 1S2OA 1V8DA 4HUJA 1Y5LA 4OHXA 2KW5A 5TF4A 3HLYA 3A4TA 3ROTA 1WMFA 2ZIXB 1Q92A 3CN7A 3EIQA 5LM3A 1UOEA 1JHUA 1MD9A 4G65A 5DEIA 1ZUNA 3ZH9B 1E61A 3EASA 1Y3CE 3HUEA 2CDCA 3OOWA 3PXEA 4JEHA 2H1WA 2DPGA 3SZMA 4EAQA 3FVTA 5BSWA 3EY9A 3DMTC 3H11A 2H7XA 1L0BA 1OGJA 1LWNA 2VHCA 4XWAA 1KFKB 2JLYA 3QNWA 3VX3A 4X90A 4ZQIA 4C20A 2YQ5A 3ZE0B 4R1OA 2LD4A 4D56A 4X7BA 1QRTA 1SA0B 2JAPA 3WLJA 3NHYA 3OCJA 4BLSA 3M8KA 5FNVA 3DMGA 2R2AA 2QXUA 2XUKA 1XMPA 1FL9A 1NVGA 3KHSA 3EXG2 3QFTA 4P83A 4G9BA 1II9A 4RF3A 4TTTS 5K0NA 1A9SA 3UTDA 2JFOA 3UMCA 4E21A 3M1IA 3WA7A 4ARBA 3WBKA 1DRUA 1F1JA 1AUQA 4G09A 1PG0A 3PXCX 4HAYA 3QVSA 3TB4A 2AR0A 1AKYA 1BAPA 1PKXA 2Q3HA 3PK0A 1SUAA 4Q03A 3MG9A 4UE6A 4CV0A 1JQ3A 1KK1A 1O5OA 3DKVA 3V42A 3VYWA 2H2AA 5A4KA 5HK8A 5H68A 4Q4HA 4YALA 4OXXA 4UMVA 5HHTA 1VB5A 1MEJA 2EWWA 1IMOA 1W2HA 2CMFA 3F47A 4MQ4A 3HKEB 1LB1B 4FBLA 4R1TA 4TLCA 3W0LB 1JIUA 1J39A 2DB3A 4PG4A 4HDSA 2WSMA 3R5SA 1PF7E 3QE3A 1H65A 1CQXA 3PEEA 3SJUA 4B4KA 2H2HA 3THOA 4BEJA 3COPA 3K5WA 3ZJ5A 1U0JA 3FIUA 4IDGA 2YWHA 1YB7A 2NG1A 3C3JA 1HR0B 3JPWA 4QGBA 4WXMA 1GQRA 3QPWA 1U8AA 2XMBA 3BE4A 4X1KA 4KOAA 2AF3C 4HVLA 1BE6A 4PS1A 4C5BA 1CLEA 2OP0A 4C01A 4O0LA 1MIHA 2G5CA 4Q34A 4U63A 1FFXB 1OPXA 4DN6A 1XL1A 5B7QA 1D4ZA 1U2GA 1NUAA 3GFPA 1A7UA 3WV5A 3DVSX 1Z0KA 3DT9A 4HB2A 1P4JA 4JC0A 5I7FA 1NVVQ 4MRRA 1A5TA 1W85A 4XVCA 3LF2A 1CB0A 3DBLA 3R2JA 3WLQA 4JODA 3PFHA 2FSUA 4MA5A 2L18A 1F3OA 1Q6ZA 3A27A 3DL7A 2FTKE 5TSDA 1Z4OA 3ZHUA 4Z53A 3Q2KA 2VT3A 1ODFA 3ISVA 4A8PA 4OVKA 2PBLA 2HW8A 4WOCA 5IEBA 3HZHA 3RG8A 1NN0A 2OWEA 5IBCA 3T3MB 3OLWA 1Y1PA 3HO8A 2PS0A 3RFUA 1JEYA 1P7CA 2PUVA 5JNSA 3P8ZA 3B82A 2P6UA 4MVWA 4O8ZA 4BE7B 1T36A 2V4MA 4WI1A 1KRHA 1TZJA 2A5DA 1FNMA 1Y37A 1T34A 2UYGA 2EX4A 3IEUA 3CTMA 3MRSA 2J4DA 3VOSA 1YB6A 2IHBA 4KLCA 1T8WA 3OX2A 2DHRA 1OFTA 1YBVA 3VYTB 1ATIA 4NH0A 5D01A 4F56A 1UKAA 2H4FA 2RC5A 2DWCA 4PYNA 4QOHA 2O5VA 1GGJA 2WJ3A 4I3GA 1B23P 1EXMA 2JPDA 1ZPDA 3DZIA 2X2EA 2YHSA 4CIBA 5IFLA 3KT6A 3H2ZA 2G9VA 2P9HA 1BYIA 2XDWA 4B7AA 3H1PA 1YE5A 3WSTA 1COWA 3OEEA 1OXVA 1N6LA 2DMRA 4H15A 4K6MA 3TS1A 2W7TA 4YUWA 2UYCA 1X1RA 1SHTX 1M2GA 2DECA 4OHPA 2REQA 1WE2A 3WNBA 3Q9SA 1V16A 2CBXA 2GF0A 3NB0A 5JWOA 2NZ2A 2PJUA 4QULA 1CUSA 4V2UA 5EC8A 1E8DA 2A67A 2PLRA 2QRKA 2AJ8A 3E81A 1P17A 3L0ZA 5JXJA 2FPPA 2LBPA 3QJYA 1QFXA 1Y6JA 5EJ2A 3SEZA 3TSCA 1UR5A 4JKOA 2EQ5A 5LOVF 1KP9A 1QIFA 1UBTS 2DM6A 2A30A 2WJVA 3D3NA 5AI8A 1FU8A 3A9CA 4OXYA 2YJ4A 1C9NA 5CBPB 2XKKA 1X1EA 4KXFB 5A0TA 2FHSA 1V6SA 1RWXA 2M6KA 5ALOA 1Z63A 1L5WA 3TI9A 4YQZA 4KR9A 2NVUB 5SZKB 3RFXA 3RVLA 3DC2A 2MYPA 4Z3OA 5JVDB 3T5GA 4P7JA 3MFYA 1MFPA 2WUGA 3FPHA 5TMDA 5BMVA 4ZI7F 1EYZA 2B4AA 2VUUA 5COBA 2IXAA 3UENA 4AY4A 1GAXA 3DHYA 2O19A 2CV1A 4PYKA 2WWXA 2Z5VA 5CFZA 3IQFA 4LQLA 1MAAA 3UC9A 1YI1A 1OX4A 4NDZA 1G42A 4UW9A 3TLEA 3F3YA 2CVPA 3EMDA 3OU7A 4L76A 2NSDA 2E87A 1NY5A 1TTPB 2F3UA 3FBTA 2NXJA 2RKBA 4EPVA 4QARA 3JSAA 3ETHA 2Y3IA 3TZEA 3DFZA 2H5IA 5IVKA 2HK6A 2QQ0A 3HBMA 2H18A 3LL4A 1BS1A 4TMWA 3BJZA 3GIDA 3MCAA 1RIFA 4TV8A 2LGJA 1OBOA 2ECPA 3SAJA 2Q6IA 4LJSA 4QQFA 3IOCA 4UDYX 3AVQA 2QTWB 3KAJA 1VE3A 2QRMA 3SX2A 4MV3A 5E4FA 3RKSA 3V33A 2Y1OA 3VYRB 5BN4A 4M9CA 4H6VA 4KIUA 3RREA 1ANKA 2NU6A 3BN3A 3PLAE 721PA 1N4AA 2P2SA 3P9ZA 3QTTA 1CZHA 1QUEA 1VDZA 2GS9A 2JZCA 4IHKA 4LZLA 3ZGYA 3ZJTA 3NWJA 4TL6A 2PX0A 1GPYA 3K09A 3ZLVA 2Y9MB 3EF0A 5IAKA 5KNBH 4X24A 3DEZA 4H3HB 4KO2S 3UJ7A 4EG4A 1NE7A 1E92A 4DW8A 1ES9A 4JI4B 3O7WA 4X71A 3FHTA 1MQAA 1ZJJA 2AOUB 1Y5IA 3FR7A 4OLBA 1VYHA 2X13A 3WMXA 2R8XA 3ZK7A 4BWVA 3D5EA 1G4AE 2NQ2C 4RY2A 4KRFA 1I3OA 1JEDA 4MW4A 5J59A 5KTKA 2W6PA 4K40A 4CQLB 4ER3A 4KK4A 3QBVA 1XQVA 2FPRA 2JJ1A 3AEYA 3OT1B 1J2YA 3AVXA 4JENA 3OQVA 3B3QA 4XPIA 3WX0A 1ZK3A 4F6LA 5JDIA 4RHYA 1FY2A 2X3UA 2V55B 3AO0B 1DJNA 5DN6A 3ZK9A 1EVZA 4DG9A 4Z1MD 5GIOE 5K0TA 5HRUA 2NU8A 2Q1SA 5SICE 1SC9A 2B30A 2BMDA 3QX8A 4C7KA 5FO0A 2XYVA 5LA6F 4HX9A 1QH8A 2UZ4A 4ZCQA 3W7BA 2WF9A 1FK8A 4YXWD 1LJ8A 3RROA 2VQDA 2L82A 2AOXA 1NW8A 4LTNA 4JVNA 2P9QA 4DARA 1T0BA 5LUBA 2C8JA 1DQRA 3BXFA 3QSGA 1XOIA 2G06A 3U19A 3RK4A 2QN2A 4N49A 1R0RE 3OM8A 4PY2A 4W1QA 3NHFA 4QPDA 5EIWA 3RODA 3EXFB 5JFTA 1P6XA 5K6AC 4FGLA 4MYRA 1YJBA 5FHRA 2HN9A 1MOZA 3G2OA 3H13A 1XDGA 3TRIA 2O57A 1GPUA 3UWSA 5AP9A 3IJ5A 1KH2A 2X41A 5EQJB 1Y4ZA 2ZJ0A 2OK8A 1NNEA 2QTFA 3PGJA 4IDDA 2CUTA 3ZIDA 1JZQA 2P91A 3WGYA 3ZWAA 4D8YA 5FAXA 5TT0A 1JG4A 2QU7A 1N6RA 2WKQA 3CUYA 3QU9A 3NT2A 3HNRA 1XL0A 3MJVA 2P5UA 3LVRE 1DRWA 1ZMTA 1WV0A 5KYYA 1W5AA 1DFHA 4HNQA 1C9YA 5FXMA 3VHQA 3WHIA 5SV2A 4F2HA 1NI4B 4LF7B 2IUYA 4E5MA 1Z4NA 1ODKA 3IKVA 3HUUA 2QRUA 2WU3A 3PQ5A 4ZOLB 1O7JA 2LP4Y 3BZBA 2OK7A 2QB5A 2WVAA 1NVEA 5K0LA 4NJEB 3IB3A 1QCYA 3X1DA 4FXOA 2CZGA 1QMPA 3C45A 5ESXA 2M9MA 1H42A 1UKVY 2J3EA 2KE5A 3HU5A 4LQDA 1D1SA 5JW6A 1RRMA 3ICVA 3LI2A 5CU7A 7ABPA 5A62A 3MJFA 4LTMA 1IN8A 5J3JA 2EIXA 2NX2A 1KI4A 1WD5A 3EUEA 1MX1A 3SYLA 3GFVA 4J4HA 1IJEA 1UM8A 3ZWCA 5JO0A 3F1KA 5LMNB 2CMGA 4R16A 5JG7A 3THSA 2XVMA 3P9XA 3PEWA 3MW8A 1XRNA 3TQTA 3JD3A 4WLEA 4LDRA 3O4FA 1QDLB 3MYYA 4QUDA 5I45A 3MJTA 2ZT6A 4ZHSA 2ZTLA 3AP3A 3D6TB 4NL4H 1JDVA 2KBEA 1WDMA 2VPWA 3AJAA 2J3IA 3HJBA 1ACLA 3LOQA 2PU5A 3DOOA 1J33A 4F21A 1NC3A 5EE1A 3TAXA 2ZJ2A 1LKZA 5HUHA 3FFBA 3GJ3A 3LW8A 3E53A 4HLUC 1JTEA 4IXWA 1VPVA 1E20A 2GHRA 1XPOA 4KP7A 3ZD7A 1U7DA 3CFYA 2AB0A 3E8SA 2A9JA 2H0QA 5AM0A 1X0XA 2GUGA 3Q85A 1L5HA 5DLQC 4Y2JA 1KY3A 1O97D 4AZ0B 2CL6X 3BRWA 4EMTA 1QMGA 1HL7A 2VJPA 2XCIA 5BQOA 1GKYA 2J5XA 4GYWA 5H7XA 1KMNA 3IVMA 2RSLA 1QIIA 3IO3A 4FR0A 3ZNQA 3B6KA 5BN1A 4FHFA 3HB1A 3TKYA 4QDOA 3LQ2A 1NULA 1YULA 2NZUG 4MIYA 4O08A 4CBVA 4DBLE 4G5RA 4B7CA 2AR9A 1ZCJA 1D1QA 3JS5A 3P9IA 5FQNA 5BW6B 3V3TA 1W1UA 3AY0A 2ZQ5A 2YJNA 3EUWA 3MS4A 1SGWA 4PXSA 4RSMA 3DVRX 3PWSA 2Q9CA 4BLWA 2GN6A 1IZ0A 2WJGA 4EA7A 1TZ2A 4ARSA 4JCOA 4NPCA 1V6AA 4J8PA 4RMNA 2PJZA 3RRMA 3BICA 3I6QA 4DE5A 2W2OA 4LJ7A 1R9JA 3A3OA 1IHPA 1ZD5A 1TVKB 3AFOA 2RGAA 3FKSA 2QNIA 4WNAA 4MEJA 2O8FB 1D2RA 2XIJA 4I9NA 2NO6A 4ZO9A 3I37X 3NHLA 2B4QA 2AYYA 3ROZA 1T3HA 1HYBA 1T1IA 2OSVA 2WSYB 1RR6A 2RGNA 3Q9UA 4P98A 4UU0A 3PUHA 1ZCZA 2YR0A 4OH7A 4EJSA 1TT7A 1XRJA 4MA4A 4JSYA 2UVPB 2YZGA 1SEVA 3TPZA 3MZ0A 2FKNA 2YOHA 3HC7A 4M6WA 3D2BA 4ZQHA 4NZPA 1A9RA 3UY4A 1XEXB 1Y5NA 3LUHA 3DV0B 4IQ0A 1G17A 1EAYA 3MOSA 4NMMA 1M7HA 3EQ7A 4ND2A 3BF8A 4DOMA 3DTVB 2IP2A 1Q7CA 1V1JA 3ADOA 3IPCA 2WE7A 4MUGA 3PSHA 4G4JA 4UUAA 1II8B 4ATNA 3JQ9C 4QPNA 2FMFA 3EWIA 3BEOA 821PA 3OPMA 4OHRA 1QIEA 2GZRA 2RHMA 3FVWA 5GWXA 1HEUA 2B8JA 4Y6RA 1Y6ZA 2VXBA 2QKYA 2HXSA 3R40A 2ZJZA 4EQZA 5JZ9A 1IAVA 5LQAA 3AGPA 1UJBA 1VI2A 4URUR 4Z1OA 3K6KA 2A9QA 4L07A 3GJ5A 2DSTA 3C3AA 4HOYA 2ZSDA 3EJ6A 2DWOA 3N6RA 4H6PA 4ZA2A 5IVIA 3ZE9A 1WY5A 3OTGA 4KTVE 1M5RA 1EESA 4A8JC 2BONA 1LS6A 1OQAA 2FGJA 1E1LA 4AQDA 4KFUA 3IP9A 3I1JA 2F4NA 1U99A 1VJTA 3OFNA 2WDZA 4MUEA 1RKBA 4V0LA 2RKOA 3ZE2B 3MTJA 2Q7DA 3VDNB 1E2MA 1BN6A 1NI5A 1UC5B 1XC7A 3EIXA 4X3OA 1NKTA 3AUXA 3I09A 2DBRA 4DANA 2JIZA 4RMIA 3FYTA 4AKGA 1F5NA 3GVIA 4YMHA 2PUAA 5F4BA 3VPCA 3OPYB 4CMEA 4X3CA 4IOJA 1BQEA 2XE4A 4MULA 5TQ0B 2CXNA 1L5LA 2EL9A 3AIOA 4DCGA 5KU7A 1KO1A 2RB5A 2DHEA 1N5MA 1OMOA 3KTFA 3S55A 2CWWA 1ZNYA 2EFEB 4TLEA 1SD5A 4XA8A 4F3NA 5DHTA 1QPZA 4UMDA 4JXZA 2JCVA 4KXLA 3GO4A 3M4NA 2OXRA 4TQGA 1R27A 4M49A 2XIQA 1Q3TA 5BNIA 4I1OA 1COWD 2GVDC 4YASA 2O2GA 4WUTA 3G13A 3I23A 3G2HA 3STTA 1IM2A 1YKFA 2WJ4A 1YI0A 2GQ0A 4W6QA 4BLPA 1KFEB 2JW5A 1X0VA 2R2GA 1JSLA 4BTLA 5IRCD 1BMDA 5JBNA 3PBKA 2IYOA 3O7MA 4FT2A 5AJYA 3ROMA 2RHLA 4BZPA 4CWAA 2V7GA 4E13A 5A4FS 2IJGX 2GJ8A 5KZMB 4BLTA 3WYFA 5FFNA 4PU0A 1W73A 1NG9A 3UMYA 3IV9A 1OI7A 4U3JA 1ML4A 3VKHA 1DC5A 3C41J 1IPFA 1VE6A 4N7MA 1XRLA 2GASA 4PE5B 1NW4A 3WBFA 5BUQA 1UMBB 2PZ8A 4AX4A 1YJXA 1PK9A 1MKYA 4D8UA 4H4DA 4ER7A 3DE7X 5BOSB 2KS6A 3F2VA 4AUNA 4DC1A 5P21A 4PGFA 4EQ6B 4G23A 4TLBA 3FUXA 1BD4A 3I2JA 5JRDS 5K0SA 3W1WA 1H9AA 1OWPA 2ZQYA 2AJCA 2CXOA 3EQ6A 3V1YA 4I36A 3A31A 4J9VA 2P9EA 4RHTA 1KK0A 1HQYE 1MABA 2HU8A 3FDFA 4FX2A 3G8YA 3TNFA 3KQNA 4LJ9A 4WAUA 2HSEA 4PO8A 5ERXA 1ZOIA 3FPBA 1QQTA 3CF0A 3QU2A 4JLBA 1DTWB 1NJ6A 1XAJA 5FL7D 1KE1A 2ONJA 2COKA 1FFHA 1CJBA 3B48A 3PXBA 4YO7A 5LWHA 4F8EA 4TKUB 1E3MA 2VP2A 3EGOA 5FAKA 1EPUA 1QYIA 3R3XA 1G2IA 1TKAA 1N0UA 3WLAA 1MCZA 5CT4A 5KINB 1JMYA 4DAEA 5C8YF 1XZDA 1H22A 3CLUD 3NDIA 4K0RA 1E2JA 1VI5A 3L04A 4FCVA 1NBWB 5AW9A 4CMBA 4CRWB 3ZCTA 7REQB 5CA0F 2XE6A 4EA9A 5LBIA 4RGQA 1TMKA 4UVIA 1NNSA 5FRDA 3IH5A 4A27A 1M2OB 4FW9A 2VNIA 4ZU6X 3RVKA 4GI5A 5AXAA 3NOOA 4LJKA 5JFGA 4QLBA 2GT1A 3I04M 3I76A 3EG9B 4FHEA 1EX9A 4TMTA 5DSTA 1TQ2A 4F3YA 4KO4S 3AZPA 2VL7A 4HS4A 3UW3A 1Y6GA 1R0WA 4OK6A 1CP3A 4XUCA 1GJRA 2IGTA 4DMCA 5F2KA 4EA8A 1UXHA 1JEOA 4HYYA 3HGQA 3U3XA 3KSUA 3P0JA 1DADA 4FYIA 2X2FA 2G80A 1N2OA 1XZPA 2QY9A 2R1TA 2ORIA 1OGYA 4RD3A 4MGHA 3UGQA 1FVOA 4UCXA 4YAKA 5ADVA 2IH2A 4BEVA 3LXXA 3ZEIA 1J0XO 4PPYA 3L4BC 4PC2A 1GG9A 1XELA 2GERA 1N1GA 2ID4A 4RKRA 3TUJC 4C4TA 2HBRA 2Q5OA 2CHFA 3IEIA 5DNCA 2ZE5A 4TV9B 4I08A 5JYCA 4JP3A 4LJ5A 1TM4E 3LWNA 1B8VA 2B4YA 5AIAA 1U3CA 2IEZA 2XNDD 4CMGA 1GN8A 3O9VA 1O1YA 3CUWA 1LBSA 3A6KA 3ABSB 3DMFA 3O92A 2RD2A 2AJDA 1N8KA 2WD7A 4GEGA 4IUYA 1RZVA 5KOJB 3T9AA 1NVMB 3P2EA 3RHSA 1MIOB 2ZTMA 3DOCA 2PJRA 3B53X 3IT0A 3QVLA 3WGLA 1G0NA 4D46A 3OC0A 4G4SP 4AIRA 1LX6A 5KO2A 4MW2A 3U4DA 1EWYA 3HDTA 5I8ZA 4TZ0A 1H94A 2NIPA 1EK6A 2OXFA 3KJZA 2HHHB 4HQ0A 4W5JA 1NASA 4Z9XA 2XZOA 1PGQA 3HACA 1AZSC 5FTMA 5CLQA 1HNNA 2AFIA 1WHSA 2FP4B 3FUTA 4Q1VA 1Z33A 3M0EA 3PJDA 4N0EA 2Q5CA 3I39X 3KJHA 2B8TA 4OOFA 2MHCA 2WQZA 4H6WA 4XWKA 2IH4A 3ZBUA 4AG5A 3LVQE 3PL1A 1BA2A 4JUFA 5H81A 1WBBA 1NVXQ 1UBRS 3AUAA 2HO4A 2PMEA 1X14A 1FFEA 3UQZA 4XB6B 4QDJA 4DA0A 3WO1A 2IEGA 1A5AB 1G8AA 1Z5VA 4KXYA 1R10A 5DWVA 1U0EA 3HRKA 2QX6A 5FPKA 4BY9E 4RE5A 3WGNA 1M34A 3KJXA 5AVVA 3VU9A 3E7XA 3T5BA 1FRFS 3O21A 3G5TA 1PO7A 5HILA 2OOKA 2XT6A 1EH5A 3GH3A 3O4JA 5DN9A 1QP0A 2WI8A 1S5PA 2JGDA 2X58A 3O2JA 3F6CA 2H1CA 2QN7A 4ZQBA 4D8WA 3JYOA 3GJQA 2HA6A 3BMNB 3HDJA 5JBIA 1ARZA 3Q8MA 3DUFA 2YHIA 1SVLA 2V1XA 4WLVA 1OLXA 2YW9A 2VHWA 3AXTA 1A96A 3FYUB 3GX1A 5GPBA 3IE0A 1N3LA 1N75A 5EWLB 2HMWA 3HPRA 1W0KA 1CZNA 1KJIA 3CV3A 9LDTA 1X15A 1RYDA 1FS6A 2HF8A 3MTDA 2W4QA 3PQ8A 4HWRA 3RKRA 2YIMA 3G2IA 3ZWOA 5K0EA 4DUGD 4EECA 4EB8A 5CLGA 2OB2A 2BR4A 3G68A 4LC9A 5FHQA