2KZ3A

Backbone 1h, 13c, and 15n chemical shift assignments for human rad51d from 1 to 83
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein RAD51L3
publication title Structural and functional characterization of the N-terminal domain of human Rad51D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kz3A00
5L1LA 1S0NA 4J9OA 2P66A 3ZD8A 5HMLA 4DL3A 3UPQA 1XC9A 4KLQA 3PV8A 5CWRA 4ED0A 3C1ZA 5DG8A 1ZQAA 2BQRA 4QZEA 3PW5A 3QEBZ 5KFCA 3KHRA 2Y1IA 4IR1A 4DF8A 4ECXA 4KLFA 4M6WA 4EZ6A 5KT7A 1XS9D 3V6KA 2HW3A 1NK8A 3MBYA 2ASJA 2PI4A 3JPSA 2JEFA 4M9JA 2KFNA 2ZJAA 4QZ8A 3RTVA 1DGSA 4B9MA 4RQ5A 1ZQDA 5TZVA 4DFMA 1L3UA 4DSLA 4KLEA 4QZIA 2AGPA 4Q45A 3PR4A 4JV2A 3T5KA 4RQ1A 4P4PA 4ECQA 4ECVA 3Q8LA 3MFHA 3PVXA 3RBEA 1NK7A 1SL2A 4DSIA 3MFIA 4KLOA 5DB8A 4F2RA 4CCHA 2HHSA 3H8WA 3V72A 2FPLA 5KG7A 2FLPA 3K4GA 4RPXA 2XC9A 1D9DA 2R8JA 2Y1JA 4O3QA 2A1JB 1NKCA 5KG4A 4GXJA 3G6YA 1IM4A 2XCPA 4YG2A 4GXIA 4ECRA 3BQ0A 2IBKA 3GIMA 3N4MB 2FPKA 4P4MA 2BHNA 2NRWA 4YP3A 4I29A 2ISOA 2V4RA 3LWMA 5KFPA 2KN7A 2UVRA 8ICFA 1TAQA 4Q44A 5J0OA 3RH5A 2DPIA 1RXWA 1ZQSA 5EOZA 3GQCA 5KFSA 5DG9A 3C2MA 1SZPA 1MQ2A 1H38A 2BPFA 4M9GA 5KFMA 3H8SA 2W9AA 3EW9A 2XCAA 2MUTB 1S76D 3SV3A 3PW7A 5KFTA 4K4IA 1XWLA 2W8KA 4DQSA 1TV9A 4JUZA 4YMMA 1U48A 2FMQA 5F9NA 4JV1A 8ICYA 4DOBA 3FYHA 2M9NA 4TUQA 1Y88A 4YMNA 1ZQQA 3E2EA 4FO6A 4P2HA 2PFNA 3C21A 4QZCA 4MFCA 3QE9Y 4YVZA 3RB4A 1NKBA 3Q8MA 5KT5A 4PHAA 4F4WA 1D8LA 3RH4A 3H7IA 1ZQYA 3MR3A 3QEAZ 9ICWA 1A77A 4ED8A 2PFQA 4R64A 4MEXA 7ICQA 1BPEA 2AJQA 4LZGA 5KFBA 4ECTA 4NLKA 4M0AA 3RB3A 5KT6A 4R8UA 4JK1A 5J0QA 9ICGA 2J6UA 4Z6CA 4DS4A 4B9VA 3T5HA 4R63A 1BGXT 5J2HA 1S77D 4F4KA 3RRHA 1ZJMA 3GV7B 4NLGA 4DF4A 2BCQA 4P4OA 3PMLA 1TFRA 4C8NA 9ICKA 4YR0A 2FLLA 9ICRA 5KFFA 1Z00A 4QW8A 3RRGA 3UXOA 3TI0A 1S0MA 4F5NA 3BQ2A 3ZDDA 3MGIA 4IQWA 3G6VA 1KRPA 4Q8EA 1IXRA 5J0RA 4RZRA 3HX0A 4MFFA 3THVA 4RQ4A 8ICLA 9ICLA 4DFJA 2BCRA 8ICVA 4TQRA 9ICNA 1HUZA 5EWFA 8ICBA 3RB6A 4IQVA 8ICNA 4F91B 5HP4A 1T8EA 1ZQBA 2ZUCA 1X9MA 3Q8SB 4M47A 1KFSA 5KFJA 4PHEA 4RNMA 4GXKA 4I2JA 5J0TA 4I28A 4YR3A 2BDPA 3KHGA 4KLMA 4B9UA 4DSKA 2HHVA 3AU6A 2BPGA 7ICTA 4F5PA 4RQ6A 1RPLA 4DSJA 9ICTA 1N56A 1B43A 5CHGA 5DQHA 1ZQHA 4F5RA 4NLNA 3C5FA 5KFQA 4XQ8A 5KFNA 2C28A 1XSLA 4J9PA 3GIJA 3T5JA 4BDPA 4KLUA 4F5QA 2ZUBA 4ED2A 5KFIA 5JUMA 5IIOA 5KG2A 2OWOA 5KFKA 4DOCA 2DPJA 2W9CB 5J2IA 5CB1A 2AQ4A 3PX4A 4UB2A 1NK4A 1DOQA 7ICKA 4I2BA 2J6SA 3AU2A 4O3PA 4EZ9A 9ICSA 3MGHA 4BWMA 5IIJA 4UAWA 4ZH4A 2HHTA 2HHQA 8ICSA 5KFLA 4MFAA 2XO7A 4ECYA 4NY8A 4QWEA 2F1IA 4QZGA 4BXOB 4F50A 3PW0A 1NK6A 2P6RA 1LB2B 2HVIA 2FPMA 5L9XA 5KG0A 1B22A 4NM2A 1MC8A 4I2IA 3MABA 4J9KA 5DB7A 3GV5B 1ZQRA 4IRDA 2HVHA 5IILA 3OHBA 2WTFA 5KFOA 5J2JA 3T5LA 2C2RA 1RXVA 1KSPA 2XY7A 3RR7A 4Z6FA 4ED3A 1U4BA 1UT8A 8ICCA 5KFXA 3NTUA 4DLEA 4RT2A 4IQUA 4DEZA 1ZQMA 2H5XA 2J6TA 4RNNA 3V7JA 2JEJA 4ELUA 3SZ2A 3C1YA 4I2DA 8ICOA 3EYZA 5KT2A 1ZQEA 3V6HA 9ICOA 3RH6A 1L3TA 2P6UA 3GV8B 5J2EA 1CEZA 3PW4A 4DQQA 5DGBA 7ICGA 3BDPA 4ED6A 1QTMA 1Z3EB 4IRCA 4O3RA 2ASDA 2LYHA 2A1JA 9ICEA 4TUSA 7ICIA 2NRZA 4RQ7A 5KT4A 1A76A 1ZQUA 2ZJ5A 2NRVA 3ORYA 3V7LA 4O3OA 3Q8QB 2BQUA 5KFHA 5KFUA 1UA1A 1U45A 5DB9A 7ICMA 7ICNA 4DL6A 4Q43A 1JXLA 2PI5A 4GLXA 2IA6A 4QW9A 5J0YA 2XY5A 3JPTA 8ICZA 5KFYA 2C2DA 3ZDBA 2B21A 2IHNA 1RYRA 2F1JA 4ELVA 4F92B 4DWIA 3TFSA 5DB6A 3SYZA 9ICAA 2MUTA 4PGYA 3EWAA 1PZNA 3HWTA 4EYHB 1JMSA 3HT3A 3H40A 4DOAA 2ASLA 1SKSA 4NLZA 1KDHA 9ICVA 1X2IA 5IIMA 3PNCA 4EYIB 4Q8FA 2HHWA 1S0VA 3KTQA 3HP6A 3ETLA 5DQIA 4I2CA 4TQSA 4KITB 2W9MA 4DS5A 4FBUA 3IHQB 3RJFA 1WCLA 5J0UA 1BPBA 4Z6EA 3TAQA 4RPZA 2ISPA 4M9NA 2C2EA 4LZDA 3RJKA 1RYSA 8ICTA 4EBDA 2JEIA 4KMUA 4PPXA 4EBCA 4RPYA 4ELTA 2F1HA 5KFRA 5L1JA 5J2GA 1EXNA 4J9QA 2AU0A 1ZQLA 2NRTA 1BPZA 4DFPA 5DQGA 1ZETA 3JPRA 3IM1A 1KFTA 4RT3A 3BJYA 3V6JA 5HNKA 2Q0ZX 4JV0A 1S97A 3ISCA 4RUCA 5IINA 4DLGA 5J2KA 2BQ3A 4DSEA 2I9GA 4TUPA 3M8SA 4EBEA 7ICHA 4RQ8A 5KG5A 4YQWA 4K4HA 8ICGA 4M04A 4C8MA 1S10A 2HHUA 1COOA 1L3VA 1JX4A 1JXEA 3OGUA 2W9BB 5DLFA 3ZDCA 8ICKA 4YFKA 4I2AA 9ICMA 4C8LA 1L3SA 2BCVA 4UBCA 9ICPA 3C5GA 3LWLA 3EZ5A 8ICMA 3TANA 3M8RA 3C2KA 4PGQA 3RAXA 4Z6DA 3C2LA 1NOMA 1SKWA 2UVWA 3ISDA 4XRHA 4YMOA 1U47A 4DL4A 3JPPA 4DL7A 3BQTA 4QZBA 1NJXA 5HMMA 4KLGA 3HW8A 4DL2A 8ICWA 2AQ0A 2RDIA 3RJJA 5DG7A 2VA3A 5DDMA 3TQ1A 4F4XA 5CA7A 5DKWA 4KLJA 8ICQA 5IIIA 3JPOA 7ICEA 1UA0A 8ICPA 2JZBB 4UQGA 1L5UA 2ZJ8A 2BCUA 4QWAA 2KZMA 4QZAA 4RUAA 1ZQPA 4UB5A 3GILA 3SV4A 4J9MA 3ZD9A 4O9MA 3PX0A 4I2FA 4TURA 2BGWA 2I1QA 2W9CA 1ZQTA 2DFLA 1TK5A 1ZQJA 4DFKA 4YXMA 1NJWA 1SL1A 3PY8A 4KLLA 4KLSA 1HJPA 4YD2A 5BOMA 4C8OA 1KTQA 8ICJA 7ICPA 3H4DA 1ZQVA 5KFDA 1D9FA 4QWDA 3UXNA 4J9RA 4YXJA 5DLGA 3OSNA 4IQTA 4J9NA 3M9OB 4F8RA 5J2BA 1T3NA 2FMSA 3LDAA 4IR9A 4F3OA 2V4QA 2R8HA 3T3FA 5L1IA 1C7YA 2FLNA 4DQIA 3RJIA 7ICSA 4BXOA 1ZQKA 3QZ7A 3RBDA 3KHHA 2ZTCA 5BPCA 1TKDA 4UAYA 2W8LA 3RJGA 3EPIA 1ZQGA 8ICEA 3JPNA 2PXIA 1ZJNA 3Q8PB 2R8GA 4KTQA 3PMNA 4M6WB 4XUSA 4ECUA 7ICUA 1ZQFA 4ED7A 1BPDA 7ICJA 9ICQA 1X9WA 2ZTDA 1K1QA 1HUOA 4RQ2A 3BQ1A 4J9SA 1ZQOA 1SKRA 3ISBA 7ICRA 3RJEA 4YR2A 4PH5A 1XSPA 9ICCA 1NJYA 1NJZA 3LK9A 5KFEA 4MF8A 4F4YA 5EWGA 1KFDA 3UXPA 4ECSA 5CP2A 3MR2A 1U49A 3N97B 2RDJA 5J2DA 3ZDEA 4KLIA 1TAUA 7ICVA 3RB0A 4YN4A 4UB1A 4MF2A 2BKEA 5D4BA 3GIIA 3TFRA 4I27A 9ICHA 1RZTA 1N48A 5BOLA 1BVSA 1S0OA 8ICAA 4PGXA 1ZQIA 1BPYA 3RAQA 2XGPA 4DQPA 3UQ2A 1XSNA 1XO1A 5DDYA 4KLTA 3ZDAA 3K75D 4J9LA 4IRKA 1AROP 1TVAA 4RQ0A 4QZDA 3M9NB 3MDCA 4BWJA 5IIKA 4DL5A 4NXZA 4HYKA 4UB3A 1KEJA 4GC7A 4R65A 1ZYQA 3RR8A 4DSFA 4M9HA 4QWBA 2XGQA 3AUOA 4I2HA 4PHPA 5KG1A 4O3NA 5J0SA 5L1KA 2PFOA 1T4GA 3B0XA 4M2YA 9ICJA 1KLNA 1JN3A 4C8KA 4RNOA 1NK0A 2ZUDA 4BGDA 5KG3A 3H4BA 4I2GA 8ICRA 5DBBA 2KZZA 4KN7A 1NK9A 8ICUA 5KFAA 4QZ9A 3Q8KA 1SL0A 4B9TA 3MR5A 9ICBA 4K4GA 4RQ3A 1XU4A 3PR5B 2VANA 3PX6A 4JWNA 1CUKA 1T7PA 3TARA 5HHIA 4I2EA 3GDXA 3MDAA 4ECWA 4E0DA 4KN4A 4R66A 3OSPA 8ICHA 4B9SA 3SI8A 2KZ3A 5KFWA 5J2FA 4KLDA 8ICXA 4X5VA 4R8UB 3PO4A 5C5JA 5KT3A 4QZFA 3G6XA 1QSSA 4B9NA 5KFZA 4ED1A 3HPOA 2BR0A 5J0PA 5F9LA 3H8JA 1QSYA 1JIHA 3B0YA 1MSWD 2AGQA 5KFVA 2FMPA 1D8YA 2AGOA 4DO9A 3OJUA 1TK8A 2W9BA 2C22A 1ZQCA 1Z00B 3GFKB 3NGDA 4B9LA 2KFZA 4YCXA 5D46A 4KLHA 4DQRA 2BPCA 2VA2A 3C23A 3MR6A 9ICFA 1V9PA 1NK5A 5J0WA 4LVSA 3GIKA 2R8KA 2GWSA 5KG6A 5J0XA 2UVVA 2V9WA 4ECZA 4O3SA 3EPGA 7ICOA 4QWCA 9ICIA 5J2CA 8ICIA 2BCSA 2NRXA 2MAXA 3OJSA 4QZHA 1U9LA 3JPQA 2IMWP 4JWMA 2HHXA 4FS1A 3PO5A 4RU9A 1WCNA 4UAZA 2R8IA 2IHMA 3RJHA 3FDSA 1UT5A 1ZQWA 5D49A 4F93B 2PFPA 7ICFA 4EEYA 1ZQXA 4F5OA 1BPXA 4NM1A 2JZBA 1QSLA 4G3IA 2KTQA 3TAPA 4F4ZA 1MQ3A 3PW2A 4PHDA 4FS2A 2XY6A 2ALZA 1ZQNA 5CR0A 1S9FA 4UB4A 5DGAA 2ATLA 1K1SA 4XA5A 5HHHA 3OHAA 4GC6A 4YD1A 1TK0A 4O0IA 4O5EA 5J2AA 5DBAA 9ICUA 1LV5A 5EWEA 5J29A 4F2SA 4MEYA 5DBCA 5CJ7A 2ZTEA 1ZQZA 3Q8RB 3QZ8A 3M9MB 3KHLA 2UVUA 4FBTA 4O5CA 7ICLA 5KFGA 5KTQA 3UQ0A 2JEGA 4O5KA 1NKEA 4UBBA 4M9LA 9ICXA 1X9SA 1QLNA 2VA8A 3V7KA
chains in the Genus database with same CATH superfamily
2WHEA 4J03A 1ZD4A 3ZD8A 1XC9A 3PV8A 4EENA 2G09A 3PW5A 5KFCA 3KHRA 4DF8A 4ECXA 4KLFA 4M6WA 2F77X 2ASJA 3HILA 3E58A 2ZJAA 4Y2UA 1ZQDA 5TZVA 4KLEA 4QZIA 2AGPA 4Q45A 4JV2A 4P4PA 1NZPA 3MFHA 3PVXA 4KX3A 2HHSA 3CRXA 3V72A 5KG7A 3IDWA 2XC9A 3D6JA 3N7SC 2R8JA 2OEHA 1NKCA 1TE2A 3WK9A 5ALMA 5KG4A 1A6SA 3G6YA 2D3DA 3BQ0A 3SAGA 3UMBA 2BHNA 4YP3A 1QQ6A 4I29A 2ISOA 2V4RA 5KFPA 1TAQA 1RXWA 1ZQSA 3ED5A 4UB8U 5KFSA 5DG9A 5ALYA 2W9AA 4PZOA 2LBOA 2ZIWA 2XCAA 1XWLA 4JUZA 2P35A 4DOBA 2M9NA 1Y88A 2EZXA 3E2EA 4FO6A 4AP9A 2PFNA 1B4FA 1NKBA 3Q8MA 1N5XA 4F4WA 5KL8B 4UASA 3RH4A 4BJQA 9ICWA 3MR3A 3QEAZ 1YT3A 7ICQA 2F8LA 3NRZA 5KFBA 3SQIA 4CNQA 2E5SA 5KT6A 4R8UA 2J6UA 4Z6CA 1GO3F 3KZIU 1S77D 4F4KA 4NLGA 4DF4A 3PMLA 1TFRA 1DK3A 9ICKA 3LVVA 4YR0A 5KFFA 4QW8A 2YTUA 5GTIU 4F5NA 3ZDDA 4IQWA 1KRPA 3HX0A 5J0RA 5ALWA 8ICVA 8ICBA 3SMVA 5HP4A 1Z19A 1T8EA 1ZQBA 4M47A 4NL9A 4P0QB 5KFJA 4GXKA 5J0TA 2LYAA 4YR3A 4DSKA 2HHVA 3F2CA 2BPGA 7ICTA 4RQ6A 1RPLA 4DSJA 1B43A 2HBKA 5DQHA 5KFQA 3SEIA 1XSLA 4KLUA 4ED2A 5JUMA 1RG6A 2OWOA 2CN1A 3PX4A 2EAMA 1NK4A 1DOQA 1XNSA 4P0PB 2NYVA 4EZ9A 9ICSA 5IIJA 2HHQA 2KKVA 3IG8A 5KFLA 4MFAA 4QWEA 2CXYA 4F50A 3PW0A 4U7CA 5L9XA 5KG0A 1B22A 4IRDA 3OHBA 2YMMA 2WTFA 3T5LA 1KSPA 1RXVA 2HBLA 4Z6FA 1U4BA 2KD1A 2KJ5A 8ICCA 3BS7A 5AI5A 3NTUA 4DLEA 3OPXA 4FZMA 4RT2A 2JEJA 2H5XA 8ICOA 5KT2A 2DUYA 1ZQEA 9ICOA 3RH6A 1L3TA 3S6JA 4CE6A 4DQQA 7ICGA 1ZXIA 4IRCA 1QTMA 3FM9A 4O3RA 7ICIA 1WUDA 4FFDA 5AK6A 4O3OA 2ZJ5A 3Q8QB 3KTQA 1U45A 1PK3A 2YY6A 4QIWF 3C28A 4DL6A 5EE3A 2IA6A 2XY5A 2DL0A 2C2DA 2B21A 2F1JA 2W3RA 5G5GA 3TFSA 3SYZA 3K1RB 3HWTA 3H8MA 3PNCA 3HP6A 2K4EA 5DQIA 4QJFB 1KQQA 4UARA 4KITB 4E0DA 5J0UA 4Z6EA 5ALPA 4ELTA 5KFRA 5ALIA 5L1JA 4J9QA 2AU0A 1ZQLA 3KD3A 4RQNA 1BPZA 5DQGA 3LYSA 3BJYA 4JV0A 1S97A 4RUCA 3R9KA 4DSEA 1SB3C 7ICHA 3MGVA 8ICGA 4Y2YA 1COOA 2QLTA 2W9BB 5DLFA 3LWLA 2F44A 3C2KA 4Z6DA 3C2LA 1L8LA 5AM1A 2FI1A 3ZI4A 4P0QA 3JPPA 4PZNA 4ACOA 4QZBA 5HMMA 2WF7A 5DDMA 4F4XA 3WU2U 4OJ5A 2EANA 2ZJ8A 4GFJA 2KZMA 4RUAA 4UB5A 4EELA 2ESEA 1ZQTA 3QU7A 2PMZF 2QKQA 4DFKA 1F5SA 8ICJA 4P0PA 4U6PA 4QWDA 3WKBA 4J9RA 3OSNA 4J9NA 1T3NA 3LDAA 2WAQC 1C7YA 4DQIA 3QZ7A 3KHHA 5AK5A 4UAYA 3RJGA 2IOHA 5ALLA 3PMNA 4XUSA 7ICUA 5HR7A 9ICQA 1PUZA 2YB1A 4J9SA 1ZQ1C 3I28A 1NJZA 1DK2A 5AKEA 4OJLA 3FAHA 2NV3A 3UXPA 4ECSA 4UB6U 1U49A 1COKA 7ICVA 2Y9UA 4YN4A 3KOOA 1A0PA 5KAFU 5BOLA 2YN4A 1ZQIA 5KNIA 3M6ZA 1HEKA 5J8YC 3K75D 2HMXA 1TVAA 3MDCA 3M9NB 4QZDA 4HYKA 1KEJA 3RR8A 4M9HA 3AUOA 4PHPA 5KG1A 5L1KA 2CRXA 1KLNA 4C8KA 1SV0A 2AXTU 3HRDD 4OJOA 1F0MA 2A19A 2MSNA 4RQ3A 1CUKA 4OJ6A 5AIBA 4C0ZA 3MDAA 1ZRNA 4ECWA 4R66A 3OSPA 8ICHA 2KZ3A 8ICXA 2ZXHA 2KK0A 5KT3A 4QZFA 5AKZA 3G6XA 4GIBA 5F9LA 3H8JA 3AQEA 3B0YA 2LI6A 2DWQA 2W9BA 3GFKB 5D46A 1YZ6A 4DQRA 2VA2A 5ALDA 9ICFA 2K8CB 5KG6A 5J0XA 1KW4A 3EPGA 4JMUA 2OYYA 3T79A 1WCNA 1ZQWA 4F93B 1HIWA 1BPXA 1QSLA 4F4ZA 4IL6U 2ALZA 2KHVA 5CR0A 2ATLA 4XA5A 5HR6A 2JXJA 5DBAA 1LV5A 2UVUA 4O5CA 4C7ZA 7ICLA 5ALVA 4O5KA 4M9LA 9ICXA 2VA8A 3V7KA 1O08A 1S0NA 2P66A 2F8KA 2HW3A 1NK8A 2E8NA 2YB4A 2KFNA 3QUBA 4QZ8A 4B9MA 4RQ5A 1L3UA 3Q8LA 1SL2A 4DSIA 4KLOA 5DB8A 3QUCA 4F2RA 4CCHA 4C7YA 2FPLA 1L8OA 2JV3A 3H0LB 1D9DA 2KP7A 3WK8A 2OCEA 1IM4A 3LWMA 1UPHA 3RH5A 4ICAA 2EAPA 3H8SA 5KFMA 4OCZA 2HI0A 4K4IA 2W8KA 1TV9A 4QIWC 2FMQA 1DRGA 4JV1A 1SV4A 4YMNA 4P2HA 3C21A 1NI3A 3RB4A 4PHAA 1D8LA 3H7IA 4ED8A 4R64A 5AI8A 2E1EA 3WK5A 1B0XA 5J0QA 9ICGA 2QB0B 3HJEA 4R63A 5ALTA 3GV7B 1DXSA 3IG5A 4C8NA 5ALHA 4CF5A 3MGIA 3WKDA 4RQ4A 5AKGA 4DFJA 4TQRA 5ALNA 5EWFA 3Q8SB 2F76X 3N7RC 5ALQA 2BDPA 2H3QA 4Y2XA 2LHTA 2BZFA 9ICTA 4F5RA 3C5FA 1ZD2P 4J9PA 2YX8A 5KFIA 5IIOA 2W9CB 1WG8A 2AQ4A 3QU2A 4UB2A 3MGHA 4BWMA 3RF9A 3BS5B 4ZH4A 2HHTA 2PKEA 2XO7A 2WFAA 1KL9A 2F1IA 4BXOB 2HVIA 1NK6A 1LB2B 1MC8A 5DB7A 2HVHA 2PMZC 5AM4A 3RR7A 1RM6C 2QB1A 4IQUA 2D6FC 2J6TA 3V7JA 4I2DA 3V6HA 1X6IA 2KVSA 3GV8B 1CEZA 3PW4A 4US9A 3BDPA 2EZZA 2ASDA 2LYHA 5AI6A 3QNMA 2BDUA 4NWIA 1ZQUA 2NRVA 1UA1A 5DB9A 3ALRA 4GLXA 2E1FA 5E79U 4QW9A 3JPTA 8ICZA 5KFYA 2IHNA 4ELVA 4F92B 4DWIA 4PGYA 2ASLA 1JMSA 3HT3A 1SKSA 9ICVA 2VJ4A 3F5EA 3OTQA 5F3XB 2HHWA 4UW9A 3WKCA 3ETLA 3LVWA 5A0LA 4TQSA 3AL0B 3BZKA 3RJFA 1BPBA 4RPZA 2C2EA 3RJKA 3NRWA 2KEYA 2JEIA 4PPXA 2W3SA 1BNOA 1EXNA 4Y2PA 2Q4TA 3JPRA 1RDFA 3IM1A 3V6JA 2QB0A 5ALEA 5IINA 2F2AB 3SAFA 2I9GA 4EBEA 4RQ8A 4K4HA 1S10A 1X40A 2HHUA 8ICKA 9ICMA 4BUGA 4PGQA 1NOMA 2WB1F 4CRXA 4UATA 4YMOA 5JTIA 1FO4A 1U47A 1WWUA 4DL4A 3TKAA 5AM2A 3TACB 1SGGA 8ICWA 2MA1A 2VA3A 5TISU 1JROA 4PL1A 4KLJA 5DKWA 8ICQA 3JPOA 3KKAA 3A0HU 3ZD9A 2WF8A 4TURA 2BGWA 2I1QA 2W9CA 2DFLA 3GZFA 1LVHA 4YXMA 1NJWA 2KIVA 3PY8A 4KLSA 1HJPA 4C8OA 2GO7A 7ICPA 4IQTA 2OHFA 3BS5A 4WJ3B 3T3FA 3RJIA 7ICSA 4BXOA 5BPCA 1TKDA 8ICEA 1ZQGA 2R8GA 1ECWA 1AQ6A 2IOFA 4ECUA 2JHDA 2G07A 1ZQFA 4ED7A 1K1QA 2LM4A 3BQ1A 3RFAA 1ZQOA 1SKRA 2K4PA 4YR2A 3RJEA 2HBJA 5AKLA 4F4YA 1T94A 4NLBA 1KFDA 5EWGA 5CP2A 1TAUA 2RDJA 5J2DA 3ZDEA 1ZD3A 4I27A 3WKEA 1RZTA 1BVSA 1S0OA 8ICAA 4PGXA 1ZD5A 1BPYA 3QXGA 4J9LA 4IRKA 1DGJA 2KOBA 4RQ0A 3PSIA 3UM9A 4R65A 2XGQA 1SWWA 1RYUA 2PFOA 4MHVA 9ICJA 1JN3A 2KSOB 1NK0A 2ZUDA 1QQ7A 3H4BA 4I2GA 1NK9A 5KFAA 4KX5A 3PR5B 3PX6A 4JWNA 5AKJA 5J8YA 5HHIA 2F3NA 4I2EA 1T3QA 2VJ5A 4B9SA 3A0BU 1SWVA 4C4SA 2LMRA 2VKQA 5KFZA 3IN5A 1QSYA 1JIHA 1MSWD 1N2XA 2FMPA 2ZG6A 2AGOA 2D8CA 1ZOLA 3NGDA 3QU4A 5J0WA 5L1MA 4LVSA 3TADC 5H2FU 2ZIVB 2UVVA 9ICIA 4QZHA 2W03A 3JPQA 3AM9A 3FDSA 5D49A 5KL1B 7ICFA 5ALGA 1C20A 4EEYA 1ZQXA 2Y0SF 4PHDA 2XY6A 1ZQNA 4UB4A 4LJXA 4GC6A 4YD1A 2EH9A 3NASA 2KMDA 4O5EA 4MEYA 5DBCA 3Q8RB 2AH5A 1ED1A 5KTQA 1Q8KA 2LYBA 5L1LA 5EE1A 4KLQA 3UPQA 3U26A 4ED0A 5DG8A 1ZQAA 4QZEA 3QEBZ 5KT7A 3MBYA 2JEFA 5GTHU 4M9JA 5AIAA 4PL2A 4DFMA 2K8BB 4C4TA 4RQ1A 4ECQA 2E3TA 1NK7A 1MN8A 1SZHA 1OXJA 2FLPA 3D2NA 4O3QA 2A1JB 4GXJA 1CI4A 4EX6A 3F2DA 4ECRA 4NLCA 4GXIA 3N4MB 4P4MA 2NRWA 2KN7A 2AHOB 3AQFA 2UVRA 8ICFA 2DPIA 5EOZA 1H38A 2BPFA 4M9GA 5ALFA 1JUDA 3EW9A 3CP8A 3IV6A 3SV3A 3PW7A 5KFTA 2A1AA 3NVZA 2KSOA 4YMMA 5F9NA 2HCFA 3FYHA 4TUQA 1ZQQA 3UMGA 1Q46A 4YVZA 3QE9Y 5KT5A 2PFQA 1BPEA 3CYMA 2AJQA 4LZGA 1M6YA 4DS4A 4B9VA 3T5HA 4QNLA 3RRHA 1ZJMA 3WK4A 1D8BA 2BCQA 5AKHA 1O03A 3PSTA 2FLLA 2R18A 1IXRA 4RZRA 3THVA 9ICLA 1FIQA 3RB6A 2ZIVA 2ZUCA 1X9MA 3NVYA 1KFSA 4PHEA 1IG6A 4I28A 4I2JA 4B9UA 2M0NA 3AU6A 4F5PA 4B6JA 1N56A 3I76A 5CHGA 1ZQHA 5G5HA 4NLNA 1RQLA 2C28A 2WB1C 4BDPA 1UHUA 2VIXA 2ZUBA 2KE7A 3QU9A 5KG2A 4DOCA 5J2IA 5CB1A 1NNLA 3AU2A 4O3PA 1N5WA 2ES6A 2ZIUB 4UAWA 8ICSA 2HOFA 4ECYA 1CRXA 1UCVA 2G0AA 4EX7A 4NM2A 4I2IA 1OUQA 4J9KA 2EAOA 3F2BA 3BQ7A 3O0FA 1Z1VA 4ED3A 3QU5A 5ALSA 1WWVA 4DEZA 4RNNA 3SZ2A 3C1YA 2W04A 5T14A 3CNHA 5DGBA 3QYPA 4ED6A 1Z3EB 2E8PA 2E8MA 2K8AA 2A1JA 9ICEA 2GOLA 4TUSA 4CF3A 2NRZA 5KT4A 3V7LA 7ICMA 2BQUA 5KFHA 3MC1A 2MRLA 5B66U 2PI5A 2WF9A 5J0YA 2RP5A 3GU3A 3ZDBA 1PVQA 4DCCA 5DB6A 9ICAA 3EWAA 1QSSA 4EYHB 3QUQA 4DOAA 2G5IB 1KDHA 2DQNB 5IIMA 3KFUF 4EYIB 1F44A 1PK1B 4I2CA 2CPRA 2W9MA 2W43A 3IHQB 1WCLA 3TAQA 4M9NA 7ICOA 2K4HA 8ICTA 4EBDA 4KMUA 4RPYA 2F1HA 5J2GA 2NRTA 4DFPA 1KFTA 3CW2C 4RT3A 1URJA 5AI0A 3PSFA 3ISCA 5J2KA 3C29A 4NJ8A 4YQWA 4M04A 3DEEA 4C8MA 3UMCA 1L3VA 1JXEA 3OGUA 4I2AA 3L3FX 1L3SA 2BCVA 4UBCA 3EZ5A 8ICMA 3RAXA 3N28A 1SKWA 3ISDA 5CRXA 4DL7A 4IC9A 1S8OA 4O3MA 5AI4A 5ALKA 5CA7A 4EEKA 7ICEA 4UQGA 2FDRA 4QWAA 4QZAA 1ZQPA 2W7OA 4NV0A 3GILA 3SV4A 4O9MA 3SAHA 1QQ5A 4KLLA 5BOMA 2FJ6A 3H4DA 1N61A 3UXNA 4F8RA 2ZIUA 4IS7A 2Y0SC 2FMSA 4IR9A 2V4QA 2R8HA 5L1IA 2FLNA 1X66A 5JU5A 3RBDA 2ZTCA 1J2MA 2E8OA 2W8LA 3EPIA 2PXIA 3Q8PB 1BPDA 1X9WA 1HUOA 4PH5A 1XSPA 9ICCA 3LK9A 5KFEA 4MF8A 1LKYB 4UB1A 2BKEA 3GIIA 9ICHA 1N48A 2XGPA 4DQPA 3UQ2A 1XO1A 5DDYA 1VLBA 2K89A 4GC7A 1ZYQA 4DSFA 4QWBA 4I2HA 5ALRA 5J0SA 3B0XA 4RNOA 4JB3A 3B9JA 4Y2QA 4BGDA 5C0YA 2W54A 1PK1A 8ICRA 5FP0A 4KN7A 1JI7A 1SL0A 2GH1A 2YMQA 3MR5A 4K4GA 9ICBA 1XU4A 5AKYA 2IOFK 2VANA 3TARA 2KIWA 3GDXA 4AYBF 2G5HB 2KHQA 2DKXA 5KFWA 4X5VA 4C80A 3PO4A 5C5JA 4FZNA 3F5AA 5KFVA 4DO9A 1TK8A 1Z00B 1N62A 3F53A 4YCXA 2KICA 1V9PA 2G08A 3H0MB 5JRTA 2GWSA 2V9WA 4ECZA 4US8A 3SD7A 4QWCA 1Z4OA 8ICIA 2BCSA 2NRXA 2MAXA 1U9LA 4JWMA 2HHXA 4FS1A 3PO5A 4RU9A 2IHMA 4UAZA 2R8IA 1UT5A 2PFPA 3PSPA 4F5OA 4PJ0U 2KTQA 3TAPA 2HSZA 2W11A 1MQ3A 2RQ5A 5AKXA 3EUB2 5DGAA 2EZYA 1K1SA 5HHHA 4O0IA 3TADA 5J2AA 9ICUA 1J2NA 2DBYA 4OO1J 5J29A 3PZPA 2ZTEA 1ZQZA 3HKZF 2W7PA 2JEGA 4Y2JA 1SIJA 1XO0A 4UAVA 2XICA 2H3VA 4J9OA 1FFUA 5HMLA 4DL3A 1KKXA 5CWRA 3C1ZA 4IR1A 2YQEA 2BQRA 2Y1IA 4EZ6A 1XS9D 5ALOA 3V6KA 2PI4A 3JPSA 3WK7A 1P7DA 3SR6A 3FC4A 1KBUA 3RTVA 1DGSA 3QUTA 2H3ZA 4DSLA 2DF4B 2FE9A 2JH7A 3PR4A 3T5KA 4ECVA 3RBEA 1L7PA 3MFIA 5ALJA 3H8WA 5ALXA 3K4GA 4RPXA 1LKYA 2XI9A 2JMGA 2Y1JA 1Q3VA 1V97A 2JR5A 1WYGA 5KAIU 2LPEA 3D2SA 2ZXIA 2XCPA 4YG2A 3WKAA 2IBKA 3GIMA 2FPKA 5AKIA 5K4LA 4Q44A 5J0OA 3GQCA 3C2MA 2KJ8A 1MQ2A 1SZPA 2WF6A 2QARB 2MUTB 1S76D 3M6KA 2B6GA 4DQSA 2N1RA 5B5EU 3ONNA 5AM3A 1U48A 8ICYA 4CGZA 2HOQA 3AN1A 4C4RA 2H3IA 2GLEA 4QZCA 4MFCA 1ZQYA 1A77A 4MEXA 3KBBA 2KVCA 4ECTA 4NLKA 4M0AA 3RB3A 3K1ZA 2MU2A 5CEHA 2G06A 4NL9C 1BNPA 4JK1A 4DFDA 1BGXT 5J2HA 2KNJA 4P4OA 3NVWA 9ICRA 1Z00A 3RRGA 3UXOA 3TI0A 1S0MA 3M7DA 3BQ2A 4CDGA 3G6VA 4Q8EA 4MFFA 8ICLA 3KKAC 2BCRA 9ICNA 1N63A 3M1YA 1JRPA 1HUZA 2RLTA 8ICNA 4IQVA 4F91B 1FFVA 1VDVA 3ICXA 4RNMA 3KHGA 4KLMA 3NVVA 2HBMA 1QCKA 3AMZA 1X42A 4XQ8A 5KFNA 3GIJA 3T5JA 4F5QA 2HDOA 5KFKA 2DPJA 3IRUA 7ICKA 5ALUA 4I2BA 2J6SA 2O6KA 3VC8A 2L5YA 2KV2A 1YZ7A 4OJPA 4NY8A 4QZGA 1L7NA 2P6RA 1NZBA 2FPMA 1ZQRA 3MABA 3GV5B 4OD0A 1MA7A 5IILA 5KFOA 5J2JA 2C2RA 2XY7A 2RHFA 5AHXA 4BX9C 1UT8A 1Q3UA 5KFXA 1ZQMA 4ELUA 5AKKA 3EYZA 1J97A 1TAMA 1QH9A 2P6UA 5J2EA 4Y2VA 2WF5A 4A8EA 2I6XA 1A76A 4RQ7A 3ORYA 5KFUA 7ICNA 4Q43A 1JXLA 3E0FA 1N60A 2KG5A 3J81j 1RYRA 2YMLA 2QARA 2DGZA 2MUTA 3ETRA 1PZNA 1V85A 3H40A 4NLZA 1X2IA 4Q8FA 2KJ9A 5AM0A 1S0VA 2A3VA 1OW5A 2K60A 4DS5A 4FBUA 1PVPA 2ISPA 2OM6A 3L4PA 4LZDA 1RYSA 1RQNA 4EBCA 2RRDA 1ZETA 2EDUA 1JALA 2EQYA 2Q0ZX 5HNKA 2OXOA 4DLGA 2BQ3A 2XIDA 4TUPA 3M8SA 5KG5A 4UAUA 3DV9A 3NS1A 1JX4A 4AYBC 2JGAA 3ZDCA 4YFKA 4USAA 4C8LA 3AEVA 9ICPA 3C5GA 5AK3A 3TANA 3M8RA 4Y2SA 4RQMA 2UVWA 3KZXA 4XRHA 4ZOHC 4FZLA 3BQTA 4KMOB 3WK6A 1NJXA 4KLGA 3HW8A 4DL2A 2AQ0A 2RDIA 2W55A 3RJJA 5DG7A 3TQ1A 3NUQA 8ICPA 3I1YA 5IIIA 1UA0A 2JZBB 5EE0A 1L5UA 2JRZA 2BCUA 2XVTA 3BZCA 2ZIXB 4J9MA 3PX0A 4I2FA 4F72A 3VCBA 1TK5A 1L6NA 1ZQJA 1SL1A 4YD2A 1KTQA 1ZQVA 5KFDA 1D9FA 2K4IA 4YXJA 1Z1BA 5DLGA 3M9OB 5J2BA 2ODGA 4F3OA 1ZQKA 1L7MA 3JPNA 1ZJNA 4KTQA 4M6WB 3N7PD 1L7OA 5AI9A 7ICJA 3HKZC 2ZTDA 1X9XA 4RQ2A 3ISBA 7ICRA 1ZRMA 1NJYA 3MR2A 2YMPA 3N97B 1Z4NA 1V38A 4KLIA 3RB0A 1SV0C 4MF2A 5ALZA 5D4BA 3TFRA 1S5LU 2LKYA 3L5KA 3RAQA 2HOIA 1XSNA 4KLTA 3DDHA 3ZDAA 1AROP 1UQVA 1SXEA 4BWJA 5IIKA 4DL5A 4NXZA 4UB3A 2ZIWB 2KKPA 4O3NA 1T4GA 4M2YA 3QX7A 5AICA 5KG3A 5DBBA 2KZZA 8ICUA 4QZ9A 3Q8KA 4B9TA 4Y2RA 2DKZA 1T7PA 1VJ5A 1IIPA 1KN5A 1FEZA 4KN4A 3SI8A 4KLDA 5J2FA 4R8UB 4B9NA 5EE9A 4ED1A 3HPOA 3H0RB 5J0PA 2H3FA 2BR0A 1K5OA 2NO4A 2AGQA 1D8YA 3OJUA 2C22A 1ZQCA 2KFZA 4B9LA 2B0CA 4KLHA 2I5HA 2BPCA 3C23A 3MR6A 1SXDA 1NK5A 3GIKA 1X6JA 2R8KA 4Y2TA 2LM1A 4O3SA 1IV8A 5J2CA 3OJSA 3IP4B 2IMWP 3RJHA 4F71A 2OH2A 2JH1A 4NM1A 4G9BA 2JZBA 4G3IA 1PVRA 2WAQF 4FS2A 3PW2A 2ZIXA 1S9FA 3OHAA 5AM5A 1TK0A 4HAIA 5EWEA 2Y9TA 4F2SA 3D2QA 5CJ7A 3KHLA 3M9MB 5AK4A 3QZ8A 2Z7JA 4FBTA 3SENA 5KFGA 4CF4A 3UQ0A 4FE3A 1NKEA 2NO5A 4UBBA 1X9SA 1QLNA
chains in the Genus database with same CATH topology
5L1LA 1S0NA 4J9OA 2P66A 3ZD8A 5HMLA 4DL3A 3UPQA 1XC9A 4KLQA 3PV8A 5CWRA 4ED0A 3C1ZA 5DG8A 1ZQAA 2BQRA 4QZEA 3PW5A 3QEBZ 5KFCA 3KHRA 2Y1IA 4IR1A 4DF8A 4ECXA 4KLFA 4M6WA 4EZ6A 5KT7A 1XS9D 3V6KA 2HW3A 1NK8A 3MBYA 2ASJA 2PI4A 3JPSA 2JEFA 4M9JA 2KFNA 2ZJAA 4QZ8A 3RTVA 1DGSA 4B9MA 4RQ5A 1ZQDA 5TZVA 4DFMA 1L3UA 4DSLA 4KLEA 4QZIA 2AGPA 4Q45A 3PR4A 4JV2A 3T5KA 4RQ1A 4P4PA 4ECQA 4ECVA 3Q8LA 3MFHA 3PVXA 3RBEA 1NK7A 1SL2A 4DSIA 3MFIA 4KLOA 5DB8A 4F2RA 4CCHA 2HHSA 3H8WA 3V72A 2FPLA 5KG7A 2FLPA 3K4GA 4RPXA 2XC9A 1D9DA 2R8JA 2Y1JA 4O3QA 2A1JB 1NKCA 5KG4A 4GXJA 3G6YA 1IM4A 2XCPA 4YG2A 4GXIA 4ECRA 3BQ0A 2IBKA 3GIMA 3N4MB 2FPKA 4P4MA 2BHNA 2NRWA 4YP3A 4I29A 2ISOA 2V4RA 3LWMA 5KFPA 2KN7A 2UVRA 8ICFA 1TAQA 4Q44A 5J0OA 3RH5A 2DPIA 1RXWA 1ZQSA 5EOZA 3GQCA 5KFSA 5DG9A 3C2MA 1SZPA 1MQ2A 1H38A 2BPFA 4M9GA 5KFMA 3H8SA 2W9AA 3EW9A 2XCAA 2MUTB 1S76D 3SV3A 3PW7A 5KFTA 4K4IA 1XWLA 2W8KA 4DQSA 1TV9A 4JUZA 4YMMA 1U48A 2FMQA 5F9NA 4JV1A 8ICYA 4DOBA 3FYHA 2M9NA 4TUQA 1Y88A 4YMNA 1ZQQA 3E2EA 4FO6A 4P2HA 2PFNA 3C21A 4QZCA 4MFCA 3QE9Y 4YVZA 3RB4A 1NKBA 3Q8MA 5KT5A 4PHAA 4F4WA 1D8LA 3RH4A 3H7IA 1ZQYA 3MR3A 3QEAZ 9ICWA 1A77A 4ED8A 2PFQA 4R64A 4MEXA 7ICQA 1BPEA 2AJQA 4LZGA 5KFBA 4ECTA 4NLKA 4M0AA 3RB3A 5KT6A 4R8UA 4JK1A 5J0QA 9ICGA 2J6UA 4Z6CA 4DS4A 4B9VA 3T5HA 4R63A 1BGXT 5J2HA 1S77D 4F4KA 3RRHA 1ZJMA 3GV7B 4NLGA 4DF4A 2BCQA 4P4OA 3PMLA 1TFRA 4C8NA 9ICKA 4YR0A 2FLLA 9ICRA 5KFFA 1Z00A 4QW8A 3RRGA 3UXOA 3TI0A 1S0MA 4F5NA 3BQ2A 3ZDDA 3MGIA 4IQWA 3G6VA 1KRPA 4Q8EA 1IXRA 5J0RA 4RZRA 3HX0A 4MFFA 3THVA 4RQ4A 8ICLA 9ICLA 4DFJA 2BCRA 8ICVA 4TQRA 9ICNA 1HUZA 5EWFA 8ICBA 3RB6A 4IQVA 8ICNA 4F91B 5HP4A 1T8EA 1ZQBA 2ZUCA 1X9MA 3Q8SB 4M47A 1KFSA 5KFJA 4PHEA 4RNMA 4GXKA 4I2JA 5J0TA 4I28A 4YR3A 2BDPA 3KHGA 4KLMA 4B9UA 4DSKA 2HHVA 3AU6A 2BPGA 7ICTA 4F5PA 4RQ6A 1RPLA 4DSJA 9ICTA 1N56A 1B43A 5CHGA 5DQHA 1ZQHA 4F5RA 4NLNA 3C5FA 5KFQA 4XQ8A 5KFNA 2C28A 1XSLA 4J9PA 3GIJA 3T5JA 4BDPA 4KLUA 4F5QA 2ZUBA 4ED2A 5KFIA 5JUMA 5IIOA 5KG2A 2OWOA 5KFKA 4DOCA 2DPJA 2W9CB 5J2IA 5CB1A 2AQ4A 3PX4A 4UB2A 1NK4A 1DOQA 7ICKA 4I2BA 2J6SA 3AU2A 4O3PA 4EZ9A 9ICSA 3MGHA 4BWMA 5IIJA 4UAWA 4ZH4A 2HHTA 2HHQA 8ICSA 5KFLA 4MFAA 2XO7A 4ECYA 4NY8A 4QWEA 2F1IA 4QZGA 4BXOB 4F50A 3PW0A 1NK6A 2P6RA 1LB2B 2HVIA 2FPMA 5L9XA 5KG0A 1B22A 4NM2A 1MC8A 4I2IA 3MABA 4J9KA 5DB7A 3GV5B 1ZQRA 4IRDA 2HVHA 5IILA 3OHBA 2WTFA 5KFOA 5J2JA 3T5LA 2C2RA 1RXVA 1KSPA 2XY7A 3RR7A 4Z6FA 4ED3A 1U4BA 1UT8A 8ICCA 5KFXA 3NTUA 4DLEA 4RT2A 4IQUA 4DEZA 1ZQMA 2H5XA 2J6TA 4RNNA 3V7JA 2JEJA 4ELUA 3SZ2A 3C1YA 4I2DA 8ICOA 3EYZA 5KT2A 1ZQEA 3V6HA 9ICOA 3RH6A 1L3TA 2P6UA 3GV8B 5J2EA 1CEZA 3PW4A 4DQQA 5DGBA 7ICGA 3BDPA 4ED6A 1QTMA 1Z3EB 4IRCA 4O3RA 2ASDA 2LYHA 2A1JA 9ICEA 4TUSA 7ICIA 2NRZA 4RQ7A 5KT4A 1A76A 1ZQUA 2ZJ5A 2NRVA 3ORYA 3V7LA 4O3OA 3Q8QB 2BQUA 5KFHA 5KFUA 1UA1A 1U45A 5DB9A 7ICMA 7ICNA 4DL6A 4Q43A 1JXLA 2PI5A 4GLXA 2IA6A 4QW9A 5J0YA 2XY5A 3JPTA 8ICZA 5KFYA 2C2DA 3ZDBA 2B21A 2IHNA 1RYRA 2F1JA 4ELVA 4F92B 4DWIA 3TFSA 5DB6A 3SYZA 9ICAA 2MUTA 4PGYA 3EWAA 1PZNA 3HWTA 4EYHB 1JMSA 3HT3A 3H40A 4DOAA 2ASLA 1SKSA 4NLZA 1KDHA 9ICVA 1X2IA 5IIMA 3PNCA 4EYIB 4Q8FA 2HHWA 1S0VA 3KTQA 3HP6A 3ETLA 5DQIA 4I2CA 4TQSA 4KITB 2W9MA 4DS5A 4FBUA 3IHQB 3RJFA 1WCLA 5J0UA 1BPBA 4Z6EA 3TAQA 4RPZA 2ISPA 4M9NA 2C2EA 4LZDA 3RJKA 1RYSA 8ICTA 4EBDA 2JEIA 4KMUA 4PPXA 4EBCA 4RPYA 4ELTA 2F1HA 5KFRA 5L1JA 5J2GA 1EXNA 4J9QA 2AU0A 1ZQLA 2NRTA 1BPZA 4DFPA 5DQGA 1ZETA 3JPRA 3IM1A 1KFTA 4RT3A 3BJYA 3V6JA 5HNKA 2Q0ZX 4JV0A 1S97A 3ISCA 4RUCA 5IINA 4DLGA 5J2KA 2BQ3A 4DSEA 2I9GA 4TUPA 3M8SA 4EBEA 7ICHA 4RQ8A 5KG5A 4YQWA 4K4HA 8ICGA 4M04A 4C8MA 1S10A 2HHUA 1COOA 1L3VA 1JX4A 1JXEA 3OGUA 2W9BB 5DLFA 3ZDCA 8ICKA 4YFKA 4I2AA 9ICMA 4C8LA 1L3SA 2BCVA 4UBCA 9ICPA 3C5GA 3LWLA 3EZ5A 8ICMA 3TANA 3M8RA 3C2KA 4PGQA 3RAXA 4Z6DA 3C2LA 1NOMA 1SKWA 2UVWA 3ISDA 4XRHA 4YMOA 1U47A 4DL4A 3JPPA 4DL7A 3BQTA 4QZBA 1NJXA 5HMMA 4KLGA 3HW8A 4DL2A 8ICWA 2AQ0A 2RDIA 3RJJA 5DG7A 2VA3A 5DDMA 3TQ1A 4F4XA 5CA7A 5DKWA 4KLJA 8ICQA 5IIIA 3JPOA 7ICEA 1UA0A 8ICPA 2JZBB 4UQGA 1L5UA 2ZJ8A 2BCUA 4QWAA 2KZMA 4QZAA 4RUAA 1ZQPA 4UB5A 3GILA 3SV4A 4J9MA 3ZD9A 4O9MA 3PX0A 4I2FA 4TURA 2BGWA 2I1QA 2W9CA 1ZQTA 2DFLA 1TK5A 1ZQJA 4DFKA 4YXMA 1NJWA 1SL1A 3PY8A 4KLLA 4KLSA 1HJPA 4YD2A 5BOMA 4C8OA 1KTQA 8ICJA 7ICPA 3H4DA 1ZQVA 5KFDA 1D9FA 4QWDA 3UXNA 4J9RA 4YXJA 5DLGA 3OSNA 4IQTA 4J9NA 3M9OB 4F8RA 5J2BA 1T3NA 2FMSA 3LDAA 4IR9A 4F3OA 2V4QA 2R8HA 3T3FA 5L1IA 1C7YA 2FLNA 4DQIA 3RJIA 7ICSA 4BXOA 1ZQKA 3QZ7A 3RBDA 3KHHA 2ZTCA 5BPCA 1TKDA 4UAYA 2W8LA 3RJGA 3EPIA 1ZQGA 8ICEA 3JPNA 2PXIA 1ZJNA 3Q8PB 2R8GA 4KTQA 3PMNA 4M6WB 4XUSA 4ECUA 7ICUA 1ZQFA 4ED7A 1BPDA 7ICJA 9ICQA 1X9WA 2ZTDA 1K1QA 1HUOA 4RQ2A 3BQ1A 4J9SA 1ZQOA 1SKRA 3ISBA 7ICRA 3RJEA 4YR2A 4PH5A 1XSPA 9ICCA 1NJYA 1NJZA 3LK9A 5KFEA 4MF8A 4F4YA 5EWGA 1KFDA 3UXPA 4ECSA 5CP2A 3MR2A 1U49A 3N97B 2RDJA 5J2DA 3ZDEA 4KLIA 1TAUA 7ICVA 3RB0A 4YN4A 4UB1A 4MF2A 2BKEA 5D4BA 3GIIA 3TFRA 4I27A 9ICHA 1RZTA 1N48A 5BOLA 1BVSA 1S0OA 8ICAA 4PGXA 1ZQIA 1BPYA 3RAQA 2XGPA 4DQPA 3UQ2A 1XSNA 1XO1A 5DDYA 4KLTA 3ZDAA 3K75D 4J9LA 4IRKA 1AROP 1TVAA 4RQ0A 4QZDA 3M9NB 3MDCA 4BWJA 5IIKA 4DL5A 4NXZA 4HYKA 4UB3A 1KEJA 4GC7A 4R65A 1ZYQA 3RR8A 4DSFA 4M9HA 4QWBA 2XGQA 3AUOA 4I2HA 4PHPA 5KG1A 4O3NA 5J0SA 5L1KA 2PFOA 1T4GA 3B0XA 4M2YA 9ICJA 1KLNA 1JN3A 4C8KA 4RNOA 1NK0A 2ZUDA 4BGDA 5KG3A 3H4BA 4I2GA 8ICRA 5DBBA 2KZZA 4KN7A 1NK9A 8ICUA 5KFAA 4QZ9A 3Q8KA 1SL0A 4B9TA 3MR5A 9ICBA 4K4GA 4RQ3A 1XU4A 3PR5B 2VANA 3PX6A 4JWNA 1CUKA 1T7PA 3TARA 5HHIA 4I2EA 3GDXA 3MDAA 4ECWA 4E0DA 4KN4A 4R66A 3OSPA 8ICHA 4B9SA 3SI8A 2KZ3A 5KFWA 5J2FA 4KLDA 8ICXA 4X5VA 4R8UB 3PO4A 5C5JA 5KT3A 4QZFA 3G6XA 1QSSA 4B9NA 5KFZA 4ED1A 3HPOA 2BR0A 5J0PA 5F9LA 3H8JA 1QSYA 1JIHA 3B0YA 1MSWD 2AGQA 5KFVA 2FMPA 1D8YA 2AGOA 4DO9A 3OJUA 1TK8A 2W9BA 2C22A 1ZQCA 1Z00B 3GFKB 3NGDA 4B9LA 2KFZA 4YCXA 5D46A 4KLHA 4DQRA 2BPCA 2VA2A 3C23A 3MR6A 9ICFA 1V9PA 1NK5A 5J0WA 4LVSA 3GIKA 2R8KA 2GWSA 5KG6A 5J0XA 2UVVA 2V9WA 4ECZA 4O3SA 3EPGA 7ICOA 4QWCA 9ICIA 5J2CA 8ICIA 2BCSA 2NRXA 2MAXA 3OJSA 4QZHA 1U9LA 3JPQA 2IMWP 4JWMA 2HHXA 4FS1A 3PO5A 4RU9A 1WCNA 4UAZA 2R8IA 2IHMA 3RJHA 3FDSA 1UT5A 1ZQWA 5D49A 4F93B 2PFPA 7ICFA 4EEYA 1ZQXA 4F5OA 1BPXA 4NM1A 2JZBA 1QSLA 4G3IA 2KTQA 3TAPA 4F4ZA 1MQ3A 3PW2A 4PHDA 4FS2A 2XY6A 2ALZA 1ZQNA 5CR0A 1S9FA 4UB4A 5DGAA 2ATLA 1K1SA 4XA5A 5HHHA 3OHAA 4GC6A 4YD1A 1TK0A 4O0IA 4O5EA 5J2AA 5DBAA 9ICUA 1LV5A 5EWEA 5J29A 4F2SA 4MEYA 5DBCA 5CJ7A 2ZTEA 1ZQZA 3Q8RB 3QZ8A 3M9MB 3KHLA 2UVUA 4FBTA 4O5CA 7ICLA 5KFGA 5KTQA 3UQ0A 2JEGA 4O5KA 1NKEA 4UBBA 4M9LA 9ICXA 1X9SA 1QLNA 2VA8A 3V7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L1L A;  1S0N A;  4J9O A;  2P66 A;  3ZD8 A;  5HML A;  4DL3 A;  3UPQ A;  1XC9 A;  4KLQ A;  3PV8 A;  5CWR A;  4ED0 A;  3C1Z A;  5DG8 A;  1ZQA A;  2BQR A;  4QZE A;  3PW5 A;  3QEB Z;  5KFC A;  3KHR A;  2Y1I A;  4IR1 A;  4DF8 A;  4ECX A;  4KLF A;  4M6W A;  4EZ6 A;  5KT7 A;  1XS9 D;  3V6K A;  2HW3 A;  1NK8 A;  3MBY A;  2ASJ A;  2PI4 A;  3JPS A;  2JEF A;  4M9J A;  2KFN A;  2ZJA A;  4QZ8 A;  3RTV A;  1DGS A;  4B9M A;  4RQ5 A;  1ZQD A;  5TZV A;  4DFM A;  1L3U A;  4DSL A;  4KLE A;  4QZI A;  2AGP A;  4Q45 A;  3PR4 A;  4JV2 A;  3T5K A;  4RQ1 A;  4P4P A;  4ECQ A;  4ECV A;  3Q8L A;  3MFH A;  3PVX A;  3RBE A;  1NK7 A;  1SL2 A;  4DSI A;  3MFI A;  4KLO A;  5DB8 A;  4F2R A;  4CCH A;  2HHS A;  3H8W A;  3V72 A;  2FPL A;  5KG7 A;  2FLP A;  3K4G A;  4RPX A;  2XC9 A;  1D9D A;  2R8J A;  2Y1J A;  4O3Q A;  2A1J B;  1NKC A;  5KG4 A;  4GXJ A;  3G6Y A;  1IM4 A;  2XCP A;  4YG2 A;  4GXI A;  4ECR A;  3BQ0 A;  2IBK A;  3GIM A;  3N4M B;  2FPK A;  4P4M A;  2BHN A;  2NRW A;  4YP3 A;  4I29 A;  2ISO A;  2V4R A;  3LWM A;  5KFP A;  2KN7 A;  2UVR A;  8ICF A;  1TAQ A;  4Q44 A;  5J0O A;  3RH5 A;  2DPI A;  1RXW A;  1ZQS A;  5EOZ A;  3GQC A;  5KFS A;  5DG9 A;  3C2M A;  1SZP A;  1MQ2 A;  1H38 A;  2BPF A;  4M9G A;  5KFM A;  3H8S A;  2W9A A;  3EW9 A;  2XCA A;  2MUT B;  1S76 D;  3SV3 A;  3PW7 A;  5KFT A;  4K4I A;  1XWL A;  2W8K A;  4DQS A;  1TV9 A;  4JUZ A;  4YMM A;  1U48 A;  2FMQ A;  5F9N A;  4JV1 A;  8ICY A;  4DOB A;  3FYH A;  2M9N A;  4TUQ A;  1Y88 A;  4YMN A;  1ZQQ A;  3E2E A;  4FO6 A;  4P2H A;  2PFN A;  3C21 A;  4QZC A;  4MFC A;  3QE9 Y;  4YVZ A;  3RB4 A;  1NKB A;  3Q8M A;  5KT5 A;  4PHA A;  4F4W A;  1D8L A;  3RH4 A;  3H7I A;  1ZQY A;  3MR3 A;  3QEA Z;  9ICW A;  1A77 A;  4ED8 A;  2PFQ A;  4R64 A;  4MEX A;  7ICQ A;  1BPE A;  2AJQ A;  4LZG A;  5KFB A;  4ECT A;  4NLK A;  4M0A A;  3RB3 A;  5KT6 A;  4R8U A;  4JK1 A;  5J0Q A;  9ICG A;  2J6U A;  4Z6C A;  4DS4 A;  4B9V A;  3T5H A;  4R63 A;  1BGX T;  5J2H A;  1S77 D;  4F4K A;  3RRH A;  1ZJM A;  3GV7 B;  4NLG A;  4DF4 A;  2BCQ A;  4P4O A;  3PML A;  1TFR A;  4C8N A;  9ICK A;  4YR0 A;  2FLL A;  9ICR A;  5KFF A;  1Z00 A;  4QW8 A;  3RRG A;  3UXO A;  3TI0 A;  1S0M A;  4F5N A;  3BQ2 A;  3ZDD A;  3MGI A;  4IQW A;  3G6V A;  1KRP A;  4Q8E A;  1IXR A;  5J0R A;  4RZR A;  3HX0 A;  4MFF A;  3THV A;  4RQ4 A;  8ICL A;  9ICL A;  4DFJ A;  2BCR A;  8ICV A;  4TQR A;  9ICN A;  1HUZ A;  5EWF A;  8ICB A;  3RB6 A;  4IQV A;  8ICN A;  4F91 B;  5HP4 A;  1T8E A;  1ZQB A;  2ZUC A;  1X9M A;  3Q8S B;  4M47 A;  1KFS A;  5KFJ A;  4PHE A;  4RNM A;  4GXK A;  4I2J A;  5J0T A;  4I28 A;  4YR3 A;  2BDP A;  3KHG A;  4KLM A;  4B9U A;  4DSK A;  2HHV A;  3AU6 A;  2BPG A;  7ICT A;  4F5P A;  4RQ6 A;  1RPL A;  4DSJ A;  9ICT A;  1N56 A;  1B43 A;  5CHG A;  5DQH A;  1ZQH A;  4F5R A;  4NLN A;  3C5F A;  5KFQ A;  4XQ8 A;  5KFN A;  2C28 A;  1XSL A;  4J9P A;  3GIJ A;  3T5J A;  4BDP A;  4KLU A;  4F5Q A;  2ZUB A;  4ED2 A;  5KFI A;  5JUM A;  5IIO A;  5KG2 A;  2OWO A;  5KFK A;  4DOC A;  2DPJ A;  2W9C B;  5J2I A;  5CB1 A;  2AQ4 A;  3PX4 A;  4UB2 A;  1NK4 A;  1DOQ A;  7ICK A;  4I2B A;  2J6S A;  3AU2 A;  4O3P A;  4EZ9 A;  9ICS A;  3MGH A;  4BWM A;  5IIJ A;  4UAW A;  4ZH4 A;  2HHT A;  2HHQ A;  8ICS A;  5KFL A;  4MFA A;  2XO7 A;  4ECY A;  4NY8 A;  4QWE A;  2F1I A;  4QZG A;  4BXO B;  4F50 A;  3PW0 A;  1NK6 A;  2P6R A;  1LB2 B;  2HVI A;  2FPM A;  5L9X A;  5KG0 A;  1B22 A;  4NM2 A;  1MC8 A;  4I2I A;  3MAB A;  4J9K A;  5DB7 A;  3GV5 B;  1ZQR A;  4IRD A;  2HVH A;  5IIL A;  3OHB A;  2WTF A;  5KFO A;  5J2J A;  3T5L A;  2C2R A;  1RXV A;  1KSP A;  2XY7 A;  3RR7 A;  4Z6F A;  4ED3 A;  1U4B A;  1UT8 A;  8ICC A;  5KFX A;  3NTU A;  4DLE A;  4RT2 A;  4IQU A;  4DEZ A;  1ZQM A;  2H5X A;  2J6T A;  4RNN A;  3V7J A;  2JEJ A;  4ELU A;  3SZ2 A;  3C1Y A;  4I2D A;  8ICO A;  3EYZ A;  5KT2 A;  1ZQE A;  3V6H A;  9ICO A;  3RH6 A;  1L3T A;  2P6U A;  3GV8 B;  5J2E A;  1CEZ A;  3PW4 A;  4DQQ A;  5DGB A;  7ICG A;  3BDP A;  4ED6 A;  1QTM A;  1Z3E B;  4IRC A;  4O3R A;  2ASD A;  2LYH A;  2A1J A;  9ICE A;  4TUS A;  7ICI A;  2NRZ A;  4RQ7 A;  5KT4 A;  1A76 A;  1ZQU A;  2ZJ5 A;  2NRV A;  3ORY A;  3V7L A;  4O3O A;  3Q8Q B;  2BQU A;  5KFH A;  5KFU A;  1UA1 A;  1U45 A;  5DB9 A;  7ICM A;  7ICN A;  4DL6 A;  4Q43 A;  1JXL A;  2PI5 A;  4GLX A;  2IA6 A;  4QW9 A;  5J0Y A;  2XY5 A;  3JPT A;  8ICZ A;  5KFY A;  2C2D A;  3ZDB A;  2B21 A;  2IHN A;  1RYR A;  2F1J A;  4ELV A;  4F92 B;  4DWI A;  3TFS A;  5DB6 A;  3SYZ A;  9ICA A;  2MUT A;  4PGY A;  3EWA A;  1PZN A;  3HWT A;  4EYH B;  1JMS A;  3HT3 A;  3H40 A;  4DOA A;  2ASL A;  1SKS A;  4NLZ A;  1KDH A;  9ICV A;  1X2I A;  5IIM A;  3PNC A;  4EYI B;  4Q8F A;  2HHW A;  1S0V A;  3KTQ A;  3HP6 A;  3ETL A;  5DQI A;  4I2C A;  4TQS A;  4KIT B;  2W9M A;  4DS5 A;  4FBU A;  3IHQ B;  3RJF A;  1WCL A;  5J0U A;  1BPB A;  4Z6E A;  3TAQ A;  4RPZ A;  2ISP A;  4M9N A;  2C2E A;  4LZD A;  3RJK A;  1RYS A;  8ICT A;  4EBD A;  2JEI A;  4KMU A;  4PPX A;  4EBC A;  4RPY A;  4ELT A;  2F1H A;  5KFR A;  5L1J A;  5J2G A;  1EXN A;  4J9Q A;  2AU0 A;  1ZQL A;  2NRT A;  1BPZ A;  4DFP A;  5DQG A;  1ZET A;  3JPR A;  3IM1 A;  1KFT A;  4RT3 A;  3BJY A;  3V6J A;  5HNK A;  2Q0Z X;  4JV0 A;  1S97 A;  3ISC A;  4RUC A;  5IIN A;  4DLG A;  5J2K A;  2BQ3 A;  4DSE A;  2I9G A;  4TUP A;  3M8S A;  4EBE A;  7ICH A;  4RQ8 A;  5KG5 A;  4YQW A;  4K4H A;  8ICG A;  4M04 A;  4C8M A;  1S10 A;  2HHU A;  1COO A;  1L3V A;  1JX4 A;  1JXE A;  3OGU A;  2W9B B;  5DLF A;  3ZDC A;  8ICK A;  4YFK A;  4I2A A;  9ICM A;  4C8L A;  1L3S A;  2BCV A;  4UBC A;  9ICP A;  3C5G A;  3LWL A;  3EZ5 A;  8ICM A;  3TAN A;  3M8R A;  3C2K A;  4PGQ A;  3RAX A;  4Z6D A;  3C2L A;  1NOM A;  1SKW A;  2UVW A;  3ISD A;  4XRH A;  4YMO A;  1U47 A;  4DL4 A;  3JPP A;  4DL7 A;  3BQT A;  4QZB A;  1NJX A;  5HMM A;  4KLG A;  3HW8 A;  4DL2 A;  8ICW A;  2AQ0 A;  2RDI A;  3RJJ A;  5DG7 A;  2VA3 A;  5DDM A;  3TQ1 A;  4F4X A;  5CA7 A;  5DKW A;  4KLJ A;  8ICQ A;  5III A;  3JPO A;  7ICE A;  1UA0 A;  8ICP A;  2JZB B;  4UQG A;  1L5U A;  2ZJ8 A;  2BCU A;  4QWA A;  2KZM A;  4QZA A;  4RUA A;  1ZQP A;  4UB5 A;  3GIL A;  3SV4 A;  4J9M A;  3ZD9 A;  4O9M A;  3PX0 A;  4I2F A;  4TUR A;  2BGW A;  2I1Q A;  2W9C A;  1ZQT A;  2DFL A;  1TK5 A;  1ZQJ A;  4DFK A;  4YXM A;  1NJW A;  1SL1 A;  3PY8 A;  4KLL A;  4KLS A;  1HJP A;  4YD2 A;  5BOM A;  4C8O A;  1KTQ A;  8ICJ A;  7ICP A;  3H4D A;  1ZQV A;  5KFD A;  1D9F A;  4QWD A;  3UXN A;  4J9R A;  4YXJ A;  5DLG A;  3OSN A;  4IQT A;  4J9N A;  3M9O B;  4F8R A;  5J2B A;  1T3N A;  2FMS A;  3LDA A;  4IR9 A;  4F3O A;  2V4Q A;  2R8H A;  3T3F A;  5L1I A;  1C7Y A;  2FLN A;  4DQI A;  3RJI A;  7ICS A;  4BXO A;  1ZQK A;  3QZ7 A;  3RBD A;  3KHH A;  2ZTC A;  5BPC A;  1TKD A;  4UAY A;  2W8L A;  3RJG A;  3EPI A;  1ZQG A;  8ICE A;  3JPN A;  2PXI A;  1ZJN A;  3Q8P B;  2R8G A;  4KTQ A;  3PMN A;  4M6W B;  4XUS A;  4ECU A;  7ICU A;  1ZQF A;  4ED7 A;  1BPD A;  7ICJ A;  9ICQ A;  1X9W A;  2ZTD A;  1K1Q A;  1HUO A;  4RQ2 A;  3BQ1 A;  4J9S A;  1ZQO A;  1SKR A;  3ISB A;  7ICR A;  3RJE A;  4YR2 A;  4PH5 A;  1XSP A;  9ICC A;  1NJY A;  1NJZ A;  3LK9 A;  5KFE A;  4MF8 A;  4F4Y A;  5EWG A;  1KFD A;  3UXP A;  4ECS A;  5CP2 A;  3MR2 A;  1U49 A;  3N97 B;  2RDJ A;  5J2D A;  3ZDE A;  4KLI A;  1TAU A;  7ICV A;  3RB0 A;  4YN4 A;  4UB1 A;  4MF2 A;  2BKE A;  5D4B A;  3GII A;  3TFR A;  4I27 A;  9ICH A;  1RZT A;  1N48 A;  5BOL A;  1BVS A;  1S0O A;  8ICA A;  4PGX A;  1ZQI A;  1BPY A;  3RAQ A;  2XGP A;  4DQP A;  3UQ2 A;  1XSN A;  1XO1 A;  5DDY A;  4KLT A;  3ZDA A;  3K75 D;  4J9L A;  4IRK A;  1ARO P;  1TVA A;  4RQ0 A;  4QZD A;  3M9N B;  3MDC A;  4BWJ A;  5IIK A;  4DL5 A;  4NXZ A;  4HYK A;  4UB3 A;  1KEJ A;  4GC7 A;  4R65 A;  1ZYQ A;  3RR8 A;  4DSF A;  4M9H A;  4QWB A;  2XGQ A;  3AUO A;  4I2H A;  4PHP A;  5KG1 A;  4O3N A;  5J0S A;  5L1K A;  2PFO A;  1T4G A;  3B0X A;  4M2Y A;  9ICJ A;  1KLN A;  1JN3 A;  4C8K A;  4RNO A;  1NK0 A;  2ZUD A;  4BGD A;  5KG3 A;  3H4B A;  4I2G A;  8ICR A;  5DBB A;  2KZZ A;  4KN7 A;  1NK9 A;  8ICU A;  5KFA A;  4QZ9 A;  3Q8K A;  1SL0 A;  4B9T A;  3MR5 A;  9ICB A;  4K4G A;  4RQ3 A;  1XU4 A;  3PR5 B;  2VAN A;  3PX6 A;  4JWN A;  1CUK A;  1T7P A;  3TAR A;  5HHI A;  4I2E A;  3GDX A;  3MDA A;  4ECW A;  4E0D A;  4KN4 A;  4R66 A;  3OSP A;  8ICH A;  4B9S A;  3SI8 A;  2KZ3 A;  5KFW A;  5J2F A;  4KLD A;  8ICX A;  4X5V A;  4R8U B;  3PO4 A;  5C5J A;  5KT3 A;  4QZF A;  3G6X A;  1QSS A;  4B9N A;  5KFZ A;  4ED1 A;  3HPO A;  2BR0 A;  5J0P A;  5F9L A;  3H8J A;  1QSY A;  1JIH A;  3B0Y A;  1MSW D;  2AGQ A;  5KFV A;  2FMP A;  1D8Y A;  2AGO A;  4DO9 A;  3OJU A;  1TK8 A;  2W9B A;  2C22 A;  1ZQC A;  1Z00 B;  3GFK B;  3NGD A;  4B9L A;  2KFZ A;  4YCX A;  5D46 A;  4KLH A;  4DQR A;  2BPC A;  2VA2 A;  3C23 A;  3MR6 A;  9ICF A;  1V9P A;  1NK5 A;  5J0W A;  4LVS A;  3GIK A;  2R8K A;  2GWS A;  5KG6 A;  5J0X A;  2UVV A;  2V9W A;  4ECZ A;  4O3S A;  3EPG A;  7ICO A;  4QWC A;  9ICI A;  5J2C A;  8ICI A;  2BCS A;  2NRX A;  2MAX A;  3OJS A;  4QZH A;  1U9L A;  3JPQ A;  2IMW P;  4JWM A;  2HHX A;  4FS1 A;  3PO5 A;  4RU9 A;  1WCN A;  4UAZ A;  2R8I A;  2IHM A;  3RJH A;  3FDS A;  1UT5 A;  1ZQW A;  5D49 A;  4F93 B;  2PFP A;  7ICF A;  4EEY A;  1ZQX A;  4F5O A;  1BPX A;  4NM1 A;  2JZB A;  1QSL A;  4G3I A;  2KTQ A;  3TAP A;  4F4Z A;  1MQ3 A;  3PW2 A;  4PHD A;  4FS2 A;  2XY6 A;  2ALZ A;  1ZQN A;  5CR0 A;  1S9F A;  4UB4 A;  5DGA A;  2ATL A;  1K1S A;  4XA5 A;  5HHH A;  3OHA A;  4GC6 A;  4YD1 A;  1TK0 A;  4O0I A;  4O5E A;  5J2A A;  5DBA A;  9ICU A;  1LV5 A;  5EWE A;  5J29 A;  4F2S A;  4MEY A;  5DBC A;  5CJ7 A;  2ZTE A;  1ZQZ A;  3Q8R B;  3QZ8 A;  3M9M B;  3KHL A;  2UVU A;  4FBT A;  4O5C A;  7ICL A;  5KFG A;  5KTQ A;  3UQ0 A;  2JEG A;  4O5K A;  1NKE A;  4UBB A;  4M9L A;  9ICX A;  1X9S A;  1QLN A;  2VA8 A;  3V7K A; 
#chains in the Genus database with same CATH topology
 2WHE A;  4J03 A;  1ZD4 A;  3ZD8 A;  1XC9 A;  3PV8 A;  4EEN A;  2G09 A;  3PW5 A;  5KFC A;  3KHR A;  4DF8 A;  4ECX A;  4KLF A;  4M6W A;  2F77 X;  2ASJ A;  3HIL A;  3E58 A;  2ZJA A;  4Y2U A;  1ZQD A;  5TZV A;  4KLE A;  4QZI A;  2AGP A;  4Q45 A;  4JV2 A;  4P4P A;  1NZP A;  3MFH A;  3PVX A;  4KX3 A;  2HHS A;  3CRX A;  3V72 A;  5KG7 A;  3IDW A;  2XC9 A;  3D6J A;  3N7S C;  2R8J A;  2OEH A;  1NKC A;  1TE2 A;  3WK9 A;  5ALM A;  5KG4 A;  1A6S A;  3G6Y A;  2D3D A;  3BQ0 A;  3SAG A;  3UMB A;  2BHN A;  4YP3 A;  1QQ6 A;  4I29 A;  2ISO A;  2V4R A;  5KFP A;  1TAQ A;  1RXW A;  1ZQS A;  3ED5 A;  4UB8 U;  5KFS A;  5DG9 A;  5ALY A;  2W9A A;  4PZO A;  2LBO A;  2ZIW A;  2XCA A;  1XWL A;  4JUZ A;  2P35 A;  4DOB A;  2M9N A;  1Y88 A;  2EZX A;  3E2E A;  4FO6 A;  4AP9 A;  2PFN A;  1B4F A;  1NKB A;  3Q8M A;  1N5X A;  4F4W A;  5KL8 B;  4UAS A;  3RH4 A;  4BJQ A;  9ICW A;  3MR3 A;  3QEA Z;  1YT3 A;  7ICQ A;  2F8L A;  3NRZ A;  5KFB A;  3SQI A;  4CNQ A;  2E5S A;  5KT6 A;  4R8U A;  2J6U A;  4Z6C A;  1GO3 F;  3KZI U;  1S77 D;  4F4K A;  4NLG A;  4DF4 A;  3PML A;  1TFR A;  1DK3 A;  9ICK A;  3LVV A;  4YR0 A;  5KFF A;  4QW8 A;  2YTU A;  5GTI U;  4F5N A;  3ZDD A;  4IQW A;  1KRP A;  3HX0 A;  5J0R A;  5ALW A;  8ICV A;  8ICB A;  3SMV A;  5HP4 A;  1Z19 A;  1T8E A;  1ZQB A;  4M47 A;  4NL9 A;  4P0Q B;  5KFJ A;  4GXK A;  5J0T A;  2LYA A;  4YR3 A;  4DSK A;  2HHV A;  3F2C A;  2BPG A;  7ICT A;  4RQ6 A;  1RPL A;  4DSJ A;  1B43 A;  2HBK A;  5DQH A;  5KFQ A;  3SEI A;  1XSL A;  4KLU A;  4ED2 A;  5JUM A;  1RG6 A;  2OWO A;  2CN1 A;  3PX4 A;  2EAM A;  1NK4 A;  1DOQ A;  1XNS A;  4P0P B;  2NYV A;  4EZ9 A;  9ICS A;  5IIJ A;  2HHQ A;  2KKV A;  3IG8 A;  5KFL A;  4MFA A;  4QWE A;  2CXY A;  4F50 A;  3PW0 A;  4U7C A;  5L9X A;  5KG0 A;  1B22 A;  4IRD A;  3OHB A;  2YMM A;  2WTF A;  3T5L A;  1KSP A;  1RXV A;  2HBL A;  4Z6F A;  1U4B A;  2KD1 A;  2KJ5 A;  8ICC A;  3BS7 A;  5AI5 A;  3NTU A;  4DLE A;  3OPX A;  4FZM A;  4RT2 A;  2JEJ A;  2H5X A;  8ICO A;  5KT2 A;  2DUY A;  1ZQE A;  9ICO A;  3RH6 A;  1L3T A;  3S6J A;  4CE6 A;  4DQQ A;  7ICG A;  1ZXI A;  4IRC A;  1QTM A;  3FM9 A;  4O3R A;  7ICI A;  1WUD A;  4FFD A;  5AK6 A;  4O3O A;  2ZJ5 A;  3Q8Q B;  3KTQ A;  1U45 A;  1PK3 A;  2YY6 A;  4QIW F;  3C28 A;  4DL6 A;  5EE3 A;  2IA6 A;  2XY5 A;  2DL0 A;  2C2D A;  2B21 A;  2F1J A;  2W3R A;  5G5G A;  3TFS A;  3SYZ A;  3K1R B;  3HWT A;  3H8M A;  3PNC A;  3HP6 A;  2K4E A;  5DQI A;  4QJF B;  1KQQ A;  4UAR A;  4KIT B;  4E0D A;  5J0U A;  4Z6E A;  5ALP A;  4ELT A;  5KFR A;  5ALI A;  5L1J A;  4J9Q A;  2AU0 A;  1ZQL A;  3KD3 A;  4RQN A;  1BPZ A;  5DQG A;  3LYS A;  3BJY A;  4JV0 A;  1S97 A;  4RUC A;  3R9K A;  4DSE A;  1SB3 C;  7ICH A;  3MGV A;  8ICG A;  4Y2Y A;  1COO A;  2QLT A;  2W9B B;  5DLF A;  3LWL A;  2F44 A;  3C2K A;  4Z6D A;  3C2L A;  1L8L A;  5AM1 A;  2FI1 A;  3ZI4 A;  4P0Q A;  3JPP A;  4PZN A;  4ACO A;  4QZB A;  5HMM A;  2WF7 A;  5DDM A;  4F4X A;  3WU2 U;  4OJ5 A;  2EAN A;  2ZJ8 A;  4GFJ A;  2KZM A;  4RUA A;  4UB5 A;  4EEL A;  2ESE A;  1ZQT A;  3QU7 A;  2PMZ F;  2QKQ A;  4DFK A;  1F5S A;  8ICJ A;  4P0P A;  4U6P A;  4QWD A;  3WKB A;  4J9R A;  3OSN A;  4J9N A;  1T3N A;  3LDA A;  2WAQ C;  1C7Y A;  4DQI A;  3QZ7 A;  3KHH A;  5AK5 A;  4UAY A;  3RJG A;  2IOH A;  5ALL A;  3PMN A;  4XUS A;  7ICU A;  5HR7 A;  9ICQ A;  1PUZ A;  2YB1 A;  4J9S A;  1ZQ1 C;  3I28 A;  1NJZ A;  1DK2 A;  5AKE A;  4OJL A;  3FAH A;  2NV3 A;  3UXP A;  4ECS A;  4UB6 U;  1U49 A;  1COK A;  7ICV A;  2Y9U A;  4YN4 A;  3KOO A;  1A0P A;  5KAF U;  5BOL A;  2YN4 A;  1ZQI A;  5KNI A;  3M6Z A;  1HEK A;  5J8Y C;  3K75 D;  2HMX A;  1TVA A;  3MDC A;  3M9N B;  4QZD A;  4HYK A;  1KEJ A;  3RR8 A;  4M9H A;  3AUO A;  4PHP A;  5KG1 A;  5L1K A;  2CRX A;  1KLN A;  4C8K A;  1SV0 A;  2AXT U;  3HRD D;  4OJO A;  1F0M A;  2A19 A;  2MSN A;  4RQ3 A;  1CUK A;  4OJ6 A;  5AIB A;  4C0Z A;  3MDA A;  1ZRN A;  4ECW A;  4R66 A;  3OSP A;  8ICH A;  2KZ3 A;  8ICX A;  2ZXH A;  2KK0 A;  5KT3 A;  4QZF A;  5AKZ A;  3G6X A;  4GIB A;  5F9L A;  3H8J A;  3AQE A;  3B0Y A;  2LI6 A;  2DWQ A;  2W9B A;  3GFK B;  5D46 A;  1YZ6 A;  4DQR A;  2VA2 A;  5ALD A;  9ICF A;  2K8C B;  5KG6 A;  5J0X A;  1KW4 A;  3EPG A;  4JMU A;  2OYY A;  3T79 A;  1WCN A;  1ZQW A;  4F93 B;  1HIW A;  1BPX A;  1QSL A;  4F4Z A;  4IL6 U;  2ALZ A;  2KHV A;  5CR0 A;  2ATL A;  4XA5 A;  5HR6 A;  2JXJ A;  5DBA A;  1LV5 A;  2UVU A;  4O5C A;  4C7Z A;  7ICL A;  5ALV A;  4O5K A;  4M9L A;  9ICX A;  2VA8 A;  3V7K A;  1O08 A;  1S0N A;  2P66 A;  2F8K A;  2HW3 A;  1NK8 A;  2E8N A;  2YB4 A;  2KFN A;  3QUB A;  4QZ8 A;  4B9M A;  4RQ5 A;  1L3U A;  3Q8L A;  1SL2 A;  4DSI A;  4KLO A;  5DB8 A;  3QUC A;  4F2R A;  4CCH A;  4C7Y A;  2FPL A;  1L8O A;  2JV3 A;  3H0L B;  1D9D A;  2KP7 A;  3WK8 A;  2OCE A;  1IM4 A;  3LWM A;  1UPH A;  3RH5 A;  4ICA A;  2EAP A;  3H8S A;  5KFM A;  4OCZ A;  2HI0 A;  4K4I A;  2W8K A;  1TV9 A;  4QIW C;  2FMQ A;  1DRG A;  4JV1 A;  1SV4 A;  4YMN A;  4P2H A;  3C21 A;  1NI3 A;  3RB4 A;  4PHA A;  1D8L A;  3H7I A;  4ED8 A;  4R64 A;  5AI8 A;  2E1E A;  3WK5 A;  1B0X A;  5J0Q A;  9ICG A;  2QB0 B;  3HJE A;  4R63 A;  5ALT A;  3GV7 B;  1DXS A;  3IG5 A;  4C8N A;  5ALH A;  4CF5 A;  3MGI A;  3WKD A;  4RQ4 A;  5AKG A;  4DFJ A;  4TQR A;  5ALN A;  5EWF A;  3Q8S B;  2F76 X;  3N7R C;  5ALQ A;  2BDP A;  2H3Q A;  4Y2X A;  2LHT A;  2BZF A;  9ICT A;  4F5R A;  3C5F A;  1ZD2 P;  4J9P A;  2YX8 A;  5KFI A;  5IIO A;  2W9C B;  1WG8 A;  2AQ4 A;  3QU2 A;  4UB2 A;  3MGH A;  4BWM A;  3RF9 A;  3BS5 B;  4ZH4 A;  2HHT A;  2PKE A;  2XO7 A;  2WFA A;  1KL9 A;  2F1I A;  4BXO B;  2HVI A;  1NK6 A;  1LB2 B;  1MC8 A;  5DB7 A;  2HVH A;  2PMZ C;  5AM4 A;  3RR7 A;  1RM6 C;  2QB1 A;  4IQU A;  2D6F C;  2J6T A;  3V7J A;  4I2D A;  3V6H A;  1X6I A;  2KVS A;  3GV8 B;  1CEZ A;  3PW4 A;  4US9 A;  3BDP A;  2EZZ A;  2ASD A;  2LYH A;  5AI6 A;  3QNM A;  2BDU A;  4NWI A;  1ZQU A;  2NRV A;  1UA1 A;  5DB9 A;  3ALR A;  4GLX A;  2E1F A;  5E79 U;  4QW9 A;  3JPT A;  8ICZ A;  5KFY A;  2IHN A;  4ELV A;  4F92 B;  4DWI A;  4PGY A;  2ASL A;  1JMS A;  3HT3 A;  1SKS A;  9ICV A;  2VJ4 A;  3F5E A;  3OTQ A;  5F3X B;  2HHW A;  4UW9 A;  3WKC A;  3ETL A;  3LVW A;  5A0L A;  4TQS A;  3AL0 B;  3BZK A;  3RJF A;  1BPB A;  4RPZ A;  2C2E A;  3RJK A;  3NRW A;  2KEY A;  2JEI A;  4PPX A;  2W3S A;  1BNO A;  1EXN A;  4Y2P A;  2Q4T A;  3JPR A;  1RDF A;  3IM1 A;  3V6J A;  2QB0 A;  5ALE A;  5IIN A;  2F2A B;  3SAF A;  2I9G A;  4EBE A;  4RQ8 A;  4K4H A;  1S10 A;  1X40 A;  2HHU A;  8ICK A;  9ICM A;  4BUG A;  4PGQ A;  1NOM A;  2WB1 F;  4CRX A;  4UAT A;  4YMO A;  5JTI A;  1FO4 A;  1U47 A;  1WWU A;  4DL4 A;  3TKA A;  5AM2 A;  3TAC B;  1SGG A;  8ICW A;  2MA1 A;  2VA3 A;  5TIS U;  1JRO A;  4PL1 A;  4KLJ A;  5DKW A;  8ICQ A;  3JPO A;  3KKA A;  3A0H U;  3ZD9 A;  2WF8 A;  4TUR A;  2BGW A;  2I1Q A;  2W9C A;  2DFL A;  3GZF A;  1LVH A;  4YXM A;  1NJW A;  2KIV A;  3PY8 A;  4KLS A;  1HJP A;  4C8O A;  2GO7 A;  7ICP A;  4IQT A;  2OHF A;  3BS5 A;  4WJ3 B;  3T3F A;  3RJI A;  7ICS A;  4BXO A;  5BPC A;  1TKD A;  8ICE A;  1ZQG A;  2R8G A;  1ECW A;  1AQ6 A;  2IOF A;  4ECU A;  2JHD A;  2G07 A;  1ZQF A;  4ED7 A;  1K1Q A;  2LM4 A;  3BQ1 A;  3RFA A;  1ZQO A;  1SKR A;  2K4P A;  4YR2 A;  3RJE A;  2HBJ A;  5AKL A;  4F4Y A;  1T94 A;  4NLB A;  1KFD A;  5EWG A;  5CP2 A;  1TAU A;  2RDJ A;  5J2D A;  3ZDE A;  1ZD3 A;  4I27 A;  3WKE A;  1RZT A;  1BVS A;  1S0O A;  8ICA A;  4PGX A;  1ZD5 A;  1BPY A;  3QXG A;  4J9L A;  4IRK A;  1DGJ A;  2KOB A;  4RQ0 A;  3PSI A;  3UM9 A;  4R65 A;  2XGQ A;  1SWW A;  1RYU A;  2PFO A;  4MHV A;  9ICJ A;  1JN3 A;  2KSO B;  1NK0 A;  2ZUD A;  1QQ7 A;  3H4B A;  4I2G A;  1NK9 A;  5KFA A;  4KX5 A;  3PR5 B;  3PX6 A;  4JWN A;  5AKJ A;  5J8Y A;  5HHI A;  2F3N A;  4I2E A;  1T3Q A;  2VJ5 A;  4B9S A;  3A0B U;  1SWV A;  4C4S A;  2LMR A;  2VKQ A;  5KFZ A;  3IN5 A;  1QSY A;  1JIH A;  1MSW D;  1N2X A;  2FMP A;  2ZG6 A;  2AGO A;  2D8C A;  1ZOL A;  3NGD A;  3QU4 A;  5J0W A;  5L1M A;  4LVS A;  3TAD C;  5H2F U;  2ZIV B;  2UVV A;  9ICI A;  4QZH A;  2W03 A;  3JPQ A;  3AM9 A;  3FDS A;  5D49 A;  5KL1 B;  7ICF A;  5ALG A;  1C20 A;  4EEY A;  1ZQX A;  2Y0S F;  4PHD A;  2XY6 A;  1ZQN A;  4UB4 A;  4LJX A;  4GC6 A;  4YD1 A;  2EH9 A;  3NAS A;  2KMD A;  4O5E A;  4MEY A;  5DBC A;  3Q8R B;  2AH5 A;  1ED1 A;  5KTQ A;  1Q8K A;  2LYB A;  5L1L A;  5EE1 A;  4KLQ A;  3UPQ A;  3U26 A;  4ED0 A;  5DG8 A;  1ZQA A;  4QZE A;  3QEB Z;  5KT7 A;  3MBY A;  2JEF A;  5GTH U;  4M9J A;  5AIA A;  4PL2 A;  4DFM A;  2K8B B;  4C4T A;  4RQ1 A;  4ECQ A;  2E3T A;  1NK7 A;  1MN8 A;  1SZH A;  1OXJ A;  2FLP A;  3D2N A;  4O3Q A;  2A1J B;  4GXJ A;  1CI4 A;  4EX6 A;  3F2D A;  4ECR A;  4NLC A;  4GXI A;  3N4M B;  4P4M A;  2NRW A;  2KN7 A;  2AHO B;  3AQF A;  2UVR A;  8ICF A;  2DPI A;  5EOZ A;  1H38 A;  2BPF A;  4M9G A;  5ALF A;  1JUD A;  3EW9 A;  3CP8 A;  3IV6 A;  3SV3 A;  3PW7 A;  5KFT A;  2A1A A;  3NVZ A;  2KSO A;  4YMM A;  5F9N A;  2HCF A;  3FYH A;  4TUQ A;  1ZQQ A;  3UMG A;  1Q46 A;  4YVZ A;  3QE9 Y;  5KT5 A;  2PFQ A;  1BPE A;  3CYM A;  2AJQ A;  4LZG A;  1M6Y A;  4DS4 A;  4B9V A;  3T5H A;  4QNL A;  3RRH A;  1ZJM A;  3WK4 A;  1D8B A;  2BCQ A;  5AKH A;  1O03 A;  3PST A;  2FLL A;  2R18 A;  1IXR A;  4RZR A;  3THV A;  9ICL A;  1FIQ A;  3RB6 A;  2ZIV A;  2ZUC A;  1X9M A;  3NVY A;  1KFS A;  4PHE A;  1IG6 A;  4I28 A;  4I2J A;  4B9U A;  2M0N A;  3AU6 A;  4F5P A;  4B6J A;  1N56 A;  3I76 A;  5CHG A;  1ZQH A;  5G5H A;  4NLN A;  1RQL A;  2C28 A;  2WB1 C;  4BDP A;  1UHU A;  2VIX A;  2ZUB A;  2KE7 A;  3QU9 A;  5KG2 A;  4DOC A;  5J2I A;  5CB1 A;  1NNL A;  3AU2 A;  4O3P A;  1N5W A;  2ES6 A;  2ZIU B;  4UAW A;  8ICS A;  2HOF A;  4ECY A;  1CRX A;  1UCV A;  2G0A A;  4EX7 A;  4NM2 A;  4I2I A;  1OUQ A;  4J9K A;  2EAO A;  3F2B A;  3BQ7 A;  3O0F A;  1Z1V A;  4ED3 A;  3QU5 A;  5ALS A;  1WWV A;  4DEZ A;  4RNN A;  3SZ2 A;  3C1Y A;  2W04 A;  5T14 A;  3CNH A;  5DGB A;  3QYP A;  4ED6 A;  1Z3E B;  2E8P A;  2E8M A;  2K8A A;  2A1J A;  9ICE A;  2GOL A;  4TUS A;  4CF3 A;  2NRZ A;  5KT4 A;  3V7L A;  7ICM A;  2BQU A;  5KFH A;  3MC1 A;  2MRL A;  5B66 U;  2PI5 A;  2WF9 A;  5J0Y A;  2RP5 A;  3GU3 A;  3ZDB A;  1PVQ A;  4DCC A;  5DB6 A;  9ICA A;  3EWA A;  1QSS A;  4EYH B;  3QUQ A;  4DOA A;  2G5I B;  1KDH A;  2DQN B;  5IIM A;  3KFU F;  4EYI B;  1F44 A;  1PK1 B;  4I2C A;  2CPR A;  2W9M A;  2W43 A;  3IHQ B;  1WCL A;  3TAQ A;  4M9N A;  7ICO A;  2K4H A;  8ICT A;  4EBD A;  4KMU A;  4RPY A;  2F1H A;  5J2G A;  2NRT A;  4DFP A;  1KFT A;  3CW2 C;  4RT3 A;  1URJ A;  5AI0 A;  3PSF A;  3ISC A;  5J2K A;  3C29 A;  4NJ8 A;  4YQW A;  4M04 A;  3DEE A;  4C8M A;  3UMC A;  1L3V A;  1JXE A;  3OGU A;  4I2A A;  3L3F X;  1L3S A;  2BCV A;  4UBC A;  3EZ5 A;  8ICM A;  3RAX A;  3N28 A;  1SKW A;  3ISD A;  5CRX A;  4DL7 A;  4IC9 A;  1S8O A;  4O3M A;  5AI4 A;  5ALK A;  5CA7 A;  4EEK A;  7ICE A;  4UQG A;  2FDR A;  4QWA A;  4QZA A;  1ZQP A;  2W7O A;  4NV0 A;  3GIL A;  3SV4 A;  4O9M A;  3SAH A;  1QQ5 A;  4KLL A;  5BOM A;  2FJ6 A;  3H4D A;  1N61 A;  3UXN A;  4F8R A;  2ZIU A;  4IS7 A;  2Y0S C;  2FMS A;  4IR9 A;  2V4Q A;  2R8H A;  5L1I A;  2FLN A;  1X66 A;  5JU5 A;  3RBD A;  2ZTC A;  1J2M A;  2E8O A;  2W8L A;  3EPI A;  2PXI A;  3Q8P B;  1BPD A;  1X9W A;  1HUO A;  4PH5 A;  1XSP A;  9ICC A;  3LK9 A;  5KFE A;  4MF8 A;  1LKY B;  4UB1 A;  2BKE A;  3GII A;  9ICH A;  1N48 A;  2XGP A;  4DQP A;  3UQ2 A;  1XO1 A;  5DDY A;  1VLB A;  2K89 A;  4GC7 A;  1ZYQ A;  4DSF A;  4QWB A;  4I2H A;  5ALR A;  5J0S A;  3B0X A;  4RNO A;  4JB3 A;  3B9J A;  4Y2Q A;  4BGD A;  5C0Y A;  2W54 A;  1PK1 A;  8ICR A;  5FP0 A;  4KN7 A;  1JI7 A;  1SL0 A;  2GH1 A;  2YMQ A;  3MR5 A;  4K4G A;  9ICB A;  1XU4 A;  5AKY A;  2IOF K;  2VAN A;  3TAR A;  2KIW A;  3GDX A;  4AYB F;  2G5H B;  2KHQ A;  2DKX A;  5KFW A;  4X5V A;  4C80 A;  3PO4 A;  5C5J A;  4FZN A;  3F5A A;  5KFV A;  4DO9 A;  1TK8 A;  1Z00 B;  1N62 A;  3F53 A;  4YCX A;  2KIC A;  1V9P A;  2G08 A;  3H0M B;  5JRT A;  2GWS A;  2V9W A;  4ECZ A;  4US8 A;  3SD7 A;  4QWC A;  1Z4O A;  8ICI A;  2BCS A;  2NRX A;  2MAX A;  1U9L A;  4JWM A;  2HHX A;  4FS1 A;  3PO5 A;  4RU9 A;  2IHM A;  4UAZ A;  2R8I A;  1UT5 A;  2PFP A;  3PSP A;  4F5O A;  4PJ0 U;  2KTQ A;  3TAP A;  2HSZ A;  2W11 A;  1MQ3 A;  2RQ5 A;  5AKX A;  3EUB 2;  5DGA A;  2EZY A;  1K1S A;  5HHH A;  4O0I A;  3TAD A;  5J2A A;  9ICU A;  1J2N A;  2DBY A;  4OO1 J;  5J29 A;  3PZP A;  2ZTE A;  1ZQZ A;  3HKZ F;  2W7P A;  2JEG A;  4Y2J A;  1SIJ A;  1XO0 A;  4UAV A;  2XIC A;  2H3V A;  4J9O A;  1FFU A;  5HML A;  4DL3 A;  1KKX A;  5CWR A;  3C1Z A;  4IR1 A;  2YQE A;  2BQR A;  2Y1I A;  4EZ6 A;  1XS9 D;  5ALO A;  3V6K A;  2PI4 A;  3JPS A;  3WK7 A;  1P7D A;  3SR6 A;  3FC4 A;  1KBU A;  3RTV A;  1DGS A;  3QUT A;  2H3Z A;  4DSL A;  2DF4 B;  2FE9 A;  2JH7 A;  3PR4 A;  3T5K A;  4ECV A;  3RBE A;  1L7P A;  3MFI A;  5ALJ A;  3H8W A;  5ALX A;  3K4G A;  4RPX A;  1LKY A;  2XI9 A;  2JMG A;  2Y1J A;  1Q3V A;  1V97 A;  2JR5 A;  1WYG A;  5KAI U;  2LPE A;  3D2S A;  2ZXI A;  2XCP A;  4YG2 A;  3WKA A;  2IBK A;  3GIM A;  2FPK A;  5AKI A;  5K4L A;  4Q44 A;  5J0O A;  3GQC A;  3C2M A;  2KJ8 A;  1MQ2 A;  1SZP A;  2WF6 A;  2QAR B;  2MUT B;  1S76 D;  3M6K A;  2B6G A;  4DQS A;  2N1R A;  5B5E U;  3ONN A;  5AM3 A;  1U48 A;  8ICY A;  4CGZ A;  2HOQ A;  3AN1 A;  4C4R A;  2H3I A;  2GLE A;  4QZC A;  4MFC A;  1ZQY A;  1A77 A;  4MEX A;  3KBB A;  2KVC A;  4ECT A;  4NLK A;  4M0A A;  3RB3 A;  3K1Z A;  2MU2 A;  5CEH A;  2G06 A;  4NL9 C;  1BNP A;  4JK1 A;  4DFD A;  1BGX T;  5J2H A;  2KNJ A;  4P4O A;  3NVW A;  9ICR A;  1Z00 A;  3RRG A;  3UXO A;  3TI0 A;  1S0M A;  3M7D A;  3BQ2 A;  4CDG A;  3G6V A;  4Q8E A;  4MFF A;  8ICL A;  3KKA C;  2BCR A;  9ICN A;  1N63 A;  3M1Y A;  1JRP A;  1HUZ A;  2RLT A;  8ICN A;  4IQV A;  4F91 B;  1FFV A;  1VDV A;  3ICX A;  4RNM A;  3KHG A;  4KLM A;  3NVV A;  2HBM A;  1QCK A;  3AMZ A;  1X42 A;  4XQ8 A;  5KFN A;  3GIJ A;  3T5J A;  4F5Q A;  2HDO A;  5KFK A;  2DPJ A;  3IRU A;  7ICK A;  5ALU A;  4I2B A;  2J6S A;  2O6K A;  3VC8 A;  2L5Y A;  2KV2 A;  1YZ7 A;  4OJP A;  4NY8 A;  4QZG A;  1L7N A;  2P6R A;  1NZB A;  2FPM A;  1ZQR A;  3MAB A;  3GV5 B;  4OD0 A;  1MA7 A;  5IIL A;  5KFO A;  5J2J A;  2C2R A;  2XY7 A;  2RHF A;  5AHX A;  4BX9 C;  1UT8 A;  1Q3U A;  5KFX A;  1ZQM A;  4ELU A;  5AKK A;  3EYZ A;  1J97 A;  1TAM A;  1QH9 A;  2P6U A;  5J2E A;  4Y2V A;  2WF5 A;  4A8E A;  2I6X A;  1A76 A;  4RQ7 A;  3ORY A;  5KFU A;  7ICN A;  4Q43 A;  1JXL A;  3E0F A;  1N60 A;  2KG5 A;  3J81 j;  1RYR A;  2YML A;  2QAR A;  2DGZ A;  2MUT A;  3ETR A;  1PZN A;  1V85 A;  3H40 A;  4NLZ A;  1X2I A;  4Q8F A;  2KJ9 A;  5AM0 A;  1S0V A;  2A3V A;  1OW5 A;  2K60 A;  4DS5 A;  4FBU A;  1PVP A;  2ISP A;  2OM6 A;  3L4P A;  4LZD A;  1RYS A;  1RQN A;  4EBC A;  2RRD A;  1ZET A;  2EDU A;  1JAL A;  2EQY A;  2Q0Z X;  5HNK A;  2OXO A;  4DLG A;  2BQ3 A;  2XID A;  4TUP A;  3M8S A;  5KG5 A;  4UAU A;  3DV9 A;  3NS1 A;  1JX4 A;  4AYB C;  2JGA A;  3ZDC A;  4YFK A;  4USA A;  4C8L A;  3AEV A;  9ICP A;  3C5G A;  5AK3 A;  3TAN A;  3M8R A;  4Y2S A;  4RQM A;  2UVW A;  3KZX A;  4XRH A;  4ZOH C;  4FZL A;  3BQT A;  4KMO B;  3WK6 A;  1NJX A;  4KLG A;  3HW8 A;  4DL2 A;  2AQ0 A;  2RDI A;  2W55 A;  3RJJ A;  5DG7 A;  3TQ1 A;  3NUQ A;  8ICP A;  3I1Y A;  5III A;  1UA0 A;  2JZB B;  5EE0 A;  1L5U A;  2JRZ A;  2BCU A;  2XVT A;  3BZC A;  2ZIX B;  4J9M A;  3PX0 A;  4I2F A;  4F72 A;  3VCB A;  1TK5 A;  1L6N A;  1ZQJ A;  1SL1 A;  4YD2 A;  1KTQ A;  1ZQV A;  5KFD A;  1D9F A;  2K4I A;  4YXJ A;  1Z1B A;  5DLG A;  3M9O B;  5J2B A;  2ODG A;  4F3O A;  1ZQK A;  1L7M A;  3JPN A;  1ZJN A;  4KTQ A;  4M6W B;  3N7P D;  1L7O A;  5AI9 A;  7ICJ A;  3HKZ C;  2ZTD A;  1X9X A;  4RQ2 A;  3ISB A;  7ICR A;  1ZRM A;  1NJY A;  3MR2 A;  2YMP A;  3N97 B;  1Z4N A;  1V38 A;  4KLI A;  3RB0 A;  1SV0 C;  4MF2 A;  5ALZ A;  5D4B A;  3TFR A;  1S5L U;  2LKY A;  3L5K A;  3RAQ A;  2HOI A;  1XSN A;  4KLT A;  3DDH A;  3ZDA A;  1ARO P;  1UQV A;  1SXE A;  4BWJ A;  5IIK A;  4DL5 A;  4NXZ A;  4UB3 A;  2ZIW B;  2KKP A;  4O3N A;  1T4G A;  4M2Y A;  3QX7 A;  5AIC A;  5KG3 A;  5DBB A;  2KZZ A;  8ICU A;  4QZ9 A;  3Q8K A;  4B9T A;  4Y2R A;  2DKZ A;  1T7P A;  1VJ5 A;  1IIP A;  1KN5 A;  1FEZ A;  4KN4 A;  3SI8 A;  4KLD A;  5J2F A;  4R8U B;  4B9N A;  5EE9 A;  4ED1 A;  3HPO A;  3H0R B;  5J0P A;  2H3F A;  2BR0 A;  1K5O A;  2NO4 A;  2AGQ A;  1D8Y A;  3OJU A;  2C22 A;  1ZQC A;  2KFZ A;  4B9L A;  2B0C A;  4KLH A;  2I5H A;  2BPC A;  3C23 A;  3MR6 A;  1SXD A;  1NK5 A;  3GIK A;  1X6J A;  2R8K A;  4Y2T A;  2LM1 A;  4O3S A;  1IV8 A;  5J2C A;  3OJS A;  3IP4 B;  2IMW P;  3RJH A;  4F71 A;  2OH2 A;  2JH1 A;  4NM1 A;  4G9B A;  2JZB A;  4G3I A;  1PVR A;  2WAQ F;  4FS2 A;  3PW2 A;  2ZIX A;  1S9F A;  3OHA A;  5AM5 A;  1TK0 A;  4HAI A;  5EWE A;  2Y9T A;  4F2S A;  3D2Q A;  5CJ7 A;  3KHL A;  3M9M B;  5AK4 A;  3QZ8 A;  2Z7J A;  4FBT A;  3SEN A;  5KFG A;  4CF4 A;  3UQ0 A;  4FE3 A;  1NKE A;  2NO5 A;  4UBB A;  1X9S A;  1QLN A; 
#chains in the Genus database with same CATH homology
 5L1L A;  1S0N A;  4J9O A;  2P66 A;  3ZD8 A;  5HML A;  4DL3 A;  3UPQ A;  1XC9 A;  4KLQ A;  3PV8 A;  5CWR A;  4ED0 A;  3C1Z A;  5DG8 A;  1ZQA A;  2BQR A;  4QZE A;  3PW5 A;  3QEB Z;  5KFC A;  3KHR A;  2Y1I A;  4IR1 A;  4DF8 A;  4ECX A;  4KLF A;  4M6W A;  4EZ6 A;  5KT7 A;  1XS9 D;  3V6K A;  2HW3 A;  1NK8 A;  3MBY A;  2ASJ A;  2PI4 A;  3JPS A;  2JEF A;  4M9J A;  2KFN A;  2ZJA A;  4QZ8 A;  3RTV A;  1DGS A;  4B9M A;  4RQ5 A;  1ZQD A;  5TZV A;  4DFM A;  1L3U A;  4DSL A;  4KLE A;  4QZI A;  2AGP A;  4Q45 A;  3PR4 A;  4JV2 A;  3T5K A;  4RQ1 A;  4P4P A;  4ECQ A;  4ECV A;  3Q8L A;  3MFH A;  3PVX A;  3RBE A;  1NK7 A;  1SL2 A;  4DSI A;  3MFI A;  4KLO A;  5DB8 A;  4F2R A;  4CCH A;  2HHS A;  3H8W A;  3V72 A;  2FPL A;  5KG7 A;  2FLP A;  3K4G A;  4RPX A;  2XC9 A;  1D9D A;  2R8J A;  2Y1J A;  4O3Q A;  2A1J B;  1NKC A;  5KG4 A;  4GXJ A;  3G6Y A;  1IM4 A;  2XCP A;  4YG2 A;  4GXI A;  4ECR A;  3BQ0 A;  2IBK A;  3GIM A;  3N4M B;  2FPK A;  4P4M A;  2BHN A;  2NRW A;  4YP3 A;  4I29 A;  2ISO A;  2V4R A;  3LWM A;  5KFP A;  2KN7 A;  2UVR A;  8ICF A;  1TAQ A;  4Q44 A;  5J0O A;  3RH5 A;  2DPI A;  1RXW A;  1ZQS A;  5EOZ A;  3GQC A;  5KFS A;  5DG9 A;  3C2M A;  1SZP A;  1MQ2 A;  1H38 A;  2BPF A;  4M9G A;  5KFM A;  3H8S A;  2W9A A;  3EW9 A;  2XCA A;  2MUT B;  1S76 D;  3SV3 A;  3PW7 A;  5KFT A;  4K4I A;  1XWL A;  2W8K A;  4DQS A;  1TV9 A;  4JUZ A;  4YMM A;  1U48 A;  2FMQ A;  5F9N A;  4JV1 A;  8ICY A;  4DOB A;  3FYH A;  2M9N A;  4TUQ A;  1Y88 A;  4YMN A;  1ZQQ A;  3E2E A;  4FO6 A;  4P2H A;  2PFN A;  3C21 A;  4QZC A;  4MFC A;  3QE9 Y;  4YVZ A;  3RB4 A;  1NKB A;  3Q8M A;  5KT5 A;  4PHA A;  4F4W A;  1D8L A;  3RH4 A;  3H7I A;  1ZQY A;  3MR3 A;  3QEA Z;  9ICW A;  1A77 A;  4ED8 A;  2PFQ A;  4R64 A;  4MEX A;  7ICQ A;  1BPE A;  2AJQ A;  4LZG A;  5KFB A;  4ECT A;  4NLK A;  4M0A A;  3RB3 A;  5KT6 A;  4R8U A;  4JK1 A;  5J0Q A;  9ICG A;  2J6U A;  4Z6C A;  4DS4 A;  4B9V A;  3T5H A;  4R63 A;  1BGX T;  5J2H A;  1S77 D;  4F4K A;  3RRH A;  1ZJM A;  3GV7 B;  4NLG A;  4DF4 A;  2BCQ A;  4P4O A;  3PML A;  1TFR A;  4C8N A;  9ICK A;  4YR0 A;  2FLL A;  9ICR A;  5KFF A;  1Z00 A;  4QW8 A;  3RRG A;  3UXO A;  3TI0 A;  1S0M A;  4F5N A;  3BQ2 A;  3ZDD A;  3MGI A;  4IQW A;  3G6V A;  1KRP A;  4Q8E A;  1IXR A;  5J0R A;  4RZR A;  3HX0 A;  4MFF A;  3THV A;  4RQ4 A;  8ICL A;  9ICL A;  4DFJ A;  2BCR A;  8ICV A;  4TQR A;  9ICN A;  1HUZ A;  5EWF A;  8ICB A;  3RB6 A;  4IQV A;  8ICN A;  4F91 B;  5HP4 A;  1T8E A;  1ZQB A;  2ZUC A;  1X9M A;  3Q8S B;  4M47 A;  1KFS A;  5KFJ A;  4PHE A;  4RNM A;  4GXK A;  4I2J A;  5J0T A;  4I28 A;  4YR3 A;  2BDP A;  3KHG A;  4KLM A;  4B9U A;  4DSK A;  2HHV A;  3AU6 A;  2BPG A;  7ICT A;  4F5P A;  4RQ6 A;  1RPL A;  4DSJ A;  9ICT A;  1N56 A;  1B43 A;  5CHG A;  5DQH A;  1ZQH A;  4F5R A;  4NLN A;  3C5F A;  5KFQ A;  4XQ8 A;  5KFN A;  2C28 A;  1XSL A;  4J9P A;  3GIJ A;  3T5J A;  4BDP A;  4KLU A;  4F5Q A;  2ZUB A;  4ED2 A;  5KFI A;  5JUM A;  5IIO A;  5KG2 A;  2OWO A;  5KFK A;  4DOC A;  2DPJ A;  2W9C B;  5J2I A;  5CB1 A;  2AQ4 A;  3PX4 A;  4UB2 A;  1NK4 A;  1DOQ A;  7ICK A;  4I2B A;  2J6S A;  3AU2 A;  4O3P A;  4EZ9 A;  9ICS A;  3MGH A;  4BWM A;  5IIJ A;  4UAW A;  4ZH4 A;  2HHT A;  2HHQ A;  8ICS A;  5KFL A;  4MFA A;  2XO7 A;  4ECY A;  4NY8 A;  4QWE A;  2F1I A;  4QZG A;  4BXO B;  4F50 A;  3PW0 A;  1NK6 A;  2P6R A;  1LB2 B;  2HVI A;  2FPM A;  5L9X A;  5KG0 A;  1B22 A;  4NM2 A;  1MC8 A;  4I2I A;  3MAB A;  4J9K A;  5DB7 A;  3GV5 B;  1ZQR A;  4IRD A;  2HVH A;  5IIL A;  3OHB A;  2WTF A;  5KFO A;  5J2J A;  3T5L A;  2C2R A;  1RXV A;  1KSP A;  2XY7 A;  3RR7 A;  4Z6F A;  4ED3 A;  1U4B A;  1UT8 A;  8ICC A;  5KFX A;  3NTU A;  4DLE A;  4RT2 A;  4IQU A;  4DEZ A;  1ZQM A;  2H5X A;  2J6T A;  4RNN A;  3V7J A;  2JEJ A;  4ELU A;  3SZ2 A;  3C1Y A;  4I2D A;  8ICO A;  3EYZ A;  5KT2 A;  1ZQE A;  3V6H A;  9ICO A;  3RH6 A;  1L3T A;  2P6U A;  3GV8 B;  5J2E A;  1CEZ A;  3PW4 A;  4DQQ A;  5DGB A;  7ICG A;  3BDP A;  4ED6 A;  1QTM A;  1Z3E B;  4IRC A;  4O3R A;  2ASD A;  2LYH A;  2A1J A;  9ICE A;  4TUS A;  7ICI A;  2NRZ A;  4RQ7 A;  5KT4 A;  1A76 A;  1ZQU A;  2ZJ5 A;  2NRV A;  3ORY A;  3V7L A;  4O3O A;  3Q8Q B;  2BQU A;  5KFH A;  5KFU A;  1UA1 A;  1U45 A;  5DB9 A;  7ICM A;  7ICN A;  4DL6 A;  4Q43 A;  1JXL A;  2PI5 A;  4GLX A;  2IA6 A;  4QW9 A;  5J0Y A;  2XY5 A;  3JPT A;  8ICZ A;  5KFY A;  2C2D A;  3ZDB A;  2B21 A;  2IHN A;  1RYR A;  2F1J A;  4ELV A;  4F92 B;  4DWI A;  3TFS A;  5DB6 A;  3SYZ A;  9ICA A;  2MUT A;  4PGY A;  3EWA A;  1PZN A;  3HWT A;  4EYH B;  1JMS A;  3HT3 A;  3H40 A;  4DOA A;  2ASL A;  1SKS A;  4NLZ A;  1KDH A;  9ICV A;  1X2I A;  5IIM A;  3PNC A;  4EYI B;  4Q8F A;  2HHW A;  1S0V A;  3KTQ A;  3HP6 A;  3ETL A;  5DQI A;  4I2C A;  4TQS A;  4KIT B;  2W9M A;  4DS5 A;  4FBU A;  3IHQ B;  3RJF A;  1WCL A;  5J0U A;  1BPB A;  4Z6E A;  3TAQ A;  4RPZ A;  2ISP A;  4M9N A;  2C2E A;  4LZD A;  3RJK A;  1RYS A;  8ICT A;  4EBD A;  2JEI A;  4KMU A;  4PPX A;  4EBC A;  4RPY A;  4ELT A;  2F1H A;  5KFR A;  5L1J A;  5J2G A;  1EXN A;  4J9Q A;  2AU0 A;  1ZQL A;  2NRT A;  1BPZ A;  4DFP A;  5DQG A;  1ZET A;  3JPR A;  3IM1 A;  1KFT A;  4RT3 A;  3BJY A;  3V6J A;  5HNK A;  2Q0Z X;  4JV0 A;  1S97 A;  3ISC A;  4RUC A;  5IIN A;  4DLG A;  5J2K A;  2BQ3 A;  4DSE A;  2I9G A;  4TUP A;  3M8S A;  4EBE A;  7ICH A;  4RQ8 A;  5KG5 A;  4YQW A;  4K4H A;  8ICG A;  4M04 A;  4C8M A;  1S10 A;  2HHU A;  1COO A;  1L3V A;  1JX4 A;  1JXE A;  3OGU A;  2W9B B;  5DLF A;  3ZDC A;  8ICK A;  4YFK A;  4I2A A;  9ICM A;  4C8L A;  1L3S A;  2BCV A;  4UBC A;  9ICP A;  3C5G A;  3LWL A;  3EZ5 A;  8ICM A;  3TAN A;  3M8R A;  3C2K A;  4PGQ A;  3RAX A;  4Z6D A;  3C2L A;  1NOM A;  1SKW A;  2UVW A;  3ISD A;  4XRH A;  4YMO A;  1U47 A;  4DL4 A;  3JPP A;  4DL7 A;  3BQT A;  4QZB A;  1NJX A;  5HMM A;  4KLG A;  3HW8 A;  4DL2 A;  8ICW A;  2AQ0 A;  2RDI A;  3RJJ A;  5DG7 A;  2VA3 A;  5DDM A;  3TQ1 A;  4F4X A;  5CA7 A;  5DKW A;  4KLJ A;  8ICQ A;  5III A;  3JPO A;  7ICE A;  1UA0 A;  8ICP A;  2JZB B;  4UQG A;  1L5U A;  2ZJ8 A;  2BCU A;  4QWA A;  2KZM A;  4QZA A;  4RUA A;  1ZQP A;  4UB5 A;  3GIL A;  3SV4 A;  4J9M A;  3ZD9 A;  4O9M A;  3PX0 A;  4I2F A;  4TUR A;  2BGW A;  2I1Q A;  2W9C A;  1ZQT A;  2DFL A;  1TK5 A;  1ZQJ A;  4DFK A;  4YXM A;  1NJW A;  1SL1 A;  3PY8 A;  4KLL A;  4KLS A;  1HJP A;  4YD2 A;  5BOM A;  4C8O A;  1KTQ A;  8ICJ A;  7ICP A;  3H4D A;  1ZQV A;  5KFD A;  1D9F A;  4QWD A;  3UXN A;  4J9R A;  4YXJ A;  5DLG A;  3OSN A;  4IQT A;  4J9N A;  3M9O B;  4F8R A;  5J2B A;  1T3N A;  2FMS A;  3LDA A;  4IR9 A;  4F3O A;  2V4Q A;  2R8H A;  3T3F A;  5L1I A;  1C7Y A;  2FLN A;  4DQI A;  3RJI A;  7ICS A;  4BXO A;  1ZQK A;  3QZ7 A;  3RBD A;  3KHH A;  2ZTC A;  5BPC A;  1TKD A;  4UAY A;  2W8L A;  3RJG A;  3EPI A;  1ZQG A;  8ICE A;  3JPN A;  2PXI A;  1ZJN A;  3Q8P B;  2R8G A;  4KTQ A;  3PMN A;  4M6W B;  4XUS A;  4ECU A;  7ICU A;  1ZQF A;  4ED7 A;  1BPD A;  7ICJ A;  9ICQ A;  1X9W A;  2ZTD A;  1K1Q A;  1HUO A;  4RQ2 A;  3BQ1 A;  4J9S A;  1ZQO A;  1SKR A;  3ISB A;  7ICR A;  3RJE A;  4YR2 A;  4PH5 A;  1XSP A;  9ICC A;  1NJY A;  1NJZ A;  3LK9 A;  5KFE A;  4MF8 A;  4F4Y A;  5EWG A;  1KFD A;  3UXP A;  4ECS A;  5CP2 A;  3MR2 A;  1U49 A;  3N97 B;  2RDJ A;  5J2D A;  3ZDE A;  4KLI A;  1TAU A;  7ICV A;  3RB0 A;  4YN4 A;  4UB1 A;  4MF2 A;  2BKE A;  5D4B A;  3GII A;  3TFR A;  4I27 A;  9ICH A;  1RZT A;  1N48 A;  5BOL A;  1BVS A;  1S0O A;  8ICA A;  4PGX A;  1ZQI A;  1BPY A;  3RAQ A;  2XGP A;  4DQP A;  3UQ2 A;  1XSN A;  1XO1 A;  5DDY A;  4KLT A;  3ZDA A;  3K75 D;  4J9L A;  4IRK A;  1ARO P;  1TVA A;  4RQ0 A;  4QZD A;  3M9N B;  3MDC A;  4BWJ A;  5IIK A;  4DL5 A;  4NXZ A;  4HYK A;  4UB3 A;  1KEJ A;  4GC7 A;  4R65 A;  1ZYQ A;  3RR8 A;  4DSF A;  4M9H A;  4QWB A;  2XGQ A;  3AUO A;  4I2H A;  4PHP A;  5KG1 A;  4O3N A;  5J0S A;  5L1K A;  2PFO A;  1T4G A;  3B0X A;  4M2Y A;  9ICJ A;  1KLN A;  1JN3 A;  4C8K A;  4RNO A;  1NK0 A;  2ZUD A;  4BGD A;  5KG3 A;  3H4B A;  4I2G A;  8ICR A;  5DBB A;  2KZZ A;  4KN7 A;  1NK9 A;  8ICU A;  5KFA A;  4QZ9 A;  3Q8K A;  1SL0 A;  4B9T A;  3MR5 A;  9ICB A;  4K4G A;  4RQ3 A;  1XU4 A;  3PR5 B;  2VAN A;  3PX6 A;  4JWN A;  1CUK A;  1T7P A;  3TAR A;  5HHI A;  4I2E A;  3GDX A;  3MDA A;  4ECW A;  4E0D A;  4KN4 A;  4R66 A;  3OSP A;  8ICH A;  4B9S A;  3SI8 A;  2KZ3 A;  5KFW A;  5J2F A;  4KLD A;  8ICX A;  4X5V A;  4R8U B;  3PO4 A;  5C5J A;  5KT3 A;  4QZF A;  3G6X A;  1QSS A;  4B9N A;  5KFZ A;  4ED1 A;  3HPO A;  2BR0 A;  5J0P A;  5F9L A;  3H8J A;  1QSY A;  1JIH A;  3B0Y A;  1MSW D;  2AGQ A;  5KFV A;  2FMP A;  1D8Y A;  2AGO A;  4DO9 A;  3OJU A;  1TK8 A;  2W9B A;  2C22 A;  1ZQC A;  1Z00 B;  3GFK B;  3NGD A;  4B9L A;  2KFZ A;  4YCX A;  5D46 A;  4KLH A;  4DQR A;  2BPC A;  2VA2 A;  3C23 A;  3MR6 A;  9ICF A;  1V9P A;  1NK5 A;  5J0W A;  4LVS A;  3GIK A;  2R8K A;  2GWS A;  5KG6 A;  5J0X A;  2UVV A;  2V9W A;  4ECZ A;  4O3S A;  3EPG A;  7ICO A;  4QWC A;  9ICI A;  5J2C A;  8ICI A;  2BCS A;  2NRX A;  2MAX A;  3OJS A;  4QZH A;  1U9L A;  3JPQ A;  2IMW P;  4JWM A;  2HHX A;  4FS1 A;  3PO5 A;  4RU9 A;  1WCN A;  4UAZ A;  2R8I A;  2IHM A;  3RJH A;  3FDS A;  1UT5 A;  1ZQW A;  5D49 A;  4F93 B;  2PFP A;  7ICF A;  4EEY A;  1ZQX A;  4F5O A;  1BPX A;  4NM1 A;  2JZB A;  1QSL A;  4G3I A;  2KTQ A;  3TAP A;  4F4Z A;  1MQ3 A;  3PW2 A;  4PHD A;  4FS2 A;  2XY6 A;  2ALZ A;  1ZQN A;  5CR0 A;  1S9F A;  4UB4 A;  5DGA A;  2ATL A;  1K1S A;  4XA5 A;  5HHH A;  3OHA A;  4GC6 A;  4YD1 A;  1TK0 A;  4O0I A;  4O5E A;  5J2A A;  5DBA A;  9ICU A;  1LV5 A;  5EWE A;  5J29 A;  4F2S A;  4MEY A;  5DBC A;  5CJ7 A;  2ZTE A;  1ZQZ A;  3Q8R B;  3QZ8 A;  3M9M B;  3KHL A;  2UVU A;  4FBT A;  4O5C A;  7ICL A;  5KFG A;  5KTQ A;  3UQ0 A;  2JEG A;  4O5K A;  1NKE A;  4UBB A;  4M9L A;  9ICX A;  1X9S A;  1QLN A;  2VA8 A;  3V7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...