2KYYA

Solution nmr structure of the n-terminal domain of putative atp-dependent dna helicase recg-related protein from nitrosomonas europaea, northeast structural genomics consortium target ner70a
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
153
structure length
153
Chain Sequence
MRSATDLLDELNAVDESARIEAKRASDMGKSVMETVIAFANEPGLDGGYLLLGVDWAINDKGDTVYRPVGLPDPDKVQRDLASQCASMLNVALRPEMQLEQVGGKTLLVVYVPEADVTHKPIYKKATGLPGGAYRRIGSSDQRCVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of the N-terminal Domain of Putative ATP-dependent DNA Helicase RecG-related Protein from Nitrosomonas europaea
rcsb
source organism Nitrosomonas europaea
molecule tags Hydrolase
molecule keywords Possible ATP-dependent DNA helicase RecG-related protein
total genus 27
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04326 AlbA_2 Putative DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.950.30 Alpha Beta 2-Layer Sandwich Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 Methyltransferase, Cobalt-precorrin-4 Transmethylase; Domain 2 2kyyA00
3LMMA 2KYYA
chains in the Genus database with same CATH superfamily
2DXVA 2QBUA 2E4RA 2E17A 2HUXA 2EEQA 2EL0A 2E8SA 2EK4A 2EN5A 5HW4A 2P9DA 3FQ6A 2OWVA 2EJZA 3NUTA 2ZVBA 2E8QA 2DV3A 2OWFA 2P6DA 1PJSA 1VA0A 2EH4A 2E0NA 2ZVCA 2P6LA 2DV7A 3FFYA 2PCGA 2E07A 2DV4A 2EGBA 2OWKA 1WYZA 2E0KA 3I4TA 2PB4A 2EL1A 2NPNA 2EJJA 2DXWA 2YBOA 1WNGA 2YBQA 2ELDA 2E8HA 1PJQA 3NEIA 2DXXA 2P5FA 2PCMA 2EGLA 2DSHA 2EKAA 2ENIA 2PCKA 2E7RA 2PCHA 1WDEA 2CBFA 2EHCA 2PB5A 2OWUA 1V9AA 2EGSA 2BB3A 1PJTA 2EMUA 2EK2A 3ND1A 2ELEA 2DEKA 1VE2A 3KWPA 2HUQA 2EJKA 1VCEA 1CBFA 2ED3A 1S4DA 2EL2A 2P5CA 2DSIA 2EL3A 2P6KA 2Z6RA 2EK3A 2HR8A 2EMRA 2HUTA 2PCIA 2E4NA 2P6IA 2DSGA 3LMMA 2EH2A 2E15A 2PB6A 2HUVA 1VHVA 2E08A 2E16A 2E8RA 2OWGA 4E16A 2EHLA 2ED5A 2PCAA 2EK7A 3NDCA 2DV5A 2KYYA 2EH5A 2P2XA
chains in the Genus database with same CATH topology
2DXVA 2QBUA 2E4RA 2E17A 2HUXA 2EEQA 2EL0A 2E8SA 2EK4A 2EN5A 5HW4A 2P9DA 3FQ6A 2OWVA 2EJZA 3NUTA 2ZVBA 2E8QA 2DV3A 2OWFA 2P6DA 1PJSA 1VA0A 2EH4A 2E0NA 2ZVCA 2P6LA 2DV7A 3FFYA 2PCGA 2E07A 2DV4A 2EGBA 2OWKA 1WYZA 2E0KA 3I4TA 2PB4A 2EL1A 2NPNA 2EJJA 2DXWA 2YBOA 1WNGA 2YBQA 2ELDA 2E8HA 1PJQA 3NEIA 2DXXA 2P5FA 2PCMA 2EGLA 2DSHA 2EKAA 2ENIA 2PCKA 2E7RA 2PCHA 1WDEA 2CBFA 2EHCA 2PB5A 2OWUA 1V9AA 2EGSA 2BB3A 1PJTA 2EMUA 2EK2A 3ND1A 2ELEA 2DEKA 1VE2A 3KWPA 2HUQA 2EJKA 1VCEA 1CBFA 2ED3A 1S4DA 2EL2A 2P5CA 2DSIA 2EL3A 2P6KA 2Z6RA 2EK3A 2HR8A 2EMRA 2HUTA 2PCIA 2E4NA 2P6IA 2DSGA 3LMMA 2EH2A 2E15A 2PB6A 2HUVA 1VHVA 2E08A 2E16A 2E8RA 2OWGA 4E16A 2EHLA 2ED5A 2PCAA 2EK7A 3NDCA 2DV5A 2KYYA 2EH5A 2P2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LMM A;  2KYY A; 
#chains in the Genus database with same CATH topology
 2DXV A;  2QBU A;  2E4R A;  2E17 A;  2HUX A;  2EEQ A;  2EL0 A;  2E8S A;  2EK4 A;  2EN5 A;  5HW4 A;  2P9D A;  3FQ6 A;  2OWV A;  2EJZ A;  3NUT A;  2ZVB A;  2E8Q A;  2DV3 A;  2OWF A;  2P6D A;  1PJS A;  1VA0 A;  2EH4 A;  2E0N A;  2ZVC A;  2P6L A;  2DV7 A;  3FFY A;  2PCG A;  2E07 A;  2DV4 A;  2EGB A;  2OWK A;  1WYZ A;  2E0K A;  3I4T A;  2PB4 A;  2EL1 A;  2NPN A;  2EJJ A;  2DXW A;  2YBO A;  1WNG A;  2YBQ A;  2ELD A;  2E8H A;  1PJQ A;  3NEI A;  2DXX A;  2P5F A;  2PCM A;  2EGL A;  2DSH A;  2EKA A;  2ENI A;  2PCK A;  2E7R A;  2PCH A;  1WDE A;  2CBF A;  2EHC A;  2PB5 A;  2OWU A;  1V9A A;  2EGS A;  2BB3 A;  1PJT A;  2EMU A;  2EK2 A;  3ND1 A;  2ELE A;  2DEK A;  1VE2 A;  3KWP A;  2HUQ A;  2EJK A;  1VCE A;  1CBF A;  2ED3 A;  1S4D A;  2EL2 A;  2P5C A;  2DSI A;  2EL3 A;  2P6K A;  2Z6R A;  2EK3 A;  2HR8 A;  2EMR A;  2HUT A;  2PCI A;  2E4N A;  2P6I A;  2DSG A;  3LMM A;  2EH2 A;  2E15 A;  2PB6 A;  2HUV A;  1VHV A;  2E08 A;  2E16 A;  2E8R A;  2OWG A;  4E16 A;  2EHL A;  2ED5 A;  2PCA A;  2EK7 A;  3NDC A;  2DV5 A;  2KYY A;  2EH5 A;  2P2X A; 
#chains in the Genus database with same CATH homology
 2DXV A;  2QBU A;  2E4R A;  2E17 A;  2HUX A;  2EEQ A;  2EL0 A;  2E8S A;  2EK4 A;  2EN5 A;  5HW4 A;  2P9D A;  3FQ6 A;  2OWV A;  2EJZ A;  3NUT A;  2ZVB A;  2E8Q A;  2DV3 A;  2OWF A;  2P6D A;  1PJS A;  1VA0 A;  2EH4 A;  2E0N A;  2ZVC A;  2P6L A;  2DV7 A;  3FFY A;  2PCG A;  2E07 A;  2DV4 A;  2EGB A;  2OWK A;  1WYZ A;  2E0K A;  3I4T A;  2PB4 A;  2EL1 A;  2NPN A;  2EJJ A;  2DXW A;  2YBO A;  1WNG A;  2YBQ A;  2ELD A;  2E8H A;  1PJQ A;  3NEI A;  2DXX A;  2P5F A;  2PCM A;  2EGL A;  2DSH A;  2EKA A;  2ENI A;  2PCK A;  2E7R A;  2PCH A;  1WDE A;  2CBF A;  2EHC A;  2PB5 A;  2OWU A;  1V9A A;  2EGS A;  2BB3 A;  1PJT A;  2EMU A;  2EK2 A;  3ND1 A;  2ELE A;  2DEK A;  1VE2 A;  3KWP A;  2HUQ A;  2EJK A;  1VCE A;  1CBF A;  2ED3 A;  1S4D A;  2EL2 A;  2P5C A;  2DSI A;  2EL3 A;  2P6K A;  2Z6R A;  2EK3 A;  2HR8 A;  2EMR A;  2HUT A;  2PCI A;  2E4N A;  2P6I A;  2DSG A;  3LMM A;  2EH2 A;  2E15 A;  2PB6 A;  2HUV A;  1VHV A;  2E08 A;  2E16 A;  2E8R A;  2OWG A;  4E16 A;  2EHL A;  2ED5 A;  2PCA A;  2EK7 A;  3NDC A;  2DV5 A;  2KYY A;  2EH5 A;  2P2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...