2KYWA

Solution nmr structure of a domain of adhesion exoprotein from pediococcus pentosaceus, northeast structural genomics consortium target ptr41o
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
MDEDATITYVDDDKGGAQVGDIVTVTGKTDDSTTYTVTIPDGYEYVGTDGGVVSSDGKTVTITFAADDSDNVVIHLKHGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion exoprotein
publication title Solution NMR Structure of a domain of adhesion exoprotein from Pediococcus pentosaceus, Northeast Structural Genomics Consortium Target PtR41O
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kywA00
2KT7A 4M00A 2KYWA 4M01A 4M02A 2KVZA
chains in the Genus database with same CATH superfamily
2BBCA 2BKRB 1ET6A 5D94A 2V9HA 2CS4A 3AE9B 2O2VB 3BZDB 3U30A 4LDTD 4TSSA 2WXHA 2RPQA 2BTEA 5DPRA 3DBRB 3V05A 2DZMA 2KQSA 1TS3A 2SEBD 2ASQA 3C8YA 1WR6E 1C76A 4AJWA 3HK0A 2WXOA 3JSVB 1LGRA 2L05A 4AP4C 2ZCCA 4WWPA 2LEKA 3TEYA 1XLNA 3AB5A 3ZRCA 2V3NA 1WE7A 1WX8A 2LJ5A 3Q3NC 2XK5B 1S1QB 2CR5A 3IT4B 2K0PA 4MJSA 2J42A 3ZTDA 2G45B 5EDSA 3HM3A 3GS2A 2ZW1A 2IGDA 4M02A 1OEYJ 2KANA 2JYTA 4R3DA 2KMAA 1YJ1A 3H8HA 1EM7A 1AARA 2AWTA 3U7ZA 4YTNB 2K3UA 4YSYB 2WWZA 1PQSA 1P98A 3MHZA 3DWGC 3RZWC 5GXGB 5KHOA 2N1VA 2WXRA 2YVCA 2K8HA 2BKFA 2WLBA 4BKGA 3AH7A 1LM8B 2UYZB 1TS2A 1VZ7A 3OJ4B 5BMGA 3W9CB 2D5GA 4RF1A 1OEYA 1RYJA 4B95A 1RAXA 4MH8A 3ZJTA 1J19A 3A4RA 1IPGA 2Z8LA 3IAS1 3MTNB 1WYGA 4ZYSA 5IN7A 4GIVA 3LDZE 1FFUA 5E6JA 4ARIA 4XWTA 2JZPA 2GI9A 4K3CA 3GE3C 1NI2A 3APDA 2JXTA 3L17A 2BYEA 3PT2B 1ZE3D 3W5UB 2ZEQA 1E9MA 3D32A 3AE1B 1HE8A 3L0WB 3RULA 1WMHA 2PTLA 3H1UA 2IO1B 4EOYA 2H88B 1YQBA 4P16A 4A55A 4M8NA 2IZVB 3ZNHB 2KDMA 2ON8A 1D6EC 2K25A 2UWQA 4DXFA 1IP9A 2N9PC 1U4AA 1SJHD 1YD8U 4USAA 3AM9A 4OZBA 4DXAB 4HRSA 4TQ0A 1YOVB 3QK0A 4HDQA 2A4ZA 3P4QB 2AL3A 3AU4A 4RGNA 3EECA 3UIPB 4K7SA 3TJPA 3NRZA 3E9SA 2KAJA 2EKIA 1XEEA 5EE0A 2N7JA 3AE5B 3C19A 1HQRD 2K8CA 4XYCA 1JQ4A 3N1XC 1N60A 5JZEB 4KZ0A 5AUKA 1OTRB 2ZPNA 5HHDG 3EGRA 3NS8A 3ZGZA 1K52A 3P1MA 4CQNA 2JUOA 3ZQ4A 2G3QB 4KIKA 1WXAA 1PDXA 4A3PA 1WRDB 2VZKB 2IPKD 1N63A 2AYOB 5IO9A 3AE8B 5J17A 2ZJDA 2J52A 1FPYA 2VZKD 2GBRA 2NBUA 4RM9A 3PTFC 1OFFA 2AEHA 1ET9A 2NCNA 4G11A 1JRUA 2KJ6A 1L0VB 2PJHA 1WI0A 5E6NA 3VVWB 4O1NA 1E6EB 1KH0A 3RUIB 5MPOA 2LWPA 2KHWB 3OG5A 4BOSC 1LFDA 2KDIA 2MA9B 3BK1A 3ALBA 3W2DA 1YN4A 2Y3AA 3RPFC 2WDQB 3U4EG 1UF0A 1PYWD 1FMAD 1L4ZB 2CU1A 2GRIA 3I9V1 4IDIA 2BYFA 2DAJA 2BB6A 4NJ7A 2AQ2B 1FIQA 2K1FA 2L3ZA 2JRIB 3KH0A 3AE6B 1EF1A 1TY0A 4HKZE 2AQ3B 2ONQA 4GDKB 4IUMB 2KC1A 1E8WA 1FNVA 1D4BA 1V5OA 4HJGE 2M1MA 1D5XC 3CWIA 1E8YA 1FM0D 1Y56A 1WGRA 4EZJA 3Q8BA 4URKA 1UZXB 2J0MA 5IOIA 3KVFB 3PZDA 4WIPA 1N6ZA 1QOFA 3V3XA 4LJPB 4MM3A 2KMCA 4HXDA 2XEWA 5AZFA 4C7ZA 4BOZB 1XD3B 2C7HA 1VZ8A 4W9CA 1VRAB 4N58A 4IOIE 2IJ0A 2RDGA 4IWOA 2Z0DB 3W1YA 1SE9A 2ZPYA 2J53A 3OJ3A 3WAPA 4WH4A 3M63B 3MC8A 4MGZE 2LASA 4IM0A 4WAFA 4ZHPA 3VUYA 1KTKA 2L8JA 2V1YA 3FKYA 1WGYA 3VHTC 2FUHB 5HFYA 2KFKB 3HHMA 2ZVNA 2GB1A 5FR6A 1AYFA 2VH1A 3TEZA 3ML8A 1I35A 3ZO5B 1V8CA 2D3BA 2PMVA 2WX1A 3Q8CA 3Q8FA 1V2YA 3DBHB 4NAMA 3VTWA 2L76A 3ZTCA 3Q8EA 3APCA 4OHJA 2KWCA 2IGHA 1YNTE 3U2SC 1V86A 1L6VA 2DX5B 1F2RI 4J3OD 3GB1A 1K8RB 4HK2A 3OWEB 2W54A 1E90A 2KQ7A 3ZJVA 2RSUA 1YIWA 1BUIC 1E10A 4L2YA 3V6EB 2DBYA 4YXDB 4C4VB 3CSFA 1N62A 2MW5A 4RCOA 1IBXA 4QAYA 2MEKA 1MPEA 3MC9A 3TEXA 3VTVA 3EFCA 3DOWA 3IBEA 3N32A 2LRUA 4EE2A 3RNFC 4MGKE 2QDFA 2GBJA 3ZDTA 5D3IB 2L7RA 4RGMA 1IGCA 3DQVA 3ZJUA 1ZOYB 1JWSD 4E3CA 3NUHB 2INDC 2K6DB 2R2OA 3DBLI 2FAZA 4DDID 2JQRB 2KWUB 4AWJA 2Y5CA 3NZ3A 4B0MA 1STEA 1TKGA 1BMLC 1R4MI 1WGKA 2JT4B 3K9OB 2GBKA 2R2QA 3P2BA 3BWUD 2AL6A 1FRRA 4NAWB 1S3SG 1WGHA 3TBLD 3RMKC 3H9DA 3VTUA 2PLPA 2WXLA 3RNCC 3GZNI 4OW0A 1YJIA 2YLMA 2KJHB 3VDZA 3SHQA 3HRDD 4FHKA 4M00A 1L2NA 2JY6A 2E6XA 4DXGA 2OJWA 4ICUA 4W9JA 1NVID 2IO2B 5H8YE 2NTSA 4A90A 3RD2A 2G1EA 1WX9A 1KRHA 1P3QU 4PS3A 5G5GA 2OJRA 5EE3A 2HE7A 3JSVA 1X1MA 2WXPA 2QCZA 1ESFA 3FC4A 2N1WA 1VCBA 2QHOA 4LCDE 2HTME 3A9KB 2N4FA 3H7PB 2Q5WD 3KYDD 3PHWB 2QSDA 3EC8A 1V80A 1FXIA 1M4VA 2OHFA 4BKSD 2LXCA 2MBQA 5C2TB 2RDHA 5G55A 2LXAA 3KLSX 1NBFC 2XK5A 3BIID 4JWUC 4WJQA 2WXNA 1I4HA 2YEPF 1WJ4A 3DWMA 1R7SA 3PRPB 3N3KB 4FJZA 3A1QA 4WQMA 2IO3B 1NEKB 1GPXA 2Z0EB 4RGOS 4W9DA 5EE9A 1C1YB 1WR1A 4WJOA 2BB5A 4LLGM 1EWCA 3Q2AC 3PRMB 2PW9A 3APFA 2HD5B 2LHEA 2YEPB 4ZOHC 2E3TA 3AE4B 4I6PA 4N59A 3TEWA 2KTRA 3N30A 3RYTA 3A33B 3AU5A 4A8XC 3HUIA 2FUG1 4IWPA 1SBBB 1YX6B 2V3SA 2MLBA 2MBOA 4JPSA 1L7YA 3AEAB 4X57B 4RM8A 1QZEA 3SR6A 1F0ZA 5J18A 3I3TB 3DDCB 5CHFA 4G50A 3AXCA 3M3JA 3V61A 4ZRPA 4WWMA 3R66C 1A70A 1KF6B 2PIAA 3CSTA 2EELA 2DZJA 5JHBA 3BYYB 4TKNA 1ZXHA 2VRRB 1L5PA 4AJYB 1EF5A 1E7VA 4GMVA 1E5WA 2DHZA 5KHQA 4ANUA 3R7QA 2WX0A 2V0GA 1LO5D 4FADA 2NS5A 2MBEA 2J0KA 2X8XX 5DPSA 1VDVA 3VUWA 1VZ6A 4JL9A 2BWES 2D3AA 4H2AA 3AEGB 1TZOA 1P7EA 2QC8A 5LXIB 5LXHA 4WWOA 3RNGC 4L1BA 4FLHA 1UBQA 3WANA 3IFWB 1Z5SB 2LD9A 1R4NI 1Z2MA 4P6VF 2Y5BB 3ZRFA 3PO0A 1HTOA 3ABVB 1RFAA 1P0RA 3PHXB 1GB1A 4M0WB 2H89B 2LJIA 3ZUNA 1JMLA 3V60A 4ASWC 1N5XA 3VFKA 3GOEA 3R3MA 2NVUI 1KLVA 3RI7C 2WQYB 4Q2JA 2KLCA 1J0GA 3PPAA 1I4GA 4A9AA 1F1HA 3VAWA 2D3CA 3QC8B 1C9FA 3HIZA 4OZAA 1AWDA 1H4RA 3QARA 1TKYA 2WDRB 2FCSA 1Y8RC 4LJOB 1QKZA 2JSVX 5IAAC 3NS1A 1QLBB 1AN8A 1XT9B 2KXJA 4GGQA 4A20A 4YTMB 2CU3A 1GAQB 3AEEB 3CIRB 2KTFA 2V3PA 3UF8A 1JWAD 2KWDA 2WDTB 1JCKB 4PYUA 1E7UA 3AE7B 3A4SC 1HEZE 3TCAA 4C80A 1NDDA 2LGSA 2FE8A 2MJEA 3AI5A 4B6WA 3Q3MC 2RPVA 4K7UA 1JROA 1J8CA 1KJTA 3RCZA 2WXJA 2KDFB 4HWIB 2DWQA 2BW2A 1KM7A 5BO4B 1OGWA 4XC2A 3LJ3A 4LNFA 2MJDA 4GOCA 4XDDA 3QWZB 3VRBB 3MJ5A 2BPSA 2WU2B 4II2B 4RF0A 1IYFA 3Q69A 4GDKA 3E56A 4BBNF 4N9F4 1GOZA 1CQVA 2C9WB 2R61A 2XNAC 2REXA 5HI1A 4ZDVA 3DHGC 4YSZB 4XDCA 3OLMD 1UWMA 2GOWA 3B9JA 1NYRA 3V6CB 1T6BX 1DYQA 5H92C 4DWFA 1D5ZC 3P63A 4PK1A 1ZW7A 2NR2A 5BMHA 1HZ6A 1SEBD 4E74A 2LUMA 4KX6B 4PS8A 5BYQA 2FCQA 1KLGD 1JWBD 4EZLA 2FNJB 1GJZA 3BK2A 2BT6A 4IG7B 3RNAC 3EA6A 2LMCA 4K81A 5C23A 3J9CA 2WXQA 1RWSA 4FHJA 1SE2A 3PVLA 3DBLB 2I1JA 2RGFA 4P7IA 3QHTA 3NOBA 1UH6A 1GC7A 1VJKA 1R4MB 3UQBA 2MSED 4KDLB 3MP9A 3QAQA 3Q3JA 4MH0E 4MACA 4WWNA 2ZZPB 2KLGA 4TMAB 4L23A 4YSXB 2PE9A 5AZGA 3KUCB 5JHAA 5DPWA 1V49A 2PVOD 2IY0B 2MRPA 2RD0A 3PLVA 3NZSA 4BBNC 2IY1B 4ZHOA 1E8XA 3NVVA 4BKTA 1M94A 4FJYA 1E0ZA 2RR9A 1WZ0A 1D3ZA 1BT0A 3ECIA 2NBVB 3AEFB 1E8ZA 1SF0A 2B3AA 2NPTB 2SAKA 4S17A 2KO3A 2JVCA 4M01A 4FXCA 2CHWA 2IBIB 2N9XA 2LVOA 4HDOA 4EEWA 4WQOB 3O13A 1L6UA 4AS1A 4US8A 1BXTA 4MGYE 2JZ3B 4F8CB 5C1ZA 2ACZB 3KQ4A 1RM6C 3AEBB 2ZNVB 1CMXB 2I1KA 5CHVC 1UGMA 2RMMA 4KIKB 2KX0A 1F77A 1QOAA 1TY2A 1WXMA 4J6IA 1C78A 3ZVVA 3ETRA 4YT0B 5AZHA 2C60A 4RMAA 1GUAB 2IDYA 2O6VA 3R2TA 1Q10A 2KACA 3LB8C 3TUOA 2C7MB 3Q8AA 4NAWA 2M19A 3QJZA 3ZLZA 3RNBC 4GDLA 4DQOC 2BGFA 3ZKJC 1I42A 1I4PA 1F52A 4HCNB 3FAHA 3IXSA 2Z59B 3GE8C 4IWQA 5JXVA 1WH3A 1WY8A 2BQQA 2FCMA 3ZNZB 1Q1OA 2K39A 4XGAB 4NY0A 1QF6A 4A3OA 3H7SA 4ZRIA 1MVKA 3DBSA 1ZXIA 4JGHB 5CTRC 1DGJA 3SD5A 1NI3A 3AE2B 3DPDA 3CMMB 3VQIA 1E7PB 4BKSA 2KOXA 4IC7B 1B1ZA 1TGZB 5LLIA 3PV1A 2INCC 4EUTA 3PRZA 2M17A 1RRBA 4DBGA 2M56B 2KFJA 2W55A 2D11A 2FBWB 5G2NA 2LGIA 3VXWA 1VD2A 3U7DA 1OQRA 4IKGA 2WXKA 1V81A 4NJCA 4G3XB 2MWSB 2C5LC 1YN3A 1SIFA 1V1OA 1IUEA 1NYQA 5D3DA 1R4NB 2BF8B 3NJTA 2MP2B 3NY5A 1WM3A 4M8MA 3UIOB 3DHIC 4BFRA 4II3B 2L00B 5EE1A 4WURA 1JWMD 1KFYB 3T3NA 4WJNA 3FILB 1YQ4B 3NVWA 3K9PB 2NTTA 1MG8A 1DOXA 2LGYA 4MT5A 5BYSA 3UQAA 3KUZA 4GU2A 1JWUD 2KC2A 1L0YB 2O2VA 1IGDA 1WWTA 4GB9A 4KKIA 2WGSA 1C4PA 4IW0A 2ZCBA 4WJPA 3DVGX 2CHXA 2K8BA 1I7HA 4OVUA 3ZXVA 4REZA 4F7ZA 2TSSA 2M0AA 5CX3A 1K53A 1N5WA 3L54A 2D07B 2MBBB 2L83A 1NENB 2LI5A 1YJJA 1GNUA 4XE0A 3MJWA 1LXDA 3N20C 2DNFA 2L0TA 2WXFA 3JVZX 1FNUA 4ANWA 1JALA 3T9LA 2A5UA 4S0RA 4NJ6A 1P9DU 1V1PB 3ZIMA 3AV8A 5TSSA 2FCNA 3P4PB 2EMTA 3L4PA 1V9JA 2JZZA 2WDVB 3B0AA 3AMZA 4ANXA 1AW7A 2LVPA 2M0XA 3PS6A 2BS4B 5T8IA 4TQ1A 1ISNA 2DYBA 3B2GA 4YL8A 5AEKB 1WXSA 1WZ3A 1MJDA 1CZPA 3QIJA 4ZYNA 3ONSA 2LFIA 4DDGD 4G0NB 3PGEA 3A9JB 1WRIA 1UBIA 2MCNB 2DYMA 3N1ZC 4GLSC 3V62A 1WIAA 1EU4A 1P7FA 2QILA 3SFDB 1EUVB 4TV3A 4ZRKA 1TTNA 2DYOA 4CHKA 2QMTA 1YX5B 3BINA 2NBWB 3NZUA 3X0WA 3TMPB 2XN9C 2I2YA 1FNWA 3DVNV 1QQRA 1TS4A 3TL5A 1UD7A 2ICIA 1I4QA 3PREA 4XWWA 2JYEA 3I63C 3AN1A 1ZDXA 3BY4B 3NHEB 1EO6A 3RNEC 1C3TA 4HPPA 4KZCA 5L95C 2W82A 1CK1A 4P1BC 2JU6X 1XLQA 3C0RB 1HXYD 4KSKC 1XLPA 3Q3FA 3O65B 4DK5A 1WM2A 2BYTA 1MHHE 3ZNGC 3W1SC 3DVNU 3R8BA 4XX5A 4XZ4A 2PVGC 4ZRJA 1HA5A 2IGGA 5JH5C 4K7WA 2L1AA 2VH2A 3QCAA 3P42A 3B08A 2W3SA 1EU3A 4HPLB 2PEAA 4MEMA 2PPHA 2JX5A 2QEJC 3R2IA 1RLFA 5DPTA 3A1QB 3JW0X 3LYYA 4MDKE 5TR5A 3L16A 3SDLC 4NZLB 3URYA 3VH3B 1UWXA 2WYQA 3SFEB 4HCPB 5AUIA 2FIDA 2KTRB 2MQJA 1WF9A 3WCQA 1DOYA 4C7YA 1K50A 5J2RA 1XF5L 3DHHC 2J4XA 4P1CC 1WE6A 1QILA 2IYDB 1FCCC 2BWFA 3QQ8B 3B2FA 2CKHB 4FA6A 3AECB 3Q14C 2JPHA 2N7EA 2HTHA 2KK8A 4MSQB 1JW9D 4JE3B 5GMVA 1WXVA 1T0QC 1YQ3B 3PZ7A 3BVGA 1XXGA 3NG0A 3N9YC 2WXIA 2X38A 2J0JA 4A6QA 2QIEB 2WXGA 1Q5WB 2IO0B 2XBBC 3N1YC 4LNIA 4W9HA 1UUPA 3Q3OC 4JIOU 1FXAA 2DLBA 3WIMA 4KSLC 1WJ6A 1T3QA 1ACCA 4HVBA 4KGTA 4W9KA 1MFWA 2EMSA 3QA8A 1T5XD 4FBJB 1MI0A 3U8ZA 2UU7A 3VR9B 1UGJA 4MJSB 5LNK1 1C79A 2LGXA 3WALA 3T8MA 3VH4B 4WAAA 3PZ8A 4ZRQA 2KDBA 1TIFA 1HZ5A 4RH6A 1FO4A 2BS3B 2HDEA 1L4DB 4N6EB 1TJEA 2BS2B 2NPTA 5FR3A 1WYWB 4HEA1 3KYCD 3GP7A 1WFYA 2KVZA 3MHSD 3TSSA 3IG3A 3ZNID 1ZKHA 4KKJA 3UI3A 2D10A 3IHPC 4LNKA 3DBRI 1WGGA 3UGBB 2N0SB 4JX1C 2ZW0A 1PUTA 3IAM1 2KKCA 2WNMA 4BVUC 3ZW3A 1QOBA 1SE3A 1SIJA 1TYGB 1ZPSA 4B9KA 2MX2A 1WGDA 4NQLB 3EUB2 1XCQL 3VRAB 1ROEA 2KFKA 1VR9A 1WJNA 4OZCA 4B0EA 2KN5A 2K9XA 4YWGG 1HTQA 4W9IA 3KW5B 2LGDA 2D3GA 4C56C 2JWZA 1MHXA 3L08A 3ENEA 2I38A 1ZP0B 3PLUA 1A5RA 1WMHB 5HG2A 4EZKA 1XO3A 2LHDA 4LK0M 1SB3C 2MHJA 4EFOA 1I4XA 1B9RA 2KN4A 1CJEA 3NVYA 4ARCA 3GZNB 3RFZB 3QX1A 2MJ3A 4IM2A 4W9FA 4C00A 1F2RC 4HKQA 4DHJB 5IKCM 2JF5A 2LRWA 1C77A 1LQBA 1OQQA 2KYWA 1J7CA 3HM6X 4W9GA 2N9LA 4DHZB 5FK9C 1JRPA 4MGIE 4DHJD 1TT5B 4HROA 4C4VA 4I6NB 5D7GA 3S2AA 3WAMA 3ML9A 2DZKA 1ZGUB 2BVCA 3EHVA 2CJNA 2G4DB 2GBMA 1Q0WB 1DOIA 2W9NA 3EFUA 1RFKA 4YTPB 1XLOA 2B76B 3KWVA 1L0XB 1F9JA 3AE3B 2RDBC 1J7AA 3M62B 4W9EA 1WSPA 2MH7A 1T0RC 2CJOA 2QJLA 1QOGA 1V5TA 4RGTA 3TIXA 2V4LA 2MP2A 1TS5A 4FN2A 4KGRA 3AEDB 5G5HA 2HJ1A 2LVQA 1FCLA 1SSNA 3FILA 1VLBA 2FIFA 5DCNA 1UELA 3SU8X 4ICVA 1KLUD 4HPMB 1PGBA 2WU5B 2NMQA 1UNSA 2PE6B 3WAOA 4F1SA 3KUDB 3U52E 2KJRA 3HVZA 4KV2A 4FULA 4OVVA 2AX5A 2KWVB 1TBEA 4MELA 1K51A 3I57A 4RFBA 3DCGA 3ZYYX 3B1LX 2DAFA 2KZRA 5IP4D 3RN9C 4K3BA 4KVGB 3LXFA 3CF6E 4JWSC 1SXTA 4OVZA 3Q6BA 1OQYA 3BVZA 4GN1A 2BYVE 5BYRA 4D2KA 2N9EB 3A9KA 5BMIA 3AULA 3H7PA 2KX3A 2KT7A 4LTUA 2INPE 2GMIC 2WHIA 3RZFA 3UINB 2ZNVC 1EWYC 2AQ1B 1I4RA 4MSMB 1V1PA 4JQWC 2G9HD 1C4CA 1FRDA 2LZ6A 1ZUD2 3W1SA 4ACFA 4MM3B 3HVDA 1SGHA 1WX7A 3JYUA 1H8CA 2KQ4X 2JWUA 1PGXA 2K22A 3M95A 4US9A 4GSWA 2DZIA 2K5PA 2WS3B 2KD0A 5D6JB 3P4SB 2CHZA 4E71A 3A9JA 5IA7A 2N9KA 3R7RA 3T3OA 2DENB 2EKEC 2KNBA 4HLEA 2OOBB 2JRHA 2LUEA 2WP9B 1TZ1A 4EKUA 4HJKA 1ENFA 1XCTL 2JXXA 5FKAC 2O6VB 2ZVOA 1GC6A 4ITKA 4KDIC 1QT9A 1PFDA 2V4IB 1SE4A 3SEBA 4W9LA 4GDLB 1FFVA 1KOTA 1J7BA 3L13A 4TUUA 4AOFA 1MG4A 1G6JA 2Y5PA 5L83A 3RT3B 2O6VD 4IM3A 1FXTB 2PKOA 1N61A 1YMHE 4NQKE 4BZAA 1WXQA 3OAWA 2K6QA 1C4AA 5HKHA 1GB4A 1FD6A 3WA0A 3VUXA 1XQQA 4JLCA 3KWLA 3VR8B 3I5JC 2KDEB 1TKEA 2HJ8A 5E6PA 3ZDMC 2KVRA 3PSEB 2L32A 4LNNA 1V97A 4CYEA 3W5VB 1IBXB 2OEDA 1SJED 1ZDVA 4M0WA 1PGAA 3L10B 4RNAA 4NNJB 4AQ7A 2G4SA 4PT5A 3IT6B 2GBNA 4PS7A 4FJVB 3IVFA 3MFGA 1D5MC 4PYZA 2J7QB 4UDUC 4I6LB 5D2MB 5C3JB 3X23A 1GG3A 2M4NA 1P1AA 4DHZE 3ZXRA 3H6NA 1T0YA 1FEHA 3DVGY 4AUQC 1WJUA 4GXBA 2INNE 2MBHA 3BVMA 5CHWA 5E6OA 4K1RB 2D2QA 2M8SA 5I4DA 3MC0B 2L0FA 2KMMA 1YN5A 3NVZA 3DBHI 2N7DA 2L52A 2C7NB 2WXMA 1V6EA 3BYTB 3P4RB 4KGSA 4LDTB 4ANVA 2GLSA 1T0SC 4BAXA 2W3RA 4CO7A 4NPNA 4LNOA
chains in the Genus database with same CATH topology
2KT7A 4M00A 2KYWA 4M01A 4M02A 2KVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KT7 A;  4M00 A;  2KYW A;  4M01 A;  4M02 A;  2KVZ A; 
#chains in the Genus database with same CATH topology
 2BBC A;  2BKR B;  1ET6 A;  5D94 A;  2V9H A;  2CS4 A;  3AE9 B;  2O2V B;  3BZD B;  3U30 A;  4LDT D;  4TSS A;  2WXH A;  2RPQ A;  2BTE A;  5DPR A;  3DBR B;  3V05 A;  2DZM A;  2KQS A;  1TS3 A;  2SEB D;  2ASQ A;  3C8Y A;  1WR6 E;  1C76 A;  4AJW A;  3HK0 A;  2WXO A;  3JSV B;  1LGR A;  2L05 A;  4AP4 C;  2ZCC A;  4WWP A;  2LEK A;  3TEY A;  1XLN A;  3AB5 A;  3ZRC A;  2V3N A;  1WE7 A;  1WX8 A;  2LJ5 A;  3Q3N C;  2XK5 B;  1S1Q B;  2CR5 A;  3IT4 B;  2K0P A;  4MJS A;  2J42 A;  3ZTD A;  2G45 B;  5EDS A;  3HM3 A;  3GS2 A;  2ZW1 A;  2IGD A;  4M02 A;  1OEY J;  2KAN A;  2JYT A;  4R3D A;  2KMA A;  1YJ1 A;  3H8H A;  1EM7 A;  1AAR A;  2AWT A;  3U7Z A;  4YTN B;  2K3U A;  4YSY B;  2WWZ A;  1PQS A;  1P98 A;  3MHZ A;  3DWG C;  3RZW C;  5GXG B;  5KHO A;  2N1V A;  2WXR A;  2YVC A;  2K8H A;  2BKF A;  2WLB A;  4BKG A;  3AH7 A;  1LM8 B;  2UYZ B;  1TS2 A;  1VZ7 A;  3OJ4 B;  5BMG A;  3W9C B;  2D5G A;  4RF1 A;  1OEY A;  1RYJ A;  4B95 A;  1RAX A;  4MH8 A;  3ZJT A;  1J19 A;  3A4R A;  1IPG A;  2Z8L A;  3IAS 1;  3MTN B;  1WYG A;  4ZYS A;  5IN7 A;  4GIV A;  3LDZ E;  1FFU A;  5E6J A;  4ARI A;  4XWT A;  2JZP A;  2GI9 A;  4K3C A;  3GE3 C;  1NI2 A;  3APD A;  2JXT A;  3L17 A;  2BYE A;  3PT2 B;  1ZE3 D;  3W5U B;  2ZEQ A;  1E9M A;  3D32 A;  3AE1 B;  1HE8 A;  3L0W B;  3RUL A;  1WMH A;  2PTL A;  3H1U A;  2IO1 B;  4EOY A;  2H88 B;  1YQB A;  4P16 A;  4A55 A;  4M8N A;  2IZV B;  3ZNH B;  2KDM A;  2ON8 A;  1D6E C;  2K25 A;  2UWQ A;  4DXF A;  1IP9 A;  2N9P C;  1U4A A;  1SJH D;  1YD8 U;  4USA A;  3AM9 A;  4OZB A;  4DXA B;  4HRS A;  4TQ0 A;  1YOV B;  3QK0 A;  4HDQ A;  2A4Z A;  3P4Q B;  2AL3 A;  3AU4 A;  4RGN A;  3EEC A;  3UIP B;  4K7S A;  3TJP A;  3NRZ A;  3E9S A;  2KAJ A;  2EKI A;  1XEE A;  5EE0 A;  2N7J A;  3AE5 B;  3C19 A;  1HQR D;  2K8C A;  4XYC A;  1JQ4 A;  3N1X C;  1N60 A;  5JZE B;  4KZ0 A;  5AUK A;  1OTR B;  2ZPN A;  5HHD G;  3EGR A;  3NS8 A;  3ZGZ A;  1K52 A;  3P1M A;  4CQN A;  2JUO A;  3ZQ4 A;  2G3Q B;  4KIK A;  1WXA A;  1PDX A;  4A3P A;  1WRD B;  2VZK B;  2IPK D;  1N63 A;  2AYO B;  5IO9 A;  3AE8 B;  5J17 A;  2ZJD A;  2J52 A;  1FPY A;  2VZK D;  2GBR A;  2NBU A;  4RM9 A;  3PTF C;  1OFF A;  2AEH A;  1ET9 A;  2NCN A;  4G11 A;  1JRU A;  2KJ6 A;  1L0V B;  2PJH A;  1WI0 A;  5E6N A;  3VVW B;  4O1N A;  1E6E B;  1KH0 A;  3RUI B;  5MPO A;  2LWP A;  2KHW B;  3OG5 A;  4BOS C;  1LFD A;  2KDI A;  2MA9 B;  3BK1 A;  3ALB A;  3W2D A;  1YN4 A;  2Y3A A;  3RPF C;  2WDQ B;  3U4E G;  1UF0 A;  1PYW D;  1FMA D;  1L4Z B;  2CU1 A;  2GRI A;  3I9V 1;  4IDI A;  2BYF A;  2DAJ A;  2BB6 A;  4NJ7 A;  2AQ2 B;  1FIQ A;  2K1F A;  2L3Z A;  2JRI B;  3KH0 A;  3AE6 B;  1EF1 A;  1TY0 A;  4HKZ E;  2AQ3 B;  2ONQ A;  4GDK B;  4IUM B;  2KC1 A;  1E8W A;  1FNV A;  1D4B A;  1V5O A;  4HJG E;  2M1M A;  1D5X C;  3CWI A;  1E8Y A;  1FM0 D;  1Y56 A;  1WGR A;  4EZJ A;  3Q8B A;  4URK A;  1UZX B;  2J0M A;  5IOI A;  3KVF B;  3PZD A;  4WIP A;  1N6Z A;  1QOF A;  3V3X A;  4LJP B;  4MM3 A;  2KMC A;  4HXD A;  2XEW A;  5AZF A;  4C7Z A;  4BOZ B;  1XD3 B;  2C7H A;  1VZ8 A;  4W9C A;  1VRA B;  4N58 A;  4IOI E;  2IJ0 A;  2RDG A;  4IWO A;  2Z0D B;  3W1Y A;  1SE9 A;  2ZPY A;  2J53 A;  3OJ3 A;  3WAP A;  4WH4 A;  3M63 B;  3MC8 A;  4MGZ E;  2LAS A;  4IM0 A;  4WAF A;  4ZHP A;  3VUY A;  1KTK A;  2L8J A;  2V1Y A;  3FKY A;  1WGY A;  3VHT C;  2FUH B;  5HFY A;  2KFK B;  3HHM A;  2ZVN A;  2GB1 A;  5FR6 A;  1AYF A;  2VH1 A;  3TEZ A;  3ML8 A;  1I35 A;  3ZO5 B;  1V8C A;  2D3B A;  2PMV A;  2WX1 A;  3Q8C A;  3Q8F A;  1V2Y A;  3DBH B;  4NAM A;  3VTW A;  2L76 A;  3ZTC A;  3Q8E A;  3APC A;  4OHJ A;  2KWC A;  2IGH A;  1YNT E;  3U2S C;  1V86 A;  1L6V A;  2DX5 B;  1F2R I;  4J3O D;  3GB1 A;  1K8R B;  4HK2 A;  3OWE B;  2W54 A;  1E90 A;  2KQ7 A;  3ZJV A;  2RSU A;  1YIW A;  1BUI C;  1E10 A;  4L2Y A;  3V6E B;  2DBY A;  4YXD B;  4C4V B;  3CSF A;  1N62 A;  2MW5 A;  4RCO A;  1IBX A;  4QAY A;  2MEK A;  1MPE A;  3MC9 A;  3TEX A;  3VTV A;  3EFC A;  3DOW A;  3IBE A;  3N32 A;  2LRU A;  4EE2 A;  3RNF C;  4MGK E;  2QDF A;  2GBJ A;  3ZDT A;  5D3I B;  2L7R A;  4RGM A;  1IGC A;  3DQV A;  3ZJU A;  1ZOY B;  1JWS D;  4E3C A;  3NUH B;  2IND C;  2K6D B;  2R2O A;  3DBL I;  2FAZ A;  4DDI D;  2JQR B;  2KWU B;  4AWJ A;  2Y5C A;  3NZ3 A;  4B0M A;  1STE A;  1TKG A;  1BML C;  1R4M I;  1WGK A;  2JT4 B;  3K9O B;  2GBK A;  2R2Q A;  3P2B A;  3BWU D;  2AL6 A;  1FRR A;  4NAW B;  1S3S G;  1WGH A;  3TBL D;  3RMK C;  3H9D A;  3VTU A;  2PLP A;  2WXL A;  3RNC C;  3GZN I;  4OW0 A;  1YJI A;  2YLM A;  2KJH B;  3VDZ A;  3SHQ A;  3HRD D;  4FHK A;  4M00 A;  1L2N A;  2JY6 A;  2E6X A;  4DXG A;  2OJW A;  4ICU A;  4W9J A;  1NVI D;  2IO2 B;  5H8Y E;  2NTS A;  4A90 A;  3RD2 A;  2G1E A;  1WX9 A;  1KRH A;  1P3Q U;  4PS3 A;  5G5G A;  2OJR A;  5EE3 A;  2HE7 A;  3JSV A;  1X1M A;  2WXP A;  2QCZ A;  1ESF A;  3FC4 A;  2N1W A;  1VCB A;  2QHO A;  4LCD E;  2HTM E;  3A9K B;  2N4F A;  3H7P B;  2Q5W D;  3KYD D;  3PHW B;  2QSD A;  3EC8 A;  1V80 A;  1FXI A;  1M4V A;  2OHF A;  4BKS D;  2LXC A;  2MBQ A;  5C2T B;  2RDH A;  5G55 A;  2LXA A;  3KLS X;  1NBF C;  2XK5 A;  3BII D;  4JWU C;  4WJQ A;  2WXN A;  1I4H A;  2YEP F;  1WJ4 A;  3DWM A;  1R7S A;  3PRP B;  3N3K B;  4FJZ A;  3A1Q A;  4WQM A;  2IO3 B;  1NEK B;  1GPX A;  2Z0E B;  4RGO S;  4W9D A;  5EE9 A;  1C1Y B;  1WR1 A;  4WJO A;  2BB5 A;  4LLG M;  1EWC A;  3Q2A C;  3PRM B;  2PW9 A;  3APF A;  2HD5 B;  2LHE A;  2YEP B;  4ZOH C;  2E3T A;  3AE4 B;  4I6P A;  4N59 A;  3TEW A;  2KTR A;  3N30 A;  3RYT A;  3A33 B;  3AU5 A;  4A8X C;  3HUI A;  2FUG 1;  4IWP A;  1SBB B;  1YX6 B;  2V3S A;  2MLB A;  2MBO A;  4JPS A;  1L7Y A;  3AEA B;  4X57 B;  4RM8 A;  1QZE A;  3SR6 A;  1F0Z A;  5J18 A;  3I3T B;  3DDC B;  5CHF A;  4G50 A;  3AXC A;  3M3J A;  3V61 A;  4ZRP A;  4WWM A;  3R66 C;  1A70 A;  1KF6 B;  2PIA A;  3CST A;  2EEL A;  2DZJ A;  5JHB A;  3BYY B;  4TKN A;  1ZXH A;  2VRR B;  1L5P A;  4AJY B;  1EF5 A;  1E7V A;  4GMV A;  1E5W A;  2DHZ A;  5KHQ A;  4ANU A;  3R7Q A;  2WX0 A;  2V0G A;  1LO5 D;  4FAD A;  2NS5 A;  2MBE A;  2J0K A;  2X8X X;  5DPS A;  1VDV A;  3VUW A;  1VZ6 A;  4JL9 A;  2BWE S;  2D3A A;  4H2A A;  3AEG B;  1TZO A;  1P7E A;  2QC8 A;  5LXI B;  5LXH A;  4WWO A;  3RNG C;  4L1B A;  4FLH A;  1UBQ A;  3WAN A;  3IFW B;  1Z5S B;  2LD9 A;  1R4N I;  1Z2M A;  4P6V F;  2Y5B B;  3ZRF A;  3PO0 A;  1HTO A;  3ABV B;  1RFA A;  1P0R A;  3PHX B;  1GB1 A;  4M0W B;  2H89 B;  2LJI A;  3ZUN A;  1JML A;  3V60 A;  4ASW C;  1N5X A;  3VFK A;  3GOE A;  3R3M A;  2NVU I;  1KLV A;  3RI7 C;  2WQY B;  4Q2J A;  2KLC A;  1J0G A;  3PPA A;  1I4G A;  4A9A A;  1F1H A;  3VAW A;  2D3C A;  3QC8 B;  1C9F A;  3HIZ A;  4OZA A;  1AWD A;  1H4R A;  3QAR A;  1TKY A;  2WDR B;  2FCS A;  1Y8R C;  4LJO B;  1QKZ A;  2JSV X;  5IAA C;  3NS1 A;  1QLB B;  1AN8 A;  1XT9 B;  2KXJ A;  4GGQ A;  4A20 A;  4YTM B;  2CU3 A;  1GAQ B;  3AEE B;  3CIR B;  2KTF A;  2V3P A;  3UF8 A;  1JWA D;  2KWD A;  2WDT B;  1JCK B;  4PYU A;  1E7U A;  3AE7 B;  3A4S C;  1HEZ E;  3TCA A;  4C80 A;  1NDD A;  2LGS A;  2FE8 A;  2MJE A;  3AI5 A;  4B6W A;  3Q3M C;  2RPV A;  4K7U A;  1JRO A;  1J8C A;  1KJT A;  3RCZ A;  2WXJ A;  2KDF B;  4HWI B;  2DWQ A;  2BW2 A;  1KM7 A;  5BO4 B;  1OGW A;  4XC2 A;  3LJ3 A;  4LNF A;  2MJD A;  4GOC A;  4XDD A;  3QWZ B;  3VRB B;  3MJ5 A;  2BPS A;  2WU2 B;  4II2 B;  4RF0 A;  1IYF A;  3Q69 A;  4GDK A;  3E56 A;  4BBN F;  4N9F 4;  1GOZ A;  1CQV A;  2C9W B;  2R61 A;  2XNA C;  2REX A;  5HI1 A;  4ZDV A;  3DHG C;  4YSZ B;  4XDC A;  3OLM D;  1UWM A;  2GOW A;  3B9J A;  1NYR A;  3V6C B;  1T6B X;  1DYQ A;  5H92 C;  4DWF A;  1D5Z C;  3P63 A;  4PK1 A;  1ZW7 A;  2NR2 A;  5BMH A;  1HZ6 A;  1SEB D;  4E74 A;  2LUM A;  4KX6 B;  4PS8 A;  5BYQ A;  2FCQ A;  1KLG D;  1JWB D;  4EZL A;  2FNJ B;  1GJZ A;  3BK2 A;  2BT6 A;  4IG7 B;  3RNA C;  3EA6 A;  2LMC A;  4K81 A;  5C23 A;  3J9C A;  2WXQ A;  1RWS A;  4FHJ A;  1SE2 A;  3PVL A;  3DBL B;  2I1J A;  2RGF A;  4P7I A;  3QHT A;  3NOB A;  1UH6 A;  1GC7 A;  1VJK A;  1R4M B;  3UQB A;  2MSE D;  4KDL B;  3MP9 A;  3QAQ A;  3Q3J A;  4MH0 E;  4MAC A;  4WWN A;  2ZZP B;  2KLG A;  4TMA B;  4L23 A;  4YSX B;  2PE9 A;  5AZG A;  3KUC B;  5JHA A;  5DPW A;  1V49 A;  2PVO D;  2IY0 B;  2MRP A;  2RD0 A;  3PLV A;  3NZS A;  4BBN C;  2IY1 B;  4ZHO A;  1E8X A;  3NVV A;  4BKT A;  1M94 A;  4FJY A;  1E0Z A;  2RR9 A;  1WZ0 A;  1D3Z A;  1BT0 A;  3ECI A;  2NBV B;  3AEF B;  1E8Z A;  1SF0 A;  2B3A A;  2NPT B;  2SAK A;  4S17 A;  2KO3 A;  2JVC A;  4M01 A;  4FXC A;  2CHW A;  2IBI B;  2N9X A;  2LVO A;  4HDO A;  4EEW A;  4WQO B;  3O13 A;  1L6U A;  4AS1 A;  4US8 A;  1BXT A;  4MGY E;  2JZ3 B;  4F8C B;  5C1Z A;  2ACZ B;  3KQ4 A;  1RM6 C;  3AEB B;  2ZNV B;  1CMX B;  2I1K A;  5CHV C;  1UGM A;  2RMM A;  4KIK B;  2KX0 A;  1F77 A;  1QOA A;  1TY2 A;  1WXM A;  4J6I A;  1C78 A;  3ZVV A;  3ETR A;  4YT0 B;  5AZH A;  2C60 A;  4RMA A;  1GUA B;  2IDY A;  2O6V A;  3R2T A;  1Q10 A;  2KAC A;  3LB8 C;  3TUO A;  2C7M B;  3Q8A A;  4NAW A;  2M19 A;  3QJZ A;  3ZLZ A;  3RNB C;  4GDL A;  4DQO C;  2BGF A;  3ZKJ C;  1I42 A;  1I4P A;  1F52 A;  4HCN B;  3FAH A;  3IXS A;  2Z59 B;  3GE8 C;  4IWQ A;  5JXV A;  1WH3 A;  1WY8 A;  2BQQ A;  2FCM A;  3ZNZ B;  1Q1O A;  2K39 A;  4XGA B;  4NY0 A;  1QF6 A;  4A3O A;  3H7S A;  4ZRI A;  1MVK A;  3DBS A;  1ZXI A;  4JGH B;  5CTR C;  1DGJ A;  3SD5 A;  1NI3 A;  3AE2 B;  3DPD A;  3CMM B;  3VQI A;  1E7P B;  4BKS A;  2KOX A;  4IC7 B;  1B1Z A;  1TGZ B;  5LLI A;  3PV1 A;  2INC C;  4EUT A;  3PRZ A;  2M17 A;  1RRB A;  4DBG A;  2M56 B;  2KFJ A;  2W55 A;  2D11 A;  2FBW B;  5G2N A;  2LGI A;  3VXW A;  1VD2 A;  3U7D A;  1OQR A;  4IKG A;  2WXK A;  1V81 A;  4NJC A;  4G3X B;  2MWS B;  2C5L C;  1YN3 A;  1SIF A;  1V1O A;  1IUE A;  1NYQ A;  5D3D A;  1R4N B;  2BF8 B;  3NJT A;  2MP2 B;  3NY5 A;  1WM3 A;  4M8M A;  3UIO B;  3DHI C;  4BFR A;  4II3 B;  2L00 B;  5EE1 A;  4WUR A;  1JWM D;  1KFY B;  3T3N A;  4WJN A;  3FIL B;  1YQ4 B;  3NVW A;  3K9P B;  2NTT A;  1MG8 A;  1DOX A;  2LGY A;  4MT5 A;  5BYS A;  3UQA A;  3KUZ A;  4GU2 A;  1JWU D;  2KC2 A;  1L0Y B;  2O2V A;  1IGD A;  1WWT A;  4GB9 A;  4KKI A;  2WGS A;  1C4P A;  4IW0 A;  2ZCB A;  4WJP A;  3DVG X;  2CHX A;  2K8B A;  1I7H A;  4OVU A;  3ZXV A;  4REZ A;  4F7Z A;  2TSS A;  2M0A A;  5CX3 A;  1K53 A;  1N5W A;  3L54 A;  2D07 B;  2MBB B;  2L83 A;  1NEN B;  2LI5 A;  1YJJ A;  1GNU A;  4XE0 A;  3MJW A;  1LXD A;  3N20 C;  2DNF A;  2L0T A;  2WXF A;  3JVZ X;  1FNU A;  4ANW A;  1JAL A;  3T9L A;  2A5U A;  4S0R A;  4NJ6 A;  1P9D U;  1V1P B;  3ZIM A;  3AV8 A;  5TSS A;  2FCN A;  3P4P B;  2EMT A;  3L4P A;  1V9J A;  2JZZ A;  2WDV B;  3B0A A;  3AMZ A;  4ANX A;  1AW7 A;  2LVP A;  2M0X A;  3PS6 A;  2BS4 B;  5T8I A;  4TQ1 A;  1ISN A;  2DYB A;  3B2G A;  4YL8 A;  5AEK B;  1WXS A;  1WZ3 A;  1MJD A;  1CZP A;  3QIJ A;  4ZYN A;  3ONS A;  2LFI A;  4DDG D;  4G0N B;  3PGE A;  3A9J B;  1WRI A;  1UBI A;  2MCN B;  2DYM A;  3N1Z C;  4GLS C;  3V62 A;  1WIA A;  1EU4 A;  1P7F A;  2QIL A;  3SFD B;  1EUV B;  4TV3 A;  4ZRK A;  1TTN A;  2DYO A;  4CHK A;  2QMT A;  1YX5 B;  3BIN A;  2NBW B;  3NZU A;  3X0W A;  3TMP B;  2XN9 C;  2I2Y A;  1FNW A;  3DVN V;  1QQR A;  1TS4 A;  3TL5 A;  1UD7 A;  2ICI A;  1I4Q A;  3PRE A;  4XWW A;  2JYE A;  3I63 C;  3AN1 A;  1ZDX A;  3BY4 B;  3NHE B;  1EO6 A;  3RNE C;  1C3T A;  4HPP A;  4KZC A;  5L95 C;  2W82 A;  1CK1 A;  4P1B C;  2JU6 X;  1XLQ A;  3C0R B;  1HXY D;  4KSK C;  1XLP A;  3Q3F A;  3O65 B;  4DK5 A;  1WM2 A;  2BYT A;  1MHH E;  3ZNG C;  3W1S C;  3DVN U;  3R8B A;  4XX5 A;  4XZ4 A;  2PVG C;  4ZRJ A;  1HA5 A;  2IGG A;  5JH5 C;  4K7W A;  2L1A A;  2VH2 A;  3QCA A;  3P42 A;  3B08 A;  2W3S A;  1EU3 A;  4HPL B;  2PEA A;  4MEM A;  2PPH A;  2JX5 A;  2QEJ C;  3R2I A;  1RLF A;  5DPT A;  3A1Q B;  3JW0 X;  3LYY A;  4MDK E;  5TR5 A;  3L16 A;  3SDL C;  4NZL B;  3URY A;  3VH3 B;  1UWX A;  2WYQ A;  3SFE B;  4HCP B;  5AUI A;  2FID A;  2KTR B;  2MQJ A;  1WF9 A;  3WCQ A;  1DOY A;  4C7Y A;  1K50 A;  5J2R A;  1XF5 L;  3DHH C;  2J4X A;  4P1C C;  1WE6 A;  1QIL A;  2IYD B;  1FCC C;  2BWF A;  3QQ8 B;  3B2F A;  2CKH B;  4FA6 A;  3AEC B;  3Q14 C;  2JPH A;  2N7E A;  2HTH A;  2KK8 A;  4MSQ B;  1JW9 D;  4JE3 B;  5GMV A;  1WXV A;  1T0Q C;  1YQ3 B;  3PZ7 A;  3BVG A;  1XXG A;  3NG0 A;  3N9Y C;  2WXI A;  2X38 A;  2J0J A;  4A6Q A;  2QIE B;  2WXG A;  1Q5W B;  2IO0 B;  2XBB C;  3N1Y C;  4LNI A;  4W9H A;  1UUP A;  3Q3O C;  4JIO U;  1FXA A;  2DLB A;  3WIM A;  4KSL C;  1WJ6 A;  1T3Q A;  1ACC A;  4HVB A;  4KGT A;  4W9K A;  1MFW A;  2EMS A;  3QA8 A;  1T5X D;  4FBJ B;  1MI0 A;  3U8Z A;  2UU7 A;  3VR9 B;  1UGJ A;  4MJS B;  5LNK 1;  1C79 A;  2LGX A;  3WAL A;  3T8M A;  3VH4 B;  4WAA A;  3PZ8 A;  4ZRQ A;  2KDB A;  1TIF A;  1HZ5 A;  4RH6 A;  1FO4 A;  2BS3 B;  2HDE A;  1L4D B;  4N6E B;  1TJE A;  2BS2 B;  2NPT A;  5FR3 A;  1WYW B;  4HEA 1;  3KYC D;  3GP7 A;  1WFY A;  2KVZ A;  3MHS D;  3TSS A;  3IG3 A;  3ZNI D;  1ZKH A;  4KKJ A;  3UI3 A;  2D10 A;  3IHP C;  4LNK A;  3DBR I;  1WGG A;  3UGB B;  2N0S B;  4JX1 C;  2ZW0 A;  1PUT A;  3IAM 1;  2KKC A;  2WNM A;  4BVU C;  3ZW3 A;  1QOB A;  1SE3 A;  1SIJ A;  1TYG B;  1ZPS A;  4B9K A;  2MX2 A;  1WGD A;  4NQL B;  3EUB 2;  1XCQ L;  3VRA B;  1ROE A;  2KFK A;  1VR9 A;  1WJN A;  4OZC A;  4B0E A;  2KN5 A;  2K9X A;  4YWG G;  1HTQ A;  4W9I A;  3KW5 B;  2LGD A;  2D3G A;  4C56 C;  2JWZ A;  1MHX A;  3L08 A;  3ENE A;  2I38 A;  1ZP0 B;  3PLU A;  1A5R A;  1WMH B;  5HG2 A;  4EZK A;  1XO3 A;  2LHD A;  4LK0 M;  1SB3 C;  2MHJ A;  4EFO A;  1I4X A;  1B9R A;  2KN4 A;  1CJE A;  3NVY A;  4ARC A;  3GZN B;  3RFZ B;  3QX1 A;  2MJ3 A;  4IM2 A;  4W9F A;  4C00 A;  1F2R C;  4HKQ A;  4DHJ B;  5IKC M;  2JF5 A;  2LRW A;  1C77 A;  1LQB A;  1OQQ A;  2KYW A;  1J7C A;  3HM6 X;  4W9G A;  2N9L A;  4DHZ B;  5FK9 C;  1JRP A;  4MGI E;  4DHJ D;  1TT5 B;  4HRO A;  4C4V A;  4I6N B;  5D7G A;  3S2A A;  3WAM A;  3ML9 A;  2DZK A;  1ZGU B;  2BVC A;  3EHV A;  2CJN A;  2G4D B;  2GBM A;  1Q0W B;  1DOI A;  2W9N A;  3EFU A;  1RFK A;  4YTP B;  1XLO A;  2B76 B;  3KWV A;  1L0X B;  1F9J A;  3AE3 B;  2RDB C;  1J7A A;  3M62 B;  4W9E A;  1WSP A;  2MH7 A;  1T0R C;  2CJO A;  2QJL A;  1QOG A;  1V5T A;  4RGT A;  3TIX A;  2V4L A;  2MP2 A;  1TS5 A;  4FN2 A;  4KGR A;  3AED B;  5G5H A;  2HJ1 A;  2LVQ A;  1FCL A;  1SSN A;  3FIL A;  1VLB A;  2FIF A;  5DCN A;  1UEL A;  3SU8 X;  4ICV A;  1KLU D;  4HPM B;  1PGB A;  2WU5 B;  2NMQ A;  1UNS A;  2PE6 B;  3WAO A;  4F1S A;  3KUD B;  3U52 E;  2KJR A;  3HVZ A;  4KV2 A;  4FUL A;  4OVV A;  2AX5 A;  2KWV B;  1TBE A;  4MEL A;  1K51 A;  3I57 A;  4RFB A;  3DCG A;  3ZYY X;  3B1L X;  2DAF A;  2KZR A;  5IP4 D;  3RN9 C;  4K3B A;  4KVG B;  3LXF A;  3CF6 E;  4JWS C;  1SXT A;  4OVZ A;  3Q6B A;  1OQY A;  3BVZ A;  4GN1 A;  2BYV E;  5BYR A;  4D2K A;  2N9E B;  3A9K A;  5BMI A;  3AUL A;  3H7P A;  2KX3 A;  2KT7 A;  4LTU A;  2INP E;  2GMI C;  2WHI A;  3RZF A;  3UIN B;  2ZNV C;  1EWY C;  2AQ1 B;  1I4R A;  4MSM B;  1V1P A;  4JQW C;  2G9H D;  1C4C A;  1FRD A;  2LZ6 A;  1ZUD 2;  3W1S A;  4ACF A;  4MM3 B;  3HVD A;  1SGH A;  1WX7 A;  3JYU A;  1H8C A;  2KQ4 X;  2JWU A;  1PGX A;  2K22 A;  3M95 A;  4US9 A;  4GSW A;  2DZI A;  2K5P A;  2WS3 B;  2KD0 A;  5D6J B;  3P4S B;  2CHZ A;  4E71 A;  3A9J A;  5IA7 A;  2N9K A;  3R7R A;  3T3O A;  2DEN B;  2EKE C;  2KNB A;  4HLE A;  2OOB B;  2JRH A;  2LUE A;  2WP9 B;  1TZ1 A;  4EKU A;  4HJK A;  1ENF A;  1XCT L;  2JXX A;  5FKA C;  2O6V B;  2ZVO A;  1GC6 A;  4ITK A;  4KDI C;  1QT9 A;  1PFD A;  2V4I B;  1SE4 A;  3SEB A;  4W9L A;  4GDL B;  1FFV A;  1KOT A;  1J7B A;  3L13 A;  4TUU A;  4AOF A;  1MG4 A;  1G6J A;  2Y5P A;  5L83 A;  3RT3 B;  2O6V D;  4IM3 A;  1FXT B;  2PKO A;  1N61 A;  1YMH E;  4NQK E;  4BZA A;  1WXQ A;  3OAW A;  2K6Q A;  1C4A A;  5HKH A;  1GB4 A;  1FD6 A;  3WA0 A;  3VUX A;  1XQQ A;  4JLC A;  3KWL A;  3VR8 B;  3I5J C;  2KDE B;  1TKE A;  2HJ8 A;  5E6P A;  3ZDM C;  2KVR A;  3PSE B;  2L32 A;  4LNN A;  1V97 A;  4CYE A;  3W5V B;  1IBX B;  2OED A;  1SJE D;  1ZDV A;  4M0W A;  1PGA A;  3L10 B;  4RNA A;  4NNJ B;  4AQ7 A;  2G4S A;  4PT5 A;  3IT6 B;  2GBN A;  4PS7 A;  4FJV B;  3IVF A;  3MFG A;  1D5M C;  4PYZ A;  2J7Q B;  4UDU C;  4I6L B;  5D2M B;  5C3J B;  3X23 A;  1GG3 A;  2M4N A;  1P1A A;  4DHZ E;  3ZXR A;  3H6N A;  1T0Y A;  1FEH A;  3DVG Y;  4AUQ C;  1WJU A;  4GXB A;  2INN E;  2MBH A;  3BVM A;  5CHW A;  5E6O A;  4K1R B;  2D2Q A;  2M8S A;  5I4D A;  3MC0 B;  2L0F A;  2KMM A;  1YN5 A;  3NVZ A;  3DBH I;  2N7D A;  2L52 A;  2C7N B;  2WXM A;  1V6E A;  3BYT B;  3P4R B;  4KGS A;  4LDT B;  4ANV A;  2GLS A;  1T0S C;  4BAX A;  2W3R A;  4CO7 A;  4NPN A;  4LNO A; 
#chains in the Genus database with same CATH homology
 2KT7 A;  4M00 A;  2KYW A;  4M01 A;  4M02 A;  2KVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...