2KYWA

Solution nmr structure of a domain of adhesion exoprotein from pediococcus pentosaceus, northeast structural genomics consortium target ptr41o
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
b'MDEDATITYVDDDKGGAQVGDIVTVTGKTDDSTTYTVTIPDGYEYVGTDGGVVSSDGKTVTITFAADDSDNVVIHLKHGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion exoprotein
publication title Solution NMR Structure of a domain of adhesion exoprotein from Pediococcus pentosaceus, Northeast Structural Genomics Consortium Target PtR41O
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kywA00
4M02A 2KYWA 4M01A 2KVZA 2KT7A 4M00A
chains in the Genus database with same CATH superfamily
3Q69A 4K1RB 3I63C 4C7YA 1WXAA 3IBEA 4PK1A 2W54A 2KVZA 2LUMA 1J0GA 1IP9A 1C4CA 2MLBA 1A70A 5E6OA 4FXCA 3P2BA 3DWGC 1EM7A 4K7SA 4RFBA 3T3OA 1Q1OA 3TIXA 1C79A 1YNTE 3GZNI 1HQRD 2LMCA 2JF5A 1CZPA 4MGZE 2HDEA 2ZPYA 5TSSA 1LFDA 3T9LA 1JMLA 4X57B 2ICIA 3VR9B 4YSZB 2DYBA 2AWTA 3DBHB 3NOBA 2WU2B 2PVGC 4HK2A 3ZNID 4OVVA 4CO7A 1L7YA 4EZLA 3IT6B 2BB5A 1Q5WB 4HDOA 1WH3A 4FJVB 1SF0A 2IDYA 3PZ7A 2AX5A 4C80A 1B9RA 3QJZA 2DZKA 2KQ7A 2QIEB 4E74A 3ZXVA 1F9JA 2KK8A 2QC8A 1JROA 4IG7B 4MH8A 2BWFA 4I6LB 4A8XC 4DXFA 1QOBA 2WXHA 2BF8B 2JRIB 4W9HA 4CYEA 1E90A 2PKOA 5AEKB 2OEDA 1WGKA 2JUOA 1DGJA 1FFVA 3A1QA 4IKGA 1C4PA 3P1MA 4A55A 1UUPA 2GBMA 3GP7A 4DXGA 1L0XB 2MBHA 1GC7A 3NZUA 4WWOA 1TKEA 3RN9C 3UI3A 1J7BA 5EDSA 5BO4B 2PEAA 2C5LC 2WXOA 2KN5A 3V05A 2K5PA 1QF6A 4TSSA 2DNFA 5D3IB 2WDRB 3V6EB 3W9CB 2JWUA 2MA9B 3N1YC 3RD2A 4N59A 4ITKA 2JU6X 2WX1A 1TS5A 1Q10A 3NS8A 3AE5B 4FJZA 2G1EA 1ISNA 2IO1B 1C77A 4YTPB 4BBNC 3O65B 3ZTCA 1T6BX 1KJTA 3I9V1 1C1YB 5DPRA 2V3SA 5EE3A 1EU4A 4LK0M 1WI0A 4KSKC 3EFUA 1WJ4A 1SE2A 1TY0A 3ZIMA 3AEEB 4BBNF 2RMMA 1XF5L 2IY0B 1ET6A 3ZJUA 1SJHD 1WXMA 2N1WA 3ZLZA 3ABVB 4P1BC 1JWUD 5BYRA 2MBBB 5E6NA 3MFGA 3Q8BA 1L6VA 1T0RC 5IAAC 3Q8CA 2FUG1 2LVQA 1KRHA 4B95A 3R7QA 2WXPA 3V3XA 1VDVA 1V5TA 4AJYB 2BS2B 3I5JC 3PRMB 3ZDTA 1XXGA 3ML8A 3GE3C 4BZAA 1P9DU 2VH1A 3RULA 3ZO5B 2N1VA 1L4DB 2Y5CA 1IYFA 2J42A 3VFKA 3QARA 1WX7A 4L2YA 1FD6A 1GPXA 1SB3C 1FNWA 2DAJA 4LTUA 3DBLB 2WNMA 1RWSA 3KYCD 3TEWA 4ICVA 3OG5A 3V60A 3CMMB 2MH7A 3R8BA 4LJOB 1E6EB 3ZQ4A 1I35A 1YD8U 2MJEA 1MG4A 4ANUA 1OQYA 4B6WA 3CIRB 1WZ0A 5KHQA 2PE9A 2IY1B 5MPOA 1WGYA 3TEXA 4XWTA 2PE6B 3QQ8B 2NPTA 3X23A 2L05A 1LQBA 2NCNA 2RPVA 3WAOA 4A90A 4FHKA 3N3KB 1G6JA 2R2OA 4HEA1 2ZJDA 3DBRB 4FULA 3MP9A 1NDDA 2INCC 3RYTA 1J7CA 2WGSA 2L0TA 2N9PC 3PO0A 1MHHE 1AYFA 1A5RA 4HXDA 3KLSX 5HG2A 3OWEB 3KQ4A 4G3XB 2WLBA 5AUIA 2Q5WD 3NVZA 4QAYA 1HTOA 3MTNB 4BVUC 2XNAC 3BWUD 1MG8A 5D94A 2M17A 5FR6A 2QCZA 1TIFA 2LJIA 2OOBB 3AB5A 3NY5A 2X8XX 1FXAA 1L0YB 2L0FA 3A4RA 2KDEB 2KQSA 3ZGZA 2LWPA 3RMKC 1STEA 4KX6B 4KKJA 3DBHI 4HKZE 3CWIA 1E7UA 4ZHPA 1ZUD2 3DHGC 4KGSA 1XLNA 5CHFA 2Y5BB 4MM3A 4YXDB 4JE3B 2Z59B 4GDKB 4MACA 2BBCA 4R3DA 3U8ZA 4LNOA 1YQ4B 1HZ6A 3BVGA 5CTRC 5FK9C 3DQVA 1J7AA 4BKSA 1IBXB 1D5ZC 2LGIA 4KZCA 3EFCA 2GLSA 1GB1A 1SJED 1E8ZA 4WJOA 1ZXHA 3T3NA 4LNKA 1EF1A 2JZPA 1FXTB 2MP2B 1UGJA 3RUIB 2K22A 2GBRA 2EMSA 2DX5B 1WYGA 1ZE3D 2JZZA 3RNGC 4B9KA 1VZ6A 2KMAA 2M1MA 4RM9A 2PJHA 3VQIA 4JGHB 2CU1A 1L4ZB 4HJKA 3OLMD 4MDKE 2FAZA 3LDZE 1I4QA 4G0NB 2SAKA 1V6EA 1QKZA 2K1FA 3HUIA 1WY8A 1FMAD 1WR1A 2BVCA 3AEAB 1YN3A 3EECA 3ZDMC 2RGFA 3BVMA 1JALA 2PPHA 1VCBA 2R2QA 2CS4A 4PYZA 2R61A 3HM6X 2ZCCA 1HE8A 1YN5A 2WXJA 4GDKA 3A9KB 3AEFB 3DVGY 1YQBA 2WDVB 4KGTA 4YSYB 2WXIA 2I1JA 3QC8B 4K7UA 1BT0A 1YMHE 2IBIB 2L3ZA 2EKIA 4J3OD 3TUOA 1WM3A 1NI3A 3L10B 3IAS1 2PTLA 3ZUNA 2IJ0A 2KZRA 2XN9C 2NMQA 1TBEA 2UU7A 3LJ3A 1IUEA 3W2DA 4M00A 1MPEA 3V6CB 3UF8A 1GJZA 1YJIA 1TGZB 4ZRKA 3MC0B 1EUVB 2KKCA 1LGRA 3K9PB 4IM3A 3DBLI 5AZGA 2MP2A 1TJEA 3C8YA 1QOAA 1YJ1A 4XDCA 4XX5A 1JWMD 4URKA 2GMIC 3FILB 4KSLC 2KHWB 1P7FA 2N9EB 2RPQA 4OZAA 4MSQB 2JVCA 5C23A 3EUB2 1C4AA 4G50A 2L52A 3Q2AC 3M3JA 1WM2A 3IFWB 3BK1A 3WA0A 3DCGA 3AM9A 3ZJVA 3DBRI 2QILA 5I4DA 1RFAA 5GMVA 1P7EA 2BWES 4ASWC 3AMZA 3Q6BA 1JWSD 1N6ZA 2FCNA 1XO3A 3PGEA 2K39A 2IO2B 1LO5D 1TKGA 3JSVB 2L32A 2OJWA 4B0EA 2NTTA 3NJTA 4GB9A 3Q3JA 5IN7A 3QK0A 3A9KA 1EWYC 4EE2A 3M62B 3HRDD 1JRUA 4F8CB 5LNK1 3DBSA 2WYQA 1WZ3A 2INDC 1BUIC 2JWZA 1E7PB 2Z0EB 3TEYA 1FRDA 2KAJA 3CSTA 5JZEB 1T0QC 1H8CA 2ZVOA 5IA7A 3JW0X 1J8CA 4OHJA 4E3CA 4IWOA 1D5MC 4W9CA 1ET9A 2DENB 1UGMA 2MHJA 1UD7A 4JQWC 3L08A 3AE7B 5CHWA 1WX8A 4RGOS 3ZVVA 2BS4B 3VRAB 4K81A 4USAA 1FNUA 4IOIE 1XEEA 1WR6E 2LASA 3ZNGC 4LJPB 1WYWB 1VRAB 2XK5A 2CHZA 2IYDB 2LGYA 3E9SA 3FILA 4NAWB 2D3CA 2BYVE 1ZDXA 2LRWA 1K8RB 2LXCA 2VZKB 3DWMA 4OW0A 1ZOYB 3TCAA 2AL6A 3R66C 2YEPB 1GUAB 2KOXA 3PVLA 1RRBA 2QJLA 1R4MB 1V97A 1D6EC 5LLIA 3Q14C 4PT5A 3X0WA 1WX9A 2RDGA 3W1SC 2Y3AA 3UGBB 2J0JA 2LHDA 5G5GA 1E9MA 4ANVA 1NYRA 3P42A 3JVZX 3BZDB 2H88B 2J0KA 3H1UA 3JSVA 3PHXB 3AE1B 1YN4A 3Q3NC 4MJSB 4HKQA 3BVZA 3AE2B 1F2RI 2GBKA 1R4NB 3L0WB 4K7WA 4GU2A 2DBYA 1RLFA 1JQ4A 2I1KA 3B1LX 3VUXA 5D2MB 4GXBA 4IWPA 1VLBA 3BYTB 1TKYA 4BKSD 3RNEC 4ZOHC 5JHAA 2BGFA 3PHWB 5H92C 1MJDA 4EOYA 1GB4A 1RFKA 3GS2A 4XWWA 4GN1A 1UH6A 3VUWA 2KDIA 4N6EB 2HJ8A 2IO3B 2WXRA 1Y8RC 4FN2A 1CK1A 3B9JA 1I4GA 2L1AA 2CHXA 3I57A 2DYMA 2LXAA 4WAAA 4DK5A 2MJ3A 4NAWA 4MELA 3IXSA 2X38A 4KDLB 1LM8B 3VAWA 2BYTA 1NEKB 5JHBA 4KGRA 1U4AA 2WU5B 2XBBC 2WDQB 3AXCA 2WXLA 3DHIC 4WURA 4YL8A 2UYZB 2KT7A 3A4SC 3QCAA 4HLEA 3PLUA 4D2KA 4LNIA 3UQAA 2D11A 1HZ5A 2VH2A 1QQRA 2GB1A 1N5WA 1V8CA 2LVOA 4HPMB 4L1BA 3CSFA 3AN1A 1RM6C 1F1HA 2NPTB 2KO3A 2WXMA 4NY0A 2WWZA 2K25A 1NI2A 1WXVA 2V4IB 1CQVA 1NYQA 4MEMA 1E5WA 4MJSA 1FNVA 1ACCA 4WJQA 2HD5B 2KMCA 3RZWC 1DOYA 4PYUA 4HCNB 2ACZB 1ESFA 2LHEA 4WWPA 1GC6A 2CU3A 3U7DA 2BKRB 2GOWA 3L4PA 2VRRB 3APFA 1QLBB 2XEWA 2ZW1A 2N9KA 4DQOC 1PUTA 3ZKJC 1VZ7A 3BK2A 5CX3A 3U2SC 4MGKE 4ZYSA 5JH5C 2JYEA 2LGDA 1F52A 4RGMA 1QILA 3SD5A 3VTVA 4MM3B 4M02A 1KTKA 1FEHA 1VR9A 3UINB 3AEGB 4ZRPA 2J52A 3VDZA 4WWMA 4NQLB 3DOWA 2KJHB 2KX3A 3AE6B 3FC4A 4LLGM 2K0PA 1X1MA 4C56C 4W9FA 1FRRA 2WXNA 4FJYA 1Y56A 2JPHA 2C7HA 3AE3B 2D3AA 2W82A 3EHVA 1NENB 3NVYA 2PIAA 4ARIA 2JXTA 4H2AA 4NNJB 4WWNA 1QT9A 3RT3B 4RH6A 3B2GA 1OTRB 2MEKA 1E8YA 3SDLC 2KD0A 2ONQA 1N60A 3Q8EA 3OAWA 1R4MI 4G11A 5DCNA 1C9FA 2DAFA 2AQ2B 1TS4A 4A6QA 2NBWB 3VRBB 2RD0A 2LEKA 5LXHA 2QMTA 2V4LA 2D5GA 4IUMB 4NPNA 1EU3A 3HVDA 1TZOA 3AI5A 3GOEA 3IVFA 4CQNA 3WANA 2BYFA 4WJPA 4M8MA 1WIAA 2D2QA 3QWZB 4NZLB 4GOCA 1I7HA 3E56A 4WJNA 2NVUI 2DZMA 4ZRIA 2Y5PA 4P16A 3SFDB 4MGIE 3VTUA 1IPGA 3AEDB 5DPWA 4RGTA 1WE7A 4PS7A 2ZCBA 4TQ1A 3RPFC 5J2RA 1EWCA 3HK0A 2KFKB 1V86A 4XDDA 4YT0B 2KYWA 3AEBB 5KHOA 5BMHA 4S0RA 4AP4C 1UF0A 2KJ6A 2BT6A 1V49A 1GNUA 5HFYA 2WS3B 4GDLB 2LVPA 3KWVA 1MFWA 1M4VA 4B0MA 4AWJA 3QIJA 2K6QA 2KWCA 2PLPA 1PGXA 1L5PA 1V1PB 2KXJA 1HA5A 2M0AA 3P63A 2K8BA 4F7ZA 3V62A 1NBFC 5G5HA 1XCTL 3IT4B 2IGDA 3PZDA 1P1AA 2W3RA 3PRZA 4EZJA 1IGDA 2GI9A 4IDIA 4KDIC 2HJ1A 3VR8B 2DZIA 3IAM1 1TS3A 3N30A 3KVFB 2HE7A 2KFJA 1KFYB 1TY2A 2FIFA 4XZ4A 2KVRA 3URYA 1XD3B 3AE4B 3A9JA 2O6VB 2DZJA 1E8WA 1WFYA 4YWGG 4ICUA 1AW7A 5EE0A 3ZNHB 2CJNA 3W5VB 4XC2A 2MWSB 3N9YC 4N58A 3TEZA 1JCKB 5C2TB 4KIKB 1F2RC 2KFKA 1AARA 3RCZA 2IZVB 3Q3FA 2WDTB 2IGGA 4RM8A 2V1YA 3C0RB 3H9DA 1NVID 2VZKD 2J7QB 4GDLA 2KN4A 4S17A 1DOXA 4K3BA 1WGRA 4GIVA 5J18A 4MSMB 5D6JB 1WE6A 3RNBC 1L0VB 1SSNA 4BAXA 4TKNA 2QEJC 1UBIA 1V1PA 3U30A 2BS3B 1YOVB 3EGRA 4HRSA 2I2YA 2G45B 2LZ6A 2M0XA 2A5UA 3ML9A 2RSUA 2XK5B 1YX5B 4ZDVA 3ZRCA 2JT4B 1YX6B 3NVWA 1KM7A 1WXQA 2KQ4X 4C4VB 2W9NA 3H8HA 1FCCC 1ZDVA 2GRIA 3R7RA 5EE9A 4DHZE 2E3TA 1K50A 5AZFA 2K6DB 3HM3A 3L13A 3D32A 2FUHB 3UIPB 3NVVA 2O6VA 4BKGA 4GSWA 4BOZB 1PFDA 3C19A 2D07B 3FAHA 2DYOA 2CKHB 4Q2JA 3PLVA 3VTWA 5LXIB 3AECB 4KKIA 1GG3A 4FA6A 2N9XA 2KC2A 1C76A 1MVKA 3R2TA 4RF1A 4KIKA 4AS1A 3MJWA 2KWDA 1E10A 2JSVX 4AQ7A 4F1SA 2BPSA 4P1CC 2LGXA 3VUYA 3ZTDA 2L8JA 1KLUD 3PV1A 1XCQL 3PSEB 1RAXA 2W3SA 4EEWA 4YTMB 4DHJB 1D4BA 4MT5A 4YTNB 1WGDA 1FXIA 2ZNVB 4W9JA 1XQQA 2N4FA 4OZBA 4DDID 2N9LA 2WXFA 1UELA 1JWAD 5HHDG 4UDUC 2REXA 4EUTA 3L17A 2HTHA 1L2NA 1PYWD 1UZXB 5DPSA 2L7RA 1SE4A 4JIOU 3RNCC 1Z5SB 3K9OB 4GLSC 1SE9A 2KTFA 1E8XA 1SIJA 4OZCA 1XLOA 3P4SB 4HWIB 4C4VA 3LB8C 2V3NA 3APDA 3AU5A 2LI5A 5BYSA 2V9HA 1KOTA 3W1YA 5FKAC 2RDHA 3TJPA 1KLGD 1FIQA 1FPYA 1OEYJ 2FNJB 4CHKA 3P4QB 1QOFA 4RGNA 4JL9A 4HVBA 1WJUA 2SEBD 3ZW3A 4WIPA 1F0ZA 2L83A 3KUCB 3RNFC 2BW2A 1N62A 5BMGA 3WIMA 4DDGD 2GBJA 3TMPB 5L95C 2YEPF 3M95A 2MBQA 2RDBC 1WGHA 4FHJA 1V80A 2ZW0A 1HTQA 2N7DA 4FADA 1UNSA 4ZHOA 2JQRB 2CR5A 4US9A 2AEHA 1KLVA 3SEBA 2WXGA 1UBQA 2BB6A 2KDBA 2MW5A 1SBBB 4ANXA 1T0SC 2J4XA 4DBGA 2I38A 3LYYA 5L83A 4J6IA 4LDTB 2EKEC 3SR6A 1J19A 4DXAB 3AV8A 3OJ3A 1E0ZA 3ALBA 1DOIA 4W9LA 2DWQA 3BY4B 2B76B 2MJDA 1I4HA 4BFRA 3OJ4B 4P6VF 3VHTC 3W1SA 4M01A 1OQQA 2JX5A 4PS3A 3BINA 3QHTA 3S2AA 2M8SA 2E6XA 3HVZA 2BQQA 2KANA 1JW9D 3TSSA 4LCDE 1ROEA 4FLHA 2QSDA 1D3ZA 3ETRA 2PVOD 1WWTA 4A3OA 4IW0A 4II2B 5G55A 2ZZPB 1T3QA 3N32A 4W9DA 4A20A 3QX1A 2C9WB 1FM0D 4P7IA 2M19A 1TS2A 1N63A 3ZJTA 3DDCB 2A4ZA 3VVWB 1HXYD 2KWUB 2PW9A 3AE8B 5BYQA 2GBNA 1TTNA 5TR5A 4I6NB 2NS5A 3DHHC 4AUQC 5IP4D 2Z0DB 1V5OA 4KZ0A 1GOZA 1YJJA 3QA8A 1WMHB 2WXQA 2EMTA 2LFIA 3DPDA 1XT9B 2OHFA 2M56B 1F77A 3MJ5A 3BYYB 4JLCA 2UWQA 3U52E 3KWLA 5G2NA 4I6PA 3PS6A 3EC8A 2NBVB 3AU4A 4ARCA 4JWSC 2JRHA 2BYEA 3P4PB 3M63B 4E71A 2RR9A 3MC8A 5IKCM 1Z2MA 2LRUA 2KDFB 3L16A 1D5XC 3Q8AA 2KC1A 2CHWA 3NUHB 2WX0A 4M0WB 2ZEQA 4HJGE 1WXSA 3U7ZA 3RNAC 1PGBA 3PREA 3ECIA 5C1ZA 3ZXRA 2C7MB 4EFOA 3KW5B 2DHZA 2K8HA 2O6VD 4RCOA 3VH4B 5GXGB 5E6JA 2ON8A 3J9CA 3DVNU 3BIID 1L6UA 1WF9A 2K3UA 3TBLD 2MCNB 1WJNA 4A3PA 3T8MA 2KTRB 4MGYE 2JZ3B 3PPAA 3TL5A 2G4SA 2J0MA 4C00A 2QHOA 4TV3A 3Q3OC 3NZ3A 1WMHA 3A9JB 5FR3A 4JPSA 2FCSA 4TUUA 3UIOB 2KMMA 3VXWA 4A9AA 3NRZA 1R4NI 2J53A 4HROA 4NQKE 1IGCA 1M94A 2KWVB 4ACFA 1YQ3B 1BXTA 4NJCA 4AJWA 1P0RA 2TSSA 3KH0A 1C78A 2JY6A 2JXXA 3ZYYX 4K3CA 2D3GA 2IPKD 4W9IA 3SHQA 2WP9B 3DVGX 1UWMA 1FCLA 4O1NA 2H89B 3PRPB 2MBOA 3AULA 3MHZA 4IC7B 3GB1A 4OVZA 2YVCA 5IO9A 5H8YE 3SFEB 2KDMA 4M0WA 4GGQA 1WGGA 4REZA 1XLPA 2C7NB 2FCQA 2G9HD 1VD2A 5EE1A 1S1QB 1PQSA 4W9GA 1XLQA 2WHIA 4RF0A 3Q3MC 2MBEA 4M8NA 2C60A 4W9EA 4RMAA 2LJ5A 1B1ZA 4RNAA 1K52A 3NG0A 1SGHA 2KACA 3H7PB 4HCPB 1I4XA 4WH4A 4L23A 3N20C 4BOSC 2ZPNA 4JWUC 2MSED 4TMAB 3AH7A 2KTRA 4MH0E 1OGWA 1DYQA 2N7JA 4IM2A 4IWQA 2MQJA 4DWFA 1R7SA 1UWXA 2CJOA 2O2VB 1PGAA 1ZPSA 1P98A 3DVNV 3GZNB 2FCMA 5JXVA 4DHJD 5T8IA 5D3DA 5AUKA 5BMIA 3WAMA 1V81A 2WXKA 2D3BA 1ZP0B 2NBUA 2V3PA 3A33B 1BMLC 4HPPA 4ZRQA 3ZRFA 1SXTA 3P4RB 3QAQA 5HKHA 3RFZB 3L54A 4NJ7A 2HTME 1T5XD 2AYOB 4OVUA 1N5XA 2K8CA 3APCA 1AN8A 1SEBD 2K9XA 1ENFA 4HPLB 4C7ZA 3NHEB 2KX0A 3O13A 3W5UB 2AL3A 1AWDA 3IG3A 1I4RA 4XGAB 3H7SA 3MC9A 1MHXA 2NTSA 1CMXB 3B0AA 1EF5A 5HI1A 4ZYNA 1GAQB 3H6NA 5DPTA 1VJKA 4YSXB 2Z8LA 1IBXA 3KUDB 1V2YA 1TZ1A 3Q8FA 1VZ8A 1ZGUB 4ZRJA 2INPE 3WALA 4XE0A 2LUEA 1OEYA 4KV2A 2IGHA 3ZNZB 4ANWA 1K53A 1WSPA 2AQ1B 3H7PA 3B08A 3PZ8A 5AZHA 3IHPC 3V61A 4WAFA 1OFFA 1QZEA 1WRIA 2DLBA 2G4DB 3B2FA 3N1ZC 2V0GA 1V1OA 3LXFA 2FIDA 1SE3A 4BKTA 3EA6A 1ZKHA 2B3AA 2OJRA 2LD9A 4AOFA 1SIFA 2O2VA 3GE8C 4W9KA 1PDXA 1P3QU 3ONSA 3VH3B 2G3QB 1ZXIA 2L00B 2MRPA 4JX1C 1K51A 4LNNA 4WQOB 3KUZA 1H4RA 1QOGA 3AE9B 1T0YA 2YLMA 1WRDB 3ENEA 4II3B 4LDTD 3MHSD 2D10A 1FO4A 4US8A 3NS1A 2JYTA 1V9JA 2ZVNA 3R2IA 4NAMA 5IOIA 4NJ6A 1YIWA 2EELA 1JRPA 4GMVA 2ASQA 3NZSA 4EKUA 2WQYB 1Q0WB 3SU8X 2LGSA 4PS8A 2BKFA 1TT5B 2INNE 4TQ0A 3I3TB 4N9F4 1I4PA 1ZW7A 3CF6E 3FKYA 1N61A 1E7VA 3HIZA 2KJRA 3RI7C 4KVGB 1S3SG 2IO0B 4FBJB 4LNFA 5D7GA 2FBWB 1I42A 2M4NA 2KLCA 1C3TA 2PMVA 1KF6B 1TYGB 2L76A 3R3MA 3U4EG 1EO6A 5E6PA 4IM0A 4HDQA 1MI0A 1FFUA 1KH0A 1CJEA 3WAPA 2BTEA 1RYJA 4EZKA 5J17A 2N7EA 3KYDD 3WCQA 2ZNVC 2NR2A 2N0SB 3UQBA 2MX2A 2AQ3B 3A1QB 1OQRA 2KLGA 2FE8A 2QDFA 2W55A 3RZFA 1LXDA 3PT2B 3JYUA 4XYCA 2KNBA 4WQMA 1HEZE 3HHMA 5C3JB 1JWBD 3PTFC 4DHZB 1WJ6A 5CHVC 3N1XC
chains in the Genus database with same CATH topology
4M02A 2KYWA 4M01A 2KVZA 2KT7A 4M00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M02 A;  2KYW A;  4M01 A;  2KVZ A;  2KT7 A;  4M00 A; 
#chains in the Genus database with same CATH topology
 3Q69 A;  4K1R B;  3I63 C;  4C7Y A;  1WXA A;  3IBE A;  4PK1 A;  2W54 A;  2KVZ A;  2LUM A;  1J0G A;  1IP9 A;  1C4C A;  2MLB A;  1A70 A;  5E6O A;  4FXC A;  3P2B A;  3DWG C;  1EM7 A;  4K7S A;  4RFB A;  3T3O A;  1Q1O A;  3TIX A;  1C79 A;  1YNT E;  3GZN I;  1HQR D;  2LMC A;  2JF5 A;  1CZP A;  4MGZ E;  2HDE A;  2ZPY A;  5TSS A;  1LFD A;  3T9L A;  1JML A;  4X57 B;  2ICI A;  3VR9 B;  4YSZ B;  2DYB A;  2AWT A;  3DBH B;  3NOB A;  2WU2 B;  2PVG C;  4HK2 A;  3ZNI D;  4OVV A;  4CO7 A;  1L7Y A;  4EZL A;  3IT6 B;  2BB5 A;  1Q5W B;  4HDO A;  1WH3 A;  4FJV B;  1SF0 A;  2IDY A;  3PZ7 A;  2AX5 A;  4C80 A;  1B9R A;  3QJZ A;  2DZK A;  2KQ7 A;  2QIE B;  4E74 A;  3ZXV A;  1F9J A;  2KK8 A;  2QC8 A;  1JRO A;  4IG7 B;  4MH8 A;  2BWF A;  4I6L B;  4A8X C;  4DXF A;  1QOB A;  2WXH A;  2BF8 B;  2JRI B;  4W9H A;  4CYE A;  1E90 A;  2PKO A;  5AEK B;  2OED A;  1WGK A;  2JUO A;  1DGJ A;  1FFV A;  3A1Q A;  4IKG A;  1C4P A;  3P1M A;  4A55 A;  1UUP A;  2GBM A;  3GP7 A;  4DXG A;  1L0X B;  2MBH A;  1GC7 A;  3NZU A;  4WWO A;  1TKE A;  3RN9 C;  3UI3 A;  1J7B A;  5EDS A;  5BO4 B;  2PEA A;  2C5L C;  2WXO A;  2KN5 A;  3V05 A;  2K5P A;  1QF6 A;  4TSS A;  2DNF A;  5D3I B;  2WDR B;  3V6E B;  3W9C B;  2JWU A;  2MA9 B;  3N1Y C;  3RD2 A;  4N59 A;  4ITK A;  2JU6 X;  2WX1 A;  1TS5 A;  1Q10 A;  3NS8 A;  3AE5 B;  4FJZ A;  2G1E A;  1ISN A;  2IO1 B;  1C77 A;  4YTP B;  4BBN C;  3O65 B;  3ZTC A;  1T6B X;  1KJT A;  3I9V 1;  1C1Y B;  5DPR A;  2V3S A;  5EE3 A;  1EU4 A;  4LK0 M;  1WI0 A;  4KSK C;  3EFU A;  1WJ4 A;  1SE2 A;  1TY0 A;  3ZIM A;  3AEE B;  4BBN F;  2RMM A;  1XF5 L;  2IY0 B;  1ET6 A;  3ZJU A;  1SJH D;  1WXM A;  2N1W A;  3ZLZ A;  3ABV B;  4P1B C;  1JWU D;  5BYR A;  2MBB B;  5E6N A;  3MFG A;  3Q8B A;  1L6V A;  1T0R C;  5IAA C;  3Q8C A;  2FUG 1;  2LVQ A;  1KRH A;  4B95 A;  3R7Q A;  2WXP A;  3V3X A;  1VDV A;  1V5T A;  4AJY B;  2BS2 B;  3I5J C;  3PRM B;  3ZDT A;  1XXG A;  3ML8 A;  3GE3 C;  4BZA A;  1P9D U;  2VH1 A;  3RUL A;  3ZO5 B;  2N1V A;  1L4D B;  2Y5C A;  1IYF A;  2J42 A;  3VFK A;  3QAR A;  1WX7 A;  4L2Y A;  1FD6 A;  1GPX A;  1SB3 C;  1FNW A;  2DAJ A;  4LTU A;  3DBL B;  2WNM A;  1RWS A;  3KYC D;  3TEW A;  4ICV A;  3OG5 A;  3V60 A;  3CMM B;  2MH7 A;  3R8B A;  4LJO B;  1E6E B;  3ZQ4 A;  1I35 A;  1YD8 U;  2MJE A;  1MG4 A;  4ANU A;  1OQY A;  4B6W A;  3CIR B;  1WZ0 A;  5KHQ A;  2PE9 A;  2IY1 B;  5MPO A;  1WGY A;  3TEX A;  4XWT A;  2PE6 B;  3QQ8 B;  2NPT A;  3X23 A;  2L05 A;  1LQB A;  2NCN A;  2RPV A;  3WAO A;  4A90 A;  4FHK A;  3N3K B;  1G6J A;  2R2O A;  4HEA 1;  2ZJD A;  3DBR B;  4FUL A;  3MP9 A;  1NDD A;  2INC C;  3RYT A;  1J7C A;  2WGS A;  2L0T A;  2N9P C;  3PO0 A;  1MHH E;  1AYF A;  1A5R A;  4HXD A;  3KLS X;  5HG2 A;  3OWE B;  3KQ4 A;  4G3X B;  2WLB A;  5AUI A;  2Q5W D;  3NVZ A;  4QAY A;  1HTO A;  3MTN B;  4BVU C;  2XNA C;  3BWU D;  1MG8 A;  5D94 A;  2M17 A;  5FR6 A;  2QCZ A;  1TIF A;  2LJI A;  2OOB B;  3AB5 A;  3NY5 A;  2X8X X;  1FXA A;  1L0Y B;  2L0F A;  3A4R A;  2KDE B;  2KQS A;  3ZGZ A;  2LWP A;  3RMK C;  1STE A;  4KX6 B;  4KKJ A;  3DBH I;  4HKZ E;  3CWI A;  1E7U A;  4ZHP A;  1ZUD 2;  3DHG C;  4KGS A;  1XLN A;  5CHF A;  2Y5B B;  4MM3 A;  4YXD B;  4JE3 B;  2Z59 B;  4GDK B;  4MAC A;  2BBC A;  4R3D A;  3U8Z A;  4LNO A;  1YQ4 B;  1HZ6 A;  3BVG A;  5CTR C;  5FK9 C;  3DQV A;  1J7A A;  4BKS A;  1IBX B;  1D5Z C;  2LGI A;  4KZC A;  3EFC A;  2GLS A;  1GB1 A;  1SJE D;  1E8Z A;  4WJO A;  1ZXH A;  3T3N A;  4LNK A;  1EF1 A;  2JZP A;  1FXT B;  2MP2 B;  1UGJ A;  3RUI B;  2K22 A;  2GBR A;  2EMS A;  2DX5 B;  1WYG A;  1ZE3 D;  2JZZ A;  3RNG C;  4B9K A;  1VZ6 A;  2KMA A;  2M1M A;  4RM9 A;  2PJH A;  3VQI A;  4JGH B;  2CU1 A;  1L4Z B;  4HJK A;  3OLM D;  4MDK E;  2FAZ A;  3LDZ E;  1I4Q A;  4G0N B;  2SAK A;  1V6E A;  1QKZ A;  2K1F A;  3HUI A;  1WY8 A;  1FMA D;  1WR1 A;  2BVC A;  3AEA B;  1YN3 A;  3EEC A;  3ZDM C;  2RGF A;  3BVM A;  1JAL A;  2PPH A;  1VCB A;  2R2Q A;  2CS4 A;  4PYZ A;  2R61 A;  3HM6 X;  2ZCC A;  1HE8 A;  1YN5 A;  2WXJ A;  4GDK A;  3A9K B;  3AEF B;  3DVG Y;  1YQB A;  2WDV B;  4KGT A;  4YSY B;  2WXI A;  2I1J A;  3QC8 B;  4K7U A;  1BT0 A;  1YMH E;  2IBI B;  2L3Z A;  2EKI A;  4J3O D;  3TUO A;  1WM3 A;  1NI3 A;  3L10 B;  3IAS 1;  2PTL A;  3ZUN A;  2IJ0 A;  2KZR A;  2XN9 C;  2NMQ A;  1TBE A;  2UU7 A;  3LJ3 A;  1IUE A;  3W2D A;  4M00 A;  1MPE A;  3V6C B;  3UF8 A;  1GJZ A;  1YJI A;  1TGZ B;  4ZRK A;  3MC0 B;  1EUV B;  2KKC A;  1LGR A;  3K9P B;  4IM3 A;  3DBL I;  5AZG A;  2MP2 A;  1TJE A;  3C8Y A;  1QOA A;  1YJ1 A;  4XDC A;  4XX5 A;  1JWM D;  4URK A;  2GMI C;  3FIL B;  4KSL C;  2KHW B;  1P7F A;  2N9E B;  2RPQ A;  4OZA A;  4MSQ B;  2JVC A;  5C23 A;  3EUB 2;  1C4A A;  4G50 A;  2L52 A;  3Q2A C;  3M3J A;  1WM2 A;  3IFW B;  3BK1 A;  3WA0 A;  3DCG A;  3AM9 A;  3ZJV A;  3DBR I;  2QIL A;  5I4D A;  1RFA A;  5GMV A;  1P7E A;  2BWE S;  4ASW C;  3AMZ A;  3Q6B A;  1JWS D;  1N6Z A;  2FCN A;  1XO3 A;  3PGE A;  2K39 A;  2IO2 B;  1LO5 D;  1TKG A;  3JSV B;  2L32 A;  2OJW A;  4B0E A;  2NTT A;  3NJT A;  4GB9 A;  3Q3J A;  5IN7 A;  3QK0 A;  3A9K A;  1EWY C;  4EE2 A;  3M62 B;  3HRD D;  1JRU A;  4F8C B;  5LNK 1;  3DBS A;  2WYQ A;  1WZ3 A;  2IND C;  1BUI C;  2JWZ A;  1E7P B;  2Z0E B;  3TEY A;  1FRD A;  2KAJ A;  3CST A;  5JZE B;  1T0Q C;  1H8C A;  2ZVO A;  5IA7 A;  3JW0 X;  1J8C A;  4OHJ A;  4E3C A;  4IWO A;  1D5M C;  4W9C A;  1ET9 A;  2DEN B;  1UGM A;  2MHJ A;  1UD7 A;  4JQW C;  3L08 A;  3AE7 B;  5CHW A;  1WX8 A;  4RGO S;  3ZVV A;  2BS4 B;  3VRA B;  4K81 A;  4USA A;  1FNU A;  4IOI E;  1XEE A;  1WR6 E;  2LAS A;  3ZNG C;  4LJP B;  1WYW B;  1VRA B;  2XK5 A;  2CHZ A;  2IYD B;  2LGY A;  3E9S A;  3FIL A;  4NAW B;  2D3C A;  2BYV E;  1ZDX A;  2LRW A;  1K8R B;  2LXC A;  2VZK B;  3DWM A;  4OW0 A;  1ZOY B;  3TCA A;  2AL6 A;  3R66 C;  2YEP B;  1GUA B;  2KOX A;  3PVL A;  1RRB A;  2QJL A;  1R4M B;  1V97 A;  1D6E C;  5LLI A;  3Q14 C;  4PT5 A;  3X0W A;  1WX9 A;  2RDG A;  3W1S C;  2Y3A A;  3UGB B;  2J0J A;  2LHD A;  5G5G A;  1E9M A;  4ANV A;  1NYR A;  3P42 A;  3JVZ X;  3BZD B;  2H88 B;  2J0K A;  3H1U A;  3JSV A;  3PHX B;  3AE1 B;  1YN4 A;  3Q3N C;  4MJS B;  4HKQ A;  3BVZ A;  3AE2 B;  1F2R I;  2GBK A;  1R4N B;  3L0W B;  4K7W A;  4GU2 A;  2DBY A;  1RLF A;  1JQ4 A;  2I1K A;  3B1L X;  3VUX A;  5D2M B;  4GXB A;  4IWP A;  1VLB A;  3BYT B;  1TKY A;  4BKS D;  3RNE C;  4ZOH C;  5JHA A;  2BGF A;  3PHW B;  5H92 C;  1MJD A;  4EOY A;  1GB4 A;  1RFK A;  3GS2 A;  4XWW A;  4GN1 A;  1UH6 A;  3VUW A;  2KDI A;  4N6E B;  2HJ8 A;  2IO3 B;  2WXR A;  1Y8R C;  4FN2 A;  1CK1 A;  3B9J A;  1I4G A;  2L1A A;  2CHX A;  3I57 A;  2DYM A;  2LXA A;  4WAA A;  4DK5 A;  2MJ3 A;  4NAW A;  4MEL A;  3IXS A;  2X38 A;  4KDL B;  1LM8 B;  3VAW A;  2BYT A;  1NEK B;  5JHB A;  4KGR A;  1U4A A;  2WU5 B;  2XBB C;  2WDQ B;  3AXC A;  2WXL A;  3DHI C;  4WUR A;  4YL8 A;  2UYZ B;  2KT7 A;  3A4S C;  3QCA A;  4HLE A;  3PLU A;  4D2K A;  4LNI A;  3UQA A;  2D11 A;  1HZ5 A;  2VH2 A;  1QQR A;  2GB1 A;  1N5W A;  1V8C A;  2LVO A;  4HPM B;  4L1B A;  3CSF A;  3AN1 A;  1RM6 C;  1F1H A;  2NPT B;  2KO3 A;  2WXM A;  4NY0 A;  2WWZ A;  2K25 A;  1NI2 A;  1WXV A;  2V4I B;  1CQV A;  1NYQ A;  4MEM A;  1E5W A;  4MJS A;  1FNV A;  1ACC A;  4WJQ A;  2HD5 B;  2KMC A;  3RZW C;  1DOY A;  4PYU A;  4HCN B;  2ACZ B;  1ESF A;  2LHE A;  4WWP A;  1GC6 A;  2CU3 A;  3U7D A;  2BKR B;  2GOW A;  3L4P A;  2VRR B;  3APF A;  1QLB B;  2XEW A;  2ZW1 A;  2N9K A;  4DQO C;  1PUT A;  3ZKJ C;  1VZ7 A;  3BK2 A;  5CX3 A;  3U2S C;  4MGK E;  4ZYS A;  5JH5 C;  2JYE A;  2LGD A;  1F52 A;  4RGM A;  1QIL A;  3SD5 A;  3VTV A;  4MM3 B;  4M02 A;  1KTK A;  1FEH A;  1VR9 A;  3UIN B;  3AEG B;  4ZRP A;  2J52 A;  3VDZ A;  4WWM A;  4NQL B;  3DOW A;  2KJH B;  2KX3 A;  3AE6 B;  3FC4 A;  4LLG M;  2K0P A;  1X1M A;  4C56 C;  4W9F A;  1FRR A;  2WXN A;  4FJY A;  1Y56 A;  2JPH A;  2C7H A;  3AE3 B;  2D3A A;  2W82 A;  3EHV A;  1NEN B;  3NVY A;  2PIA A;  4ARI A;  2JXT A;  4H2A A;  4NNJ B;  4WWN A;  1QT9 A;  3RT3 B;  4RH6 A;  3B2G A;  1OTR B;  2MEK A;  1E8Y A;  3SDL C;  2KD0 A;  2ONQ A;  1N60 A;  3Q8E A;  3OAW A;  1R4M I;  4G11 A;  5DCN A;  1C9F A;  2DAF A;  2AQ2 B;  1TS4 A;  4A6Q A;  2NBW B;  3VRB B;  2RD0 A;  2LEK A;  5LXH A;  2QMT A;  2V4L A;  2D5G A;  4IUM B;  4NPN A;  1EU3 A;  3HVD A;  1TZO A;  3AI5 A;  3GOE A;  3IVF A;  4CQN A;  3WAN A;  2BYF A;  4WJP A;  4M8M A;  1WIA A;  2D2Q A;  3QWZ B;  4NZL B;  4GOC A;  1I7H A;  3E56 A;  4WJN A;  2NVU I;  2DZM A;  4ZRI A;  2Y5P A;  4P16 A;  3SFD B;  4MGI E;  3VTU A;  1IPG A;  3AED B;  5DPW A;  4RGT A;  1WE7 A;  4PS7 A;  2ZCB A;  4TQ1 A;  3RPF C;  5J2R A;  1EWC A;  3HK0 A;  2KFK B;  1V86 A;  4XDD A;  4YT0 B;  2KYW A;  3AEB B;  5KHO A;  5BMH A;  4S0R A;  4AP4 C;  1UF0 A;  2KJ6 A;  2BT6 A;  1V49 A;  1GNU A;  5HFY A;  2WS3 B;  4GDL B;  2LVP A;  3KWV A;  1MFW A;  1M4V A;  4B0M A;  4AWJ A;  3QIJ A;  2K6Q A;  2KWC A;  2PLP A;  1PGX A;  1L5P A;  1V1P B;  2KXJ A;  1HA5 A;  2M0A A;  3P63 A;  2K8B A;  4F7Z A;  3V62 A;  1NBF C;  5G5H A;  1XCT L;  3IT4 B;  2IGD A;  3PZD A;  1P1A A;  2W3R A;  3PRZ A;  4EZJ A;  1IGD A;  2GI9 A;  4IDI A;  4KDI C;  2HJ1 A;  3VR8 B;  2DZI A;  3IAM 1;  1TS3 A;  3N30 A;  3KVF B;  2HE7 A;  2KFJ A;  1KFY B;  1TY2 A;  2FIF A;  4XZ4 A;  2KVR A;  3URY A;  1XD3 B;  3AE4 B;  3A9J A;  2O6V B;  2DZJ A;  1E8W A;  1WFY A;  4YWG G;  4ICU A;  1AW7 A;  5EE0 A;  3ZNH B;  2CJN A;  3W5V B;  4XC2 A;  2MWS B;  3N9Y C;  4N58 A;  3TEZ A;  1JCK B;  5C2T B;  4KIK B;  1F2R C;  2KFK A;  1AAR A;  3RCZ A;  2IZV B;  3Q3F A;  2WDT B;  2IGG A;  4RM8 A;  2V1Y A;  3C0R B;  3H9D A;  1NVI D;  2VZK D;  2J7Q B;  4GDL A;  2KN4 A;  4S17 A;  1DOX A;  4K3B A;  1WGR A;  4GIV A;  5J18 A;  4MSM B;  5D6J B;  1WE6 A;  3RNB C;  1L0V B;  1SSN A;  4BAX A;  4TKN A;  2QEJ C;  1UBI A;  1V1P A;  3U30 A;  2BS3 B;  1YOV B;  3EGR A;  4HRS A;  2I2Y A;  2G45 B;  2LZ6 A;  2M0X A;  2A5U A;  3ML9 A;  2RSU A;  2XK5 B;  1YX5 B;  4ZDV A;  3ZRC A;  2JT4 B;  1YX6 B;  3NVW A;  1KM7 A;  1WXQ A;  2KQ4 X;  4C4V B;  2W9N A;  3H8H A;  1FCC C;  1ZDV A;  2GRI A;  3R7R A;  5EE9 A;  4DHZ E;  2E3T A;  1K50 A;  5AZF A;  2K6D B;  3HM3 A;  3L13 A;  3D32 A;  2FUH B;  3UIP B;  3NVV A;  2O6V A;  4BKG A;  4GSW A;  4BOZ B;  1PFD A;  3C19 A;  2D07 B;  3FAH A;  2DYO A;  2CKH B;  4Q2J A;  3PLV A;  3VTW A;  5LXI B;  3AEC B;  4KKI A;  1GG3 A;  4FA6 A;  2N9X A;  2KC2 A;  1C76 A;  1MVK A;  3R2T A;  4RF1 A;  4KIK A;  4AS1 A;  3MJW A;  2KWD A;  1E10 A;  2JSV X;  4AQ7 A;  4F1S A;  2BPS A;  4P1C C;  2LGX A;  3VUY A;  3ZTD A;  2L8J A;  1KLU D;  3PV1 A;  1XCQ L;  3PSE B;  1RAX A;  2W3S A;  4EEW A;  4YTM B;  4DHJ B;  1D4B A;  4MT5 A;  4YTN B;  1WGD A;  1FXI A;  2ZNV B;  4W9J A;  1XQQ A;  2N4F A;  4OZB A;  4DDI D;  2N9L A;  2WXF A;  1UEL A;  1JWA D;  5HHD G;  4UDU C;  2REX A;  4EUT A;  3L17 A;  2HTH A;  1L2N A;  1PYW D;  1UZX B;  5DPS A;  2L7R A;  1SE4 A;  4JIO U;  3RNC C;  1Z5S B;  3K9O B;  4GLS C;  1SE9 A;  2KTF A;  1E8X A;  1SIJ A;  4OZC A;  1XLO A;  3P4S B;  4HWI B;  4C4V A;  3LB8 C;  2V3N A;  3APD A;  3AU5 A;  2LI5 A;  5BYS A;  2V9H A;  1KOT A;  3W1Y A;  5FKA C;  2RDH A;  3TJP A;  1KLG D;  1FIQ A;  1FPY A;  1OEY J;  2FNJ B;  4CHK A;  3P4Q B;  1QOF A;  4RGN A;  4JL9 A;  4HVB A;  1WJU A;  2SEB D;  3ZW3 A;  4WIP A;  1F0Z A;  2L83 A;  3KUC B;  3RNF C;  2BW2 A;  1N62 A;  5BMG A;  3WIM A;  4DDG D;  2GBJ A;  3TMP B;  5L95 C;  2YEP F;  3M95 A;  2MBQ A;  2RDB C;  1WGH A;  4FHJ A;  1V80 A;  2ZW0 A;  1HTQ A;  2N7D A;  4FAD A;  1UNS A;  4ZHO A;  2JQR B;  2CR5 A;  4US9 A;  2AEH A;  1KLV A;  3SEB A;  2WXG A;  1UBQ A;  2BB6 A;  2KDB A;  2MW5 A;  1SBB B;  4ANX A;  1T0S C;  2J4X A;  4DBG A;  2I38 A;  3LYY A;  5L83 A;  4J6I A;  4LDT B;  2EKE C;  3SR6 A;  1J19 A;  4DXA B;  3AV8 A;  3OJ3 A;  1E0Z A;  3ALB A;  1DOI A;  4W9L A;  2DWQ A;  3BY4 B;  2B76 B;  2MJD A;  1I4H A;  4BFR A;  3OJ4 B;  4P6V F;  3VHT C;  3W1S A;  4M01 A;  1OQQ A;  2JX5 A;  4PS3 A;  3BIN A;  3QHT A;  3S2A A;  2M8S A;  2E6X A;  3HVZ A;  2BQQ A;  2KAN A;  1JW9 D;  3TSS A;  4LCD E;  1ROE A;  4FLH A;  2QSD A;  1D3Z A;  3ETR A;  2PVO D;  1WWT A;  4A3O A;  4IW0 A;  4II2 B;  5G55 A;  2ZZP B;  1T3Q A;  3N32 A;  4W9D A;  4A20 A;  3QX1 A;  2C9W B;  1FM0 D;  4P7I A;  2M19 A;  1TS2 A;  1N63 A;  3ZJT A;  3DDC B;  2A4Z A;  3VVW B;  1HXY D;  2KWU B;  2PW9 A;  3AE8 B;  5BYQ A;  2GBN A;  1TTN A;  5TR5 A;  4I6N B;  2NS5 A;  3DHH C;  4AUQ C;  5IP4 D;  2Z0D B;  1V5O A;  4KZ0 A;  1GOZ A;  1YJJ A;  3QA8 A;  1WMH B;  2WXQ A;  2EMT A;  2LFI A;  3DPD A;  1XT9 B;  2OHF A;  2M56 B;  1F77 A;  3MJ5 A;  3BYY B;  4JLC A;  2UWQ A;  3U52 E;  3KWL A;  5G2N A;  4I6P A;  3PS6 A;  3EC8 A;  2NBV B;  3AU4 A;  4ARC A;  4JWS C;  2JRH A;  2BYE A;  3P4P B;  3M63 B;  4E71 A;  2RR9 A;  3MC8 A;  5IKC M;  1Z2M A;  2LRU A;  2KDF B;  3L16 A;  1D5X C;  3Q8A A;  2KC1 A;  2CHW A;  3NUH B;  2WX0 A;  4M0W B;  2ZEQ A;  4HJG E;  1WXS A;  3U7Z A;  3RNA C;  1PGB A;  3PRE A;  3ECI A;  5C1Z A;  3ZXR A;  2C7M B;  4EFO A;  3KW5 B;  2DHZ A;  2K8H A;  2O6V D;  4RCO A;  3VH4 B;  5GXG B;  5E6J A;  2ON8 A;  3J9C A;  3DVN U;  3BII D;  1L6U A;  1WF9 A;  2K3U A;  3TBL D;  2MCN B;  1WJN A;  4A3P A;  3T8M A;  2KTR B;  4MGY E;  2JZ3 B;  3PPA A;  3TL5 A;  2G4S A;  2J0M A;  4C00 A;  2QHO A;  4TV3 A;  3Q3O C;  3NZ3 A;  1WMH A;  3A9J B;  5FR3 A;  4JPS A;  2FCS A;  4TUU A;  3UIO B;  2KMM A;  3VXW A;  4A9A A;  3NRZ A;  1R4N I;  2J53 A;  4HRO A;  4NQK E;  1IGC A;  1M94 A;  2KWV B;  4ACF A;  1YQ3 B;  1BXT A;  4NJC A;  4AJW A;  1P0R A;  2TSS A;  3KH0 A;  1C78 A;  2JY6 A;  2JXX A;  3ZYY X;  4K3C A;  2D3G A;  2IPK D;  4W9I A;  3SHQ A;  2WP9 B;  3DVG X;  1UWM A;  1FCL A;  4O1N A;  2H89 B;  3PRP B;  2MBO A;  3AUL A;  3MHZ A;  4IC7 B;  3GB1 A;  4OVZ A;  2YVC A;  5IO9 A;  5H8Y E;  3SFE B;  2KDM A;  4M0W A;  4GGQ A;  1WGG A;  4REZ A;  1XLP A;  2C7N B;  2FCQ A;  2G9H D;  1VD2 A;  5EE1 A;  1S1Q B;  1PQS A;  4W9G A;  1XLQ A;  2WHI A;  4RF0 A;  3Q3M C;  2MBE A;  4M8N A;  2C60 A;  4W9E A;  4RMA A;  2LJ5 A;  1B1Z A;  4RNA A;  1K52 A;  3NG0 A;  1SGH A;  2KAC A;  3H7P B;  4HCP B;  1I4X A;  4WH4 A;  4L23 A;  3N20 C;  4BOS C;  2ZPN A;  4JWU C;  2MSE D;  4TMA B;  3AH7 A;  2KTR A;  4MH0 E;  1OGW A;  1DYQ A;  2N7J A;  4IM2 A;  4IWQ A;  2MQJ A;  4DWF A;  1R7S A;  1UWX A;  2CJO A;  2O2V B;  1PGA A;  1ZPS A;  1P98 A;  3DVN V;  3GZN B;  2FCM A;  5JXV A;  4DHJ D;  5T8I A;  5D3D A;  5AUK A;  5BMI A;  3WAM A;  1V81 A;  2WXK A;  2D3B A;  1ZP0 B;  2NBU A;  2V3P A;  3A33 B;  1BML C;  4HPP A;  4ZRQ A;  3ZRF A;  1SXT A;  3P4R B;  3QAQ A;  5HKH A;  3RFZ B;  3L54 A;  4NJ7 A;  2HTM E;  1T5X D;  2AYO B;  4OVU A;  1N5X A;  2K8C A;  3APC A;  1AN8 A;  1SEB D;  2K9X A;  1ENF A;  4HPL B;  4C7Z A;  3NHE B;  2KX0 A;  3O13 A;  3W5U B;  2AL3 A;  1AWD A;  3IG3 A;  1I4R A;  4XGA B;  3H7S A;  3MC9 A;  1MHX A;  2NTS A;  1CMX B;  3B0A A;  1EF5 A;  5HI1 A;  4ZYN A;  1GAQ B;  3H6N A;  5DPT A;  1VJK A;  4YSX B;  2Z8L A;  1IBX A;  3KUD B;  1V2Y A;  1TZ1 A;  3Q8F A;  1VZ8 A;  1ZGU B;  4ZRJ A;  2INP E;  3WAL A;  4XE0 A;  2LUE A;  1OEY A;  4KV2 A;  2IGH A;  3ZNZ B;  4ANW A;  1K53 A;  1WSP A;  2AQ1 B;  3H7P A;  3B08 A;  3PZ8 A;  5AZH A;  3IHP C;  3V61 A;  4WAF A;  1OFF A;  1QZE A;  1WRI A;  2DLB A;  2G4D B;  3B2F A;  3N1Z C;  2V0G A;  1V1O A;  3LXF A;  2FID A;  1SE3 A;  4BKT A;  3EA6 A;  1ZKH A;  2B3A A;  2OJR A;  2LD9 A;  4AOF A;  1SIF A;  2O2V A;  3GE8 C;  4W9K A;  1PDX A;  1P3Q U;  3ONS A;  3VH3 B;  2G3Q B;  1ZXI A;  2L00 B;  2MRP A;  4JX1 C;  1K51 A;  4LNN A;  4WQO B;  3KUZ A;  1H4R A;  1QOG A;  3AE9 B;  1T0Y A;  2YLM A;  1WRD B;  3ENE A;  4II3 B;  4LDT D;  3MHS D;  2D10 A;  1FO4 A;  4US8 A;  3NS1 A;  2JYT A;  1V9J A;  2ZVN A;  3R2I A;  4NAM A;  5IOI A;  4NJ6 A;  1YIW A;  2EEL A;  1JRP A;  4GMV A;  2ASQ A;  3NZS A;  4EKU A;  2WQY B;  1Q0W B;  3SU8 X;  2LGS A;  4PS8 A;  2BKF A;  1TT5 B;  2INN E;  4TQ0 A;  3I3T B;  4N9F 4;  1I4P A;  1ZW7 A;  3CF6 E;  3FKY A;  1N61 A;  1E7V A;  3HIZ A;  2KJR A;  3RI7 C;  4KVG B;  1S3S G;  2IO0 B;  4FBJ B;  4LNF A;  5D7G A;  2FBW B;  1I42 A;  2M4N A;  2KLC A;  1C3T A;  2PMV A;  1KF6 B;  1TYG B;  2L76 A;  3R3M A;  3U4E G;  1EO6 A;  5E6P A;  4IM0 A;  4HDQ A;  1MI0 A;  1FFU A;  1KH0 A;  1CJE A;  3WAP A;  2BTE A;  1RYJ A;  4EZK A;  5J17 A;  2N7E A;  3KYD D;  3WCQ A;  2ZNV C;  2NR2 A;  2N0S B;  3UQB A;  2MX2 A;  2AQ3 B;  3A1Q B;  1OQR A;  2KLG A;  2FE8 A;  2QDF A;  2W55 A;  3RZF A;  1LXD A;  3PT2 B;  3JYU A;  4XYC A;  2KNB A;  4WQM A;  1HEZ E;  3HHM A;  5C3J B;  1JWB D;  3PTF C;  4DHZ B;  1WJ6 A;  5CHV C;  3N1X C; 
#chains in the Genus database with same CATH homology
 4M02 A;  2KYW A;  4M01 A;  2KVZ A;  2KT7 A;  4M00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...