2KYYA

Solution nmr structure of the n-terminal domain of putative atp-dependent dna helicase recg-related protein from nitrosomonas europaea, northeast structural genomics consortium target ner70a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLEQVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the N-terminal Domain of Putative ATP-dependent DNA Helicase RecG-related Protein from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Hydrolase
molecule keywords Possible ATP-dependent DNA helicase RecG-related protein
total genus 27
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04326 AlbA_2 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.30 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2kyyA00
3LMMA 2KYYA
chains in the Genus database with same CATH superfamily
2CBFA 2DXVA 2P5FA 2E0NA 5HW4A 2EHLA 2EK2A 2NPNA 2EK4A 1CBFA 2DSIA 2EH2A 2HUQA 2PCKA 2EL0A 2OWUA 2DEKA 2EHCA 2EL2A 1PJTA 2YBQA 2EJKA 2ZVBA 1WYZA 1PJQA 2Z6RA 2HUVA 2DXXA 2EMRA 2P6KA 2P6IA 3FQ6A 1WNGA 2BB3A 2EK7A 1VCEA 4E16A 2EEQA 2P9DA 2PB5A 2PB6A 2EH4A 2EL1A 2EGBA 2EL3A 2EGSA 3FFYA 2E4NA 2E8HA 2YBOA 3KWPA 3NUTA 2PCAA 2EMUA 2EKAA 2PCIA 2OWVA 2P6DA 2E07A 2OWKA 2EK3A 2P6LA 3LMMA 2E8SA 2E16A 3I4TA 2E17A 2HR8A 2EN5A 1VE2A 2EJJA 2P5CA 2DSGA 2ED5A 2E4RA 2DV7A 2ED3A 2DV3A 2OWGA 2DV5A 1PJSA 2ELEA 2HUXA 2KYYA 3NDCA 1VHVA 2EH5A 2E7RA 2ENIA 2QBUA 3ND1A 2PCGA 2E8RA 2E0KA 2E08A 2ZVCA 2HUTA 3NEIA 1VA0A 2E15A 1V9AA 2DV4A 1S4DA 1WDEA 2PB4A 2PCMA 2EGLA 2EJZA 2PCHA 2P2XA 2E8QA 2OWFA 2DXWA 2DSHA 2ELDA
chains in the Genus database with same CATH topology
2CBFA 2DXVA 2P5FA 2E0NA 5HW4A 2EHLA 2EK2A 2NPNA 2EK4A 1CBFA 2DSIA 2EH2A 2HUQA 2PCKA 2EL0A 2OWUA 2DEKA 2EHCA 2EL2A 1PJTA 2YBQA 2EJKA 2ZVBA 1WYZA 1PJQA 2Z6RA 2HUVA 2DXXA 2EMRA 2P6KA 2P6IA 3FQ6A 1WNGA 2BB3A 2EK7A 1VCEA 4E16A 2EEQA 2P9DA 2PB5A 2PB6A 2EH4A 2EL1A 2EGBA 2EL3A 2EGSA 3FFYA 2E4NA 2E8HA 2YBOA 3KWPA 3NUTA 2PCAA 2EMUA 2EKAA 2PCIA 2OWVA 2P6DA 2E07A 2OWKA 2EK3A 2P6LA 3LMMA 2E8SA 2E16A 3I4TA 2E17A 2HR8A 2EN5A 1VE2A 2EJJA 2P5CA 2DSGA 2ED5A 2E4RA 2DV7A 2ED3A 2DV3A 2OWGA 2DV5A 1PJSA 2ELEA 2HUXA 2KYYA 3NDCA 1VHVA 2EH5A 2E7RA 2ENIA 2QBUA 3ND1A 2PCGA 2E8RA 2E0KA 2E08A 2ZVCA 2HUTA 3NEIA 1VA0A 2E15A 1V9AA 2DV4A 1S4DA 1WDEA 2PB4A 2PCMA 2EGLA 2EJZA 2PCHA 2P2XA 2E8QA 2OWFA 2DXWA 2DSHA 2ELDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMM A;  2KYY A; 
#chains in the Genus database with same CATH topology
 2CBF A;  2DXV A;  2P5F A;  2E0N A;  5HW4 A;  2EHL A;  2EK2 A;  2NPN A;  2EK4 A;  1CBF A;  2DSI A;  2EH2 A;  2HUQ A;  2PCK A;  2EL0 A;  2OWU A;  2DEK A;  2EHC A;  2EL2 A;  1PJT A;  2YBQ A;  2EJK A;  2ZVB A;  1WYZ A;  1PJQ A;  2Z6R A;  2HUV A;  2DXX A;  2EMR A;  2P6K A;  2P6I A;  3FQ6 A;  1WNG A;  2BB3 A;  2EK7 A;  1VCE A;  4E16 A;  2EEQ A;  2P9D A;  2PB5 A;  2PB6 A;  2EH4 A;  2EL1 A;  2EGB A;  2EL3 A;  2EGS A;  3FFY A;  2E4N A;  2E8H A;  2YBO A;  3KWP A;  3NUT A;  2PCA A;  2EMU A;  2EKA A;  2PCI A;  2OWV A;  2P6D A;  2E07 A;  2OWK A;  2EK3 A;  2P6L A;  3LMM A;  2E8S A;  2E16 A;  3I4T A;  2E17 A;  2HR8 A;  2EN5 A;  1VE2 A;  2EJJ A;  2P5C A;  2DSG A;  2ED5 A;  2E4R A;  2DV7 A;  2ED3 A;  2DV3 A;  2OWG A;  2DV5 A;  1PJS A;  2ELE A;  2HUX A;  2KYY A;  3NDC A;  1VHV A;  2EH5 A;  2E7R A;  2ENI A;  2QBU A;  3ND1 A;  2PCG A;  2E8R A;  2E0K A;  2E08 A;  2ZVC A;  2HUT A;  3NEI A;  1VA0 A;  2E15 A;  1V9A A;  2DV4 A;  1S4D A;  1WDE A;  2PB4 A;  2PCM A;  2EGL A;  2EJZ A;  2PCH A;  2P2X A;  2E8Q A;  2OWF A;  2DXW A;  2DSH A;  2ELD A; 
#chains in the Genus database with same CATH homology
 2CBF A;  2DXV A;  2P5F A;  2E0N A;  5HW4 A;  2EHL A;  2EK2 A;  2NPN A;  2EK4 A;  1CBF A;  2DSI A;  2EH2 A;  2HUQ A;  2PCK A;  2EL0 A;  2OWU A;  2DEK A;  2EHC A;  2EL2 A;  1PJT A;  2YBQ A;  2EJK A;  2ZVB A;  1WYZ A;  1PJQ A;  2Z6R A;  2HUV A;  2DXX A;  2EMR A;  2P6K A;  2P6I A;  3FQ6 A;  1WNG A;  2BB3 A;  2EK7 A;  1VCE A;  4E16 A;  2EEQ A;  2P9D A;  2PB5 A;  2PB6 A;  2EH4 A;  2EL1 A;  2EGB A;  2EL3 A;  2EGS A;  3FFY A;  2E4N A;  2E8H A;  2YBO A;  3KWP A;  3NUT A;  2PCA A;  2EMU A;  2EKA A;  2PCI A;  2OWV A;  2P6D A;  2E07 A;  2OWK A;  2EK3 A;  2P6L A;  3LMM A;  2E8S A;  2E16 A;  3I4T A;  2E17 A;  2HR8 A;  2EN5 A;  1VE2 A;  2EJJ A;  2P5C A;  2DSG A;  2ED5 A;  2E4R A;  2DV7 A;  2ED3 A;  2DV3 A;  2OWG A;  2DV5 A;  1PJS A;  2ELE A;  2HUX A;  2KYY A;  3NDC A;  1VHV A;  2EH5 A;  2E7R A;  2ENI A;  2QBU A;  3ND1 A;  2PCG A;  2E8R A;  2E0K A;  2E08 A;  2ZVC A;  2HUT A;  3NEI A;  1VA0 A;  2E15 A;  1V9A A;  2DV4 A;  1S4D A;  1WDE A;  2PB4 A;  2PCM A;  2EGL A;  2EJZ A;  2PCH A;  2P2X A;  2E8Q A;  2OWF A;  2DXW A;  2DSH A;  2ELD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...