2KYWA

Solution nmr structure of a domain of adhesion exoprotein from pediococcus pentosaceus, northeast structural genomics consortium target ptr41o
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
87
structure length
87
Chain Sequence
MDEDATITYVDDDKGGAQVGDIVTVTGKTDDSTTYTVTIPDGYEYVGTDGGVVSSDGKTVTITFAADDSDNVVIHLKHGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesion exoprotein
publication title Solution NMR Structure of a domain of adhesion exoprotein from Pediococcus pentosaceus, Northeast Structural Genomics Consortium Target PtR41O
rcsb
source organism Pediococcus pentosaceus
molecule tags Cell adhesion
total genus 17
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06458 MucBP MucBP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.320 Alpha Beta Roll Ubiquitin-like (UB roll) Putative peptidoglycan bound protein (lpxtg motif) 2kywA00
4M02A 2KYWA 2KVZA 4M00A 4M01A 2KT7A
chains in the Genus database with same CATH superfamily
1DYQA 2ICIA 1EWCA 3C19A 3FAHA 2WQYB 3FKYA 3NY5A 2RDBC 3GB1A 3P42A 3PVLA 3APCA 3SEBA 4FHJA 4MT5A 1GG3A 2N4FA 3V6CB 1WXMA 4MGZE 2AX5A 1WGRA 3PS6A 3Q8FA 2FCQA 1UNSA 4URKA 3AEBB 3DCGA 2PTLA 2L05A 2BQQA 4P16A 4DXFA 4XC2A 1LQBA 2PIAA 1V5TA 1PUTA 4RGTA 4TSSA 2M19A 1V97A 1PGBA 2EKIA 2REXA 2RDGA 4IG7B 3APDA 4I6NB 2LRWA 3ZRFA 1MJDA 3AI5A 3H7PB 3A9JA 4A3PA 2KO3A 3LB8C 3NJTA 3QA8A 4HROA 3Q2AC 1D4BA 1FXAA 2K9XA 2WDRB 3PV1A 1S1QB 2L32A 5JXVA 1QLBB 1E8XA 4W9JA 4JGHB 2JSVX 4BBNF 2JQRB 4DK5A 3VXWA 1SE4A 3AE4B 4FULA 2NPTA 4XZ4A 4ARCA 2JXTA 4TQ1A 4IUMB 2J7QB 4US9A 1Z2MA 2VH2A 2LZ6A 2N1VA 1HTOA 1L6UA 4XYCA 1OTRB 2V3PA 1N63A 3VQIA 2FUG1 5IAAC 3ZTCA 2IBIB 3M62B 3P2BA 5EE1A 4M8NA 3I9V1 4W9HA 1MG8A 1L5PA 2DAFA 1EF5A 3VRBB 1HZ6A 3RZFA 2PKOA 1JRUA 1UF0A 1LGRA 1YN4A 2KN4A 2XK5B 3A1QB 4EZJA 1ESFA 3WAOA 1MHXA 5KHQA 1DGJA 4FN2A 4B6WA 2GBMA 4WAFA 3RNBC 2YVCA 4JPSA 1WR1A 4K7SA 1WX8A 3RFZB 2YLMA 4Q2JA 1R4NI 2INCC 1FCCC 2AEHA 4F7ZA 2KK8A 3L10B 2KC2A 3QAQA 4RH6A 3BINA 1I42A 3TEXA 3VFKA 2KJHB 5LNK1 2DNFA 1RYJA 4C4VB 4RMAA 3NZUA 4GOCA 2GOWA 2HJ1A 4NJCA 1SXTA 3L4PA 1XD3B 1VJKA 2B3AA 3E56A 3EFCA 4P7IA 1WX7A 4ZRJA 3BVGA 4NQKE 3ZDMC 2JZZA 3RPFC 2KANA 2KOXA 2INPE 5E6JA 4BOZB 2UYZB 2LVQA 1Q1OA 4GXBA 2QCZA 4MGIE 4PYUA 2MH7A 2AQ1B 1P3QU 2JT4B 3SDLC 3KW5B 2WDVB 2JWUA 3DBLI 1E0ZA 4LNOA 5JH5C 2RD0A 3HM6X 4DDGD 1UWMA 1AYFA 2WU5B 1UELA 2W55A 4YSXB 3P4SB 4KSKC 4AWJA 4ITKA 1F9JA 2C5LC 2FCMA 5DPRA 2M4NA 3OWEB 3HIZA 5D6JB 3AE1B 3EUB2 4OVZA 3X0WA 1RRBA 2K8BA 2WXLA 2MQJA 3TIXA 3NVVA 3N3KB 1FIQA 2IYDB 2R2QA 2Y5CA 1WI0A 3V3XA 2AWTA 4H2AA 2ZZPB 2DENB 5C2TB 3AU5A 4MSMB 3WIMA 4GDKB 1TJEA 2LD9A 2KTRA 3P63A 2BYVE 1UBQA 4GU2A 1TY2A 2MCNB 5DCNA 4DHZB 2NS5A 2W3RA 2LHEA 1NI2A 1JWBD 2LUMA 3JVZX 1TS5A 2QSDA 4C7YA 1NDDA 3DVGY 3VUWA 3KYCD 1KLVA 2MWSB 2KZRA 1UWXA 5CHVC 4HCPB 3GS2A 1QF6A 1TGZB 3NHEB 4CYEA 1RAXA 3TL5A 2UWQA 1WGHA 2GBNA 3MHSD 1NVID 1WJUA 4IKGA 1YD8U 1SE2A 3ZLZA 2MBEA 2PLPA 1P98A 4KX6B 2MHJA 4M01A 1T5XD 3BVMA 3NRZA 2M8SA 3NZ3A 2HD5B 2J0KA 1WY8A 2QJLA 4LDTD 3TJPA 3DVNV 1P7EA 1WE6A 4NQLB 2C7NB 1T0RC 5G5HA 1T0SC 2BPSA 2Z8LA 2BKFA 1JWUD 5BMGA 1WXVA 3Q8BA 3NVWA 1WR6E 4LNNA 2EKEC 2WDTB 1ISNA 2M1MA 4WJQA 1FNVA 3QJZA 3ZNHB 1XF5L 4IW0A 2WHIA 3N20C 4KDIC 3L16A 4HPMB 2W54A 3VR8B 3TMPB 5EE9A 5EE3A 1V1OA 3B2GA 2BGFA 2HE7A 2FAZA 3IAS1 1WXAA 1HZ5A 1V8CA 1WGDA 4FA6A 2V4IB 1RFAA 3DVGX 3KLSX 4N58A 2WXFA 2HTHA 2RGFA 1MHHE 5J18A 4HEA1 2M0AA 1R4NB 4FLHA 2DZIA 3AEEB 2O2VA 4NAWA 4E74A 4II3B 5G55A 3U7DA 4FBJB 1ZDVA 3EHVA 5KHOA 1C76A 2KXJA 1PDXA 1KFYB 1ZDXA 2V1YA 4KKIA 1AWDA 1IGDA 2RPVA 4N59A 4AOFA 1TTNA 1HA5A 1FFUA 4G3XB 3ZDTA 4YWGG 3ZW3A 4FJVB 4YT0B 2O6VA 5GMVA 3PREA 3DWMA 1VD2A 3DBLB 4B95A 2LGIA 4K81A 5IO9A 2YEPF 2RDHA 1L4ZB 2MP2B 4K3BA 2KWDA 2N9KA 4A9AA 4WAAA 1JWMD 1J19A 3T3NA 3A4RA 1UD7A 1WE7A 2NBUA 1E90A 5DPSA 1K50A 2BW2A 2LASA 2L76A 2V4LA 4ZHPA 2FCSA 2KQ4X 3RCZA 2NTTA 5IOIA 4RGOS 1IBXB 2B76B 4BZAA 3QWZB 1OFFA 4FADA 1L7YA 2KT7A 5E6PA 4LK0M 4MSQB 2KDEB 1F2RI 2MEKA 1YQBA 3EC8A 4MGYE 4KIKA 5E6NA 1AN8A 5D3IB 5FKAC 2WXKA 5JZEB 1WYGA 3ZXRA 1HQRD 3BWUD 2L8JA 2GRIA 2ACZB 1FFVA 1SEBD 2GB1A 1I4RA 5AUIA 4BAXA 4IWPA 5JHBA 3UINB 4BKSA 1C77A 2QEJC 4LNKA 3W1SC 1HE8A 1K53A 2K8CA 1XCTL 1N60A 3CIRB 3E9SA 1BT0A 1EU4A 3ABVB 3AE3B 5AUKA 3RN9C 3SR6A 2WXHA 2QHOA 1KLUD 4I6LB 4O1NA 4F8CB 3Q8AA 4M0WB 2DBYA 3SU8X 3GZNB 4WJNA 4C80A 1RM6C 1I4HA 2WXRA 3PTFC 3AMZA 2NMQA 2WP9B 3KUCB 5TR5A 1EO6A 4DHZE 1Q5WB 2OJWA 2O6VD 1B9RA 2L7RA 3NVYA 3ZNZB 3Q3NC 2D3GA 3A9KB 2M56B 4XE0A 1SSNA 2PPHA 2WNMA 3RT3B 1E8YA 1TZ1A 2DAJA 1CJEA 2I38A 3OJ3A 2E3TA 2D5GA 4G11A 1V1PB 1H4RA 3R7QA 4M00A 3BYYB 1OEYJ 1WJ6A 3HUIA 3AEGB 1DOYA 4B0EA 1T0QC 3URYA 2D07B 3CMMB 1B1ZA 1FRDA 2C9WB 4WJPA 4WWOA 4HWIB 3R2TA 4A3OA 3ETRA 1VZ7A 3KH0A 3T9LA 4DHJB 1XLOA 1I4PA 2CJOA 5EE0A 4FJYA 2KX0A 3PPAA 4K7WA 3BIID 2KMAA 2KD0A 3PRPB 1YX5B 2DWQA 3DHGC 3WCQA 3TEWA 2Z0DB 2JPHA 2LXAA 1I7HA 4JIOU 1C1YB 4W9CA 3PLVA 3AH7A 2K1FA 4UDUC 2V0GA 2Z0EB 2BYEA 3JSVB 4MH8A 4NAMA 3RYTA 3B08A 4PS7A 1SB3C 1ZW7A 4REZA 3CSTA 1LM8B 3VUYA 4DWFA 3AECB 2TSSA 1PYWD 2DZJA 2WXJA 4XDDA 3U2SC 1GUAB 4US8A 4JL9A 1C4PA 3ZJVA 1QKZA 1XO3A 1NBFC 2N9XA 4NY0A 4RGMA 4TKNA 1HTQA 3T3OA 3HVDA 1EF1A 1V5OA 3IFWB 2VRRB 2ONQA 1WMHB 3AM9A 1MVKA 3H7PA 2D2QA 4PK1A 1C79A 1IUEA 1FM0D 2E6XA 5AEKB 5BYQA 2WLBA 3H7SA 2JF5A 5D3DA 3ZRCA 1HXYD 2BS2B 5L83A 4EZLA 1XLNA 1OQYA 3RULA 1SIJA 4YSZB 4RGNA 1N62A 2WXOA 3QQ8B 3VRAB 3MC0B 1VDVA 2G4DB 3N32A 3Q3MC 3PZDA 4KGTA 4GN1A 1IP9A 4A6QA 5HKHA 3B0AA 1JCKB 1QILA 2KNBA 3V05A 5C23A 1JWSD 3PSEB 1VLBA 4DHJD 2GLSA 2XK5A 3A1QA 2N0SB 3AE2B 4ANUA 2ZEQA 1QZEA 3V6EB 1JQ4A 3NUHB 1YQ4B 2J53A 3BZDB 1K52A 4W9FA 1VZ8A 4LJPB 2D3CA 3ENEA 5FR6A 3KWVA 5CX3A 1ZGUB 2CHWA 2CHXA 3AULA 1BMLC 2K0PA 2MW5A 1FCLA 2FIDA 5H8YE 1CMXB 1F2RC 2YEPB 4HVBA 2GBRA 4C4VA 2M17A 2IJ0A 3ZJUA 2CHZA 4YTPB 2X8XX 4HDOA 4G0NB 4ICVA 4MM3B 2BKRB 1SF0A 1J0GA 4TQ0A 2DYBA 1OQQA 4G50A 2MBBB 5L95C 1GJZA 4M8MA 4LDTB 3OG5A 3DBHI 4DXAB 1A70A 1PQSA 3ML8A 4M02A 1PGXA 3TEYA 2ZVOA 2L0TA 5BYSA 2KN5A 2QC8A 4PYZA 1XQQA 1GAQB 1D5XC 1XXGA 3DBRI 2ASQA 4WQOB 2LMCA 3CSFA 4W9LA 2N7DA 2J52A 3OAWA 3VTVA 5MPOA 1L4DB 1TKEA 2JRIB 4S17A 3ZTDA 5CHFA 1A5RA 3VHTC 1F77A 3NS8A 1KH0A 1TBEA 3N1ZC 2GBKA 3W5VB 4NPNA 2VZKD 4A90A 2HDEA 2KQ7A 2RSUA 4KGSA 5IN7A 5D94A 4LNFA 3RI7C 1LO5D 1ZKHA 4HXDA 3DVNU 2KTRB 2J0JA 2JZPA 2WXIA 3KUZA 4C00A 2W82A 3IG3A 1MPEA 3QIJA 2G9HD 1WXSA 2K8HA 5LLIA 4ZRPA 4WWPA 1TY0A 2DZMA 4YTNB 2EELA 3ZIMA 1NENB 3MJ5A 2CU1A 3A33B 1FO4A 2J42A 2NBVB 3CF6E 3KUDB 3PRMB 3IT4B 4N9F4 3ZGZA 3J9CA 4KVGB 4XWTA 2GI9A 2PVGC 1FPYA 2BVCA 3EA6A 4WH4A 2KFKA 4N6EB 4AUQC 5T8IA 1P0RA 3C8YA 3ZKJC 1J7AA 1J7CA 1TYGB 5FR3A 3ZJTA 2I2YA 2BS3B 1WJ4A 4DXGA 2LGDA 3MJWA 3RUIB 3VR9B 4W9KA 5DPTA 3S2AA 1NYRA 5EDSA 3PO0A 1SJHD 1EU3A 3EECA 4ICUA 2IY1B 1WM2A 5LXIB 1GC7A 4RM9A 1BXTA 2MJDA 4BKGA 5GXGB 2FUHB 3V61A 2WDQB 2KDIA 1JW9D 5BMIA 2BB5A 2W3SA 3AN1A 5CTRC 2KFJA 1ZOYB 2LJIA 3I5JC 3KWLA 1YX6B 1TT5B 1JWAD 1SGHA 3FILB 1E7UA 3M3JA 5J2RA 3MFGA 3N30A 1Z5SB 1FXTB 2AYOB 4CO7A 3QARA 1C3TA 4ZOHC 3ZNID 4KZ0A 5E6OA 5H92C 1K8RB 3DQVA 1ACCA 2WX1A 2WXPA 1X1MA 1V49A 4CHKA 2EMTA 2FE8A 2J4XA 2KWVB 3UQBA 3ZNGC 2O2VB 3R3MA 5G2NA 4ANVA 2N9LA 5TSSA 1WJNA 1SBBB 4IOIE 2C7MB 3T8MA 4W9DA 3H1UA 2LVOA 2NBWB 2JU6X 4W9IA 2KWCA 2ZW0A 2ZJDA 5I4DA 4I6PA 1WM3A 1TS3A 3Q8EA 5HFYA 3IAM1 3NVZA 4II2B 2BS4B 1WXQA 3Q69A 3WANA 3DBHB 2WS3B 1J8CA 1E7VA 4OZCA 2LGSA 4JLCA 4PS8A 2O6VB 4XX5A 2IO2B 4MEMA 4DDID 2SEBD 3B9JA 3DBRB 2KQSA 2MP2A 3PLUA 4DBGA 1IYFA 1YMHE 3K9PB 2G45B 1OEYA 2D3BA 3Q6BA 1YOVB 4KDLB 3W1SA 2KLGA 4HKZE 2MSED 2K25A 3H8HA 1N61A 3HVZA 1IBXA 2CJNA 4BBNC 1YN5A 2FCNA 2KTFA 2PEAA 5CHWA 3AE9B 3ZXVA 2H89B 4NNJB 1D5MC 2CS4A 2K39A 3HHMA 1N5WA 4KIKB 3DBSA 2DZKA 4HK2A 2JX5A 2FNJB 1KTKA 1C4AA 1TKGA 4NZLB 4ZYNA 1HEZE 2BBCA 2INNE 1YJ1A 2FBWB 3PGEA 4USAA 2ON8A 2INDC 4EFOA 1ROEA 4JWUC 1G6JA 1GB4A 3ZUNA 2D11A 1S3SG 2WXNA 1LFDA 2MBOA 3N1YC 3RNEC 3HM3A 1YN3A 4IWOA 3BK2A 4MJSB 3Q3OC 2ZNVC 4CQNA 2AQ2B 3BYTB 2XEWA 3R8BA 2BF8B 4OHJA 1DOIA 1ZXHA 1ET9A 3NOBA 1E8WA 1ZP0B 4MH0E 3P4QB 2RR9A 2MA9B 4GDLB 2IGHA 1YQ3B 2KJRA 1IPGA 4WJOA 3N1XC 3RNGC 2AQ3B 1V81A 2L00B 3TBLD 1LXDA 1F0ZA 1JRPA 3NS1A 1YJIA 2G4SA 2N9PC 1WZ3A 2LVPA 4WWMA 1H8CA 2KC1A 4WIPA 4P1CC 2AL6A 4ZRIA 3JW0X 5HG2A 1TZOA 4ZRQA 3VTUA 3OJ4B 4YXDB 2LI5A 5FK9C 4OVVA 1QOAA 4ZYSA 1FNWA 1WGYA 3UQAA 3H6NA 3VUXA 4LTUA 1ZE3D 4S0RA 1V1PA 3DDCB 2MBQA 4K3CA 1EM7A 4W9EA 1KRHA 3UGBB 1L6VA 1V2YA 4AJWA 3RNAC 1SE9A 2ZCCA 2AL3A 4KGRA 4L2YA 3ECIA 2K6QA 2BT6A 2L52A 1UGJA 1QT9A 1ZXIA 2GMIC 3LYYA 1FXIA 1L0VB 2KX3A 4IM3A 4BKTA 2EMSA 2HTME 1Q10A 2MRPA 4EKUA 1VRAB 4P6VF 4BKSD 1ZPSA 2OEDA 4NJ6A 1WWTA 2KDMA 1KOTA 3JSVA 1STEA 4PS3A 1U4AA 2Y5PA 3MHZA 3WA0A 2N7EA 2JYTA 3PHXB 4QAYA 3AE8B 4ARIA 1UGMA 1WZ0A 3I63C 1M94A 1RLFA 1TKYA 1D5ZC 3P1MA 1WF9A 1XCQL 2WYQA 3IBEA 2LUEA 3V60A 4D2KA 1K51A 2Q5WD 2KKCA 1PFDA 3A9JB 1F1HA 2LHDA 3AV8A 3MTNB 1YNTE 1F52A 3UF8A 1GB1A 1WMHA 2GBJA 3HK0A 3AEAB 1FNUA 1I35A 2JWZA 3D32A 3IHPC 3ONSA 3W2DA 4OZAA 2W9NA 3GE8C 2NPTB 1I4XA 3VVWB 2X38A 3QHTA 2CKHB 4AP4C 4JWSC 4GGQA 1C78A 1ZUD2 3GP7A 1TS2A 1XLQA 2WWZA 1M4VA 4GB9A 3BY4B 1KF6B 4WWNA 4YSYB 1MFWA 2VZKB 1JROA 3PHWB 1E9MA 2M0XA 2ZPNA 1UUPA 3P4PB 3TSSA 2JY6A 2NCNA 3TEZA 3O65B 4E71A 1XEEA 1SE3A 2NR2A 4LLGM 3TCAA 3H9DA 4JE3B 3L13A 1ENFA 4OVUA 2IY0B 1I4GA 4WQMA 4RF0A 3AXCA 2OJRA 3QK0A 3PT2B 1V86A 3P4RB 4ACFA 3SFEB 4E3CA 4EE2A 4GLSC 2LGYA 4RNAA 4K7UA 4YTMB 3WALA 3LXFA 4MELA 1KM7A 3QC8B 1UH6A 5JHAA 4XGAB 5BMHA 3PZ8A 4A20A 1NEKB 1WIAA 4LCDE 2BWFA 2KVRA 4GSWA 1FD6A 1TIFA 3GE3C 3AE6B 2WXQA 5C3JB 3BK1A 4F1SA 4L23A 2QILA 5G5GA 4MM3A 1WGGA 3A4SC 4OW0A 1R7SA 2WX0A 3W5UB 2XN9C 4IM0A 1AARA 1YJJA 4MGKE 2CR5A 3IXSA 4AJYB 2LFIA 5BO4B 2UU7A 2BYTA 5AZGA 5BYRA 4ZRKA 4YL8A 1WSPA 3QX1A 3OLMD 1SIFA 2IPKD 2KDFB 1D3ZA 1MG4A 2KLCA 2IO1B 2LXCA 2KMCA 4TUUA 2KAJA 3M63B 2DX5B 1D6EC 1VZ6A 1ET6A 1QOGA 2N9EB 4PT5A 5J17A 3UI3A 2LWPA 1UBIA 3AE5B 1GC6A 4EUTA 1FMAD 1Y8RC 4GDKA 4HLEA 4ASWC 2JVCA 2HJ8A 1WRDB 1C4CA 1R4MI 4XDCA 3RD2A 2PJHA 1GOZA 4KKJA 2MJ3A 4X57B 3WAPA 4A55A 4EEWA 4OZBA 2KVZA 4C7ZA 1IGCA 2JUOA 3U52E 3SFDB 2OOBB 2L1AA 2DYOA 1E8ZA 1I4QA 3ALBA 1PGAA 3R66C 2PE9A 1EWYC 3APFA 2WGSA 4ZHOA 2A4ZA 1Y56A 3V62A 1L0XB 4L1BA 2IO3B 4FHKA 1GNUA 3AB5A 3KQ4A 1FRRA 2LEKA 4ANXA 4AQ7A 2MX2A 4IC7B 2R61A 3SD5A 1CK1A 2OHFA 2K6DB 1XT9B 3TUOA 1C9FA 2KWUB 2DYMA 3ZYYX 3Q3JA 5IKCM 2JYEA 3DPDA 3HRDD 3M95A 1TS4A 1RWSA 2JZ3B 2L0FA 1FEHA 4MACA 4AS1A 1YIWA 4HKQA 2G3QB 2KFKB 1WFYA 2KACA 3DWGC 3N9YC 3GZNI 3VTWA 1V6EA 2N1WA 1N6ZA 4MDKE 1WYWB 4IM2A 4HCNB 1E5WA 4NJ7A 3Q3FA 4FJZA 3B2FA 3ZO5B 3W1YA 1E7PB 3L17A 2PVOD 1OQRA 2BYFA 3PRZA 4P1BC 1RFKA 2BTEA 3MC9A 3L0WB 1E10A 3RNFC 2JRHA 1WRIA 2PW9A 2FIFA 3NG0A 1L2NA 4LJOB 2NTSA 3AE7B 2IGDA 2ZVNA 2A5UA 5IP4D 4B0MA 2N7JA 2V9HA 1V9JA 3FILA 4LNIA 3GOEA 2KHWB 2PE6B 1P1AA 3IT6B 1T6BX 1DOXA 4HPPA 1N5XA 5DPWA 3R2IA 2D10A 4GMVA 1EUVB 1QQRA 4NAWB 3LDZE 2D3AA 2LJ5A 1JMLA 4K1RB 3VH3B 2ZPYA 1P9DU 2QDFA 1MI0A 4KZCA 3VAWA 4J6IA 3C0RB 2XBBC 1QOFA 3WAMA 1T0YA 2SAKA 4ZDVA 3U4EG 3B1LX 2R2OA 4A8XC 3UIPB 4BOSC 4RFBA 3RMKC 3SHQA 5HI1A 1SJED 4J3OD 2IGGA 3AEDB 1T3QA 4KV2A 2KJ6A 4JX1C 5D2MB 2WXMA 1KJTA 5AZFA 3Q8CA 2NVUI 4HRSA 1OGWA 2IO0B 2MJEA 2L3ZA 1Q0WB 1QOBA 2V3SA 2G1EA 4HPLB 4BFRA 3R7RA 1L0YB 2QMTA 3ZVVA 4ANWA 3PZ7A 2RPQA 4IWQA 3AU4A 4B9KA 3L08A 2ZNVB 2IZVB 3U7ZA 4FXCA 1CZPA 3K9OB 1XLPA 3DHIC 1VCBA 5LXHA 3I3TB 1P7FA 1NI3A 2Y5BB 4TMAB 1J7BA 3ML9A 2Z59B 3X23A 2I1JA 2K3UA 4EZKA 4WURA 2KYWA 2H88B 3QCAA 4HDQA 4DQOC 4JQWC 3LJ3A 3RZWC 2VH1A 4C56C 1R4MB 1CQVA 3U30A 3IVFA 2ZCBA 3I57A 1WH3A 1WGKA 3KYDD 4HJGE 2L83A 2RMMA 3VDZA 1JALA 3CWIA 2BWES 3VH4B 2C7HA 3RNCC 2KMMA 2QIEB 2JXXA 2IDYA 3NZSA 1E6EB 4MJSA 3Q14C 2I1KA 3DOWA 3EFUA 4TV3A 4IDIA 2ZW1A 1V80A 3AEFB 5AZHA 1WX9A 4HJKA 3UIOB 5IA7A 5HHDG 4KSLC 4EOYA 2PMVA 2BB6A 2MBHA 3FC4A 2K22A 4M0WA 1GPXA 2WXGA 4GDLA 2C60A 1KLGD 4RCOA 1AW7A 4R3DA 4GIVA 2DLBA 2MLBA 1VR9A 3BVZA 3MC8A 3ZQ4A 2WU2B 3W9CB 1NYQA 2V3NA 4RF1A 3A9KA 4RM8A 3DHHC 2J0MA 1UZXB 3KVFB 3U8ZA 4W9GA 2LRUA 4XWWA 3EGRA 5C1ZA 3MP9A 2DHZA 1BUIC 4BVUC 2KDBA 2LGXA 2CU3A 3JYUA 2K5PA 3L54A 3O13A 5D7GA 2XNAC 2Y3AA
chains in the Genus database with same CATH topology
4M02A 2KYWA 2KVZA 4M00A 4M01A 2KT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M02 A;  2KYW A;  2KVZ A;  4M00 A;  4M01 A;  2KT7 A; 
#chains in the Genus database with same CATH topology
 1DYQ A;  2ICI A;  1EWC A;  3C19 A;  3FAH A;  2WQY B;  3FKY A;  3NY5 A;  2RDB C;  3GB1 A;  3P42 A;  3PVL A;  3APC A;  3SEB A;  4FHJ A;  4MT5 A;  1GG3 A;  2N4F A;  3V6C B;  1WXM A;  4MGZ E;  2AX5 A;  1WGR A;  3PS6 A;  3Q8F A;  2FCQ A;  1UNS A;  4URK A;  3AEB B;  3DCG A;  2PTL A;  2L05 A;  2BQQ A;  4P16 A;  4DXF A;  4XC2 A;  1LQB A;  2PIA A;  1V5T A;  1PUT A;  4RGT A;  4TSS A;  2M19 A;  1V97 A;  1PGB A;  2EKI A;  2REX A;  2RDG A;  4IG7 B;  3APD A;  4I6N B;  2LRW A;  3ZRF A;  1MJD A;  3AI5 A;  3H7P B;  3A9J A;  4A3P A;  2KO3 A;  3LB8 C;  3NJT A;  3QA8 A;  4HRO A;  3Q2A C;  1D4B A;  1FXA A;  2K9X A;  2WDR B;  3PV1 A;  1S1Q B;  2L32 A;  5JXV A;  1QLB B;  1E8X A;  4W9J A;  4JGH B;  2JSV X;  4BBN F;  2JQR B;  4DK5 A;  3VXW A;  1SE4 A;  3AE4 B;  4FUL A;  2NPT A;  4XZ4 A;  4ARC A;  2JXT A;  4TQ1 A;  4IUM B;  2J7Q B;  4US9 A;  1Z2M A;  2VH2 A;  2LZ6 A;  2N1V A;  1HTO A;  1L6U A;  4XYC A;  1OTR B;  2V3P A;  1N63 A;  3VQI A;  2FUG 1;  5IAA C;  3ZTC A;  2IBI B;  3M62 B;  3P2B A;  5EE1 A;  4M8N A;  3I9V 1;  4W9H A;  1MG8 A;  1L5P A;  2DAF A;  1EF5 A;  3VRB B;  1HZ6 A;  3RZF A;  2PKO A;  1JRU A;  1UF0 A;  1LGR A;  1YN4 A;  2KN4 A;  2XK5 B;  3A1Q B;  4EZJ A;  1ESF A;  3WAO A;  1MHX A;  5KHQ A;  1DGJ A;  4FN2 A;  4B6W A;  2GBM A;  4WAF A;  3RNB C;  2YVC A;  4JPS A;  1WR1 A;  4K7S A;  1WX8 A;  3RFZ B;  2YLM A;  4Q2J A;  1R4N I;  2INC C;  1FCC C;  2AEH A;  4F7Z A;  2KK8 A;  3L10 B;  2KC2 A;  3QAQ A;  4RH6 A;  3BIN A;  1I42 A;  3TEX A;  3VFK A;  2KJH B;  5LNK 1;  2DNF A;  1RYJ A;  4C4V B;  4RMA A;  3NZU A;  4GOC A;  2GOW A;  2HJ1 A;  4NJC A;  1SXT A;  3L4P A;  1XD3 B;  1VJK A;  2B3A A;  3E56 A;  3EFC A;  4P7I A;  1WX7 A;  4ZRJ A;  3BVG A;  4NQK E;  3ZDM C;  2JZZ A;  3RPF C;  2KAN A;  2KOX A;  2INP E;  5E6J A;  4BOZ B;  2UYZ B;  2LVQ A;  1Q1O A;  4GXB A;  2QCZ A;  4MGI E;  4PYU A;  2MH7 A;  2AQ1 B;  1P3Q U;  2JT4 B;  3SDL C;  3KW5 B;  2WDV B;  2JWU A;  3DBL I;  1E0Z A;  4LNO A;  5JH5 C;  2RD0 A;  3HM6 X;  4DDG D;  1UWM A;  1AYF A;  2WU5 B;  1UEL A;  2W55 A;  4YSX B;  3P4S B;  4KSK C;  4AWJ A;  4ITK A;  1F9J A;  2C5L C;  2FCM A;  5DPR A;  2M4N A;  3OWE B;  3HIZ A;  5D6J B;  3AE1 B;  3EUB 2;  4OVZ A;  3X0W A;  1RRB A;  2K8B A;  2WXL A;  2MQJ A;  3TIX A;  3NVV A;  3N3K B;  1FIQ A;  2IYD B;  2R2Q A;  2Y5C A;  1WI0 A;  3V3X A;  2AWT A;  4H2A A;  2ZZP B;  2DEN B;  5C2T B;  3AU5 A;  4MSM B;  3WIM A;  4GDK B;  1TJE A;  2LD9 A;  2KTR A;  3P63 A;  2BYV E;  1UBQ A;  4GU2 A;  1TY2 A;  2MCN B;  5DCN A;  4DHZ B;  2NS5 A;  2W3R A;  2LHE A;  1NI2 A;  1JWB D;  2LUM A;  3JVZ X;  1TS5 A;  2QSD A;  4C7Y A;  1NDD A;  3DVG Y;  3VUW A;  3KYC D;  1KLV A;  2MWS B;  2KZR A;  1UWX A;  5CHV C;  4HCP B;  3GS2 A;  1QF6 A;  1TGZ B;  3NHE B;  4CYE A;  1RAX A;  3TL5 A;  2UWQ A;  1WGH A;  2GBN A;  3MHS D;  1NVI D;  1WJU A;  4IKG A;  1YD8 U;  1SE2 A;  3ZLZ A;  2MBE A;  2PLP A;  1P98 A;  4KX6 B;  2MHJ A;  4M01 A;  1T5X D;  3BVM A;  3NRZ A;  2M8S A;  3NZ3 A;  2HD5 B;  2J0K A;  1WY8 A;  2QJL A;  4LDT D;  3TJP A;  3DVN V;  1P7E A;  1WE6 A;  4NQL B;  2C7N B;  1T0R C;  5G5H A;  1T0S C;  2BPS A;  2Z8L A;  2BKF A;  1JWU D;  5BMG A;  1WXV A;  3Q8B A;  3NVW A;  1WR6 E;  4LNN A;  2EKE C;  2WDT B;  1ISN A;  2M1M A;  4WJQ A;  1FNV A;  3QJZ A;  3ZNH B;  1XF5 L;  4IW0 A;  2WHI A;  3N20 C;  4KDI C;  3L16 A;  4HPM B;  2W54 A;  3VR8 B;  3TMP B;  5EE9 A;  5EE3 A;  1V1O A;  3B2G A;  2BGF A;  2HE7 A;  2FAZ A;  3IAS 1;  1WXA A;  1HZ5 A;  1V8C A;  1WGD A;  4FA6 A;  2V4I B;  1RFA A;  3DVG X;  3KLS X;  4N58 A;  2WXF A;  2HTH A;  2RGF A;  1MHH E;  5J18 A;  4HEA 1;  2M0A A;  1R4N B;  4FLH A;  2DZI A;  3AEE B;  2O2V A;  4NAW A;  4E74 A;  4II3 B;  5G55 A;  3U7D A;  4FBJ B;  1ZDV A;  3EHV A;  5KHO A;  1C76 A;  2KXJ A;  1PDX A;  1KFY B;  1ZDX A;  2V1Y A;  4KKI A;  1AWD A;  1IGD A;  2RPV A;  4N59 A;  4AOF A;  1TTN A;  1HA5 A;  1FFU A;  4G3X B;  3ZDT A;  4YWG G;  3ZW3 A;  4FJV B;  4YT0 B;  2O6V A;  5GMV A;  3PRE A;  3DWM A;  1VD2 A;  3DBL B;  4B95 A;  2LGI A;  4K81 A;  5IO9 A;  2YEP F;  2RDH A;  1L4Z B;  2MP2 B;  4K3B A;  2KWD A;  2N9K A;  4A9A A;  4WAA A;  1JWM D;  1J19 A;  3T3N A;  3A4R A;  1UD7 A;  1WE7 A;  2NBU A;  1E90 A;  5DPS A;  1K50 A;  2BW2 A;  2LAS A;  2L76 A;  2V4L A;  4ZHP A;  2FCS A;  2KQ4 X;  3RCZ A;  2NTT A;  5IOI A;  4RGO S;  1IBX B;  2B76 B;  4BZA A;  3QWZ B;  1OFF A;  4FAD A;  1L7Y A;  2KT7 A;  5E6P A;  4LK0 M;  4MSQ B;  2KDE B;  1F2R I;  2MEK A;  1YQB A;  3EC8 A;  4MGY E;  4KIK A;  5E6N A;  1AN8 A;  5D3I B;  5FKA C;  2WXK A;  5JZE B;  1WYG A;  3ZXR A;  1HQR D;  3BWU D;  2L8J A;  2GRI A;  2ACZ B;  1FFV A;  1SEB D;  2GB1 A;  1I4R A;  5AUI A;  4BAX A;  4IWP A;  5JHB A;  3UIN B;  4BKS A;  1C77 A;  2QEJ C;  4LNK A;  3W1S C;  1HE8 A;  1K53 A;  2K8C A;  1XCT L;  1N60 A;  3CIR B;  3E9S A;  1BT0 A;  1EU4 A;  3ABV B;  3AE3 B;  5AUK A;  3RN9 C;  3SR6 A;  2WXH A;  2QHO A;  1KLU D;  4I6L B;  4O1N A;  4F8C B;  3Q8A A;  4M0W B;  2DBY A;  3SU8 X;  3GZN B;  4WJN A;  4C80 A;  1RM6 C;  1I4H A;  2WXR A;  3PTF C;  3AMZ A;  2NMQ A;  2WP9 B;  3KUC B;  5TR5 A;  1EO6 A;  4DHZ E;  1Q5W B;  2OJW A;  2O6V D;  1B9R A;  2L7R A;  3NVY A;  3ZNZ B;  3Q3N C;  2D3G A;  3A9K B;  2M56 B;  4XE0 A;  1SSN A;  2PPH A;  2WNM A;  3RT3 B;  1E8Y A;  1TZ1 A;  2DAJ A;  1CJE A;  2I38 A;  3OJ3 A;  2E3T A;  2D5G A;  4G11 A;  1V1P B;  1H4R A;  3R7Q A;  4M00 A;  3BYY B;  1OEY J;  1WJ6 A;  3HUI A;  3AEG B;  1DOY A;  4B0E A;  1T0Q C;  3URY A;  2D07 B;  3CMM B;  1B1Z A;  1FRD A;  2C9W B;  4WJP A;  4WWO A;  4HWI B;  3R2T A;  4A3O A;  3ETR A;  1VZ7 A;  3KH0 A;  3T9L A;  4DHJ B;  1XLO A;  1I4P A;  2CJO A;  5EE0 A;  4FJY A;  2KX0 A;  3PPA A;  4K7W A;  3BII D;  2KMA A;  2KD0 A;  3PRP B;  1YX5 B;  2DWQ A;  3DHG C;  3WCQ A;  3TEW A;  2Z0D B;  2JPH A;  2LXA A;  1I7H A;  4JIO U;  1C1Y B;  4W9C A;  3PLV A;  3AH7 A;  2K1F A;  4UDU C;  2V0G A;  2Z0E B;  2BYE A;  3JSV B;  4MH8 A;  4NAM A;  3RYT A;  3B08 A;  4PS7 A;  1SB3 C;  1ZW7 A;  4REZ A;  3CST A;  1LM8 B;  3VUY A;  4DWF A;  3AEC B;  2TSS A;  1PYW D;  2DZJ A;  2WXJ A;  4XDD A;  3U2S C;  1GUA B;  4US8 A;  4JL9 A;  1C4P A;  3ZJV A;  1QKZ A;  1XO3 A;  1NBF C;  2N9X A;  4NY0 A;  4RGM A;  4TKN A;  1HTQ A;  3T3O A;  3HVD A;  1EF1 A;  1V5O A;  3IFW B;  2VRR B;  2ONQ A;  1WMH B;  3AM9 A;  1MVK A;  3H7P A;  2D2Q A;  4PK1 A;  1C79 A;  1IUE A;  1FM0 D;  2E6X A;  5AEK B;  5BYQ A;  2WLB A;  3H7S A;  2JF5 A;  5D3D A;  3ZRC A;  1HXY D;  2BS2 B;  5L83 A;  4EZL A;  1XLN A;  1OQY A;  3RUL A;  1SIJ A;  4YSZ B;  4RGN A;  1N62 A;  2WXO A;  3QQ8 B;  3VRA B;  3MC0 B;  1VDV A;  2G4D B;  3N32 A;  3Q3M C;  3PZD A;  4KGT A;  4GN1 A;  1IP9 A;  4A6Q A;  5HKH A;  3B0A A;  1JCK B;  1QIL A;  2KNB A;  3V05 A;  5C23 A;  1JWS D;  3PSE B;  1VLB A;  4DHJ D;  2GLS A;  2XK5 A;  3A1Q A;  2N0S B;  3AE2 B;  4ANU A;  2ZEQ A;  1QZE A;  3V6E B;  1JQ4 A;  3NUH B;  1YQ4 B;  2J53 A;  3BZD B;  1K52 A;  4W9F A;  1VZ8 A;  4LJP B;  2D3C A;  3ENE A;  5FR6 A;  3KWV A;  5CX3 A;  1ZGU B;  2CHW A;  2CHX A;  3AUL A;  1BML C;  2K0P A;  2MW5 A;  1FCL A;  2FID A;  5H8Y E;  1CMX B;  1F2R C;  2YEP B;  4HVB A;  2GBR A;  4C4V A;  2M17 A;  2IJ0 A;  3ZJU A;  2CHZ A;  4YTP B;  2X8X X;  4HDO A;  4G0N B;  4ICV A;  4MM3 B;  2BKR B;  1SF0 A;  1J0G A;  4TQ0 A;  2DYB A;  1OQQ A;  4G50 A;  2MBB B;  5L95 C;  1GJZ A;  4M8M A;  4LDT B;  3OG5 A;  3DBH I;  4DXA B;  1A70 A;  1PQS A;  3ML8 A;  4M02 A;  1PGX A;  3TEY A;  2ZVO A;  2L0T A;  5BYS A;  2KN5 A;  2QC8 A;  4PYZ A;  1XQQ A;  1GAQ B;  1D5X C;  1XXG A;  3DBR I;  2ASQ A;  4WQO B;  2LMC A;  3CSF A;  4W9L A;  2N7D A;  2J52 A;  3OAW A;  3VTV A;  5MPO A;  1L4D B;  1TKE A;  2JRI B;  4S17 A;  3ZTD A;  5CHF A;  1A5R A;  3VHT C;  1F77 A;  3NS8 A;  1KH0 A;  1TBE A;  3N1Z C;  2GBK A;  3W5V B;  4NPN A;  2VZK D;  4A90 A;  2HDE A;  2KQ7 A;  2RSU A;  4KGS A;  5IN7 A;  5D94 A;  4LNF A;  3RI7 C;  1LO5 D;  1ZKH A;  4HXD A;  3DVN U;  2KTR B;  2J0J A;  2JZP A;  2WXI A;  3KUZ A;  4C00 A;  2W82 A;  3IG3 A;  1MPE A;  3QIJ A;  2G9H D;  1WXS A;  2K8H A;  5LLI A;  4ZRP A;  4WWP A;  1TY0 A;  2DZM A;  4YTN B;  2EEL A;  3ZIM A;  1NEN B;  3MJ5 A;  2CU1 A;  3A33 B;  1FO4 A;  2J42 A;  2NBV B;  3CF6 E;  3KUD B;  3PRM B;  3IT4 B;  4N9F 4;  3ZGZ A;  3J9C A;  4KVG B;  4XWT A;  2GI9 A;  2PVG C;  1FPY A;  2BVC A;  3EA6 A;  4WH4 A;  2KFK A;  4N6E B;  4AUQ C;  5T8I A;  1P0R A;  3C8Y A;  3ZKJ C;  1J7A A;  1J7C A;  1TYG B;  5FR3 A;  3ZJT A;  2I2Y A;  2BS3 B;  1WJ4 A;  4DXG A;  2LGD A;  3MJW A;  3RUI B;  3VR9 B;  4W9K A;  5DPT A;  3S2A A;  1NYR A;  5EDS A;  3PO0 A;  1SJH D;  1EU3 A;  3EEC A;  4ICU A;  2IY1 B;  1WM2 A;  5LXI B;  1GC7 A;  4RM9 A;  1BXT A;  2MJD A;  4BKG A;  5GXG B;  2FUH B;  3V61 A;  2WDQ B;  2KDI A;  1JW9 D;  5BMI A;  2BB5 A;  2W3S A;  3AN1 A;  5CTR C;  2KFJ A;  1ZOY B;  2LJI A;  3I5J C;  3KWL A;  1YX6 B;  1TT5 B;  1JWA D;  1SGH A;  3FIL B;  1E7U A;  3M3J A;  5J2R A;  3MFG A;  3N30 A;  1Z5S B;  1FXT B;  2AYO B;  4CO7 A;  3QAR A;  1C3T A;  4ZOH C;  3ZNI D;  4KZ0 A;  5E6O A;  5H92 C;  1K8R B;  3DQV A;  1ACC A;  2WX1 A;  2WXP A;  1X1M A;  1V49 A;  4CHK A;  2EMT A;  2FE8 A;  2J4X A;  2KWV B;  3UQB A;  3ZNG C;  2O2V B;  3R3M A;  5G2N A;  4ANV A;  2N9L A;  5TSS A;  1WJN A;  1SBB B;  4IOI E;  2C7M B;  3T8M A;  4W9D A;  3H1U A;  2LVO A;  2NBW B;  2JU6 X;  4W9I A;  2KWC A;  2ZW0 A;  2ZJD A;  5I4D A;  4I6P A;  1WM3 A;  1TS3 A;  3Q8E A;  5HFY A;  3IAM 1;  3NVZ A;  4II2 B;  2BS4 B;  1WXQ A;  3Q69 A;  3WAN A;  3DBH B;  2WS3 B;  1J8C A;  1E7V A;  4OZC A;  2LGS A;  4JLC A;  4PS8 A;  2O6V B;  4XX5 A;  2IO2 B;  4MEM A;  4DDI D;  2SEB D;  3B9J A;  3DBR B;  2KQS A;  2MP2 A;  3PLU A;  4DBG A;  1IYF A;  1YMH E;  3K9P B;  2G45 B;  1OEY A;  2D3B A;  3Q6B A;  1YOV B;  4KDL B;  3W1S A;  2KLG A;  4HKZ E;  2MSE D;  2K25 A;  3H8H A;  1N61 A;  3HVZ A;  1IBX A;  2CJN A;  4BBN C;  1YN5 A;  2FCN A;  2KTF A;  2PEA A;  5CHW A;  3AE9 B;  3ZXV A;  2H89 B;  4NNJ B;  1D5M C;  2CS4 A;  2K39 A;  3HHM A;  1N5W A;  4KIK B;  3DBS A;  2DZK A;  4HK2 A;  2JX5 A;  2FNJ B;  1KTK A;  1C4A A;  1TKG A;  4NZL B;  4ZYN A;  1HEZ E;  2BBC A;  2INN E;  1YJ1 A;  2FBW B;  3PGE A;  4USA A;  2ON8 A;  2IND C;  4EFO A;  1ROE A;  4JWU C;  1G6J A;  1GB4 A;  3ZUN A;  2D11 A;  1S3S G;  2WXN A;  1LFD A;  2MBO A;  3N1Y C;  3RNE C;  3HM3 A;  1YN3 A;  4IWO A;  3BK2 A;  4MJS B;  3Q3O C;  2ZNV C;  4CQN A;  2AQ2 B;  3BYT B;  2XEW A;  3R8B A;  2BF8 B;  4OHJ A;  1DOI A;  1ZXH A;  1ET9 A;  3NOB A;  1E8W A;  1ZP0 B;  4MH0 E;  3P4Q B;  2RR9 A;  2MA9 B;  4GDL B;  2IGH A;  1YQ3 B;  2KJR A;  1IPG A;  4WJO A;  3N1X C;  3RNG C;  2AQ3 B;  1V81 A;  2L00 B;  3TBL D;  1LXD A;  1F0Z A;  1JRP A;  3NS1 A;  1YJI A;  2G4S A;  2N9P C;  1WZ3 A;  2LVP A;  4WWM A;  1H8C A;  2KC1 A;  4WIP A;  4P1C C;  2AL6 A;  4ZRI A;  3JW0 X;  5HG2 A;  1TZO A;  4ZRQ A;  3VTU A;  3OJ4 B;  4YXD B;  2LI5 A;  5FK9 C;  4OVV A;  1QOA A;  4ZYS A;  1FNW A;  1WGY A;  3UQA A;  3H6N A;  3VUX A;  4LTU A;  1ZE3 D;  4S0R A;  1V1P A;  3DDC B;  2MBQ A;  4K3C A;  1EM7 A;  4W9E A;  1KRH A;  3UGB B;  1L6V A;  1V2Y A;  4AJW A;  3RNA C;  1SE9 A;  2ZCC A;  2AL3 A;  4KGR A;  4L2Y A;  3ECI A;  2K6Q A;  2BT6 A;  2L52 A;  1UGJ A;  1QT9 A;  1ZXI A;  2GMI C;  3LYY A;  1FXI A;  1L0V B;  2KX3 A;  4IM3 A;  4BKT A;  2EMS A;  2HTM E;  1Q10 A;  2MRP A;  4EKU A;  1VRA B;  4P6V F;  4BKS D;  1ZPS A;  2OED A;  4NJ6 A;  1WWT A;  2KDM A;  1KOT A;  3JSV A;  1STE A;  4PS3 A;  1U4A A;  2Y5P A;  3MHZ A;  3WA0 A;  2N7E A;  2JYT A;  3PHX B;  4QAY A;  3AE8 B;  4ARI A;  1UGM A;  1WZ0 A;  3I63 C;  1M94 A;  1RLF A;  1TKY A;  1D5Z C;  3P1M A;  1WF9 A;  1XCQ L;  2WYQ A;  3IBE A;  2LUE A;  3V60 A;  4D2K A;  1K51 A;  2Q5W D;  2KKC A;  1PFD A;  3A9J B;  1F1H A;  2LHD A;  3AV8 A;  3MTN B;  1YNT E;  1F52 A;  3UF8 A;  1GB1 A;  1WMH A;  2GBJ A;  3HK0 A;  3AEA B;  1FNU A;  1I35 A;  2JWZ A;  3D32 A;  3IHP C;  3ONS A;  3W2D A;  4OZA A;  2W9N A;  3GE8 C;  2NPT B;  1I4X A;  3VVW B;  2X38 A;  3QHT A;  2CKH B;  4AP4 C;  4JWS C;  4GGQ A;  1C78 A;  1ZUD 2;  3GP7 A;  1TS2 A;  1XLQ A;  2WWZ A;  1M4V A;  4GB9 A;  3BY4 B;  1KF6 B;  4WWN A;  4YSY B;  1MFW A;  2VZK B;  1JRO A;  3PHW B;  1E9M A;  2M0X A;  2ZPN A;  1UUP A;  3P4P B;  3TSS A;  2JY6 A;  2NCN A;  3TEZ A;  3O65 B;  4E71 A;  1XEE A;  1SE3 A;  2NR2 A;  4LLG M;  3TCA A;  3H9D A;  4JE3 B;  3L13 A;  1ENF A;  4OVU A;  2IY0 B;  1I4G A;  4WQM A;  4RF0 A;  3AXC A;  2OJR A;  3QK0 A;  3PT2 B;  1V86 A;  3P4R B;  4ACF A;  3SFE B;  4E3C A;  4EE2 A;  4GLS C;  2LGY A;  4RNA A;  4K7U A;  4YTM B;  3WAL A;  3LXF A;  4MEL A;  1KM7 A;  3QC8 B;  1UH6 A;  5JHA A;  4XGA B;  5BMH A;  3PZ8 A;  4A20 A;  1NEK B;  1WIA A;  4LCD E;  2BWF A;  2KVR A;  4GSW A;  1FD6 A;  1TIF A;  3GE3 C;  3AE6 B;  2WXQ A;  5C3J B;  3BK1 A;  4F1S A;  4L23 A;  2QIL A;  5G5G A;  4MM3 A;  1WGG A;  3A4S C;  4OW0 A;  1R7S A;  2WX0 A;  3W5U B;  2XN9 C;  4IM0 A;  1AAR A;  1YJJ A;  4MGK E;  2CR5 A;  3IXS A;  4AJY B;  2LFI A;  5BO4 B;  2UU7 A;  2BYT A;  5AZG A;  5BYR A;  4ZRK A;  4YL8 A;  1WSP A;  3QX1 A;  3OLM D;  1SIF A;  2IPK D;  2KDF B;  1D3Z A;  1MG4 A;  2KLC A;  2IO1 B;  2LXC A;  2KMC A;  4TUU A;  2KAJ A;  3M63 B;  2DX5 B;  1D6E C;  1VZ6 A;  1ET6 A;  1QOG A;  2N9E B;  4PT5 A;  5J17 A;  3UI3 A;  2LWP A;  1UBI A;  3AE5 B;  1GC6 A;  4EUT A;  1FMA D;  1Y8R C;  4GDK A;  4HLE A;  4ASW C;  2JVC A;  2HJ8 A;  1WRD B;  1C4C A;  1R4M I;  4XDC A;  3RD2 A;  2PJH A;  1GOZ A;  4KKJ A;  2MJ3 A;  4X57 B;  3WAP A;  4A55 A;  4EEW A;  4OZB A;  2KVZ A;  4C7Z A;  1IGC A;  2JUO A;  3U52 E;  3SFD B;  2OOB B;  2L1A A;  2DYO A;  1E8Z A;  1I4Q A;  3ALB A;  1PGA A;  3R66 C;  2PE9 A;  1EWY C;  3APF A;  2WGS A;  4ZHO A;  2A4Z A;  1Y56 A;  3V62 A;  1L0X B;  4L1B A;  2IO3 B;  4FHK A;  1GNU A;  3AB5 A;  3KQ4 A;  1FRR A;  2LEK A;  4ANX A;  4AQ7 A;  2MX2 A;  4IC7 B;  2R61 A;  3SD5 A;  1CK1 A;  2OHF A;  2K6D B;  1XT9 B;  3TUO A;  1C9F A;  2KWU B;  2DYM A;  3ZYY X;  3Q3J A;  5IKC M;  2JYE A;  3DPD A;  3HRD D;  3M95 A;  1TS4 A;  1RWS A;  2JZ3 B;  2L0F A;  1FEH A;  4MAC A;  4AS1 A;  1YIW A;  4HKQ A;  2G3Q B;  2KFK B;  1WFY A;  2KAC A;  3DWG C;  3N9Y C;  3GZN I;  3VTW A;  1V6E A;  2N1W A;  1N6Z A;  4MDK E;  1WYW B;  4IM2 A;  4HCN B;  1E5W A;  4NJ7 A;  3Q3F A;  4FJZ A;  3B2F A;  3ZO5 B;  3W1Y A;  1E7P B;  3L17 A;  2PVO D;  1OQR A;  2BYF A;  3PRZ A;  4P1B C;  1RFK A;  2BTE A;  3MC9 A;  3L0W B;  1E10 A;  3RNF C;  2JRH A;  1WRI A;  2PW9 A;  2FIF A;  3NG0 A;  1L2N A;  4LJO B;  2NTS A;  3AE7 B;  2IGD A;  2ZVN A;  2A5U A;  5IP4 D;  4B0M A;  2N7J A;  2V9H A;  1V9J A;  3FIL A;  4LNI A;  3GOE A;  2KHW B;  2PE6 B;  1P1A A;  3IT6 B;  1T6B X;  1DOX A;  4HPP A;  1N5X A;  5DPW A;  3R2I A;  2D10 A;  4GMV A;  1EUV B;  1QQR A;  4NAW B;  3LDZ E;  2D3A A;  2LJ5 A;  1JML A;  4K1R B;  3VH3 B;  2ZPY A;  1P9D U;  2QDF A;  1MI0 A;  4KZC A;  3VAW A;  4J6I A;  3C0R B;  2XBB C;  1QOF A;  3WAM A;  1T0Y A;  2SAK A;  4ZDV A;  3U4E G;  3B1L X;  2R2O A;  4A8X C;  3UIP B;  4BOS C;  4RFB A;  3RMK C;  3SHQ A;  5HI1 A;  1SJE D;  4J3O D;  2IGG A;  3AED B;  1T3Q A;  4KV2 A;  2KJ6 A;  4JX1 C;  5D2M B;  2WXM A;  1KJT A;  5AZF A;  3Q8C A;  2NVU I;  4HRS A;  1OGW A;  2IO0 B;  2MJE A;  2L3Z A;  1Q0W B;  1QOB A;  2V3S A;  2G1E A;  4HPL B;  4BFR A;  3R7R A;  1L0Y B;  2QMT A;  3ZVV A;  4ANW A;  3PZ7 A;  2RPQ A;  4IWQ A;  3AU4 A;  4B9K A;  3L08 A;  2ZNV B;  2IZV B;  3U7Z A;  4FXC A;  1CZP A;  3K9O B;  1XLP A;  3DHI C;  1VCB A;  5LXH A;  3I3T B;  1P7F A;  1NI3 A;  2Y5B B;  4TMA B;  1J7B A;  3ML9 A;  2Z59 B;  3X23 A;  2I1J A;  2K3U A;  4EZK A;  4WUR A;  2KYW A;  2H88 B;  3QCA A;  4HDQ A;  4DQO C;  4JQW C;  3LJ3 A;  3RZW C;  2VH1 A;  4C56 C;  1R4M B;  1CQV A;  3U30 A;  3IVF A;  2ZCB A;  3I57 A;  1WH3 A;  1WGK A;  3KYD D;  4HJG E;  2L83 A;  2RMM A;  3VDZ A;  1JAL A;  3CWI A;  2BWE S;  3VH4 B;  2C7H A;  3RNC C;  2KMM A;  2QIE B;  2JXX A;  2IDY A;  3NZS A;  1E6E B;  4MJS A;  3Q14 C;  2I1K A;  3DOW A;  3EFU A;  4TV3 A;  4IDI A;  2ZW1 A;  1V80 A;  3AEF B;  5AZH A;  1WX9 A;  4HJK A;  3UIO B;  5IA7 A;  5HHD G;  4KSL C;  4EOY A;  2PMV A;  2BB6 A;  2MBH A;  3FC4 A;  2K22 A;  4M0W A;  1GPX A;  2WXG A;  4GDL A;  2C60 A;  1KLG D;  4RCO A;  1AW7 A;  4R3D A;  4GIV A;  2DLB A;  2MLB A;  1VR9 A;  3BVZ A;  3MC8 A;  3ZQ4 A;  2WU2 B;  3W9C B;  1NYQ A;  2V3N A;  4RF1 A;  3A9K A;  4RM8 A;  3DHH C;  2J0M A;  1UZX B;  3KVF B;  3U8Z A;  4W9G A;  2LRU A;  4XWW A;  3EGR A;  5C1Z A;  3MP9 A;  2DHZ A;  1BUI C;  4BVU C;  2KDB A;  2LGX A;  2CU3 A;  3JYU A;  2K5P A;  3L54 A;  3O13 A;  5D7G A;  2XNA C;  2Y3A A; 
#chains in the Genus database with same CATH homology
 4M02 A;  2KYW A;  2KVZ A;  4M00 A;  4M01 A;  2KT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...