2KZ3A

Backbone 1h, 13c, and 15n chemical shift assignments for human rad51d from 1 to 83
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the N-terminal domain of human Rad51D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Putative uncharacterized protein RAD51L3
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kz3A00
4IQWA 3GV8B 5DLGA 3MFHA 2W8LA 7ICSA 3H8WA 1JXEA 4QZCA 3V72A 2C2EA 3PO5A 4RQ5A 4NXZA 4RPXA 4ED1A 4F5NA 4JUZA 3GV5B 1V9PA 5KFRA 4YMNA 3UQ0A 2FMSA 4R65A 2ASDA 4R63A 1KEJA 2F1IA 1TK5A 4O3NA 4ECXA 4F8RA 5KT6A 4ECVA 1U9LA 4NM1A 1D8YA 3Q8QB 3OJUA 3ISCA 4Z6CA 3B0XA 8ICFA 1ZQXA 5J2AA 3JPPA 3RJFA 1Z00B 5KFTA 1ZQWA 3ZDCA 4C8NA 3PV8A 7ICVA 4BWJA 3EPGA 1HUZA 3TAPA 3ZDDA 3UXPA 4QZBA 1H38A 5TZVA 1X9WA 4F3OA 2KFZA 1KFTA 3EW9A 2RDIA 2ZJ8A 1CUKA 1RZTA 5KFDA 4O5EA 3C21A 2DPJA 4QZIA 2UVWA 4ZH4A 4BGDA 2Y1JA 3MBYA 7ICHA 1NK5A 2BCRA 4KLMA 2ZJ5A 1ZQPA 4YP3A 4NLZA 4KLDA 3RB4A 3MDAA 2UVVA 1KFDA 1HJPA 8ICCA 5KFZA 3HPOA 8ICJA 4B9UA 1JXLA 3KHGA 3SYZA 2UVUA 3BDPA 2PFNA 4FBUA 5KFEA 3K4GA 4RPYA 4JV2A 3T5JA 1K1QA 3UXNA 4DOBA 5DG7A 4LVSA 8ICEA 1NJYA 3GQCA 3TAQA 7ICLA 1TVAA 9ICBA 3GIIA 5KFNA 1TAUA 3QEAZ 2MAXA 1COOA 1XSPA 2BCSA 3Q8MA 4KLQA 3B0YA 7ICJA 9ICGA 3V6HA 1TV9A 3ISDA 4M04A 2ZUBA 1DOQA 2P66A 5KFPA 5L1KA 1JN3A 4PH5A 2ZTCA 1U45A 3JPRA 4IRDA 4KMUA 4K4HA 4M9JA 4KLOA 5DQHA 2W9BA 7ICFA 3RJIA 2ASLA 4P4OA 4YFKA 3RJKA 5KT7A 4DL2A 5HHIA 9ICRA 1ZQNA 4F4WA 4MF2A 9ICSA 1ZQSA 3V7LA 5J2IA 4EYIB 5KFOA 4DLEA 4J9PA 4QW8A 3TARA 4M9NA 5KFVA 5KG7A 4IR1A 1ZQRA 8ICGA 1ZQDA 4GLXA 4YQWA 2IA6A 8ICHA 4JV1A 1NKEA 2AGQA 5L9XA 1MSWD 4I2EA 1A76A 3PW5A 4DFJA 3Q8LA 4M0AA 4ED6A 5CHGA 3RB6A 1L3TA 4DFKA 5DBBA 3PW2A 4KLLA 4KLSA 3M8SA 2KN7A 1LB2B 3MGIA 3ZD9A 3OJSA 1NJZA 4GXKA 5KG5A 2W9BB 2J6TA 7ICRA 1Y88A 1ZQOA 4CCHA 4DSKA 1NK7A 9ICUA 1TKDA 4DOCA 4F4ZA 3C1ZA 1UT8A 2NRVA 4UB1A 3LWLA 3T3FA 3PVXA 4F4KA 4M9GA 2ALZA 2JEIA 1N56A 3RBEA 4C8MA 2WTFA 2VA2A 8ICLA 5D4BA 8ICSA 4F5QA 1NKCA 3RTVA 4IRKA 4KTQA 4ED3A 4QZ9A 1NK8A 4I2DA 9ICFA 3C1YA 4TUQA 3PY8A 1ZQJA 4UB4A 4IQTA 3TI0A 1S10A 3LDAA 4I2AA 1T8EA 2IHNA 4KLJA 4NLNA 9ICPA 4DEZA 3TQ1A 3GIJA 2BPCA 1KFSA 1ZQUA 4I28A 8ICZA 2HHSA 1RYSA 5DB7A 3H8SA 2W9CB 3G6XA 3RB3A 5J0QA 3MGHA 3PX4A 4ED0A 2BCQA 2HHTA 5KFIA 3JPOA 4IR9A 9ICQA 3JPTA 1NK0A 1ZQEA 2XGQA 1ZQBA 7ICKA 1S0MA 5HNKA 2BCVA 4PHDA 4NLGA 4B9LA 1ZQTA 2JEJA 4B9NA 5CB1A 4O5KA 3V6KA 5IIJA 2I9GA 4IRCA 1JX4A 4XQ8A 5BOMA 4O3QA 2NRTA 4M6WA 5KTQA 1TK8A 3RJEA 3H4DA 2AU0A 2JEFA 3ZDEA 5CR0A 4TUPA 3RJJA 2RDJA 3HW8A 2V4QA 2AQ0A 2NRWA 1L3VA 2NRXA 1MQ3A 2PFQA 2ISOA 4RT3A 3OHBA 3ISBA 4F5PA 2A1JA 4GXIA 2V9WA 2BCUA 4O3SA 4PGXA 3ETLA 2HVIA 8ICPA 1BPBA 3GIMA 4QZFA 4KLHA 4KITB 4R8UB 1UA0A 1U4BA 9ICEA 3IM1A 1U47A 4GXJA 1S0OA 2ZTEA 4RQ6A 3UXOA 1ZQQA 3H40A 1ZJNA 2VA8A 4C8LA 4F2RA 8ICXA 4J9NA 4P2HA 1KTQA 1XS9D 3OSNA 5EOZA 2BQUA 5KG2A 7ICIA 1WCNA 3EWAA 9ICTA 4ELVA 4M2YA 3H7IA 1TK0A 2PI5A 4J9LA 5IIKA 3T5HA 1NK6A 2LYHA 3C2LA 1T4GA 1SL2A 4UAWA 5KT3A 1Z3EB 3KHHA 5EWGA 2JZBB 1BPEA 5KG6A 3BQ2A 4TQRA 4P4MA 2UVRA 4DL3A 4C8OA 3GDXA 3PX0A 2H5XA 4KLIA 5L1LA 4MF8A 2R8IA 5CJ7A 3N97B 3M9NB 2BR0A 2VANA 1ZQVA 3RH5A 2AJQA 9ICHA 2BQ3A 5J0TA 1QSLA 4RQ8A 2FPKA 3KHLA 3PW4A 2W8KA 7ICGA 4R66A 1JMSA 4UBCA 1K1SA 2KTQA 2PI4A 2ZJAA 5J2FA 3SV4A 4I2FA 1L5UA 3RR7A 4F5RA 2KZ3A 4DSEA 5KFJA 4XUSA 3EZ5A 4PGYA 3UQ2A 5DGBA 3HT3A 1NOMA 1S9FA 4J9QA 5KFQA 1SKSA 1QLNA 4YD2A 1UT5A 5L1IA 3OSPA 5J0UA 1ZQZA 4QZEA 2BHNA 4ED2A 8ICIA 5L1JA 3RRGA 2FLNA 7ICOA 2JZBA 1SKRA 1QSSA 2XY6A 3OGUA 4FS1A 3K75D 5DB6A 1WCLA 3PR4A 2HHQA 4YR3A 2I1QA 3GV7B 1ZQAA 4Q8EA 4UB3A 3V7KA 1N48A 2V4RA 5BOLA 2AGPA 3ZDAA 3MR6A 1SZPA 4EEYA 3ZDBA 4J9SA 4QW9A 2DFLA 5J0XA 2HHVA 4DS4A 2BGWA 4K4IA 4BWMA 5DLFA 4Z6FA 3Q8SB 3H4BA 9ICLA 5EWFA 3BQTA 5IIMA 2P6RA 1D9FA 1KRPA 1IM4A 4FBTA 2HW3A 1U49A 4EBCA 1RXWA 4PHPA 4F92B 4UQGA 3NTUA 1ZQCA 4DL4A 4QZ8A 4DOAA 2GWSA 4DQSA 4F2SA 4Z6EA 4JWMA 4F5OA 4DQQA 1EXNA 2F1JA 5C5JA 3NGDA 5J29A 4HYKA 4GC6A 4ECZA 4QWBA 3RRHA 4NLKA 4B9MA 4DFMA 4I27A 4KLFA 8ICWA 4LZDA 4QZAA 1QTMA 4DF8A 7ICPA 3FDSA 4ED8A 1ZQYA 2M9NA 4F91B 1SKWA 5DQIA 4FO6A 1XSNA 1SL1A 5KFSA 3KHRA 2BDPA 8ICMA 5KFLA 4I29A 5KFWA 3FYHA 2W9AA 1SL0A 2R8JA 1T3NA 2FLPA 4PHAA 3MR5A 1ZQHA 1S0VA 4UAZA 1MC8A 1NJWA 1ZQKA 8ICBA 4TQSA 4MEYA 4R8UA 3M8RA 4LZGA 5J2DA 1ZQMA 3QZ7A 1S76D 9ICXA 2J6SA 3OHAA 1S77D 2KZZA 2PFPA 4DL5A 4I2GA 5KFGA 2PXIA 1AROP 3TFRA 5D49A 3Q8PB 9ICVA 4XRHA 5J2EA 5KG3A 2HHWA 4UB2A 5KFXA 5KG0A 4BXOA 4BXOB 4O5CA 1BVSA 4I2CA 2C28A 4ELTA 1RPLA 5KG1A 9ICNA 4B9TA 1BGXT 1XO1A 3MFIA 1PZNA 4DFPA 8ICKA 4YVZA 2XY7A 9ICCA 4RUAA 1UA1A 3JPSA 5J2BA 4YXMA 1NKBA 4DSLA 1MQ2A 4NM2A 5KFYA 4RZRA 3RR8A 3AU2A 4F93B 9ICOA 4KLGA 5HHHA 5J2KA 4F4XA 5DB9A 5J0SA 4QZDA 4O9MA 7ICEA 7ICNA 2FPMA 2A1JB 1BPZA 1X9MA 1X9SA 5D46A 4Q43A 4JV0A 2Y1IA 2J6UA 5IIIA 4O3OA 5J0RA 4ELUA 4KN7A 4Z6DA 3N4MB 4DLGA 1C7YA 5IINA 4FS2A 4EBDA 4JWNA 5KT5A 1D8LA 2ZTDA 2ZUDA 3PMNA 2BPFA 4KN4A 4I2JA 3SV3A 1XU4A 1CEZA 5DG9A 5KFCA 4YMMA 3AUOA 3HWTA 4J9KA 4ECQA 4RQ3A 5DQGA 5KFHA 1TAQA 2Q0ZX 4RQ7A 7ICQA 9ICIA 5DB8A 4ECWA 2ASJA 5F9NA 2OWOA 4XA5A 4E0DA 2VA3A 5CA7A 5J2GA 5KFKA 4RU9A 4DL6A 8ICQA 7ICTA 4C8KA 4UBBA 8ICNA 1KDHA 9ICWA 4B9VA 1ZQLA 2PFOA 2F1HA 4BDPA 4R64A 4YD1A 4EZ6A 4O0IA 3QEBZ 3THVA 1HUOA 2FLLA 4IQVA 1XWLA 3HP6A 3KTQA 4DQRA 1RXVA 2NRZA 2KZMA 1JIHA 4DSIA 5DDYA 3T5LA 1X2IA 8ICUA 4YR0A 1S97A 1ZETA 4MFFA 4RNNA 3C5FA 2JEGA 1ZQFA 5CP2A 1T7PA 4PPXA 4Q8FA 4QWAA 9ICKA 5BPCA 4RPZA 3V6JA 4M9LA 9ICMA 2KFNA 3RBDA 4I2BA 3RB0A 5J0PA 3MR3A 4DSJA 5KFMA 4TURA 3AU6A 4YN4A 2B21A 5KFAA 3C2KA 5EWEA 3G6YA 1XC9A 5J0OA 3M9MB 3PO4A 5IIOA 4ECYA 8ICAA 4PHEA 3RAXA 8ICTA 3PX6A 3E2EA 4PGQA 4YG2A 2FMQA 3SZ2A 2XCPA 1ZYQA 2W9MA 2R8HA 2AGOA 1XSLA 1RYRA 5DG8A 4YMOA 3RJHA 3QZ8A 1B43A 4KLTA 8ICOA 4DL7A 3M9OB 4RQ2A 9ICAA 3PW7A 1L3UA 4YXJA 3T5KA 2ISPA 2C2RA 4O3PA 1ZQIA 4F50A 2BPGA 8ICYA 5KG4A 2XO7A 3RH6A 1ZJMA 3JPQA 4DO9A 2HHXA 3ZD8A 1QSYA 5DBCA 1BPYA 5KFUA 3RJGA 1ZQGA 4M9HA 5DBAA 4RT2A 4YCXA 4YR2A 5J2HA 4ECTA 2ATLA 5HMLA 1A77A 2XCAA 4IQUA 3BQ0A 4ECSA 4RNMA 4TUSA 3QE9Y 4Q45A 8ICRA 3LWMA 4ECRA 5HMMA 2R8KA 2R8GA 2IHMA 1DGSA 3PW0A 8ICVA 3MR2A 4DF4A 2IMWP 4O3RA 4P4PA 4RQ0A 5KFBA 4DQPA 4UB5A 2HVHA 4G3IA 3GIKA 1NK9A 3Q8RB 3Q8KA 3GFKB 2BQRA 2IBKA 3C2MA 2MUTB 4JK1A 7ICMA 4J9MA 5J2CA 4MFAA 1B22A 5KFFA 2C2DA 4EBEA 1L3SA 2DPIA 4I2HA 1KLNA 3LK9A 2FMPA 1BPDA 3EPIA 2AQ4A 1NK4A 3PR5B 4MFCA 4KLUA 4UAYA 4RQ1A 4QWCA 4DQIA 4K4GA 4KLEA 2BKEA 3JPNA 4RQ4A 3EYZA 4MEXA 4QZGA 3RAQA 4ED7A 2XC9A 2C22A 5DGAA 9ICJA 4QZHA 1LV5A 3SI8A 3IHQB 5CWRA 4RUCA 3V7JA 1D9DA 2XY5A 3TANA 4M6WB 1U48A 4NY8A 5J0YA 3BJYA 3GILA 4X5VA 4DWIA 2FPLA 4RNOA 1IXRA 5KT2A 2ZUCA 5KT4A 2W9CA 3C5GA 3BQ1A 5J2JA 4J9OA 4Q44A 4J9RA 4DS5A 4GC7A 5HP4A 2P6UA 5J0WA 5DDMA 5IILA 4I2IA 5DKWA 5JUMA 2MUTA 3HX0A 2HHUA 4F4YA 1TFRA 3MABA 4QWEA 3UPQA 4DSFA 3TFSA 4EZ9A 7ICUA 4ECUA 4M47A 1NJXA 1BPXA 3C23A 3ORYA 4B9SA 2XGPA 3H8JA 1Z00A 3RH4A 3G6VA 5F9LA 4EYHB 1S0NA 1KSPA 4QWDA 3PNCA 3PMLA 3MDCA
chains in the Genus database with same CATH superfamily
3B9JA 3L4PA 3MFHA 5AKYA 2I5HA 3H8WA 2W03A 4NXZA 4ED1A 3IV6A 4YMNA 2PMZF 2F1IA 4ECXA 4F8RA 3Q8QB 2AH5A 1L7MA 3CYMA 5J2AA 3JPPA 1Z00B 4EX6A 5KFTA 2CPRA 2F3NA 3UXPA 1H38A 1Q3UA 1KFTA 2RDIA 2ZJ8A 1X40A 1CUKA 3QUTA 2E3TA 2QLTA 2DPJA 4QIWF 2UVWA 4ZH4A 7ICHA 1Z1BA 3NRWA 2OCEA 2UVVA 3TKAA 5JTIA 3LVVA 4FBUA 2PFNA 4EENA 1K1QA 5KL1B 1NJYA 3TAQA 1TAUA 2BCSA 3Q8MA 3V6HA 1TV9A 2Y9UA 2ZXHA 2ZUBA 1DOQA 4M9JA 3JPRA 5DQHA 3RJIA 2ASLA 4P4OA 4YFKA 3KZXA 3RJKA 3M6KA 9ICRA 9ICSA 4EYIB 5KFOA 2HDOA 4M9NA 3TARA 5KFVA 3D2NA 3J81j 8ICGA 4FFDA 1ZQDA 4I2EA 3QX7A 2BZFA 2LHTA 4M0AA 1L3TA 1RM6C 2QB0B 4KLLA 2KN7A 1LB2B 3WKAA 2G5IB 1NJZA 4GXKA 4CCHA 4OJOA 5AKIA 2K4PA 9ICUA 3TACB 4FZNA 1N56A 3RBEA 4C8MA 8ICLA 2VA2A 3QUBA 1NI3A 4KTQA 1ZQJA 3LDAA 4KLJA 2IHNA 2KG5A 9ICPA 3TQ1A 3GIJA 1KFSA 4I28A 1RYSA 3H8SA 5AI6A 2W9CB 3F2BA 3JPOA 4IR9A 3JPTA 1ZQBA 3CNHA 4QNLA 5ALZA 4PHDA 4B9LA 1TE2A 2K4IA 2QARA 3UMCA 1DGJA 3AQFA 5AIBA 3H4DA 2AU0A 5K4LA 5CR0A 3RJJA 1MQ3A 2ISOA 1ZD3A 4QIWC 3SAFA 3ETLA 1VLBA 4QZFA 1U47A 1ZQQA 2KHQA 1ZJNA 2VA8A 2NO5A 1Q3VA 2D3DA 1XS9D 2KNJA 2BQUA 5KG2A 7ICIA 1WCNA 4HAIA 3H7IA 4J9LA 2ZIVB 2LYHA 1SL2A 2KVSA 1ZOLA 1RQLA 2JZBB 2UVRA 4DL3A 4KLIA 4MF8A 3M9NB 3RH5A 4R66A 2KTQA 1L5UA 3RR7A 4DSEA 4XUSA 1VJ5A 3UQ2A 3HT3A 2WAQF 1S9FA 5KFQA 1DXSA 4QZEA 5J0UA 4ED2A 2VIXA 5L1JA 3RRGA 8ICIA 2FLNA 1QSSA 1WCLA 3CRXA 5A0LA 1N48A 1JUDA 4EEYA 4QW9A 2HHVA 1Z4NA 2ZIUB 1COKA 5EWFA 1JROA 4FBTA 1IM4A 1U49A 4UQGA 2JGAA 4DQSA 3WKCA 1OUQA 2EQYA 1EXNA 4MHVA 4HYKA 4GC6A 2JR5A 4DFMA 4I27A 2M0NA 2FJ6A 2M9NA 1FIQA 4FO6A 3H8MA 3AN1A 2KVCA 8ICBA 4LZGA 5AM5A 1ZQMA 2G07A 2KJ9A 5KFGA 3KKAA 1AROP 3ETRA 3Q8PB 3QUQA 4PJ0U 1P7DA 5KG3A 1S8OA 5AM0A 4BXOA 4I2CA 2C28A 1RPLA 5AM4A 4B9TA 1XO1A 2HI0A 3MFIA 1CRXA 2KMDA 5ALWA 4DSLA 4OJ6A 1MQ2A 4IL6U 9ICOA 3MGVA 5HHHA 2A19A 2HBKA 5DB9A 5AI4A 5J0SA 3PSIA 2E5SA 1X9MA 5D46A 4O3MA 2J6UA 3O0FA 4DLGA 5IINA 2WF5A 4C0ZA 1D8LA 2OXOA 2ZTDA 2ZUDA 5GTIU 4I2JA 3BQ7A 1XU4A 1CEZA 5ALTA 5DQGA 1TAQA 7ICQA 3H0MB 9ICIA 5JRTA 4UATA 5KFKA 8ICQA 4DL6A 7ICTA 4BUGA 4C8KA 4RQMA 4UARA 2F1HA 3WK5A 4O0IA 3QEBZ 3HP6A 5DDYA 4MFFA 3ONNA 1ZETA 3C5FA 2JEGA 9ICKA 2KFNA 1SIJA 3MR3A 5EE9A 1ZD5A 3N28A 5KFMA 3C2KA 5EWEA 4Y2UA 4CF4A 3E2EA 4PGQA 2XCPA 1ZYQA 2AGOA 1XSLA 1RYRA 5DG8A 4YMOA 9ICAA 3PW7A 1L3UA 2P35A 1DK3A 2C2RA 4O3PA 1ZQIA 2EZXA 2XO7A 4DO9A 5EE3A 2Y0SF 2EDUA 2HHXA 1QSYA 1KBUA 2KJ8A 2Q4TA 4YCXA 4ECTA 4OJPA 3BQ0A 1JRPA 2R8KA 2IHMA 1DGSA 2EZZA 3WK4A 2HBJA 1SWVA 3Q8RB 4EEKA 2CXYA 4JB3A 4EBEA 3LK9A 2FMPA 4QWCA 1PUZA 3RAQA 9ICJA 2OH2A 2DKXA 3DV9A 3SEIA 4RUCA 2ES6A 3V7JA 1D9DA 1U48A 4NY8A 4OO1J 2AJQA 1SGGA 1IXRA 1O08A 3N7RC 4J9OA 4Q44A 4GC7A 5J0WA 4PL2A 2MUTA 1TFRA 3BZCA 2W7OA 1BPXA 2LBOA 4P0QB 1Z00A 2AXTU 3AM9A 5F9LA 4EYHB 4OCZA 3PNCA 3PMLA 3MDCA 3I28A 2E8MA 2W8LA 5EE0A 4GIBA 1JXEA 4RQ5A 2MRLA 3GV5B 1V9PA 1HEKA 4R63A 3NS1A 1KEJA 3NVWA 1D8YA 3C29A 2KV2A 3OJUA 4QJFB 3D2SA 3ISCA 1PVRA 3PSTA 1IV8A 1BNPA 5KAFU 3ZDCA 4C8NA 3WK7A 4UAVA 2RQ5A 3PV8A 7ICVA 4BWJA 1HUZA 1IG6A 1X9WA 2KFZA 3EW9A 4JMUA 1RZTA 2KICA 3C21A 3IN5A 3OTQA 2K4HA 4BGDA 2Y1JA 2BCRA 1FO4A 1ZQPA 3GU3A 3MDAA 5B66U 5AI9A 3KHGA 2UVUA 4RPYA 3UXNA 7ICLA 3GIIA 3HILA 5KFNA 2MAXA 7ICJA 3B0YA 1BNOA 1WUDA 3ISDA 2W7PA 4M04A 5L1KA 2OYYA 2ZTCA 4IRDA 2W9BA 1N61A 4DL2A 1KQQA 3HJEA 5J2IA 5J8YA 3KKAC 2K8BB 3SR6A 4YQWA 4NLBA 2KE7A 3M7DA 4DFJA 4ED6A 2LKYA 1YT3A 3MGIA 3A0BU 5KG5A 1Y88A 1Z4OA 3LVWA 4UB1A 2NRVA 2L5YA 2WTFA 5D4BA 8ICSA 1FFVA 4IRKA 4QZ9A 4TUQA 1N5XA 4NLNA 3NVVA 2XICA 2HHSA 5DB7A 3G6XA 5J0QA 1K5OA 3C28A 2XGQA 7ICKA 1S0MA 1J2MA 2BCVA 2JEJA 4B9NA 5H2FU 4J03A 5IIJA 1JX4A 4XQ8A 3QU4A 5KTQA 4UW9A 3DEEA 3IG8A 4P0PB 4UB6U 2MU2A 3OHBA 1O03A 4GXIA 2DWQA 2V9WA 3NVZA 4PGXA 2HVIA 8ICPA 1BPBA 4R8UB 1UA0A 5ALNA 1S0OA 4RQ6A 3UXOA 3H40A 4F2RA 2KD1A 4P2HA 1KTQA 5EOZA 2RP5A 9ICTA 4ELVA 4M2YA 1JI7A 3K1ZA 4RQNA 4G9BA 3EUB2 1NK6A 3C2LA 2VJ4A 2FI1A 4C80A 5KT3A 5EWGA 3BQ2A 1MA7A 4TQRA 2KIWA 2H5XA 2CN1A 2R8IA 1J2NA 4RQ8A 2FPKA 2W8KA 1NZPA 5ALUA 2PI4A 5AK4A 1Q46A 4F72A 4PGYA 5L1IA 1SV0C 1ZQZA 7ICOA 2JZBA 3H0RB 2XY6A 4FS1A 3K75D 2I1QA 5AKJA 1ZQAA 3V7KA 2V4RA 2AGPA 2PKEA 4DS4A 2BGWA 4US9A 5DLFA 3Q8SB 9ICLA 2HW3A 1KRPA 1UHUA 4WJ3B 2G08A 4EBCA 1RXWA 4PHPA 3NTUA 1ZQCA 3MC1A 4F2SA 4DOAA 4F5OA 2F1JA 5J29A 1F5SA 4B9MA 2E8NA 4LZDA 7ICPA 3FDSA 4ED8A 4F91B 2B6GA 2AHOB 5KFSA 3KHRA 2YMQA 5KFLA 1T3NA 4PHAA 1ZQKA 4MEYA 4C4SA 2F8KA 1S76D 3OHAA 1ZD4A 5JU5A 5D49A 9ICVA 2HHWA 5F3XB 4UB2A 5KFXA 4Y2SA 4O5CA 9ICNA 1ECWA 5T14A 4AP9A 9ICCA 2W43A 3L5KA 1L6NA 2G0AA 4YXMA 4CDGA 5KFYA 1T3QA 2FPMA 3WKDA 2A1JB 4JV0A 2Y1IA 5IIIA 4O3OA 5J0RA 3SENA 5AKKA 1RDFA 2KEYA 3PMNA 2BPFA 2PMZC 5KL8B 3AUOA 4J9KA 4ECQA 4RQ3A 2WHEA 2D8CA 5DB8A 4NWIA 2H3IA 2OWOA 4XA5A 1X9XA 2VA3A 5TISU 5CA7A 5J2GA 8ICNA 2A3VA 1KDHA 4R64A 4YD1A 2FLLA 4US8A 2KOBA 2NRZA 2KZMA 3QU2A 1X2IA 8ICUA 4QWAA 2DUYA 5J0PA 4DSJA 1N60A 4Y2RA 1XC9A 3SD7A 5CRXA 3PO4A 1XNSA 5IIOA 3RAXA 3BS5A 2FMQA 3SZ2A 3QZ8A 4DL7A 3M9OB 5ALMA 3QNMA 2BDUA 2EAOA 2F8LA 3T5KA 3F5AA 4DFDA 4F50A 2BPGA 2YMLA 8ICYA 1B0XA 3RH6A 3JPQA 1OW5A 3BS7A 2MA1A 3ZD8A 4KX5A 1BPYA 5KFUA 4M9HA 1X66A 4YR2A 2XCAA 4ECSA 4TUSA 2ESEA 2LPEA 4Q45A 3PW0A 1B4FA 2WF9A 3MR2A 2IMWP 4P4PA 5ALXA 2ZG6A 2CRXA 2E8OA 1NK9A 2BQRA 1N5WA 2IBKA 5ALRA 5J2CA 1B22A 1L3SA 2DPIA 5AI0A 3PR5B 4KLUA 5ALQA 2KKVA 4MEXA 3QXGA 4C7YA 2G09A 5G5GA 4ED7A 1LV5A 2JMGA 3SI8A 3IHQB 5AHXA 1QLNA 2W9CA 2FPLA 5KT2A 4RNOA 5KT4A 2E8PA 5ALDA 5HP4A 3WK9A 2P6UA 5DKWA 5JUMA 1XO0A 2HBLA 3MABA 3UPQA 4DSFA 4M47A 3C23A 4B9SA 2XGPA 3H8JA 3G6VA 2R18A 3IDWA 4ZOHC 3GV8B 3CW2C 5DLGA 3IP4B 7ICSA 3KD3A 2C2EA 5KFRA 3UQ0A 3A0HU 1QQ7A 3QU7A 1N63A 3S6JA 4OD0A 4U7CA 3B0XA 1ZQXA 2KK0A 2F2AB 3M6ZA 3ZDDA 4QZBA 4F3OA 2F77X 3F2CA 4NJ8A 2LYBA 2HOFA 4QZIA 2KIVA 4KLMA 2ZJ5A 4KLDA 5AICA 1OXJA 1KFDA 1HJPA 8ICCA 3KFUF 3SYZA 5KFEA 2GLEA 2ZIWB 5ALLA 4JV2A 8ICEA 5DG7A 4LVSA 1TVAA 3QEAZ 2JH7A 1XSPA 4KLQA 1X6IA 2P66A 5KFPA 4PH5A 3ICXA 4K4HA 7ICFA 5KT7A 2W3SA 1ZQNA 3V7LA 4C4TA 2HSZA 4J9PA 5KG7A 1ZQRA 8ICHA 2IA6A 5L9XA 3AQEA 1A76A 1LKYA 4CF3A 5L1MA 5CHGA 4DFKA 5DBBA 3PW2A 1NNLA 3M8SA 3OJSA 2K4EA 3I76A 2W9BB 4DSKA 3H0LB 1QCKA 4UAUA 1L8LA 4DOCA 3C1ZA 3L3FX 2JEIA 2LM4A 4M9GA 5AM3A 1J97A 4F5QA 1NKCA 3RTVA 4ED3A 4CRXA 4I2DA 9ICFA 2FDRA 1RG6A 4UB4A 4IQTA 1S10A 1S5LU 1ZQ1C 4I2AA 1T8EA 1PK1A 4DEZA 5G5HA 2BPCA 1ZQUA 8ICZA 3PSPA 2QARB 3PX4A 5KFIA 1NK0A 4NLGA 1ZQTA 5CB1A 4O5KA 3V6KA 2JHDA 5BOMA 4O3QA 2HCFA 4M6WA 4NL9C 2JEFA 4TUPA 2V4QA 3PSFA 4RT3A 3ISBA 2ZIXA 4O3SA 2VKQA 5AIAA 5ALPA 2EAMA 4KLHA 2DBYA 2ZTEA 3WK8A 4J9NA 5ALGA 1CI4A 2EAPA 1UPHA 2F76X 3WKEA 3EWAA 4IC9A 3PZPA 1TK0A 2PI5A 5IIKA 4EX7A 3WKBA 1T4GA 4UAWA 3KHHA 1L7PA 2G06A 3HRDD 1BPEA 4P4MA 1NZBA 4C8OA 3GDXA 2BR0A 3N97B 3HKZC 4U6PA 2VANA 5J0TA 3KHLA 3PW4A 2WF6A 7ICGA 2W55A 1JMSA 4UBCA 1T94A 2FE9A 2B0CA 2ZJAA 5J2FA 1GO3F 4I2FA 4F5RA 2KZ3A 5AI5A 2H3FA 5KFJA 1F0MA 3EZ5A 4NL9A 4J9QA 1SKSA 4C4RA 4Y2QA 2RHFA 4BJQA 2BHNA 4EELA 3M1YA 3PR4A 2HHQA 3GV7B 4UB3A 5BOLA 3MR6A 2DFLA 5J0XA 4F71A 2KSOA 4Z6FA 2N1RA 2P6RA 1D9FA 4F92B 2IOFA 4DL4A 4JWMA 4Z6EA 4DQQA 5C5JA 3RRHA 3NGDA 1L7NA 3ZI4A 3SQIA 4KLFA 4DF8A 2RRDA 2LI6A 1ZQYA 3TADC 5AK6A 1XSNA 1SL1A 2GOLA 8ICMA 2YB4A 4I29A 2HMXA 1SL0A 2G5HB 1ZQHA 1MC8A 1NJWA 3FC4A 4R8UA 3VCBA 5AKGA 9ICXA 1F44A 2J6SA 2KZZA 2PFPA 4DL5A 2PXIA 3TFRA 1PK1B 3F2DA 5KG0A 4FZMA 1QQ5A 4CF5A 3SAHA 4BXOB 4ELTA 1BGXT 3FAHA 8ICKA 2EANA 4YVZA 2OHFA 3NRZA 4RUAA 4NM2A 4Y2TA 4KLGA 2LM1A 4F4XA 2DGZA 1A6SA 7ICNA 1FFUA 2ZIXB 1BPZA 1X9SA 4Q43A 3NVYA 1URJA 4ELUA 3WK6A 5ALVA 4KN7A 4Z6DA 4Y2XA 3N4MB 1C7YA 1IIPA 4FZLA 5AKEA 4KN4A 5DG9A 3F53A 1WG8A 2Q0ZX 4RQ7A 4ECWA 1N62A 2ASJA 2OM6A 5F9NA 4UBBA 2ZIWA 4B9VA 1ZQLA 2PFOA 1LVHA 4BDPA 1M6YA 3THVA 1HUOA 3UMGA 4BX9C 2H3VA 1JIHA 1KW4A 4DSIA 3T5LA 4YR0A 2DKZA 2D6FC 1ZQFA 5CP2A 4Q8FA 3V6JA 2HOIA 1DRGA 3RBDA 4I2BA 3RB0A 1X6JA 4YN4A 2B21A 5KFAA 1Z19A 3G6YA 5J0OA 3M9MB 4ECYA 8ICAA 3PX6A 5KAIU 4YG2A 3SAGA 1Z1VA 4KLTA 3RJHA 4ICAA 1B43A 4C7ZA 4KMOB 4YXJA 1ZJMA 1QQ6A 2VJ5A 2WF7A 1PVQA 4KX3A 1V85A 5J8YC 5DBCA 3RJGA 1SXDA 5DBAA 3TADA 1A77A 1V97A 3QE9Y 5AKHA 8ICRA 3LWMA 5AKZA 5HMMA 1SV0A 8ICVA 2YTUA 4DF4A 5GTHU 4O3RA 2XVTA 5KFBA 4DQPA 4G3IA 3GIKA 1ED1A 3OPXA 3KOOA 4JK1A 4J9MA 4MFAA 5KFFA 3E0FA 2C2DA 4I2HA 3E58A 1BPDA 1NK4A 4MFCA 4UAYA 4RQ1A 4K4GA 2BKEA 4RQ4A 3EYZA 4QZGA 2XC9A 2C22A 4CNQA 1RQNA 2JV3A 5DGAA 4PZNA 4IS7A 3TANA 4M6WB 5J0YA 3GILA 3KTQA 5J2JA 5ALYA 4DS5A 5DDMA 4I2IA 2ZIVA 4F4YA 3D2QA 4QWEA 2RLTA 4EZ9A 4ECUA 5C0YA 3RH4A 2WAQC 3QYPA 2KKPA 4IQWA 2QB1A 2K60A 2OEHA 5AM1A 5ALIA 4QZCA 5KNIA 3V72A 3SMVA 3PO5A 4RPXA 4F5NA 4JUZA 1SV4A 2FMSA 4R65A 2ASDA 1KKXA 2LYAA 1TK5A 4O3NA 5KT6A 4ECVA 1U9LA 4NM1A 4Z6CA 8ICFA 5ALFA 3RJFA 3GZFA 1ZQWA 4OJLA 3U26A 3EPGA 2WB1C 5B5EU 1QH9A 3TAPA 5TZVA 1N2XA 5KFDA 4O5EA 4ACOA 2LMRA 2ZIUA 2EZYA 3MBYA 1WYGA 1NK5A 2Y0SC 3D6JA 4YP3A 4NLZA 3RB4A 3UM9A 5KFZA 3HPOA 8ICJA 4B9UA 1JXLA 3BDPA 3K4GA 3T5JA 4DOBA 4GFJA 3GQCA 1HIWA 9ICBA 1COOA 2GO7A 9ICGA 4P0PA 1JN3A 2W04A 3FM9A 3K1RB 1U45A 4KMUA 4KLOA 1ZXIA 5HHIA 4F4WA 1VDVA 4MF2A 1ZQSA 1PVPA 4DLEA 4QW8A 4IR1A 4PZOA 4GLXA 4JV1A 1NKEA 1WWUA 2AGQA 1JALA 4B6JA 1MSWD 3PW5A 3Q8LA 3RB6A 1A0PA 4KLSA 3ZD9A 1YZ6A 2J6TA 7ICRA 1ZQOA 5AK5A 3LYSA 1NK7A 1TKDA 1FEZA 3ED5A 2Z7JA 3T3FA 4F4ZA 2JH1A 1UT8A 3LWLA 4F4KA 3PVXA 2ALZA 4UB8U 2IOHA 1L8OA 2EH9A 3I1YA 1NK8A 3C1YA 3PY8A 2A1AA 3TI0A 1KL9A 2NV3A 2YX8A 3HKZF 5EE1A 3RB3A 3MGHA 4ED0A 2BCQA 2XIDA 2HHTA 9ICQA 1ZQEA 2NO4A 5HNKA 2I9GA 4IRCA 2NRTA 2WB1F 3RJEA 1TK8A 2H3QA 4LJXA 3ZDEA 2RDJA 3HW8A 2AQ0A 2NRWA 1L3VA 2NRXA 2PFQA 1TAMA 4F5PA 3BZKA 2A1JA 2BCUA 2IOFK 3GIMA 4KITB 2QKQA 1U4BA 9ICEA 3IM1A 4GXJA 1PK3A 3AEVA 4C8LA 3ALRA 8ICXA 3OSNA 2F44A 4DCCA 3T5HA 5HR7A 1Z3EB 1C20A 5KG6A 4A8EA 3PX0A 1D8BA 5L1LA 2JXJA 5CJ7A 2YMMA 1ZQVA 9ICHA 2BQ3A 1QSLA 1K1SA 2KJ5A 3SV4A 1ZD2P 3T79A 2DL0A 5DGBA 3IRUA 4USAA 1NOMA 1SXEA 1MN8A 4YD2A 1UT5A 3OSPA 2YMPA 1SKRA 2XI9A 3OGUA 5DB6A 4YR3A 4Q8EA 3VC8A 3ZDAA 1SZPA 1Q8KA 3ZDBA 4J9SA 2JRZA 2W11A 4K4IA 4BWMA 2E1FA 5AKXA 3H4BA 3DDHA 3BQTA 5IIMA 2K8CB 5CEHA 4CE6A 1UQVA 3KZIU 4QZ8A 2GWSA 2HOQA 5ALHA 4ECZA 4NLKA 4QWBA 8ICWA 4QZAA 1QTMA 1L7OA 2YY6A 1SKWA 5DQIA 2BDPA 1SWWA 5KFWA 3FYHA 2W9AA 2R8JA 4UASA 2FLPA 3MR5A 1DK2A 3F5EA 1S0VA 4UAZA 3AMZA 4TQSA 3M8RA 5J2DA 1LKYB 2W54A 3QZ7A 3N7PD 1S77D 5ALJA 4I2GA 4AYBC 4XRHA 5J2EA 1ZRNA 2ZXIA 5E79U 3QUCA 1BVSA 5KG1A 1PZNA 4DFPA 2XY7A 4Y2VA 1UA1A 3JPSA 5J2BA 1NKBA 4RZRA 5HR6A 3RR8A 2W3RA 3AU2A 4F93B 3NUQA 4AYBF 5J2KA 2WFAA 4QZDA 4O9MA 5AK3A 2WF8A 7ICEA 3QU9A 2YB1A 3CP8A 2KHVA 4FS2A 4EBDA 4JWNA 5KT5A 2H3ZA 1SZHA 3SV3A 1YZ7A 5KFCA 4YMMA 3HWTA 5KFHA 3RF9A 3KBBA 2Y9TA 5ALKA 4E0DA 4Y2YA 4CGZA 2KSOB 4NV0A 4RU9A 5ALOA 5AKLA 3AL0B 2HBMA 9ICWA 4EZ6A 4IQVA 1XWLA 4P0QA 4DQRA 1RXVA 3WU2U 3UMBA 1S97A 4Y2PA 4RNNA 1T7PA 4PPXA 5AI8A 5BPCA 4RPZA 4M9LA 9ICMA 1AQ6A 2YQEA 5ALSA 1UCVA 2K8AA 4TURA 3AU6A 3QU5A 4PHEA 8ICTA 1KN5A 4Y2JA 2W9MA 2I6XA 2R8HA 8ICOA 3N7SC 2YN4A 4RQ2A 3BS5B 2ISPA 1SB3C 5KG4A 4NLCA 1V38A 1ZQGA 4RT2A 5J2HA 2ATLA 3IG5A 5HMLA 4IQUA 5ALEA 4RNMA 2MSNA 4ECRA 2QB0A 2R8GA 2K89A 4RQ0A 2DF4B 4UB5A 2E1EA 2HVHA 3Q8KA 2ODGA 3GFKB 3C2MA 1RYUA 2MUTB 7ICMA 1X42A 3R9KA 4PL1A 2KP7A 1KLNA 4OJ5A 2NYVA 3EPIA 2AQ4A 2DQNB 3NASA 4DQIA 4KLEA 3JPNA 1ZRMA 4QZHA 5AM2A 5CWRA 2XY5A 2GH1A 3BJYA 2O6KA 4X5VA 4DWIA 3C5GA 2ZUCA 1WWVA 3BQ1A 4J9RA 5IILA 3HX0A 2HHUA 3TFSA 7ICUA 5FP0A 1NJXA 3RFAA 3ORYA 1S0NA 1KSPA 4QWDA 4FE3A
chains in the Genus database with same CATH topology
4IQWA 3GV8B 5DLGA 3MFHA 2W8LA 7ICSA 3H8WA 1JXEA 4QZCA 3V72A 2C2EA 3PO5A 4RQ5A 4NXZA 4RPXA 4ED1A 4F5NA 4JUZA 3GV5B 1V9PA 5KFRA 4YMNA 3UQ0A 2FMSA 4R65A 2ASDA 4R63A 1KEJA 2F1IA 1TK5A 4O3NA 4ECXA 4F8RA 5KT6A 4ECVA 1U9LA 4NM1A 1D8YA 3Q8QB 3OJUA 3ISCA 4Z6CA 3B0XA 8ICFA 1ZQXA 5J2AA 3JPPA 3RJFA 1Z00B 5KFTA 1ZQWA 3ZDCA 4C8NA 3PV8A 7ICVA 4BWJA 3EPGA 1HUZA 3TAPA 3ZDDA 3UXPA 4QZBA 1H38A 5TZVA 1X9WA 4F3OA 2KFZA 1KFTA 3EW9A 2RDIA 2ZJ8A 1CUKA 1RZTA 5KFDA 4O5EA 3C21A 2DPJA 4QZIA 2UVWA 4ZH4A 4BGDA 2Y1JA 3MBYA 7ICHA 1NK5A 2BCRA 4KLMA 2ZJ5A 1ZQPA 4YP3A 4NLZA 4KLDA 3RB4A 3MDAA 2UVVA 1KFDA 1HJPA 8ICCA 5KFZA 3HPOA 8ICJA 4B9UA 1JXLA 3KHGA 3SYZA 2UVUA 3BDPA 2PFNA 4FBUA 5KFEA 3K4GA 4RPYA 4JV2A 3T5JA 1K1QA 3UXNA 4DOBA 5DG7A 4LVSA 8ICEA 1NJYA 3GQCA 3TAQA 7ICLA 1TVAA 9ICBA 3GIIA 5KFNA 1TAUA 3QEAZ 2MAXA 1COOA 1XSPA 2BCSA 3Q8MA 4KLQA 3B0YA 7ICJA 9ICGA 3V6HA 1TV9A 3ISDA 4M04A 2ZUBA 1DOQA 2P66A 5KFPA 5L1KA 1JN3A 4PH5A 2ZTCA 1U45A 3JPRA 4IRDA 4KMUA 4K4HA 4M9JA 4KLOA 5DQHA 2W9BA 7ICFA 3RJIA 2ASLA 4P4OA 4YFKA 3RJKA 5KT7A 4DL2A 5HHIA 9ICRA 1ZQNA 4F4WA 4MF2A 9ICSA 1ZQSA 3V7LA 5J2IA 4EYIB 5KFOA 4DLEA 4J9PA 4QW8A 3TARA 4M9NA 5KFVA 5KG7A 4IR1A 1ZQRA 8ICGA 1ZQDA 4GLXA 4YQWA 2IA6A 8ICHA 4JV1A 1NKEA 2AGQA 5L9XA 1MSWD 4I2EA 1A76A 3PW5A 4DFJA 3Q8LA 4M0AA 4ED6A 5CHGA 3RB6A 1L3TA 4DFKA 5DBBA 3PW2A 4KLLA 4KLSA 3M8SA 2KN7A 1LB2B 3MGIA 3ZD9A 3OJSA 1NJZA 4GXKA 5KG5A 2W9BB 2J6TA 7ICRA 1Y88A 1ZQOA 4CCHA 4DSKA 1NK7A 9ICUA 1TKDA 4DOCA 4F4ZA 3C1ZA 1UT8A 2NRVA 4UB1A 3LWLA 3T3FA 3PVXA 4F4KA 4M9GA 2ALZA 2JEIA 1N56A 3RBEA 4C8MA 2WTFA 2VA2A 8ICLA 5D4BA 8ICSA 4F5QA 1NKCA 3RTVA 4IRKA 4KTQA 4ED3A 4QZ9A 1NK8A 4I2DA 9ICFA 3C1YA 4TUQA 3PY8A 1ZQJA 4UB4A 4IQTA 3TI0A 1S10A 3LDAA 4I2AA 1T8EA 2IHNA 4KLJA 4NLNA 9ICPA 4DEZA 3TQ1A 3GIJA 2BPCA 1KFSA 1ZQUA 4I28A 8ICZA 2HHSA 1RYSA 5DB7A 3H8SA 2W9CB 3G6XA 3RB3A 5J0QA 3MGHA 3PX4A 4ED0A 2BCQA 2HHTA 5KFIA 3JPOA 4IR9A 9ICQA 3JPTA 1NK0A 1ZQEA 2XGQA 1ZQBA 7ICKA 1S0MA 5HNKA 2BCVA 4PHDA 4NLGA 4B9LA 1ZQTA 2JEJA 4B9NA 5CB1A 4O5KA 3V6KA 5IIJA 2I9GA 4IRCA 1JX4A 4XQ8A 5BOMA 4O3QA 2NRTA 4M6WA 5KTQA 1TK8A 3RJEA 3H4DA 2AU0A 2JEFA 3ZDEA 5CR0A 4TUPA 3RJJA 2RDJA 3HW8A 2V4QA 2AQ0A 2NRWA 1L3VA 2NRXA 1MQ3A 2PFQA 2ISOA 4RT3A 3OHBA 3ISBA 4F5PA 2A1JA 4GXIA 2V9WA 2BCUA 4O3SA 4PGXA 3ETLA 2HVIA 8ICPA 1BPBA 3GIMA 4QZFA 4KLHA 4KITB 4R8UB 1UA0A 1U4BA 9ICEA 3IM1A 1U47A 4GXJA 1S0OA 2ZTEA 4RQ6A 3UXOA 1ZQQA 3H40A 1ZJNA 2VA8A 4C8LA 4F2RA 8ICXA 4J9NA 4P2HA 1KTQA 1XS9D 3OSNA 5EOZA 2BQUA 5KG2A 7ICIA 1WCNA 3EWAA 9ICTA 4ELVA 4M2YA 3H7IA 1TK0A 2PI5A 4J9LA 5IIKA 3T5HA 1NK6A 2LYHA 3C2LA 1T4GA 1SL2A 4UAWA 5KT3A 1Z3EB 3KHHA 5EWGA 2JZBB 1BPEA 5KG6A 3BQ2A 4TQRA 4P4MA 2UVRA 4DL3A 4C8OA 3GDXA 3PX0A 2H5XA 4KLIA 5L1LA 4MF8A 2R8IA 5CJ7A 3N97B 3M9NB 2BR0A 2VANA 1ZQVA 3RH5A 2AJQA 9ICHA 2BQ3A 5J0TA 1QSLA 4RQ8A 2FPKA 3KHLA 3PW4A 2W8KA 7ICGA 4R66A 1JMSA 4UBCA 1K1SA 2KTQA 2PI4A 2ZJAA 5J2FA 3SV4A 4I2FA 1L5UA 3RR7A 4F5RA 2KZ3A 4DSEA 5KFJA 4XUSA 3EZ5A 4PGYA 3UQ2A 5DGBA 3HT3A 1NOMA 1S9FA 4J9QA 5KFQA 1SKSA 1QLNA 4YD2A 1UT5A 5L1IA 3OSPA 5J0UA 1ZQZA 4QZEA 2BHNA 4ED2A 8ICIA 5L1JA 3RRGA 2FLNA 7ICOA 2JZBA 1SKRA 1QSSA 2XY6A 3OGUA 4FS1A 3K75D 5DB6A 1WCLA 3PR4A 2HHQA 4YR3A 2I1QA 3GV7B 1ZQAA 4Q8EA 4UB3A 3V7KA 1N48A 2V4RA 5BOLA 2AGPA 3ZDAA 3MR6A 1SZPA 4EEYA 3ZDBA 4J9SA 4QW9A 2DFLA 5J0XA 2HHVA 4DS4A 2BGWA 4K4IA 4BWMA 5DLFA 4Z6FA 3Q8SB 3H4BA 9ICLA 5EWFA 3BQTA 5IIMA 2P6RA 1D9FA 1KRPA 1IM4A 4FBTA 2HW3A 1U49A 4EBCA 1RXWA 4PHPA 4F92B 4UQGA 3NTUA 1ZQCA 4DL4A 4QZ8A 4DOAA 2GWSA 4DQSA 4F2SA 4Z6EA 4JWMA 4F5OA 4DQQA 1EXNA 2F1JA 5C5JA 3NGDA 5J29A 4HYKA 4GC6A 4ECZA 4QWBA 3RRHA 4NLKA 4B9MA 4DFMA 4I27A 4KLFA 8ICWA 4LZDA 4QZAA 1QTMA 4DF8A 7ICPA 3FDSA 4ED8A 1ZQYA 2M9NA 4F91B 1SKWA 5DQIA 4FO6A 1XSNA 1SL1A 5KFSA 3KHRA 2BDPA 8ICMA 5KFLA 4I29A 5KFWA 3FYHA 2W9AA 1SL0A 2R8JA 1T3NA 2FLPA 4PHAA 3MR5A 1ZQHA 1S0VA 4UAZA 1MC8A 1NJWA 1ZQKA 8ICBA 4TQSA 4MEYA 4R8UA 3M8RA 4LZGA 5J2DA 1ZQMA 3QZ7A 1S76D 9ICXA 2J6SA 3OHAA 1S77D 2KZZA 2PFPA 4DL5A 4I2GA 5KFGA 2PXIA 1AROP 3TFRA 5D49A 3Q8PB 9ICVA 4XRHA 5J2EA 5KG3A 2HHWA 4UB2A 5KFXA 5KG0A 4BXOA 4BXOB 4O5CA 1BVSA 4I2CA 2C28A 4ELTA 1RPLA 5KG1A 9ICNA 4B9TA 1BGXT 1XO1A 3MFIA 1PZNA 4DFPA 8ICKA 4YVZA 2XY7A 9ICCA 4RUAA 1UA1A 3JPSA 5J2BA 4YXMA 1NKBA 4DSLA 1MQ2A 4NM2A 5KFYA 4RZRA 3RR8A 3AU2A 4F93B 9ICOA 4KLGA 5HHHA 5J2KA 4F4XA 5DB9A 5J0SA 4QZDA 4O9MA 7ICEA 7ICNA 2FPMA 2A1JB 1BPZA 1X9MA 1X9SA 5D46A 4Q43A 4JV0A 2Y1IA 2J6UA 5IIIA 4O3OA 5J0RA 4ELUA 4KN7A 4Z6DA 3N4MB 4DLGA 1C7YA 5IINA 4FS2A 4EBDA 4JWNA 5KT5A 1D8LA 2ZTDA 2ZUDA 3PMNA 2BPFA 4KN4A 4I2JA 3SV3A 1XU4A 1CEZA 5DG9A 5KFCA 4YMMA 3AUOA 3HWTA 4J9KA 4ECQA 4RQ3A 5DQGA 5KFHA 1TAQA 2Q0ZX 4RQ7A 7ICQA 9ICIA 5DB8A 4ECWA 2ASJA 5F9NA 2OWOA 4XA5A 4E0DA 2VA3A 5CA7A 5J2GA 5KFKA 4RU9A 4DL6A 8ICQA 7ICTA 4C8KA 4UBBA 8ICNA 1KDHA 9ICWA 4B9VA 1ZQLA 2PFOA 2F1HA 4BDPA 4R64A 4YD1A 4EZ6A 4O0IA 3QEBZ 3THVA 1HUOA 2FLLA 4IQVA 1XWLA 3HP6A 3KTQA 4DQRA 1RXVA 2NRZA 2KZMA 1JIHA 4DSIA 5DDYA 3T5LA 1X2IA 8ICUA 4YR0A 1S97A 1ZETA 4MFFA 4RNNA 3C5FA 2JEGA 1ZQFA 5CP2A 1T7PA 4PPXA 4Q8FA 4QWAA 9ICKA 5BPCA 4RPZA 3V6JA 4M9LA 9ICMA 2KFNA 3RBDA 4I2BA 3RB0A 5J0PA 3MR3A 4DSJA 5KFMA 4TURA 3AU6A 4YN4A 2B21A 5KFAA 3C2KA 5EWEA 3G6YA 1XC9A 5J0OA 3M9MB 3PO4A 5IIOA 4ECYA 8ICAA 4PHEA 3RAXA 8ICTA 3PX6A 3E2EA 4PGQA 4YG2A 2FMQA 3SZ2A 2XCPA 1ZYQA 2W9MA 2R8HA 2AGOA 1XSLA 1RYRA 5DG8A 4YMOA 3RJHA 3QZ8A 1B43A 4KLTA 8ICOA 4DL7A 3M9OB 4RQ2A 9ICAA 3PW7A 1L3UA 4YXJA 3T5KA 2ISPA 2C2RA 4O3PA 1ZQIA 4F50A 2BPGA 8ICYA 5KG4A 2XO7A 3RH6A 1ZJMA 3JPQA 4DO9A 2HHXA 3ZD8A 1QSYA 5DBCA 1BPYA 5KFUA 3RJGA 1ZQGA 4M9HA 5DBAA 4RT2A 4YCXA 4YR2A 5J2HA 4ECTA 2ATLA 5HMLA 1A77A 2XCAA 4IQUA 3BQ0A 4ECSA 4RNMA 4TUSA 3QE9Y 4Q45A 8ICRA 3LWMA 4ECRA 5HMMA 2R8KA 2R8GA 2IHMA 1DGSA 3PW0A 8ICVA 3MR2A 4DF4A 2IMWP 4O3RA 4P4PA 4RQ0A 5KFBA 4DQPA 4UB5A 2HVHA 4G3IA 3GIKA 1NK9A 3Q8RB 3Q8KA 3GFKB 2BQRA 2IBKA 3C2MA 2MUTB 4JK1A 7ICMA 4J9MA 5J2CA 4MFAA 1B22A 5KFFA 2C2DA 4EBEA 1L3SA 2DPIA 4I2HA 1KLNA 3LK9A 2FMPA 1BPDA 3EPIA 2AQ4A 1NK4A 3PR5B 4MFCA 4KLUA 4UAYA 4RQ1A 4QWCA 4DQIA 4K4GA 4KLEA 2BKEA 3JPNA 4RQ4A 3EYZA 4MEXA 4QZGA 3RAQA 4ED7A 2XC9A 2C22A 5DGAA 9ICJA 4QZHA 1LV5A 3SI8A 3IHQB 5CWRA 4RUCA 3V7JA 1D9DA 2XY5A 3TANA 4M6WB 1U48A 4NY8A 5J0YA 3BJYA 3GILA 4X5VA 4DWIA 2FPLA 4RNOA 1IXRA 5KT2A 2ZUCA 5KT4A 2W9CA 3C5GA 3BQ1A 5J2JA 4J9OA 4Q44A 4J9RA 4DS5A 4GC7A 5HP4A 2P6UA 5J0WA 5DDMA 5IILA 4I2IA 5DKWA 5JUMA 2MUTA 3HX0A 2HHUA 4F4YA 1TFRA 3MABA 4QWEA 3UPQA 4DSFA 3TFSA 4EZ9A 7ICUA 4ECUA 4M47A 1NJXA 1BPXA 3C23A 3ORYA 4B9SA 2XGPA 3H8JA 1Z00A 3RH4A 3G6VA 5F9LA 4EYHB 1S0NA 1KSPA 4QWDA 3PNCA 3PMLA 3MDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IQW A;  3GV8 B;  5DLG A;  3MFH A;  2W8L A;  7ICS A;  3H8W A;  1JXE A;  4QZC A;  3V72 A;  2C2E A;  3PO5 A;  4RQ5 A;  4NXZ A;  4RPX A;  4ED1 A;  4F5N A;  4JUZ A;  3GV5 B;  1V9P A;  5KFR A;  4YMN A;  3UQ0 A;  2FMS A;  4R65 A;  2ASD A;  4R63 A;  1KEJ A;  2F1I A;  1TK5 A;  4O3N A;  4ECX A;  4F8R A;  5KT6 A;  4ECV A;  1U9L A;  4NM1 A;  1D8Y A;  3Q8Q B;  3OJU A;  3ISC A;  4Z6C A;  3B0X A;  8ICF A;  1ZQX A;  5J2A A;  3JPP A;  3RJF A;  1Z00 B;  5KFT A;  1ZQW A;  3ZDC A;  4C8N A;  3PV8 A;  7ICV A;  4BWJ A;  3EPG A;  1HUZ A;  3TAP A;  3ZDD A;  3UXP A;  4QZB A;  1H38 A;  5TZV A;  1X9W A;  4F3O A;  2KFZ A;  1KFT A;  3EW9 A;  2RDI A;  2ZJ8 A;  1CUK A;  1RZT A;  5KFD A;  4O5E A;  3C21 A;  2DPJ A;  4QZI A;  2UVW A;  4ZH4 A;  4BGD A;  2Y1J A;  3MBY A;  7ICH A;  1NK5 A;  2BCR A;  4KLM A;  2ZJ5 A;  1ZQP A;  4YP3 A;  4NLZ A;  4KLD A;  3RB4 A;  3MDA A;  2UVV A;  1KFD A;  1HJP A;  8ICC A;  5KFZ A;  3HPO A;  8ICJ A;  4B9U A;  1JXL A;  3KHG A;  3SYZ A;  2UVU A;  3BDP A;  2PFN A;  4FBU A;  5KFE A;  3K4G A;  4RPY A;  4JV2 A;  3T5J A;  1K1Q A;  3UXN A;  4DOB A;  5DG7 A;  4LVS A;  8ICE A;  1NJY A;  3GQC A;  3TAQ A;  7ICL A;  1TVA A;  9ICB A;  3GII A;  5KFN A;  1TAU A;  3QEA Z;  2MAX A;  1COO A;  1XSP A;  2BCS A;  3Q8M A;  4KLQ A;  3B0Y A;  7ICJ A;  9ICG A;  3V6H A;  1TV9 A;  3ISD A;  4M04 A;  2ZUB A;  1DOQ A;  2P66 A;  5KFP A;  5L1K A;  1JN3 A;  4PH5 A;  2ZTC A;  1U45 A;  3JPR A;  4IRD A;  4KMU A;  4K4H A;  4M9J A;  4KLO A;  5DQH A;  2W9B A;  7ICF A;  3RJI A;  2ASL A;  4P4O A;  4YFK A;  3RJK A;  5KT7 A;  4DL2 A;  5HHI A;  9ICR A;  1ZQN A;  4F4W A;  4MF2 A;  9ICS A;  1ZQS A;  3V7L A;  5J2I A;  4EYI B;  5KFO A;  4DLE A;  4J9P A;  4QW8 A;  3TAR A;  4M9N A;  5KFV A;  5KG7 A;  4IR1 A;  1ZQR A;  8ICG A;  1ZQD A;  4GLX A;  4YQW A;  2IA6 A;  8ICH A;  4JV1 A;  1NKE A;  2AGQ A;  5L9X A;  1MSW D;  4I2E A;  1A76 A;  3PW5 A;  4DFJ A;  3Q8L A;  4M0A A;  4ED6 A;  5CHG A;  3RB6 A;  1L3T A;  4DFK A;  5DBB A;  3PW2 A;  4KLL A;  4KLS A;  3M8S A;  2KN7 A;  1LB2 B;  3MGI A;  3ZD9 A;  3OJS A;  1NJZ A;  4GXK A;  5KG5 A;  2W9B B;  2J6T A;  7ICR A;  1Y88 A;  1ZQO A;  4CCH A;  4DSK A;  1NK7 A;  9ICU A;  1TKD A;  4DOC A;  4F4Z A;  3C1Z A;  1UT8 A;  2NRV A;  4UB1 A;  3LWL A;  3T3F A;  3PVX A;  4F4K A;  4M9G A;  2ALZ A;  2JEI A;  1N56 A;  3RBE A;  4C8M A;  2WTF A;  2VA2 A;  8ICL A;  5D4B A;  8ICS A;  4F5Q A;  1NKC A;  3RTV A;  4IRK A;  4KTQ A;  4ED3 A;  4QZ9 A;  1NK8 A;  4I2D A;  9ICF A;  3C1Y A;  4TUQ A;  3PY8 A;  1ZQJ A;  4UB4 A;  4IQT A;  3TI0 A;  1S10 A;  3LDA A;  4I2A A;  1T8E A;  2IHN A;  4KLJ A;  4NLN A;  9ICP A;  4DEZ A;  3TQ1 A;  3GIJ A;  2BPC A;  1KFS A;  1ZQU A;  4I28 A;  8ICZ A;  2HHS A;  1RYS A;  5DB7 A;  3H8S A;  2W9C B;  3G6X A;  3RB3 A;  5J0Q A;  3MGH A;  3PX4 A;  4ED0 A;  2BCQ A;  2HHT A;  5KFI A;  3JPO A;  4IR9 A;  9ICQ A;  3JPT A;  1NK0 A;  1ZQE A;  2XGQ A;  1ZQB A;  7ICK A;  1S0M A;  5HNK A;  2BCV A;  4PHD A;  4NLG A;  4B9L A;  1ZQT A;  2JEJ A;  4B9N A;  5CB1 A;  4O5K A;  3V6K A;  5IIJ A;  2I9G A;  4IRC A;  1JX4 A;  4XQ8 A;  5BOM A;  4O3Q A;  2NRT A;  4M6W A;  5KTQ A;  1TK8 A;  3RJE A;  3H4D A;  2AU0 A;  2JEF A;  3ZDE A;  5CR0 A;  4TUP A;  3RJJ A;  2RDJ A;  3HW8 A;  2V4Q A;  2AQ0 A;  2NRW A;  1L3V A;  2NRX A;  1MQ3 A;  2PFQ A;  2ISO A;  4RT3 A;  3OHB A;  3ISB A;  4F5P A;  2A1J A;  4GXI A;  2V9W A;  2BCU A;  4O3S A;  4PGX A;  3ETL A;  2HVI A;  8ICP A;  1BPB A;  3GIM A;  4QZF A;  4KLH A;  4KIT B;  4R8U B;  1UA0 A;  1U4B A;  9ICE A;  3IM1 A;  1U47 A;  4GXJ A;  1S0O A;  2ZTE A;  4RQ6 A;  3UXO A;  1ZQQ A;  3H40 A;  1ZJN A;  2VA8 A;  4C8L A;  4F2R A;  8ICX A;  4J9N A;  4P2H A;  1KTQ A;  1XS9 D;  3OSN A;  5EOZ A;  2BQU A;  5KG2 A;  7ICI A;  1WCN A;  3EWA A;  9ICT A;  4ELV A;  4M2Y A;  3H7I A;  1TK0 A;  2PI5 A;  4J9L A;  5IIK A;  3T5H A;  1NK6 A;  2LYH A;  3C2L A;  1T4G A;  1SL2 A;  4UAW A;  5KT3 A;  1Z3E B;  3KHH A;  5EWG A;  2JZB B;  1BPE A;  5KG6 A;  3BQ2 A;  4TQR A;  4P4M A;  2UVR A;  4DL3 A;  4C8O A;  3GDX A;  3PX0 A;  2H5X A;  4KLI A;  5L1L A;  4MF8 A;  2R8I A;  5CJ7 A;  3N97 B;  3M9N B;  2BR0 A;  2VAN A;  1ZQV A;  3RH5 A;  2AJQ A;  9ICH A;  2BQ3 A;  5J0T A;  1QSL A;  4RQ8 A;  2FPK A;  3KHL A;  3PW4 A;  2W8K A;  7ICG A;  4R66 A;  1JMS A;  4UBC A;  1K1S A;  2KTQ A;  2PI4 A;  2ZJA A;  5J2F A;  3SV4 A;  4I2F A;  1L5U A;  3RR7 A;  4F5R A;  2KZ3 A;  4DSE A;  5KFJ A;  4XUS A;  3EZ5 A;  4PGY A;  3UQ2 A;  5DGB A;  3HT3 A;  1NOM A;  1S9F A;  4J9Q A;  5KFQ A;  1SKS A;  1QLN A;  4YD2 A;  1UT5 A;  5L1I A;  3OSP A;  5J0U A;  1ZQZ A;  4QZE A;  2BHN A;  4ED2 A;  8ICI A;  5L1J A;  3RRG A;  2FLN A;  7ICO A;  2JZB A;  1SKR A;  1QSS A;  2XY6 A;  3OGU A;  4FS1 A;  3K75 D;  5DB6 A;  1WCL A;  3PR4 A;  2HHQ A;  4YR3 A;  2I1Q A;  3GV7 B;  1ZQA A;  4Q8E A;  4UB3 A;  3V7K A;  1N48 A;  2V4R A;  5BOL A;  2AGP A;  3ZDA A;  3MR6 A;  1SZP A;  4EEY A;  3ZDB A;  4J9S A;  4QW9 A;  2DFL A;  5J0X A;  2HHV A;  4DS4 A;  2BGW A;  4K4I A;  4BWM A;  5DLF A;  4Z6F A;  3Q8S B;  3H4B A;  9ICL A;  5EWF A;  3BQT A;  5IIM A;  2P6R A;  1D9F A;  1KRP A;  1IM4 A;  4FBT A;  2HW3 A;  1U49 A;  4EBC A;  1RXW A;  4PHP A;  4F92 B;  4UQG A;  3NTU A;  1ZQC A;  4DL4 A;  4QZ8 A;  4DOA A;  2GWS A;  4DQS A;  4F2S A;  4Z6E A;  4JWM A;  4F5O A;  4DQQ A;  1EXN A;  2F1J A;  5C5J A;  3NGD A;  5J29 A;  4HYK A;  4GC6 A;  4ECZ A;  4QWB A;  3RRH A;  4NLK A;  4B9M A;  4DFM A;  4I27 A;  4KLF A;  8ICW A;  4LZD A;  4QZA A;  1QTM A;  4DF8 A;  7ICP A;  3FDS A;  4ED8 A;  1ZQY A;  2M9N A;  4F91 B;  1SKW A;  5DQI A;  4FO6 A;  1XSN A;  1SL1 A;  5KFS A;  3KHR A;  2BDP A;  8ICM A;  5KFL A;  4I29 A;  5KFW A;  3FYH A;  2W9A A;  1SL0 A;  2R8J A;  1T3N A;  2FLP A;  4PHA A;  3MR5 A;  1ZQH A;  1S0V A;  4UAZ A;  1MC8 A;  1NJW A;  1ZQK A;  8ICB A;  4TQS A;  4MEY A;  4R8U A;  3M8R A;  4LZG A;  5J2D A;  1ZQM A;  3QZ7 A;  1S76 D;  9ICX A;  2J6S A;  3OHA A;  1S77 D;  2KZZ A;  2PFP A;  4DL5 A;  4I2G A;  5KFG A;  2PXI A;  1ARO P;  3TFR A;  5D49 A;  3Q8P B;  9ICV A;  4XRH A;  5J2E A;  5KG3 A;  2HHW A;  4UB2 A;  5KFX A;  5KG0 A;  4BXO A;  4BXO B;  4O5C A;  1BVS A;  4I2C A;  2C28 A;  4ELT A;  1RPL A;  5KG1 A;  9ICN A;  4B9T A;  1BGX T;  1XO1 A;  3MFI A;  1PZN A;  4DFP A;  8ICK A;  4YVZ A;  2XY7 A;  9ICC A;  4RUA A;  1UA1 A;  3JPS A;  5J2B A;  4YXM A;  1NKB A;  4DSL A;  1MQ2 A;  4NM2 A;  5KFY A;  4RZR A;  3RR8 A;  3AU2 A;  4F93 B;  9ICO A;  4KLG A;  5HHH A;  5J2K A;  4F4X A;  5DB9 A;  5J0S A;  4QZD A;  4O9M A;  7ICE A;  7ICN A;  2FPM A;  2A1J B;  1BPZ A;  1X9M A;  1X9S A;  5D46 A;  4Q43 A;  4JV0 A;  2Y1I A;  2J6U A;  5III A;  4O3O A;  5J0R A;  4ELU A;  4KN7 A;  4Z6D A;  3N4M B;  4DLG A;  1C7Y A;  5IIN A;  4FS2 A;  4EBD A;  4JWN A;  5KT5 A;  1D8L A;  2ZTD A;  2ZUD A;  3PMN A;  2BPF A;  4KN4 A;  4I2J A;  3SV3 A;  1XU4 A;  1CEZ A;  5DG9 A;  5KFC A;  4YMM A;  3AUO A;  3HWT A;  4J9K A;  4ECQ A;  4RQ3 A;  5DQG A;  5KFH A;  1TAQ A;  2Q0Z X;  4RQ7 A;  7ICQ A;  9ICI A;  5DB8 A;  4ECW A;  2ASJ A;  5F9N A;  2OWO A;  4XA5 A;  4E0D A;  2VA3 A;  5CA7 A;  5J2G A;  5KFK A;  4RU9 A;  4DL6 A;  8ICQ A;  7ICT A;  4C8K A;  4UBB A;  8ICN A;  1KDH A;  9ICW A;  4B9V A;  1ZQL A;  2PFO A;  2F1H A;  4BDP A;  4R64 A;  4YD1 A;  4EZ6 A;  4O0I A;  3QEB Z;  3THV A;  1HUO A;  2FLL A;  4IQV A;  1XWL A;  3HP6 A;  3KTQ A;  4DQR A;  1RXV A;  2NRZ A;  2KZM A;  1JIH A;  4DSI A;  5DDY A;  3T5L A;  1X2I A;  8ICU A;  4YR0 A;  1S97 A;  1ZET A;  4MFF A;  4RNN A;  3C5F A;  2JEG A;  1ZQF A;  5CP2 A;  1T7P A;  4PPX A;  4Q8F A;  4QWA A;  9ICK A;  5BPC A;  4RPZ A;  3V6J A;  4M9L A;  9ICM A;  2KFN A;  3RBD A;  4I2B A;  3RB0 A;  5J0P A;  3MR3 A;  4DSJ A;  5KFM A;  4TUR A;  3AU6 A;  4YN4 A;  2B21 A;  5KFA A;  3C2K A;  5EWE A;  3G6Y A;  1XC9 A;  5J0O A;  3M9M B;  3PO4 A;  5IIO A;  4ECY A;  8ICA A;  4PHE A;  3RAX A;  8ICT A;  3PX6 A;  3E2E A;  4PGQ A;  4YG2 A;  2FMQ A;  3SZ2 A;  2XCP A;  1ZYQ A;  2W9M A;  2R8H A;  2AGO A;  1XSL A;  1RYR A;  5DG8 A;  4YMO A;  3RJH A;  3QZ8 A;  1B43 A;  4KLT A;  8ICO A;  4DL7 A;  3M9O B;  4RQ2 A;  9ICA A;  3PW7 A;  1L3U A;  4YXJ A;  3T5K A;  2ISP A;  2C2R A;  4O3P A;  1ZQI A;  4F50 A;  2BPG A;  8ICY A;  5KG4 A;  2XO7 A;  3RH6 A;  1ZJM A;  3JPQ A;  4DO9 A;  2HHX A;  3ZD8 A;  1QSY A;  5DBC A;  1BPY A;  5KFU A;  3RJG A;  1ZQG A;  4M9H A;  5DBA A;  4RT2 A;  4YCX A;  4YR2 A;  5J2H A;  4ECT A;  2ATL A;  5HML A;  1A77 A;  2XCA A;  4IQU A;  3BQ0 A;  4ECS A;  4RNM A;  4TUS A;  3QE9 Y;  4Q45 A;  8ICR A;  3LWM A;  4ECR A;  5HMM A;  2R8K A;  2R8G A;  2IHM A;  1DGS A;  3PW0 A;  8ICV A;  3MR2 A;  4DF4 A;  2IMW P;  4O3R A;  4P4P A;  4RQ0 A;  5KFB A;  4DQP A;  4UB5 A;  2HVH A;  4G3I A;  3GIK A;  1NK9 A;  3Q8R B;  3Q8K A;  3GFK B;  2BQR A;  2IBK A;  3C2M A;  2MUT B;  4JK1 A;  7ICM A;  4J9M A;  5J2C A;  4MFA A;  1B22 A;  5KFF A;  2C2D A;  4EBE A;  1L3S A;  2DPI A;  4I2H A;  1KLN A;  3LK9 A;  2FMP A;  1BPD A;  3EPI A;  2AQ4 A;  1NK4 A;  3PR5 B;  4MFC A;  4KLU A;  4UAY A;  4RQ1 A;  4QWC A;  4DQI A;  4K4G A;  4KLE A;  2BKE A;  3JPN A;  4RQ4 A;  3EYZ A;  4MEX A;  4QZG A;  3RAQ A;  4ED7 A;  2XC9 A;  2C22 A;  5DGA A;  9ICJ A;  4QZH A;  1LV5 A;  3SI8 A;  3IHQ B;  5CWR A;  4RUC A;  3V7J A;  1D9D A;  2XY5 A;  3TAN A;  4M6W B;  1U48 A;  4NY8 A;  5J0Y A;  3BJY A;  3GIL A;  4X5V A;  4DWI A;  2FPL A;  4RNO A;  1IXR A;  5KT2 A;  2ZUC A;  5KT4 A;  2W9C A;  3C5G A;  3BQ1 A;  5J2J A;  4J9O A;  4Q44 A;  4J9R A;  4DS5 A;  4GC7 A;  5HP4 A;  2P6U A;  5J0W A;  5DDM A;  5IIL A;  4I2I A;  5DKW A;  5JUM A;  2MUT A;  3HX0 A;  2HHU A;  4F4Y A;  1TFR A;  3MAB A;  4QWE A;  3UPQ A;  4DSF A;  3TFS A;  4EZ9 A;  7ICU A;  4ECU A;  4M47 A;  1NJX A;  1BPX A;  3C23 A;  3ORY A;  4B9S A;  2XGP A;  3H8J A;  1Z00 A;  3RH4 A;  3G6V A;  5F9L A;  4EYH B;  1S0N A;  1KSP A;  4QWD A;  3PNC A;  3PML A;  3MDC A; 
#chains in the Genus database with same CATH topology
 3B9J A;  3L4P A;  3MFH A;  5AKY A;  2I5H A;  3H8W A;  2W03 A;  4NXZ A;  4ED1 A;  3IV6 A;  4YMN A;  2PMZ F;  2F1I A;  4ECX A;  4F8R A;  3Q8Q B;  2AH5 A;  1L7M A;  3CYM A;  5J2A A;  3JPP A;  1Z00 B;  4EX6 A;  5KFT A;  2CPR A;  2F3N A;  3UXP A;  1H38 A;  1Q3U A;  1KFT A;  2RDI A;  2ZJ8 A;  1X40 A;  1CUK A;  3QUT A;  2E3T A;  2QLT A;  2DPJ A;  4QIW F;  2UVW A;  4ZH4 A;  7ICH A;  1Z1B A;  3NRW A;  2OCE A;  2UVV A;  3TKA A;  5JTI A;  3LVV A;  4FBU A;  2PFN A;  4EEN A;  1K1Q A;  5KL1 B;  1NJY A;  3TAQ A;  1TAU A;  2BCS A;  3Q8M A;  3V6H A;  1TV9 A;  2Y9U A;  2ZXH A;  2ZUB A;  1DOQ A;  4M9J A;  3JPR A;  5DQH A;  3RJI A;  2ASL A;  4P4O A;  4YFK A;  3KZX A;  3RJK A;  3M6K A;  9ICR A;  9ICS A;  4EYI B;  5KFO A;  2HDO A;  4M9N A;  3TAR A;  5KFV A;  3D2N A;  3J81 j;  8ICG A;  4FFD A;  1ZQD A;  4I2E A;  3QX7 A;  2BZF A;  2LHT A;  4M0A A;  1L3T A;  1RM6 C;  2QB0 B;  4KLL A;  2KN7 A;  1LB2 B;  3WKA A;  2G5I B;  1NJZ A;  4GXK A;  4CCH A;  4OJO A;  5AKI A;  2K4P A;  9ICU A;  3TAC B;  4FZN A;  1N56 A;  3RBE A;  4C8M A;  8ICL A;  2VA2 A;  3QUB A;  1NI3 A;  4KTQ A;  1ZQJ A;  3LDA A;  4KLJ A;  2IHN A;  2KG5 A;  9ICP A;  3TQ1 A;  3GIJ A;  1KFS A;  4I28 A;  1RYS A;  3H8S A;  5AI6 A;  2W9C B;  3F2B A;  3JPO A;  4IR9 A;  3JPT A;  1ZQB A;  3CNH A;  4QNL A;  5ALZ A;  4PHD A;  4B9L A;  1TE2 A;  2K4I A;  2QAR A;  3UMC A;  1DGJ A;  3AQF A;  5AIB A;  3H4D A;  2AU0 A;  5K4L A;  5CR0 A;  3RJJ A;  1MQ3 A;  2ISO A;  1ZD3 A;  4QIW C;  3SAF A;  3ETL A;  1VLB A;  4QZF A;  1U47 A;  1ZQQ A;  2KHQ A;  1ZJN A;  2VA8 A;  2NO5 A;  1Q3V A;  2D3D A;  1XS9 D;  2KNJ A;  2BQU A;  5KG2 A;  7ICI A;  1WCN A;  4HAI A;  3H7I A;  4J9L A;  2ZIV B;  2LYH A;  1SL2 A;  2KVS A;  1ZOL A;  1RQL A;  2JZB B;  2UVR A;  4DL3 A;  4KLI A;  4MF8 A;  3M9N B;  3RH5 A;  4R66 A;  2KTQ A;  1L5U A;  3RR7 A;  4DSE A;  4XUS A;  1VJ5 A;  3UQ2 A;  3HT3 A;  2WAQ F;  1S9F A;  5KFQ A;  1DXS A;  4QZE A;  5J0U A;  4ED2 A;  2VIX A;  5L1J A;  3RRG A;  8ICI A;  2FLN A;  1QSS A;  1WCL A;  3CRX A;  5A0L A;  1N48 A;  1JUD A;  4EEY A;  4QW9 A;  2HHV A;  1Z4N A;  2ZIU B;  1COK A;  5EWF A;  1JRO A;  4FBT A;  1IM4 A;  1U49 A;  4UQG A;  2JGA A;  4DQS A;  3WKC A;  1OUQ A;  2EQY A;  1EXN A;  4MHV A;  4HYK A;  4GC6 A;  2JR5 A;  4DFM A;  4I27 A;  2M0N A;  2FJ6 A;  2M9N A;  1FIQ A;  4FO6 A;  3H8M A;  3AN1 A;  2KVC A;  8ICB A;  4LZG A;  5AM5 A;  1ZQM A;  2G07 A;  2KJ9 A;  5KFG A;  3KKA A;  1ARO P;  3ETR A;  3Q8P B;  3QUQ A;  4PJ0 U;  1P7D A;  5KG3 A;  1S8O A;  5AM0 A;  4BXO A;  4I2C A;  2C28 A;  1RPL A;  5AM4 A;  4B9T A;  1XO1 A;  2HI0 A;  3MFI A;  1CRX A;  2KMD A;  5ALW A;  4DSL A;  4OJ6 A;  1MQ2 A;  4IL6 U;  9ICO A;  3MGV A;  5HHH A;  2A19 A;  2HBK A;  5DB9 A;  5AI4 A;  5J0S A;  3PSI A;  2E5S A;  1X9M A;  5D46 A;  4O3M A;  2J6U A;  3O0F A;  4DLG A;  5IIN A;  2WF5 A;  4C0Z A;  1D8L A;  2OXO A;  2ZTD A;  2ZUD A;  5GTI U;  4I2J A;  3BQ7 A;  1XU4 A;  1CEZ A;  5ALT A;  5DQG A;  1TAQ A;  7ICQ A;  3H0M B;  9ICI A;  5JRT A;  4UAT A;  5KFK A;  8ICQ A;  4DL6 A;  7ICT A;  4BUG A;  4C8K A;  4RQM A;  4UAR A;  2F1H A;  3WK5 A;  4O0I A;  3QEB Z;  3HP6 A;  5DDY A;  4MFF A;  3ONN A;  1ZET A;  3C5F A;  2JEG A;  9ICK A;  2KFN A;  1SIJ A;  3MR3 A;  5EE9 A;  1ZD5 A;  3N28 A;  5KFM A;  3C2K A;  5EWE A;  4Y2U A;  4CF4 A;  3E2E A;  4PGQ A;  2XCP A;  1ZYQ A;  2AGO A;  1XSL A;  1RYR A;  5DG8 A;  4YMO A;  9ICA A;  3PW7 A;  1L3U A;  2P35 A;  1DK3 A;  2C2R A;  4O3P A;  1ZQI A;  2EZX A;  2XO7 A;  4DO9 A;  5EE3 A;  2Y0S F;  2EDU A;  2HHX A;  1QSY A;  1KBU A;  2KJ8 A;  2Q4T A;  4YCX A;  4ECT A;  4OJP A;  3BQ0 A;  1JRP A;  2R8K A;  2IHM A;  1DGS A;  2EZZ A;  3WK4 A;  2HBJ A;  1SWV A;  3Q8R B;  4EEK A;  2CXY A;  4JB3 A;  4EBE A;  3LK9 A;  2FMP A;  4QWC A;  1PUZ A;  3RAQ A;  9ICJ A;  2OH2 A;  2DKX A;  3DV9 A;  3SEI A;  4RUC A;  2ES6 A;  3V7J A;  1D9D A;  1U48 A;  4NY8 A;  4OO1 J;  2AJQ A;  1SGG A;  1IXR A;  1O08 A;  3N7R C;  4J9O A;  4Q44 A;  4GC7 A;  5J0W A;  4PL2 A;  2MUT A;  1TFR A;  3BZC A;  2W7O A;  1BPX A;  2LBO A;  4P0Q B;  1Z00 A;  2AXT U;  3AM9 A;  5F9L A;  4EYH B;  4OCZ A;  3PNC A;  3PML A;  3MDC A;  3I28 A;  2E8M A;  2W8L A;  5EE0 A;  4GIB A;  1JXE A;  4RQ5 A;  2MRL A;  3GV5 B;  1V9P A;  1HEK A;  4R63 A;  3NS1 A;  1KEJ A;  3NVW A;  1D8Y A;  3C29 A;  2KV2 A;  3OJU A;  4QJF B;  3D2S A;  3ISC A;  1PVR A;  3PST A;  1IV8 A;  1BNP A;  5KAF U;  3ZDC A;  4C8N A;  3WK7 A;  4UAV A;  2RQ5 A;  3PV8 A;  7ICV A;  4BWJ A;  1HUZ A;  1IG6 A;  1X9W A;  2KFZ A;  3EW9 A;  4JMU A;  1RZT A;  2KIC A;  3C21 A;  3IN5 A;  3OTQ A;  2K4H A;  4BGD A;  2Y1J A;  2BCR A;  1FO4 A;  1ZQP A;  3GU3 A;  3MDA A;  5B66 U;  5AI9 A;  3KHG A;  2UVU A;  4RPY A;  3UXN A;  7ICL A;  3GII A;  3HIL A;  5KFN A;  2MAX A;  7ICJ A;  3B0Y A;  1BNO A;  1WUD A;  3ISD A;  2W7P A;  4M04 A;  5L1K A;  2OYY A;  2ZTC A;  4IRD A;  2W9B A;  1N61 A;  4DL2 A;  1KQQ A;  3HJE A;  5J2I A;  5J8Y A;  3KKA C;  2K8B B;  3SR6 A;  4YQW A;  4NLB A;  2KE7 A;  3M7D A;  4DFJ A;  4ED6 A;  2LKY A;  1YT3 A;  3MGI A;  3A0B U;  5KG5 A;  1Y88 A;  1Z4O A;  3LVW A;  4UB1 A;  2NRV A;  2L5Y A;  2WTF A;  5D4B A;  8ICS A;  1FFV A;  4IRK A;  4QZ9 A;  4TUQ A;  1N5X A;  4NLN A;  3NVV A;  2XIC A;  2HHS A;  5DB7 A;  3G6X A;  5J0Q A;  1K5O A;  3C28 A;  2XGQ A;  7ICK A;  1S0M A;  1J2M A;  2BCV A;  2JEJ A;  4B9N A;  5H2F U;  4J03 A;  5IIJ A;  1JX4 A;  4XQ8 A;  3QU4 A;  5KTQ A;  4UW9 A;  3DEE A;  3IG8 A;  4P0P B;  4UB6 U;  2MU2 A;  3OHB A;  1O03 A;  4GXI A;  2DWQ A;  2V9W A;  3NVZ A;  4PGX A;  2HVI A;  8ICP A;  1BPB A;  4R8U B;  1UA0 A;  5ALN A;  1S0O A;  4RQ6 A;  3UXO A;  3H40 A;  4F2R A;  2KD1 A;  4P2H A;  1KTQ A;  5EOZ A;  2RP5 A;  9ICT A;  4ELV A;  4M2Y A;  1JI7 A;  3K1Z A;  4RQN A;  4G9B A;  3EUB 2;  1NK6 A;  3C2L A;  2VJ4 A;  2FI1 A;  4C80 A;  5KT3 A;  5EWG A;  3BQ2 A;  1MA7 A;  4TQR A;  2KIW A;  2H5X A;  2CN1 A;  2R8I A;  1J2N A;  4RQ8 A;  2FPK A;  2W8K A;  1NZP A;  5ALU A;  2PI4 A;  5AK4 A;  1Q46 A;  4F72 A;  4PGY A;  5L1I A;  1SV0 C;  1ZQZ A;  7ICO A;  2JZB A;  3H0R B;  2XY6 A;  4FS1 A;  3K75 D;  2I1Q A;  5AKJ A;  1ZQA A;  3V7K A;  2V4R A;  2AGP A;  2PKE A;  4DS4 A;  2BGW A;  4US9 A;  5DLF A;  3Q8S B;  9ICL A;  2HW3 A;  1KRP A;  1UHU A;  4WJ3 B;  2G08 A;  4EBC A;  1RXW A;  4PHP A;  3NTU A;  1ZQC A;  3MC1 A;  4F2S A;  4DOA A;  4F5O A;  2F1J A;  5J29 A;  1F5S A;  4B9M A;  2E8N A;  4LZD A;  7ICP A;  3FDS A;  4ED8 A;  4F91 B;  2B6G A;  2AHO B;  5KFS A;  3KHR A;  2YMQ A;  5KFL A;  1T3N A;  4PHA A;  1ZQK A;  4MEY A;  4C4S A;  2F8K A;  1S76 D;  3OHA A;  1ZD4 A;  5JU5 A;  5D49 A;  9ICV A;  2HHW A;  5F3X B;  4UB2 A;  5KFX A;  4Y2S A;  4O5C A;  9ICN A;  1ECW A;  5T14 A;  4AP9 A;  9ICC A;  2W43 A;  3L5K A;  1L6N A;  2G0A A;  4YXM A;  4CDG A;  5KFY A;  1T3Q A;  2FPM A;  3WKD A;  2A1J B;  4JV0 A;  2Y1I A;  5III A;  4O3O A;  5J0R A;  3SEN A;  5AKK A;  1RDF A;  2KEY A;  3PMN A;  2BPF A;  2PMZ C;  5KL8 B;  3AUO A;  4J9K A;  4ECQ A;  4RQ3 A;  2WHE A;  2D8C A;  5DB8 A;  4NWI A;  2H3I A;  2OWO A;  4XA5 A;  1X9X A;  2VA3 A;  5TIS U;  5CA7 A;  5J2G A;  8ICN A;  2A3V A;  1KDH A;  4R64 A;  4YD1 A;  2FLL A;  4US8 A;  2KOB A;  2NRZ A;  2KZM A;  3QU2 A;  1X2I A;  8ICU A;  4QWA A;  2DUY A;  5J0P A;  4DSJ A;  1N60 A;  4Y2R A;  1XC9 A;  3SD7 A;  5CRX A;  3PO4 A;  1XNS A;  5IIO A;  3RAX A;  3BS5 A;  2FMQ A;  3SZ2 A;  3QZ8 A;  4DL7 A;  3M9O B;  5ALM A;  3QNM A;  2BDU A;  2EAO A;  2F8L A;  3T5K A;  3F5A A;  4DFD A;  4F50 A;  2BPG A;  2YML A;  8ICY A;  1B0X A;  3RH6 A;  3JPQ A;  1OW5 A;  3BS7 A;  2MA1 A;  3ZD8 A;  4KX5 A;  1BPY A;  5KFU A;  4M9H A;  1X66 A;  4YR2 A;  2XCA A;  4ECS A;  4TUS A;  2ESE A;  2LPE A;  4Q45 A;  3PW0 A;  1B4F A;  2WF9 A;  3MR2 A;  2IMW P;  4P4P A;  5ALX A;  2ZG6 A;  2CRX A;  2E8O A;  1NK9 A;  2BQR A;  1N5W A;  2IBK A;  5ALR A;  5J2C A;  1B22 A;  1L3S A;  2DPI A;  5AI0 A;  3PR5 B;  4KLU A;  5ALQ A;  2KKV A;  4MEX A;  3QXG A;  4C7Y A;  2G09 A;  5G5G A;  4ED7 A;  1LV5 A;  2JMG A;  3SI8 A;  3IHQ B;  5AHX A;  1QLN A;  2W9C A;  2FPL A;  5KT2 A;  4RNO A;  5KT4 A;  2E8P A;  5ALD A;  5HP4 A;  3WK9 A;  2P6U A;  5DKW A;  5JUM A;  1XO0 A;  2HBL A;  3MAB A;  3UPQ A;  4DSF A;  4M47 A;  3C23 A;  4B9S A;  2XGP A;  3H8J A;  3G6V A;  2R18 A;  3IDW A;  4ZOH C;  3GV8 B;  3CW2 C;  5DLG A;  3IP4 B;  7ICS A;  3KD3 A;  2C2E A;  5KFR A;  3UQ0 A;  3A0H U;  1QQ7 A;  3QU7 A;  1N63 A;  3S6J A;  4OD0 A;  4U7C A;  3B0X A;  1ZQX A;  2KK0 A;  2F2A B;  3M6Z A;  3ZDD A;  4QZB A;  4F3O A;  2F77 X;  3F2C A;  4NJ8 A;  2LYB A;  2HOF A;  4QZI A;  2KIV A;  4KLM A;  2ZJ5 A;  4KLD A;  5AIC A;  1OXJ A;  1KFD A;  1HJP A;  8ICC A;  3KFU F;  3SYZ A;  5KFE A;  2GLE A;  2ZIW B;  5ALL A;  4JV2 A;  8ICE A;  5DG7 A;  4LVS A;  1TVA A;  3QEA Z;  2JH7 A;  1XSP A;  4KLQ A;  1X6I A;  2P66 A;  5KFP A;  4PH5 A;  3ICX A;  4K4H A;  7ICF A;  5KT7 A;  2W3S A;  1ZQN A;  3V7L A;  4C4T A;  2HSZ A;  4J9P A;  5KG7 A;  1ZQR A;  8ICH A;  2IA6 A;  5L9X A;  3AQE A;  1A76 A;  1LKY A;  4CF3 A;  5L1M A;  5CHG A;  4DFK A;  5DBB A;  3PW2 A;  1NNL A;  3M8S A;  3OJS A;  2K4E A;  3I76 A;  2W9B B;  4DSK A;  3H0L B;  1QCK A;  4UAU A;  1L8L A;  4DOC A;  3C1Z A;  3L3F X;  2JEI A;  2LM4 A;  4M9G A;  5AM3 A;  1J97 A;  4F5Q A;  1NKC A;  3RTV A;  4ED3 A;  4CRX A;  4I2D A;  9ICF A;  2FDR A;  1RG6 A;  4UB4 A;  4IQT A;  1S10 A;  1S5L U;  1ZQ1 C;  4I2A A;  1T8E A;  1PK1 A;  4DEZ A;  5G5H A;  2BPC A;  1ZQU A;  8ICZ A;  3PSP A;  2QAR B;  3PX4 A;  5KFI A;  1NK0 A;  4NLG A;  1ZQT A;  5CB1 A;  4O5K A;  3V6K A;  2JHD A;  5BOM A;  4O3Q A;  2HCF A;  4M6W A;  4NL9 C;  2JEF A;  4TUP A;  2V4Q A;  3PSF A;  4RT3 A;  3ISB A;  2ZIX A;  4O3S A;  2VKQ A;  5AIA A;  5ALP A;  2EAM A;  4KLH A;  2DBY A;  2ZTE A;  3WK8 A;  4J9N A;  5ALG A;  1CI4 A;  2EAP A;  1UPH A;  2F76 X;  3WKE A;  3EWA A;  4IC9 A;  3PZP A;  1TK0 A;  2PI5 A;  5IIK A;  4EX7 A;  3WKB A;  1T4G A;  4UAW A;  3KHH A;  1L7P A;  2G06 A;  3HRD D;  1BPE A;  4P4M A;  1NZB A;  4C8O A;  3GDX A;  2BR0 A;  3N97 B;  3HKZ C;  4U6P A;  2VAN A;  5J0T A;  3KHL A;  3PW4 A;  2WF6 A;  7ICG A;  2W55 A;  1JMS A;  4UBC A;  1T94 A;  2FE9 A;  2B0C A;  2ZJA A;  5J2F A;  1GO3 F;  4I2F A;  4F5R A;  2KZ3 A;  5AI5 A;  2H3F A;  5KFJ A;  1F0M A;  3EZ5 A;  4NL9 A;  4J9Q A;  1SKS A;  4C4R A;  4Y2Q A;  2RHF A;  4BJQ A;  2BHN A;  4EEL A;  3M1Y A;  3PR4 A;  2HHQ A;  3GV7 B;  4UB3 A;  5BOL A;  3MR6 A;  2DFL A;  5J0X A;  4F71 A;  2KSO A;  4Z6F A;  2N1R A;  2P6R A;  1D9F A;  4F92 B;  2IOF A;  4DL4 A;  4JWM A;  4Z6E A;  4DQQ A;  5C5J A;  3RRH A;  3NGD A;  1L7N A;  3ZI4 A;  3SQI A;  4KLF A;  4DF8 A;  2RRD A;  2LI6 A;  1ZQY A;  3TAD C;  5AK6 A;  1XSN A;  1SL1 A;  2GOL A;  8ICM A;  2YB4 A;  4I29 A;  2HMX A;  1SL0 A;  2G5H B;  1ZQH A;  1MC8 A;  1NJW A;  3FC4 A;  4R8U A;  3VCB A;  5AKG A;  9ICX A;  1F44 A;  2J6S A;  2KZZ A;  2PFP A;  4DL5 A;  2PXI A;  3TFR A;  1PK1 B;  3F2D A;  5KG0 A;  4FZM A;  1QQ5 A;  4CF5 A;  3SAH A;  4BXO B;  4ELT A;  1BGX T;  3FAH A;  8ICK A;  2EAN A;  4YVZ A;  2OHF A;  3NRZ A;  4RUA A;  4NM2 A;  4Y2T A;  4KLG A;  2LM1 A;  4F4X A;  2DGZ A;  1A6S A;  7ICN A;  1FFU A;  2ZIX B;  1BPZ A;  1X9S A;  4Q43 A;  3NVY A;  1URJ A;  4ELU A;  3WK6 A;  5ALV A;  4KN7 A;  4Z6D A;  4Y2X A;  3N4M B;  1C7Y A;  1IIP A;  4FZL A;  5AKE A;  4KN4 A;  5DG9 A;  3F53 A;  1WG8 A;  2Q0Z X;  4RQ7 A;  4ECW A;  1N62 A;  2ASJ A;  2OM6 A;  5F9N A;  4UBB A;  2ZIW A;  4B9V A;  1ZQL A;  2PFO A;  1LVH A;  4BDP A;  1M6Y A;  3THV A;  1HUO A;  3UMG A;  4BX9 C;  2H3V A;  1JIH A;  1KW4 A;  4DSI A;  3T5L A;  4YR0 A;  2DKZ A;  2D6F C;  1ZQF A;  5CP2 A;  4Q8F A;  3V6J A;  2HOI A;  1DRG A;  3RBD A;  4I2B A;  3RB0 A;  1X6J A;  4YN4 A;  2B21 A;  5KFA A;  1Z19 A;  3G6Y A;  5J0O A;  3M9M B;  4ECY A;  8ICA A;  3PX6 A;  5KAI U;  4YG2 A;  3SAG A;  1Z1V A;  4KLT A;  3RJH A;  4ICA A;  1B43 A;  4C7Z A;  4KMO B;  4YXJ A;  1ZJM A;  1QQ6 A;  2VJ5 A;  2WF7 A;  1PVQ A;  4KX3 A;  1V85 A;  5J8Y C;  5DBC A;  3RJG A;  1SXD A;  5DBA A;  3TAD A;  1A77 A;  1V97 A;  3QE9 Y;  5AKH A;  8ICR A;  3LWM A;  5AKZ A;  5HMM A;  1SV0 A;  8ICV A;  2YTU A;  4DF4 A;  5GTH U;  4O3R A;  2XVT A;  5KFB A;  4DQP A;  4G3I A;  3GIK A;  1ED1 A;  3OPX A;  3KOO A;  4JK1 A;  4J9M A;  4MFA A;  5KFF A;  3E0F A;  2C2D A;  4I2H A;  3E58 A;  1BPD A;  1NK4 A;  4MFC A;  4UAY A;  4RQ1 A;  4K4G A;  2BKE A;  4RQ4 A;  3EYZ A;  4QZG A;  2XC9 A;  2C22 A;  4CNQ A;  1RQN A;  2JV3 A;  5DGA A;  4PZN A;  4IS7 A;  3TAN A;  4M6W B;  5J0Y A;  3GIL A;  3KTQ A;  5J2J A;  5ALY A;  4DS5 A;  5DDM A;  4I2I A;  2ZIV A;  4F4Y A;  3D2Q A;  4QWE A;  2RLT A;  4EZ9 A;  4ECU A;  5C0Y A;  3RH4 A;  2WAQ C;  3QYP A;  2KKP A;  4IQW A;  2QB1 A;  2K60 A;  2OEH A;  5AM1 A;  5ALI A;  4QZC A;  5KNI A;  3V72 A;  3SMV A;  3PO5 A;  4RPX A;  4F5N A;  4JUZ A;  1SV4 A;  2FMS A;  4R65 A;  2ASD A;  1KKX A;  2LYA A;  1TK5 A;  4O3N A;  5KT6 A;  4ECV A;  1U9L A;  4NM1 A;  4Z6C A;  8ICF A;  5ALF A;  3RJF A;  3GZF A;  1ZQW A;  4OJL A;  3U26 A;  3EPG A;  2WB1 C;  5B5E U;  1QH9 A;  3TAP A;  5TZV A;  1N2X A;  5KFD A;  4O5E A;  4ACO A;  2LMR A;  2ZIU A;  2EZY A;  3MBY A;  1WYG A;  1NK5 A;  2Y0S C;  3D6J A;  4YP3 A;  4NLZ A;  3RB4 A;  3UM9 A;  5KFZ A;  3HPO A;  8ICJ A;  4B9U A;  1JXL A;  3BDP A;  3K4G A;  3T5J A;  4DOB A;  4GFJ A;  3GQC A;  1HIW A;  9ICB A;  1COO A;  2GO7 A;  9ICG A;  4P0P A;  1JN3 A;  2W04 A;  3FM9 A;  3K1R B;  1U45 A;  4KMU A;  4KLO A;  1ZXI A;  5HHI A;  4F4W A;  1VDV A;  4MF2 A;  1ZQS A;  1PVP A;  4DLE A;  4QW8 A;  4IR1 A;  4PZO A;  4GLX A;  4JV1 A;  1NKE A;  1WWU A;  2AGQ A;  1JAL A;  4B6J A;  1MSW D;  3PW5 A;  3Q8L A;  3RB6 A;  1A0P A;  4KLS A;  3ZD9 A;  1YZ6 A;  2J6T A;  7ICR A;  1ZQO A;  5AK5 A;  3LYS A;  1NK7 A;  1TKD A;  1FEZ A;  3ED5 A;  2Z7J A;  3T3F A;  4F4Z A;  2JH1 A;  1UT8 A;  3LWL A;  4F4K A;  3PVX A;  2ALZ A;  4UB8 U;  2IOH A;  1L8O A;  2EH9 A;  3I1Y A;  1NK8 A;  3C1Y A;  3PY8 A;  2A1A A;  3TI0 A;  1KL9 A;  2NV3 A;  2YX8 A;  3HKZ F;  5EE1 A;  3RB3 A;  3MGH A;  4ED0 A;  2BCQ A;  2XID A;  2HHT A;  9ICQ A;  1ZQE A;  2NO4 A;  5HNK A;  2I9G A;  4IRC A;  2NRT A;  2WB1 F;  3RJE A;  1TK8 A;  2H3Q A;  4LJX A;  3ZDE A;  2RDJ A;  3HW8 A;  2AQ0 A;  2NRW A;  1L3V A;  2NRX A;  2PFQ A;  1TAM A;  4F5P A;  3BZK A;  2A1J A;  2BCU A;  2IOF K;  3GIM A;  4KIT B;  2QKQ A;  1U4B A;  9ICE A;  3IM1 A;  4GXJ A;  1PK3 A;  3AEV A;  4C8L A;  3ALR A;  8ICX A;  3OSN A;  2F44 A;  4DCC A;  3T5H A;  5HR7 A;  1Z3E B;  1C20 A;  5KG6 A;  4A8E A;  3PX0 A;  1D8B A;  5L1L A;  2JXJ A;  5CJ7 A;  2YMM A;  1ZQV A;  9ICH A;  2BQ3 A;  1QSL A;  1K1S A;  2KJ5 A;  3SV4 A;  1ZD2 P;  3T79 A;  2DL0 A;  5DGB A;  3IRU A;  4USA A;  1NOM A;  1SXE A;  1MN8 A;  4YD2 A;  1UT5 A;  3OSP A;  2YMP A;  1SKR A;  2XI9 A;  3OGU A;  5DB6 A;  4YR3 A;  4Q8E A;  3VC8 A;  3ZDA A;  1SZP A;  1Q8K A;  3ZDB A;  4J9S A;  2JRZ A;  2W11 A;  4K4I A;  4BWM A;  2E1F A;  5AKX A;  3H4B A;  3DDH A;  3BQT A;  5IIM A;  2K8C B;  5CEH A;  4CE6 A;  1UQV A;  3KZI U;  4QZ8 A;  2GWS A;  2HOQ A;  5ALH A;  4ECZ A;  4NLK A;  4QWB A;  8ICW A;  4QZA A;  1QTM A;  1L7O A;  2YY6 A;  1SKW A;  5DQI A;  2BDP A;  1SWW A;  5KFW A;  3FYH A;  2W9A A;  2R8J A;  4UAS A;  2FLP A;  3MR5 A;  1DK2 A;  3F5E A;  1S0V A;  4UAZ A;  3AMZ A;  4TQS A;  3M8R A;  5J2D A;  1LKY B;  2W54 A;  3QZ7 A;  3N7P D;  1S77 D;  5ALJ A;  4I2G A;  4AYB C;  4XRH A;  5J2E A;  1ZRN A;  2ZXI A;  5E79 U;  3QUC A;  1BVS A;  5KG1 A;  1PZN A;  4DFP A;  2XY7 A;  4Y2V A;  1UA1 A;  3JPS A;  5J2B A;  1NKB A;  4RZR A;  5HR6 A;  3RR8 A;  2W3R A;  3AU2 A;  4F93 B;  3NUQ A;  4AYB F;  5J2K A;  2WFA A;  4QZD A;  4O9M A;  5AK3 A;  2WF8 A;  7ICE A;  3QU9 A;  2YB1 A;  3CP8 A;  2KHV A;  4FS2 A;  4EBD A;  4JWN A;  5KT5 A;  2H3Z A;  1SZH A;  3SV3 A;  1YZ7 A;  5KFC A;  4YMM A;  3HWT A;  5KFH A;  3RF9 A;  3KBB A;  2Y9T A;  5ALK A;  4E0D A;  4Y2Y A;  4CGZ A;  2KSO B;  4NV0 A;  4RU9 A;  5ALO A;  5AKL A;  3AL0 B;  2HBM A;  9ICW A;  4EZ6 A;  4IQV A;  1XWL A;  4P0Q A;  4DQR A;  1RXV A;  3WU2 U;  3UMB A;  1S97 A;  4Y2P A;  4RNN A;  1T7P A;  4PPX A;  5AI8 A;  5BPC A;  4RPZ A;  4M9L A;  9ICM A;  1AQ6 A;  2YQE A;  5ALS A;  1UCV A;  2K8A A;  4TUR A;  3AU6 A;  3QU5 A;  4PHE A;  8ICT A;  1KN5 A;  4Y2J A;  2W9M A;  2I6X A;  2R8H A;  8ICO A;  3N7S C;  2YN4 A;  4RQ2 A;  3BS5 B;  2ISP A;  1SB3 C;  5KG4 A;  4NLC A;  1V38 A;  1ZQG A;  4RT2 A;  5J2H A;  2ATL A;  3IG5 A;  5HML A;  4IQU A;  5ALE A;  4RNM A;  2MSN A;  4ECR A;  2QB0 A;  2R8G A;  2K89 A;  4RQ0 A;  2DF4 B;  4UB5 A;  2E1E A;  2HVH A;  3Q8K A;  2ODG A;  3GFK B;  3C2M A;  1RYU A;  2MUT B;  7ICM A;  1X42 A;  3R9K A;  4PL1 A;  2KP7 A;  1KLN A;  4OJ5 A;  2NYV A;  3EPI A;  2AQ4 A;  2DQN B;  3NAS A;  4DQI A;  4KLE A;  3JPN A;  1ZRM A;  4QZH A;  5AM2 A;  5CWR A;  2XY5 A;  2GH1 A;  3BJY A;  2O6K A;  4X5V A;  4DWI A;  3C5G A;  2ZUC A;  1WWV A;  3BQ1 A;  4J9R A;  5IIL A;  3HX0 A;  2HHU A;  3TFS A;  7ICU A;  5FP0 A;  1NJX A;  3RFA A;  3ORY A;  1S0N A;  1KSP A;  4QWD A;  4FE3 A; 
#chains in the Genus database with same CATH homology
 4IQW A;  3GV8 B;  5DLG A;  3MFH A;  2W8L A;  7ICS A;  3H8W A;  1JXE A;  4QZC A;  3V72 A;  2C2E A;  3PO5 A;  4RQ5 A;  4NXZ A;  4RPX A;  4ED1 A;  4F5N A;  4JUZ A;  3GV5 B;  1V9P A;  5KFR A;  4YMN A;  3UQ0 A;  2FMS A;  4R65 A;  2ASD A;  4R63 A;  1KEJ A;  2F1I A;  1TK5 A;  4O3N A;  4ECX A;  4F8R A;  5KT6 A;  4ECV A;  1U9L A;  4NM1 A;  1D8Y A;  3Q8Q B;  3OJU A;  3ISC A;  4Z6C A;  3B0X A;  8ICF A;  1ZQX A;  5J2A A;  3JPP A;  3RJF A;  1Z00 B;  5KFT A;  1ZQW A;  3ZDC A;  4C8N A;  3PV8 A;  7ICV A;  4BWJ A;  3EPG A;  1HUZ A;  3TAP A;  3ZDD A;  3UXP A;  4QZB A;  1H38 A;  5TZV A;  1X9W A;  4F3O A;  2KFZ A;  1KFT A;  3EW9 A;  2RDI A;  2ZJ8 A;  1CUK A;  1RZT A;  5KFD A;  4O5E A;  3C21 A;  2DPJ A;  4QZI A;  2UVW A;  4ZH4 A;  4BGD A;  2Y1J A;  3MBY A;  7ICH A;  1NK5 A;  2BCR A;  4KLM A;  2ZJ5 A;  1ZQP A;  4YP3 A;  4NLZ A;  4KLD A;  3RB4 A;  3MDA A;  2UVV A;  1KFD A;  1HJP A;  8ICC A;  5KFZ A;  3HPO A;  8ICJ A;  4B9U A;  1JXL A;  3KHG A;  3SYZ A;  2UVU A;  3BDP A;  2PFN A;  4FBU A;  5KFE A;  3K4G A;  4RPY A;  4JV2 A;  3T5J A;  1K1Q A;  3UXN A;  4DOB A;  5DG7 A;  4LVS A;  8ICE A;  1NJY A;  3GQC A;  3TAQ A;  7ICL A;  1TVA A;  9ICB A;  3GII A;  5KFN A;  1TAU A;  3QEA Z;  2MAX A;  1COO A;  1XSP A;  2BCS A;  3Q8M A;  4KLQ A;  3B0Y A;  7ICJ A;  9ICG A;  3V6H A;  1TV9 A;  3ISD A;  4M04 A;  2ZUB A;  1DOQ A;  2P66 A;  5KFP A;  5L1K A;  1JN3 A;  4PH5 A;  2ZTC A;  1U45 A;  3JPR A;  4IRD A;  4KMU A;  4K4H A;  4M9J A;  4KLO A;  5DQH A;  2W9B A;  7ICF A;  3RJI A;  2ASL A;  4P4O A;  4YFK A;  3RJK A;  5KT7 A;  4DL2 A;  5HHI A;  9ICR A;  1ZQN A;  4F4W A;  4MF2 A;  9ICS A;  1ZQS A;  3V7L A;  5J2I A;  4EYI B;  5KFO A;  4DLE A;  4J9P A;  4QW8 A;  3TAR A;  4M9N A;  5KFV A;  5KG7 A;  4IR1 A;  1ZQR A;  8ICG A;  1ZQD A;  4GLX A;  4YQW A;  2IA6 A;  8ICH A;  4JV1 A;  1NKE A;  2AGQ A;  5L9X A;  1MSW D;  4I2E A;  1A76 A;  3PW5 A;  4DFJ A;  3Q8L A;  4M0A A;  4ED6 A;  5CHG A;  3RB6 A;  1L3T A;  4DFK A;  5DBB A;  3PW2 A;  4KLL A;  4KLS A;  3M8S A;  2KN7 A;  1LB2 B;  3MGI A;  3ZD9 A;  3OJS A;  1NJZ A;  4GXK A;  5KG5 A;  2W9B B;  2J6T A;  7ICR A;  1Y88 A;  1ZQO A;  4CCH A;  4DSK A;  1NK7 A;  9ICU A;  1TKD A;  4DOC A;  4F4Z A;  3C1Z A;  1UT8 A;  2NRV A;  4UB1 A;  3LWL A;  3T3F A;  3PVX A;  4F4K A;  4M9G A;  2ALZ A;  2JEI A;  1N56 A;  3RBE A;  4C8M A;  2WTF A;  2VA2 A;  8ICL A;  5D4B A;  8ICS A;  4F5Q A;  1NKC A;  3RTV A;  4IRK A;  4KTQ A;  4ED3 A;  4QZ9 A;  1NK8 A;  4I2D A;  9ICF A;  3C1Y A;  4TUQ A;  3PY8 A;  1ZQJ A;  4UB4 A;  4IQT A;  3TI0 A;  1S10 A;  3LDA A;  4I2A A;  1T8E A;  2IHN A;  4KLJ A;  4NLN A;  9ICP A;  4DEZ A;  3TQ1 A;  3GIJ A;  2BPC A;  1KFS A;  1ZQU A;  4I28 A;  8ICZ A;  2HHS A;  1RYS A;  5DB7 A;  3H8S A;  2W9C B;  3G6X A;  3RB3 A;  5J0Q A;  3MGH A;  3PX4 A;  4ED0 A;  2BCQ A;  2HHT A;  5KFI A;  3JPO A;  4IR9 A;  9ICQ A;  3JPT A;  1NK0 A;  1ZQE A;  2XGQ A;  1ZQB A;  7ICK A;  1S0M A;  5HNK A;  2BCV A;  4PHD A;  4NLG A;  4B9L A;  1ZQT A;  2JEJ A;  4B9N A;  5CB1 A;  4O5K A;  3V6K A;  5IIJ A;  2I9G A;  4IRC A;  1JX4 A;  4XQ8 A;  5BOM A;  4O3Q A;  2NRT A;  4M6W A;  5KTQ A;  1TK8 A;  3RJE A;  3H4D A;  2AU0 A;  2JEF A;  3ZDE A;  5CR0 A;  4TUP A;  3RJJ A;  2RDJ A;  3HW8 A;  2V4Q A;  2AQ0 A;  2NRW A;  1L3V A;  2NRX A;  1MQ3 A;  2PFQ A;  2ISO A;  4RT3 A;  3OHB A;  3ISB A;  4F5P A;  2A1J A;  4GXI A;  2V9W A;  2BCU A;  4O3S A;  4PGX A;  3ETL A;  2HVI A;  8ICP A;  1BPB A;  3GIM A;  4QZF A;  4KLH A;  4KIT B;  4R8U B;  1UA0 A;  1U4B A;  9ICE A;  3IM1 A;  1U47 A;  4GXJ A;  1S0O A;  2ZTE A;  4RQ6 A;  3UXO A;  1ZQQ A;  3H40 A;  1ZJN A;  2VA8 A;  4C8L A;  4F2R A;  8ICX A;  4J9N A;  4P2H A;  1KTQ A;  1XS9 D;  3OSN A;  5EOZ A;  2BQU A;  5KG2 A;  7ICI A;  1WCN A;  3EWA A;  9ICT A;  4ELV A;  4M2Y A;  3H7I A;  1TK0 A;  2PI5 A;  4J9L A;  5IIK A;  3T5H A;  1NK6 A;  2LYH A;  3C2L A;  1T4G A;  1SL2 A;  4UAW A;  5KT3 A;  1Z3E B;  3KHH A;  5EWG A;  2JZB B;  1BPE A;  5KG6 A;  3BQ2 A;  4TQR A;  4P4M A;  2UVR A;  4DL3 A;  4C8O A;  3GDX A;  3PX0 A;  2H5X A;  4KLI A;  5L1L A;  4MF8 A;  2R8I A;  5CJ7 A;  3N97 B;  3M9N B;  2BR0 A;  2VAN A;  1ZQV A;  3RH5 A;  2AJQ A;  9ICH A;  2BQ3 A;  5J0T A;  1QSL A;  4RQ8 A;  2FPK A;  3KHL A;  3PW4 A;  2W8K A;  7ICG A;  4R66 A;  1JMS A;  4UBC A;  1K1S A;  2KTQ A;  2PI4 A;  2ZJA A;  5J2F A;  3SV4 A;  4I2F A;  1L5U A;  3RR7 A;  4F5R A;  2KZ3 A;  4DSE A;  5KFJ A;  4XUS A;  3EZ5 A;  4PGY A;  3UQ2 A;  5DGB A;  3HT3 A;  1NOM A;  1S9F A;  4J9Q A;  5KFQ A;  1SKS A;  1QLN A;  4YD2 A;  1UT5 A;  5L1I A;  3OSP A;  5J0U A;  1ZQZ A;  4QZE A;  2BHN A;  4ED2 A;  8ICI A;  5L1J A;  3RRG A;  2FLN A;  7ICO A;  2JZB A;  1SKR A;  1QSS A;  2XY6 A;  3OGU A;  4FS1 A;  3K75 D;  5DB6 A;  1WCL A;  3PR4 A;  2HHQ A;  4YR3 A;  2I1Q A;  3GV7 B;  1ZQA A;  4Q8E A;  4UB3 A;  3V7K A;  1N48 A;  2V4R A;  5BOL A;  2AGP A;  3ZDA A;  3MR6 A;  1SZP A;  4EEY A;  3ZDB A;  4J9S A;  4QW9 A;  2DFL A;  5J0X A;  2HHV A;  4DS4 A;  2BGW A;  4K4I A;  4BWM A;  5DLF A;  4Z6F A;  3Q8S B;  3H4B A;  9ICL A;  5EWF A;  3BQT A;  5IIM A;  2P6R A;  1D9F A;  1KRP A;  1IM4 A;  4FBT A;  2HW3 A;  1U49 A;  4EBC A;  1RXW A;  4PHP A;  4F92 B;  4UQG A;  3NTU A;  1ZQC A;  4DL4 A;  4QZ8 A;  4DOA A;  2GWS A;  4DQS A;  4F2S A;  4Z6E A;  4JWM A;  4F5O A;  4DQQ A;  1EXN A;  2F1J A;  5C5J A;  3NGD A;  5J29 A;  4HYK A;  4GC6 A;  4ECZ A;  4QWB A;  3RRH A;  4NLK A;  4B9M A;  4DFM A;  4I27 A;  4KLF A;  8ICW A;  4LZD A;  4QZA A;  1QTM A;  4DF8 A;  7ICP A;  3FDS A;  4ED8 A;  1ZQY A;  2M9N A;  4F91 B;  1SKW A;  5DQI A;  4FO6 A;  1XSN A;  1SL1 A;  5KFS A;  3KHR A;  2BDP A;  8ICM A;  5KFL A;  4I29 A;  5KFW A;  3FYH A;  2W9A A;  1SL0 A;  2R8J A;  1T3N A;  2FLP A;  4PHA A;  3MR5 A;  1ZQH A;  1S0V A;  4UAZ A;  1MC8 A;  1NJW A;  1ZQK A;  8ICB A;  4TQS A;  4MEY A;  4R8U A;  3M8R A;  4LZG A;  5J2D A;  1ZQM A;  3QZ7 A;  1S76 D;  9ICX A;  2J6S A;  3OHA A;  1S77 D;  2KZZ A;  2PFP A;  4DL5 A;  4I2G A;  5KFG A;  2PXI A;  1ARO P;  3TFR A;  5D49 A;  3Q8P B;  9ICV A;  4XRH A;  5J2E A;  5KG3 A;  2HHW A;  4UB2 A;  5KFX A;  5KG0 A;  4BXO A;  4BXO B;  4O5C A;  1BVS A;  4I2C A;  2C28 A;  4ELT A;  1RPL A;  5KG1 A;  9ICN A;  4B9T A;  1BGX T;  1XO1 A;  3MFI A;  1PZN A;  4DFP A;  8ICK A;  4YVZ A;  2XY7 A;  9ICC A;  4RUA A;  1UA1 A;  3JPS A;  5J2B A;  4YXM A;  1NKB A;  4DSL A;  1MQ2 A;  4NM2 A;  5KFY A;  4RZR A;  3RR8 A;  3AU2 A;  4F93 B;  9ICO A;  4KLG A;  5HHH A;  5J2K A;  4F4X A;  5DB9 A;  5J0S A;  4QZD A;  4O9M A;  7ICE A;  7ICN A;  2FPM A;  2A1J B;  1BPZ A;  1X9M A;  1X9S A;  5D46 A;  4Q43 A;  4JV0 A;  2Y1I A;  2J6U A;  5III A;  4O3O A;  5J0R A;  4ELU A;  4KN7 A;  4Z6D A;  3N4M B;  4DLG A;  1C7Y A;  5IIN A;  4FS2 A;  4EBD A;  4JWN A;  5KT5 A;  1D8L A;  2ZTD A;  2ZUD A;  3PMN A;  2BPF A;  4KN4 A;  4I2J A;  3SV3 A;  1XU4 A;  1CEZ A;  5DG9 A;  5KFC A;  4YMM A;  3AUO A;  3HWT A;  4J9K A;  4ECQ A;  4RQ3 A;  5DQG A;  5KFH A;  1TAQ A;  2Q0Z X;  4RQ7 A;  7ICQ A;  9ICI A;  5DB8 A;  4ECW A;  2ASJ A;  5F9N A;  2OWO A;  4XA5 A;  4E0D A;  2VA3 A;  5CA7 A;  5J2G A;  5KFK A;  4RU9 A;  4DL6 A;  8ICQ A;  7ICT A;  4C8K A;  4UBB A;  8ICN A;  1KDH A;  9ICW A;  4B9V A;  1ZQL A;  2PFO A;  2F1H A;  4BDP A;  4R64 A;  4YD1 A;  4EZ6 A;  4O0I A;  3QEB Z;  3THV A;  1HUO A;  2FLL A;  4IQV A;  1XWL A;  3HP6 A;  3KTQ A;  4DQR A;  1RXV A;  2NRZ A;  2KZM A;  1JIH A;  4DSI A;  5DDY A;  3T5L A;  1X2I A;  8ICU A;  4YR0 A;  1S97 A;  1ZET A;  4MFF A;  4RNN A;  3C5F A;  2JEG A;  1ZQF A;  5CP2 A;  1T7P A;  4PPX A;  4Q8F A;  4QWA A;  9ICK A;  5BPC A;  4RPZ A;  3V6J A;  4M9L A;  9ICM A;  2KFN A;  3RBD A;  4I2B A;  3RB0 A;  5J0P A;  3MR3 A;  4DSJ A;  5KFM A;  4TUR A;  3AU6 A;  4YN4 A;  2B21 A;  5KFA A;  3C2K A;  5EWE A;  3G6Y A;  1XC9 A;  5J0O A;  3M9M B;  3PO4 A;  5IIO A;  4ECY A;  8ICA A;  4PHE A;  3RAX A;  8ICT A;  3PX6 A;  3E2E A;  4PGQ A;  4YG2 A;  2FMQ A;  3SZ2 A;  2XCP A;  1ZYQ A;  2W9M A;  2R8H A;  2AGO A;  1XSL A;  1RYR A;  5DG8 A;  4YMO A;  3RJH A;  3QZ8 A;  1B43 A;  4KLT A;  8ICO A;  4DL7 A;  3M9O B;  4RQ2 A;  9ICA A;  3PW7 A;  1L3U A;  4YXJ A;  3T5K A;  2ISP A;  2C2R A;  4O3P A;  1ZQI A;  4F50 A;  2BPG A;  8ICY A;  5KG4 A;  2XO7 A;  3RH6 A;  1ZJM A;  3JPQ A;  4DO9 A;  2HHX A;  3ZD8 A;  1QSY A;  5DBC A;  1BPY A;  5KFU A;  3RJG A;  1ZQG A;  4M9H A;  5DBA A;  4RT2 A;  4YCX A;  4YR2 A;  5J2H A;  4ECT A;  2ATL A;  5HML A;  1A77 A;  2XCA A;  4IQU A;  3BQ0 A;  4ECS A;  4RNM A;  4TUS A;  3QE9 Y;  4Q45 A;  8ICR A;  3LWM A;  4ECR A;  5HMM A;  2R8K A;  2R8G A;  2IHM A;  1DGS A;  3PW0 A;  8ICV A;  3MR2 A;  4DF4 A;  2IMW P;  4O3R A;  4P4P A;  4RQ0 A;  5KFB A;  4DQP A;  4UB5 A;  2HVH A;  4G3I A;  3GIK A;  1NK9 A;  3Q8R B;  3Q8K A;  3GFK B;  2BQR A;  2IBK A;  3C2M A;  2MUT B;  4JK1 A;  7ICM A;  4J9M A;  5J2C A;  4MFA A;  1B22 A;  5KFF A;  2C2D A;  4EBE A;  1L3S A;  2DPI A;  4I2H A;  1KLN A;  3LK9 A;  2FMP A;  1BPD A;  3EPI A;  2AQ4 A;  1NK4 A;  3PR5 B;  4MFC A;  4KLU A;  4UAY A;  4RQ1 A;  4QWC A;  4DQI A;  4K4G A;  4KLE A;  2BKE A;  3JPN A;  4RQ4 A;  3EYZ A;  4MEX A;  4QZG A;  3RAQ A;  4ED7 A;  2XC9 A;  2C22 A;  5DGA A;  9ICJ A;  4QZH A;  1LV5 A;  3SI8 A;  3IHQ B;  5CWR A;  4RUC A;  3V7J A;  1D9D A;  2XY5 A;  3TAN A;  4M6W B;  1U48 A;  4NY8 A;  5J0Y A;  3BJY A;  3GIL A;  4X5V A;  4DWI A;  2FPL A;  4RNO A;  1IXR A;  5KT2 A;  2ZUC A;  5KT4 A;  2W9C A;  3C5G A;  3BQ1 A;  5J2J A;  4J9O A;  4Q44 A;  4J9R A;  4DS5 A;  4GC7 A;  5HP4 A;  2P6U A;  5J0W A;  5DDM A;  5IIL A;  4I2I A;  5DKW A;  5JUM A;  2MUT A;  3HX0 A;  2HHU A;  4F4Y A;  1TFR A;  3MAB A;  4QWE A;  3UPQ A;  4DSF A;  3TFS A;  4EZ9 A;  7ICU A;  4ECU A;  4M47 A;  1NJX A;  1BPX A;  3C23 A;  3ORY A;  4B9S A;  2XGP A;  3H8J A;  1Z00 A;  3RH4 A;  3G6V A;  5F9L A;  4EYH B;  1S0N A;  1KSP A;  4QWD A;  3PNC A;  3PML A;  3MDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...