2KZ3A

Backbone 1h, 13c, and 15n chemical shift assignments for human rad51d from 1 to 83
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the N-terminal domain of human Rad51D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Putative uncharacterized protein RAD51L3
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kz3A00
7ICOA 2W9CA 4JUZA 3MFHA 1ZQJA 4QWCA 2A1JB 4EBCA 4DWIA 1BPXA 5KG0A 4O3OA 4QZBA 1ZQHA 4I2IA 5DG9A 4PHDA 5D49A 4FBUA 1RYSA 4BXOA 4F2SA 1WCLA 4K4HA 1SZPA 4DS5A 4GC7A 3OSPA 4M9LA 2ZJ8A 1MSWD 3PX4A 5L9XA 2NRXA 2AGPA 2HHWA 1UA1A 4I2HA 8ICRA 3T5LA 9ICWA 1S97A 8ICCA 5KFAA 8ICYA 4UB4A 7ICRA 4MEYA 2FLPA 2F1IA 1MC8A 5KG6A 1V9PA 4IR9A 5KT4A 4EYIB 4ECVA 7ICUA 5L1KA 1U47A 5KFKA 2KZMA 5HHIA 5IILA 7ICNA 4KLLA 5HMLA 2HHVA 4FO6A 8ICLA 4KLMA 4F91B 3PR5B 4JK1A 1PZNA 4RQ1A 2FLNA 4BWJA 3PW7A 4RUCA 3TARA 2IMWP 4FBTA 4M2YA 4M47A 7ICGA 4NLKA 2HHXA 5KFQA 2PI4A 3BQ2A 4DSKA 4I2GA 3V6JA 5DLFA 4YFKA 3THVA 4KMUA 4F5OA 4DLEA 4DFMA 3RRHA 2C2DA 2MUTB 1SKRA 4E0DA 2BHNA 2MAXA 4IQWA 9ICKA 7ICEA 1B22A 7ICVA 3AU2A 3H7IA 4F4YA 3C5GA 4IQUA 3Q8PB 4F5QA 3PW0A 4KTQA 4PGYA 2W9MA 5KFJA 3EPGA 5F9NA 8ICPA 1S0VA 2BPCA 1QSSA 3ZDEA 1ZQFA 2P66A 4YMNA 3UPQA 9ICUA 1KTQA 1ZYQA 4Z6DA 1ZQVA 7ICQA 1KFSA 3IM1A 2I9GA 2W9AA 2BPGA 2PFNA 2KZ3A 1BPBA 4YMMA 2W9BB 3UQ2A 8ICZA 5DDYA 5KFOA 2FMPA 9ICIA 4RT2A 1Z3EB 4RQ5A 4EBEA 3T5HA 2UVRA 1ZQTA 2ISOA 1A76A 3T5KA 5KFMA 1ZQSA 2W8LA 8ICHA 4UB1A 4ECZA 4P4MA 2F1JA 1QTMA 5KG4A 2R8KA 4Z6EA 4C8MA 1XWLA 3RB3A 4O3NA 1BPZA 3PR4A 1TK0A 4DQRA 1S76D 5D4BA 5CWRA 4J9LA 1UT5A 4BDPA 4R63A 3MABA 2KTQA 3LWLA 4DL6A 4B9VA 4B9LA 4ECRA 3QZ7A 4JV2A 3BQTA 4QZ9A 4XUSA 5J2HA 2J6TA 3G6XA 1BPEA 4B9NA 9ICEA 3MDAA 4DFPA 4PHAA 2PFQA 5CHGA 8ICKA 1COOA 3OHAA 2P6UA 5IIIA 4DL7A 3RH6A 3RJJA 5TZVA 1D8YA 3UXNA 4KITB 4KLDA 1B43A 1ZQWA 5KFRA 2ISPA 1TK5A 4KLQA 2VA2A 9ICVA 4LZDA 8ICBA 5IIMA 9ICCA 3QEAZ 3PW2A 5HP4A 4ED3A 2DPJA 2NRWA 3GQCA 4RQ2A 2C2EA 1JN3A 5DB6A 1XS9D 4ECXA 4YVZA 4DO9A 1ZQEA 3KHHA 1NKBA 5KFSA 3HPOA 4IQVA 4PHPA 4J9QA 1JX4A 5KFPA 3EZ5A 3C2MA 5DLGA 8ICUA 2NRVA 8ICEA 2R8IA 2R8HA 2KFZA 4M9JA 4O3RA 4KLEA 5J2DA 3B0XA 2XC9A 5BOLA 4QWAA 1RPLA 1NJXA 1ZQZA 3JPSA 1ZQCA 3BDPA 9ICFA 3RJKA 2ATLA 3Q8RB 4R8UB 1Y88A 4YD2A 3AUOA 3PX0A 2AGQA 4J9PA 4BXOB 1NK7A 4F5PA 5KFHA 2VA3A 1S10A 2Y1JA 2IA6A 1CEZA 3OHBA 1MQ2A 4GXJA 8ICGA 4Q44A 5J2EA 3GIJA 1KSPA 4J9RA 1KRPA 4G3IA 4DFKA 4KLFA 2PXIA 1ZQXA 2B21A 2XY7A 1ZQBA 4IRCA 4MFCA 1MQ3A 4DSFA 3SV3A 4CCHA 5DKWA 3GV5B 4KLSA 3T5JA 3GDXA 4UB3A 3PW4A 4JV0A 4PHEA 4ECWA 1SKSA 5IIOA 1BPYA 5EWFA 3ISDA 4I2BA 3Q8LA 5BPCA 2BCVA 4ED6A 1XO1A 2C28A 4QZ8A 3ORYA 4J9KA 2ZJAA 4RQ4A 9ICOA 2FPKA 1X9MA 3JPNA 1ZQOA 4KLIA 2W8KA 3NGDA 3TAQA 2AGOA 1U45A 5J2IA 5KFEA 5J0QA 4UB5A 3OGUA 3HT3A 5DQGA 4ECSA 3V6HA 1X9WA 2BGWA 1ZQKA 4QZIA 4RPYA 1NKCA 4KLJA 4DQQA 3ZDDA 8ICQA 4F50A 4DSEA 2BCQA 4B9UA 1L3TA 5J2AA 1JIHA 1JXEA 4QZFA 3Q8QB 3ISBA 3C1ZA 2P6RA 4NLZA 2BDPA 9ICAA 4IRDA 3ZDCA 3C2LA 5CB1A 4I27A 5DBBA 4EZ6A 3H8JA 2ZUDA 4QZHA 3RBDA 4DEZA 3GFKB 2XCAA 2AQ4A 4B9TA 5KFXA 1NK9A 1K1QA 5DDMA 3M9MB 2RDIA 3H40A 1TK8A 1TKDA 3BQ1A 3ZDBA 3M9OB 1T8EA 9ICXA 5IINA 4BWMA 4RQ0A 2FPLA 4ED0A 3AU6A 4DQSA 4JWNA 4I2FA 1LB2B 2IHNA 5L1LA 1L3SA 5DBAA 2JEJA 5J0XA 4DQPA 4DSLA 1TV9A 4Q8EA 2JEIA 1DGSA 5J2CA 3G6YA 5J0WA 1ZQLA 1D9DA 4JWMA 3C23A 3ZD8A 2HHQA 3V7LA 3Q8MA 1ZQQA 5KFGA 4M04A 4ED1A 3HP6A 4R8UA 4UAYA 3BQ0A 2V9WA 4UAZA 8ICIA 2GWSA 5DB8A 2HW3A 3C21A 5KFIA 3UQ0A 2W9CB 1XC9A 9ICMA 1ZQMA 9ICJA 3RAQA 5J2GA 1DOQA 2FPMA 2MUTA 2I1QA 3OSNA 5J0RA 3SI8A 3H8WA 4YR2A 2FMQA 4XRHA 2NRTA 9ICSA 2XCPA 4RZRA 4TQSA 3RB4A 3PY8A 2WTFA 1TAUA 5KFBA 4O5KA 2R8JA 3TI0A 1QSYA 5KT3A 1C7YA 3M8RA 2AU0A 5KFYA 3MDCA 2M9NA 3PMNA 5EWGA 1NK6A 4UQGA 4KLTA 1KFTA 4YG2A 3QEBZ 4TUQA 5L1IA 5DG7A 3MR6A 5J0YA 4DOAA 3RR7A 4R65A 4ELVA 5KFFA 4RQ3A 3V7JA 1ZJNA 1N56A 4K4GA 2HHTA 4IRKA 2KN7A 1D8LA 3ZD9A 3EWAA 2DFLA 2UVWA 7ICJA 7ICSA 9ICGA 3QZ8A 4J9OA 1KEJA 1Z00A 4YN4A 4MF8A 3GV8B 2ALZA 4YXMA 5DBCA 4MFFA 5KT2A 3V72A 7ICLA 3SV4A 1SKWA 9ICRA 1NJZA 8ICXA 4KN7A 1A77A 2JZBB 2OWOA 5DQIA 2NRZA 4QWDA 3RJFA 3HWTA 4QZCA 3HW8A 3GV7B 1Z00B 3M8SA 1SL0A 1BGXT 3PMLA 5CP2A 8ICMA 2R8GA 5J0UA 4B9MA 2V4QA 4XQ8A 5F9LA 3PV8A 1ZJMA 1HUZA 5L1JA 1NJYA 8ICJA 1U49A 4DL5A 1XSNA 8ICNA 4MEXA 3IHQB 1S0OA 4NY8A 3B0YA 4F5NA 4ZH4A 4RQ6A 2BQ3A 3MR3A 3T3FA 3LWMA 4EBDA 3K75D 5IIKA 5KG2A 5KFUA 4JV1A 1HJPA 4FS2A 2Y1IA 3C5FA 4GC6A 4QZEA 3H8SA 1QSLA 2IHMA 7ICHA 2ZUCA 3M9NB 4I2EA 3JPRA 2LYHA 1QLNA 3RR8A 1LV5A 1BVSA 1L3UA 4ECQA 7ICFA 5DQHA 2PI5A 3HX0A 9ICPA 4LVSA 3V7KA 8ICWA 1S77D 4DF4A 4YR3A 2AJQA 3Q8KA 2BCUA 4KLUA 3FDSA 5KG3A 5KFDA 3OJUA 4DOCA 5HMMA 4O0IA 4I28A 3EYZA 3RJIA 5KFZA 5DGBA 5J29A 5KFNA 7ICMA 4DL3A 5KFWA 4Q45A 4ECUA 1ZQNA 4NLGA 3GIMA 3KTQA 4TQRA 4P2HA 1X9SA 2HHUA 5KG7A 4EZ9A 5DB9A 2V4RA 3MGIA 3MR2A 3SZ2A 4I29A 4RPZA 9ICLA 4GLXA 1D9FA 5CA7A 1T7PA 3EPIA 3GIKA 4F3OA 5KFLA 5KFCA 4BGDA 4O3SA 4RQ8A 2XGQA 4PPXA 4M6WA 5KT7A 3RTVA 4M9NA 5DGAA 8ICTA 4UBBA 2BQUA 1U9LA 1RXVA 1NKEA 4YCXA 2A1JA 4QZGA 4O9MA 4RQ7A 4ED8A 3OJSA 4F4ZA 1BPDA 1TAQA 4C8LA 2ASLA 1TVAA 5HHHA 1AROP 3MBYA 5JUMA 2ZTDA 2HVIA 3QE9Y 1T4GA 3JPTA 4F4KA 4F93B 5CJ7A 3TANA 5J0TA 1UT8A 1K1SA 5KFTA 5KT5A 4I2AA 1ZQDA 4O5EA 1ZQRA 5D46A 1ZQUA 4C8NA 3MGHA 3RB0A 1HUOA 9ICQA 9ICNA 4P4OA 5KG1A 2VANA 4DF8A 4Q8FA 4QWEA 3MR5A 4I2CA 8ICFA 2RDJA 1SL1A 4YD1A 1RZTA 4RNMA 4F92B 3GILA 4PGQA 3BJYA 3G6VA 4F4XA 1ZQGA 4Q43A 3RH5A 4ELTA 8ICAA 4P4PA 3PO5A 5HNKA 1KDHA 1IXRA 3H4DA 1ZQIA 2AQ0A 4YXJA 4DLGA 4NM2A 4LZGA 3C1YA 4RNOA 4MFAA 5KT6A 2C2RA 1JXLA 3UXOA 2W9BA 3H4BA 3RAXA 5BOMA 2ASJA 2HHSA 1EXNA 4RNNA 4HYKA 1X2IA 1T3NA 4QW8A 3UXPA 4QW9A 4DL2A 4QZDA 4UAWA 1IM4A 4J9SA 1NK8A 2XY6A 1SL2A 2BPFA 3JPQA 2IBKA 3PO4A 1KFDA 4O3PA 5J2KA 3PX6A 2FLLA 2ZTCA 5J2BA 4NXZA 2F1HA 1S0MA 2PFOA 4GXIA 2Q0ZX 3LK9A 4IQTA 9ICBA 3V6KA 7ICKA 3K4GA 4F5RA 3TFSA 1XU4A 4DQIA 3EW9A 5KTQA 4Z6CA 4PGXA 4C8KA 4YMOA 3LDAA 1ZQAA 1UA0A 4NLNA 4RPXA 2PFPA 3N4MB 2ZUBA 4EYHB 4O5CA 5EWEA 4RU9A 5DB7A 5IIJA 2J6UA 4IR1A 4QWBA 4O3QA 4KLOA 1NOMA 4KLGA 1KLNA 5EOZA 2XO7A 1L5UA 4ED2A 1RYRA 4M9GA 2J6SA 2ZJ5A 3PNCA 2JEFA 1CUKA 2ZTEA 3C2KA 3MFIA 2JEGA 4YQWA 2BQRA 3TAPA 1ZQPA 5KG5A 4F2RA 4YP3A 2JZBA 5J2JA 4DSJA 4EEYA 4M6WB 2BCSA 4DS4A 2XY5A 8ICOA 4F4WA 1XSLA 2BCRA 3ETLA 4PH5A 1XSPA 3RJHA 8ICSA 3ZDAA 4K4IA 2HVHA 4DFJA 5C5JA 4R64A 2DPIA 3RJGA 2KZZA 7ICTA 1S9FA 4M0AA 4DSIA 4DL4A 4NM1A 1NJWA 4UB2A 2C22A 2UVVA 3KHRA 1RXWA 1NK5A 3FYHA 4Z6FA 5J0OA 2UVUA 4J9NA 4RUAA 1U4BA 4M9HA 3TFRA 1ZETA 1N48A 4ED7A 8ICVA 1TFRA 3RH4A 3JPPA 7ICIA 1S0NA 2VA8A 3PW5A 5CR0A 4J9MA 2ASDA 2FMSA 3TQ1A 9ICHA 4XA5A 4KN4A 3SYZA 4RT3A 4TURA 3E2EA 3RRGA 1NK0A 4DOBA 1ZQYA 1H38A 5J0PA 2H5XA 3RBEA 4X5VA 7ICPA 4ECTA 3NTUA 1NK4A 2XGPA 4B9SA 4MF2A 5DG8A 4UBCA 3JPOA 5J2FA 4TUSA 4TUPA 3PVXA 3KHLA 4C8OA 1JMSA 3Q8SB 4I2JA 4F8RA 3KHGA 3N97B 1L3VA 4KLHA 2BR0A 3ISCA 4ELUA 5KFVA 4QZAA 4YR0A 2BKEA 3GIIA 2KFNA 9ICTA 4FS1A 3RB6A 1U48A 4R66A 4GXKA 1WCNA 5J0SA 4ECYA 3RJEA 4I2DA
chains in the Genus database with same CATH superfamily
4A8EA 7ICOA 4JUZA 1ZQJA 1LKYA 4EBCA 3ETRA 4DWIA 1L8OA 2CPRA 2JR5A 4BXOA 2KOBA 2W04A 2F8KA 4F2SA 2ZJ8A 5K4LA 2AGPA 8ICRA 3QXGA 5KFAA 8ICYA 4MEYA 1MC8A 4EYIB 4WJ3B 4Y2JA 5L1KA 5G5GA 5IILA 1PVRA 4RQ1A 1PZNA 1L7OA 1N62A 5AM0A 4P0QB 2IMWP 4BJQA 4FBTA 4M47A 4NLKA 5KFQA 4I2GA 4YFKA 4KMUA 4DLEA 4IQWA 2BHNA 2MAXA 4F4YA 4IQUA 8ICPA 3I28A 5AKGA 1ZQFA 4KX3A 9ICUA 3UPQA 5B5EU 4B6JA 2KV2A 7ICQA 3F53A 1KFSA 2KSOB 4YMMA 3UQ2A 3F2CA 9ICIA 4RT2A 2N1RA 1ZQTA 3T5KA 4IC9A 2RRDA 4UB1A 5AKEA 2F1JA 2KVSA 1B4FA 4ZOHC 4J9LA 4BDPA 1J2MA 2OCEA 3KZXA 4ECRA 5J2HA 2J6TA 9ICEA 4G9BA 8ICKA 2PFQA 5CHGA 3OHAA 2P6UA 5IIIA 2KJ5A 5TZVA 1ZQWA 5KFRA 2I6XA 4LZDA 2VKQA 5ALZA 2QKQA 9ICCA 2W3SA 4DCCA 1NZBA 2DPJA 1JN3A 5DB6A 1XS9D 3KZIU 1NKBA 3HPOA 1RG6A 3C2MA 8ICUA 2R8IA 2XC9A 1NJXA 2YN4A 1ZQZA 4UASA 2H3VA 3Q8RB 4R8UB 1Y88A 1GO3F 4J9PA 4BXOB 4CRXA 3A0BU 4GXJA 4JMUA 5J2EA 4G3IA 4KLFA 2LBOA 3H0MB 2PXIA 2B21A 2XY7A 1ZQBA 4MFCA 3CRXA 1MQ3A 2Y0SC 3SV3A 3GV5B 3T5JA 4ECWA 3MGVA 3B9JA 4I2BA 3F2BA 3ICXA 2C28A 4QZ8A 2ZJAA 4RQ4A 4KLIA 4ECSA 7ICEA 5DQGA 2KNJA 4DQQA 4DSEA 2P6RA 3ISBA 1JIHA 1JXEA 3Q8QB 4NLZA 3C2LA 3PZPA 4EZ6A 3RBDA 1JROA 2XCAA 2AQ4A 2ZIXB 5KFXA 5DDMA 2BDUA 3M9OB 5ALQA 4ED0A 4DQSA 1LB2B 1L7MA 4DSLA 4Q8EA 1TV9A 3G6YA 2OXOA 3QU2A 5J0WA 1ZQLA 1D9DA 3C23A 3QU4A 2HHQA 3V7LA 2DBYA 3WKCA 8ICIA 2GWSA 1MA7A 2E8OA 3C21A 5KFIA 3UQ0A 5AKXA 2G08A 4FFDA 5J2GA 3RAQA 2MUTA 2I1QA 5J0RA 1HIWA 3H8WA 1F5SA 4RZRA 3KKAA 3PY8A 5KFBA 5KT3A 2FJ6A 2AU0A 3M1YA 1NK6A 4KLTA 2E1FA 4TUQA 5L1IA 3MR6A 4DOAA 3RR7A 4ELVA 1PUZA 5CRXA 2HOFA 4RQ3A 1LVHA 3V7JA 3LVWA 1ZJNA 1D8LA 2YQEA 3UMBA 5ALDA 1KEJA 2QB0A 3GV8B 2GO7A 5KT2A 3V72A 1A77A 2IOFK 3RFAA 5DQIA 5AKHA 4QWDA 1Z00B 5ALTA 3PMLA 1N5WA 1Z1BA 2JXJA 5J0UA 2V4QA 2WF5A 3PV8A 1NJYA 1J2NA 1U49A 2WF9A 4NL9C 3HRDD 5AM4A 3B0YA 4RQ6A 3R9KA 1HJPA 4FS2A 2Y1IA 1QSLA 4QZEA 3H8SA 2EANA 2ZUCA 1LV5A 7ICFA 2XIDA 5DQHA 4Y2YA 1AQ6A 3V7KA 2G09A 2JH1A 1S77D 4DF4A 5KFDA 5HMMA 3IDWA 4PZNA 3EYZA 3RJIA 5DGBA 4Q45A 4ECUA 3NRZA 1ZD4A 1X9SA 5ALSA 3FAHA 5AM2A 5KG7A 4EZ9A 4UW9A 3SZ2A 4I29A 4OJ5A 1V38A 3KOOA 5ALIA 2JV3A 1CRXA 3VC8A 4RQ7A 1TAQA 4C8LA 1QQ6A 2ZTDA 5AIBA 2HSZA 3QE9Y 2F44A 1T4GA 4F4KA 4IS7A 5CJ7A 3TANA 1K1SA 2K89A 5KFTA 4I2AA 1T94A 4O3MA 4O5EA 2HOIA 3RB0A 4P4OA 5KG1A 2VANA 5A0LA 4QWEA 4I2CA 2RDJA 2EZZA 1SL1A 1RZTA 4RNMA 4PGQA 1C20A 5T14A 2HI0A 1QQ7A 1IXRA 4YXJA 4NJ8A 5JU5A 4NM2A 2WAQF 5ALRA 3CW2C 3UXOA 3RAXA 1PVQA 1X2IA 1T3NA 4QW8A 4DL2A 1IM4A 4F72A 2BPFA 1KFDA 2FLLA 5J2KA 2G0AA 4US9A 3OTQA 4OCZA 5AICA 1NI3A 7ICKA 2K4IA 3SEIA 3DDHA 4DQIA 3EW9A 4Z6CA 2KJ8A 5FP0A 2K4HA 4EYHB 5EWEA 1WWUA 4QWBA 4O3QA 1LKYB 4KLOA 4KLGA 1SV0C 2EDUA 1L5UA 4ED2A 5J8YC 2WF8A 2ZJ5A 3BQ7A 1JI7A 4CDGA 3PNCA 3C2KA 2JEGA 3QUQA 1L6NA 2W55A 4YP3A 2NYVA 4F4WA 3ZDAA 2LHTA 4EX6A 3BZKA 1Z4NA 4NM1A 3NVYA 5KAFU 2MSNA 5J0OA 4Y2XA 4EELA 7ICIA 8ICVA 1N61A 2ASDA 2WF6A 9ICHA 4RT3A 3E2EA 4DOBA 5AI6A 4B9SA 4C7ZA 1NK4A 5JTIA 3PVXA 5AI9A 3F5EA 5AI0A 3KHGA 3N97B 1FIQA 4QZAA 4YR0A 2BKEA 4NLCA 5AM1A 4R66A 2YMLA 3D2QA 1ECWA 1WYGA 2W9CA 3MFHA 4QWCA 3GU3A 5EE3A 5KG0A 4QZBA 1ZQHA 4I2IA 5D49A 4FBUA 3SENA 3OSPA 5ALMA 1UA1A 3SQIA 1S97A 3M6ZA 5KG6A 4IR9A 5KT4A 7ICUA 1Z4OA 3IP4B 2KZMA 5HHIA 4KLLA 2F76X 5HMLA 2HHVA 2HBMA 8ICLA 4F91B 3WKDA 4RUCA 3TARA 2QARA 1JRPA 2PI4A 2KJ9A 1Q46A 3THVA 1RDFA 2ZIVB 4E0DA 1SKRA 3H7IA 4F5QA 4KTQA 1PK1B 5KFJA 2W9MA 3EPGA 5F9NA 2AXTU 1QSSA 4YMNA 1V85A 3WK4A 2I9GA 2LPEA 5KFOA 2FMPA 4EBEA 2UVRA 2GLEA 3ALRA 2ISOA 3WK5A 5KFMA 2W8LA 4CGZA 2R8KA 4Z6EA 1XWLA 3RB3A 1BPZA 3PR4A 1TK0A 4DQRA 1S76D 2HBKA 5D4BA 4R63A 2K8BB 4DL6A 3BQTA 4QZ9A 4XUSA 4B9NA 3MDAA 2AH5A 4DL7A 3IG8A 3AL0B 4KLDA 1B43A 2ISPA 1TK5A 9ICVA 3PW2A 5HP4A 1BNPA 1JALA 3TACB 5DLGA 2R8HA 2KG5A 3B0XA 5BOLA 4QWAA 3RJKA 2VJ5A 4UB6U 3EUB2 4YD2A 2AGQA 1ZD2P 3PX0A 3GZFA 5AKZA 2KP7A 5KFHA 1S10A 4P0PB 2IA6A 1CEZA 8ICGA 2E8PA 3GIJA 1KSPA 5EE9A 4IRCA 1N63A 4CCHA 4KLSA 4UB3A 4JV0A 1SKSA 5IIOA 4DFDA 2BCVA 2QARB 2W43A 4NV0A 3JPNA 5AK3A 1U45A 5J0QA 2BPGA 3V6HA 4RPYA 2YX8A 3ZDDA 1J97A 4B9UA 4QZFA 3KD3A 4IRDA 4AYBC 3QUCA 2IOHA 3GFKB 4B9TA 2BZFA 2HOQA 5E79U 1K1QA 3M9MB 1TK8A 3BQ1A 5EE1A 1T8EA 4PJ0U 4BWMA 2W54A 4JWNA 2IHNA 5TISU 1O03A 4UARA 5J2CA 2W7OA 2IOFA 1KKXA 1IG6A 5KFGA 4M04A 3BQ0A 2V9WA 1XC9A 9ICJA 1ZQMA 2K8AA 3OSNA 3SI8A 3NS1A 4XRHA 2DWQA 9ICSA 1SV0A 3RB4A 3QU5A 3TI0A 5J8YA 1QSYA 5AM5A 2VIXA 2M9NA 2G5HB 4UQGA 1RYUA 5J0YA 1KBUA 5AHXA 1SXEA 1N56A 2HHTA 2G5IB 4USAA 1ZQ1C 2UVWA 3QZ8A 1ZXIA 4J9OA 4MF8A 1Z00A 1KW4A 4KN7A 1XNSA 3RJFA 3DV9A 3GV7B 1BGXT 2R8GA 1HUZA 5F9LA 4HAIA 5L1JA 8ICJA 5G5HA 4MEXA 1SZHA 2ESEA 3T79A 3C28A 2CRXA 3LWMA 5KG2A 3NVZA 2IHMA 7ICHA 3M9NB 3JPRA 1N60A 4LJXA 2K60A 1L3UA 2PI5A 9ICPA 3Q8KA 3FDSA 4DOCA 3TADC 1Z19A 5KFZA 5L1MA 2KK0A 5DB9A 2V4RA 4RPZA 2RP5A 9ICLA 4GLXA 1D9FA 5CA7A 2OM6A 2F77X 5KFLA 5KFCA 2FE9A 2PKEA 4PPXA 4M6WA 1URJA 3RTVA 5AKLA 2BQUA 1NKEA 2A1JA 4O9MA 1BPDA 2ASLA 1AROP 5JUMA 2HVIA 4IL6U 3JPTA 4F93B 1UT8A 2HBLA 5KT5A 2WHEA 1ZQRA 2P35A 1ZQUA 9ICQA 5AK5A 3WKBA 4YD1A 4F4XA 1ZQGA 8ICAA 2YY6A 3PO5A 2AQ0A 4DLGA 2C2RA 5KT6A 5BOMA 1EXNA 1RQNA 3IN5A 4UAWA 1SL2A 2IBKA 3JPQA 3PO4A 3PX6A 2DUYA 5J2BA 3AN1A 1DK2A 1SXDA 3K4GA 2DQNB 2DL0A 4YMOA 5DB7A 3D6JA 1UCVA 5EOZA 1RYRA 4M9GA 3K1ZA 2JEFA 2YMQA 3MFIA 3QYPA 3FM9A 4Y2PA 4YQWA 3TAPA 3E0FA 5J2JA 2YTUA 4CF3A 1X40A 2BCRA 4PH5A 1XSPA 3F5AA 8ICSA 4K4IA 2A1AA 1S9FA 1WG8A 3SD7A 1NJWA 3NUQA 2C22A 2UVUA 5ALOA 4J9NA 1U4BA 4M9HA 1N48A 1TFRA 3RH4A 2W7PA 3H0RB 5CR0A 2QB1A 3SYZA 4C4SA 3RRGA 2D8CA 2HCFA 1ZQYA 2ZIVA 2H5XA 3RBEA 4X5VA 5DG8A 2MU2A 2NO4A 4TUPA 3PSIA 4I2JA 4UAVA 2NO5A 3K1RB 2DKXA 2KKVA 4FS1A 1U48A 5ALHA 1Q3VA 4JB3A 4ECYA 4I2DA 3NASA 4OO1J 2OEHA 2K8CB 1BPXA 4O3OA 4EX7A 5DG9A 5ALXA 4GC7A 3HILA 4M9LA 1MSWD 5L9XA 2NRXA 2HHWA 3T5LA 2FLPA 2F1IA 2KHQA 1U47A 4KMOB 4U6PA 2WF7A 4JK1A 2FLNA 5ALLA 4BWJA 4M2YA 2D6FC 2HHXA 3UMGA 5DLFA 3RF9A 2WFAA 4C80A 2Z7JA 4DFMA 2C2DA 3D2NA 7ICVA 3AU2A 3WKEA 3Q8PB 4PGYA 3IV6A 2HDOA 1WUDA 1S0VA 1KTQA 1ZYQA 3WK8A 2FDRA 1OW5A 2W9AA 4QNLA 3NVVA 2YMPA 3T5HA 1A76A 3FC4A 8ICHA 3DEEA 1QTMA 4C8MA 2AHOB 2KD1A 4O3NA 5AI4A 5AM3A 3MABA 2KTQA 2KMDA 5EE0A 3LYSA 3QZ7A 5KL8B 2LMRA 2A19A 4PHAA 4DFPA 2DGZA 3RJJA 3H8MA 1NNLA 5ALYA 3OPXA 3UXNA 4KITB 2KIVA 8ICBA 3QEAZ 4ED3A 4BUGA 2C2EA 4ECXA 4YVZA 4DO9A 2OYYA 4IQVA 4PHPA 4J9QA 2Y0SF 3C29A 5KFPA 1TE2A 4NL9A 1N5XA 4MHVA 2D3DA 2NRVA 2K4EA 4M9JA 4KLEA 5J2DA 3JPSA 9ICFA 5AI5A 3PSPA 2VA3A 1K5OA 2Y1JA 3PSFA 2KICA 1MQ2A 3WKAA 4Q44A 3BZCA 1KRPA 4DSFA 5DKWA 3J81j 3GDXA 3PW4A 4PHEA 1BPYA 5EWFA 2H3ZA 5BPCA 2E5SA 2OH2A 1L7PA 2K4PA 3ORYA 1RM6C 4J9KA 1F44A 5GTHU 2JGAA 9ICOA 3BS5B 1X9MA 1ZQOA 2W8KA 3NGDA 3TAQA 2AGOA 4GFJA 5KFEA 4UB5A 3HT3A 3OGUA 5J2IA 9ICWA 3BS7A 1X9WA 2BGWA 8ICQA 4QZIA 1NKCA 4KLJA 4F50A 2BCQA 1L3TA 5J2AA 3I1YA 3C1ZA 3ZI4A 2BDPA 9ICAA 3ZDCA 5DBBA 4J03A 2MRLA 2ZUDA 3SAHA 5KNIA 1DK3A 1NK9A 2RDIA 5AKKA 5ALFA 4C7YA 5C0YA 5IINA 2FPLA 1O08A 2MA1A 1L3SA 5DBAA 2JEJA 5J0XA 5F3XB 2F2AB 1DGSA 2F8LA 4JWMA 4Y2TA 2KKPA 3ZD8A 2XICA 1ZQQA 4UB8U 4UAZA 1PK1A 9ICMA 1SWWA 2FPMA 4YR2A 2Y9UA 2NRTA 4QJFB 2XCPA 4TQSA 2WTFA 2R8JA 3M8RA 5KFYA 3MDCA 1ED1A 3SR6A 5EWGA 3QEBZ 3TKAA 1OUQA 3QUTA 2KN7A 3ZD9A 3EWAA 2DFLA 4OJOA 7ICSA 9ICGA 2E3TA 4YN4A 2ALZA 4YXMA 5DBCA 4MFFA 7ICLA 3SV4A 1SKWA 2JZBB 2OWOA 3QX7A 4Y2QA 3HWTA 4QZCA 1FFUA 3HW8A 1KQQA 2EZXA 4B9MA 4I2HA 2EH9A 4XQ8A 2E8MA 3U26A 3S6JA 5AIAA 4DL5A 1XSNA 8ICNA 2O6KA 4ZH4A 4EBDA 3K75D 5IIKA 5KFUA 5CEHA 3C5FA 2LYHA 1B0XA 1DRGA 4LVSA 8ICWA 2E1EA 4FZLA 2PMZF 2Y9TA 2BCUA 2AJQA 4KLUA 3OJUA 4O0IA 4I28A 5KFNA 7ICMA 4DL3A 3AQFA 5KFWA 4NLGA 3GIMA 3KTQA 3F2DA 2ZIWA 3MGIA 3VCBA 4PZOA 5AK4A 3HJEA 3AMZA 3EPIA 3GIKA 4F3OA 4BGDA 4O3SA 1PVPA 2XGQA 4AYBF 1Q3UA 2L5YA 3WK9A 4M9NA 3M6KA 1RXVA 4QZGA 3N7RC 4ED8A 3OJSA 1X9XA 3WK7A 1TVAA 5HHHA 3MBYA 2CXYA 4Y2VA 2PMZC 2JH7A 3QU9A 1ZQDA 4C8NA 3MGHA 9ICNA 4P0PA 1YT3A 3I76A 3MR5A 4C4TA 5AK6A 1M6YA 4F92B 3GILA 3SAFA 3BJYA 3G6VA 3RH5A 3QU7A 4ELTA 2DKZA 5HNKA 1KDHA 5GTIU 3H4DA 1SGGA 1ZRMA 4LZGA 3C1YA 2W9BA 3H4BA 1KN5A 2HHSA 4HYKA 3UXPA 2XVTA 4QZDA 2XY6A 1F0MA 1D8BA 1T3QA 5AKYA 3WU2U 4NXZA 2F1HA 2PFOA 4GXIA 3D2SA 3N7SC 3O0FA 2Q4TA 1XU4A 3BS5A 2H3FA 2FI1A 5KTQA 4C8KA 1ZQAA 2HMXA 4NLNA 3N4MB 2ZUBA 5IIJA 2J6UA 2EAOA 2XO7A 3PSTA 2J6SA 1BNOA 1SV4A 4F2RA 1FO4A 4CNQA 4DSJA 4M6WB 2BCSA 4DS4A 2XY5A 1XSLA 3ETLA 3KFUF 2HVHA 4R64A 7ICTA 4M0AA 4UB2A 3FYHA 4Z6FA 1COKA 4RUAA 2KIWA 2KSOA 3TFRA 3JPPA 1S0NA 5ALUA 4J9MA 4XA5A 4KN4A 2KVCA 4ICAA 5J0PA 4ECTA 3QUBA 2XGPA 4MF2A 3E58A 5J2FA 3KHLA 4KLHA 2BR0A 4RQMA 3ISCA 4ELUA 3CP8A 3GIIA 9ICTA 3RB6A 4CE6A 4GXKA 4F71A 1RQLA 2ODGA 3H0LB 2A1JB 4PHDA 1RYSA 2ZIXA 4NWIA 4K4HA 1WCLA 1SZPA 2ZIUB 4DS5A 4FZNA 3PX4A 2GH1A 1S8OA 8ICCA 4UB4A 7ICRA 1V9PA 1VDVA 4ECVA 2R18A 4U7CA 5KFKA 7ICNA 4FO6A 4KLMA 3PR5B 1IIPA 3PW7A 7ICGA 3BQ2A 4DSKA 3V6JA 4Y2SA 2LYAA 5ALNA 4F5OA 9ICKA 3RRHA 2MUTB 1B22A 3C5GA 3PW0A 3L5KA 2DF4B 2BPCA 3ZDEA 2P66A 4P0QA 4Z6DA 1ZQVA 3IM1A 2PFNA 2KZ3A 1BPBA 2W03A 2W9BB 8ICZA 3IRUA 5DDYA 3UMCA 1Z3EB 3N28A 4RQ5A 2G07A 1ZQSA 2W3RA 4ECZA 4P4MA 2ES6A 5KG4A 2KE7A 4EENA 3SAGA 5CWRA 4Y2UA 1UT5A 3LWLA 4B9VA 2QB0B 1JUDA 4CF4A 4B9LA 4JV2A 4QIWC 1A0PA 3G6XA 1BPEA 3A0HU 1COOA 3RH6A 1D8YA 4KLQA 1XO0A 2VA2A 5IIMA 2NRWA 3GQCA 4RQ2A 1ZQEA 3KHHA 5KFSA 1JX4A 4PL2A 3EZ5A 2YB4A 3L4PA 8ICEA 2KHVA 2KFZA 4O3RA 1ZQCA 1RPLA 2NV3A 3BDPA 2EZYA 2ATLA 2I5HA 3AUOA 1ZRNA 2YMMA 1NK7A 4F5PA 2EAMA 4CF5A 2WAQC 2JRZA 3M7DA 2ZIUA 3OHBA 1IV8A 3N7PD 5AKJA 4J9RA 2YB1A 4DFKA 1ZQXA 3NVWA 4FZMA 4ACOA 1YZ7A 2KEYA 3QNMA 5ALGA 1UQVA 2XI9A 3ISDA 2RLTA 3Q8LA 4ED6A 1XO1A 2FPKA 1V97A 4BX9C 1S0MA 4JV1A 1ZQKA 2WB1C 2LKYA 4OJPA 1CI4A 1SIJA 5CB1A 4I27A 3H8JA 4QZHA 4OD0A 4DEZA 1Q8KA 3HKZF 3H40A 1TKDA 3ZDBA 9ICXA 1FEZA 5AI8A 4RQ0A 2ZXIA 3AU6A 1ZOLA 4I2FA 4DQPA 5L1LA 2JEIA 5ALPA 3UM9A 1DXSA 3Q8MA 4ED1A 1X42A 3HKZC 3HP6A 4R8UA 4UAYA 5DB8A 2HW3A 2W9CB 3AM9A 1DOQA 2QLTA 2FMQA 5ALKA 1TAUA 3L3FX 2WB1F 4O5KA 3CNHA 1WWVA 1C7YA 3LVVA 3PMNA 1L7NA 1KFTA 4YG2A 5DG7A 2ZG6A 1SWVA 2OHFA 4EEKA 4R65A 2HBJA 5KFFA 4K4GA 4IRKA 2ZIWB 7ICJA 1ZD3A 2H3QA 5AKIA 4C0ZA 8ICXA 3KKAC 1NJZA 9ICRA 2NRZA 4UATA 3NRWA 3M8SA 1SL0A 5CP2A 8ICMA 1ZJMA 3IHQB 1S0OA 4NY8A 4F5NA 2BQ3A 3MR3A 3T3FA 5HR7A 1SB3C 4GC6A 4Y2RA 5ALVA 4I2EA 4UAUA 1QLNA 3RR8A 1BVSA 4ECQA 3HX0A 4FE3A 1P7DA 2E8NA 4YR3A 5KG3A 1VJ5A 1PK3A 5J29A 4QIWF 1ZQNA 4TQRA 1FFVA 2EAPA 4P2HA 1X66A 3ONNA 2HHUA 4PL1A 3MR2A 4OJ6A 1T7PA 4US8A 4RQ8A 4KX5A 5KT7A 8ICTA 5DGAA 4UBBA 1U9LA 1A6SA 4YCXA 3ED5A 4F4ZA 5ALWA 1OXJA 1QH9A 4OJLA 5J0TA 2G06A 5D46A 1X6IA 1HUOA 3MC1A 4Q8FA 4DF8A 3CYMA 3AEVA 8ICFA 5ALEA 1UPHA 2LM4A 4NLBA 3KBBA 4Q43A 1KL9A 2RQ5A 2RHFA 4P4PA 1ZQIA 3AQEA 2LM1A 4RNOA 4MFAA 2VJ4A 1JXLA 2ASJA 4RNNA 2EQYA 4QW9A 4J9SA 1NK8A 1ZD5A 2GOLA 4O3PA 2ZTCA 2CN1A 1DGJA 2B6GA 2Q0ZX 3LK9A 4IQTA 9ICBA 3V6KA 3TFSA 1TAMA 4F5RA 1UHUA 4PGXA 3LDAA 5KAIU 1UA0A 4RPXA 2PFPA 4O5CA 4RU9A 4IR1A 2JHDA 1NZPA 2LYBA 2ZXHA 1NOMA 1HEKA 2W11A 1KLNA 4AP9A 5HR6A 2A3VA 1CUKA 2ZTEA 1QCKA 1S5LU 5H2FU 2BQRA 1ZQPA 5KG5A 2JZBA 2JMGA 3WK6A 4EEYA 8ICOA 2M0NA 4GIBA 3RJHA 5JRTA 5ALJA 4DFJA 5C5JA 3RJGA 2DPIA 2KZZA 2H3IA 4DSIA 1Z1VA 4DL4A 2LI6A 2F3NA 2UVVA 3KHRA 1RXWA 2B0CA 1NK5A 4RQNA 1ZETA 1MN8A 3TADA 5KL1B 4ED7A 2VA8A 3PW5A 1L8LA 2FMSA 3TQ1A 4TURA 1NK0A 1H38A 1X6JA 7ICPA 3NTUA 4UBCA 3JPOA 5B66U 4TUSA 4C4RA 4C8OA 1JMSA 3Q8SB 1VLBA 4F8RA 1L3VA 3IG5A 5KFVA 1YZ6A 1N2XA 2KFNA 3SMVA 1WCNA 5J0SA 3RJEA 1QQ5A
chains in the Genus database with same CATH topology
7ICOA 2W9CA 4JUZA 3MFHA 1ZQJA 4QWCA 2A1JB 4EBCA 4DWIA 1BPXA 5KG0A 4O3OA 4QZBA 1ZQHA 4I2IA 5DG9A 4PHDA 5D49A 4FBUA 1RYSA 4BXOA 4F2SA 1WCLA 4K4HA 1SZPA 4DS5A 4GC7A 3OSPA 4M9LA 2ZJ8A 1MSWD 3PX4A 5L9XA 2NRXA 2AGPA 2HHWA 1UA1A 4I2HA 8ICRA 3T5LA 9ICWA 1S97A 8ICCA 5KFAA 8ICYA 4UB4A 7ICRA 4MEYA 2FLPA 2F1IA 1MC8A 5KG6A 1V9PA 4IR9A 5KT4A 4EYIB 4ECVA 7ICUA 5L1KA 1U47A 5KFKA 2KZMA 5HHIA 5IILA 7ICNA 4KLLA 5HMLA 2HHVA 4FO6A 8ICLA 4KLMA 4F91B 3PR5B 4JK1A 1PZNA 4RQ1A 2FLNA 4BWJA 3PW7A 4RUCA 3TARA 2IMWP 4FBTA 4M2YA 4M47A 7ICGA 4NLKA 2HHXA 5KFQA 2PI4A 3BQ2A 4DSKA 4I2GA 3V6JA 5DLFA 4YFKA 3THVA 4KMUA 4F5OA 4DLEA 4DFMA 3RRHA 2C2DA 2MUTB 1SKRA 4E0DA 2BHNA 2MAXA 4IQWA 9ICKA 7ICEA 1B22A 7ICVA 3AU2A 3H7IA 4F4YA 3C5GA 4IQUA 3Q8PB 4F5QA 3PW0A 4KTQA 4PGYA 2W9MA 5KFJA 3EPGA 5F9NA 8ICPA 1S0VA 2BPCA 1QSSA 3ZDEA 1ZQFA 2P66A 4YMNA 3UPQA 9ICUA 1KTQA 1ZYQA 4Z6DA 1ZQVA 7ICQA 1KFSA 3IM1A 2I9GA 2W9AA 2BPGA 2PFNA 2KZ3A 1BPBA 4YMMA 2W9BB 3UQ2A 8ICZA 5DDYA 5KFOA 2FMPA 9ICIA 4RT2A 1Z3EB 4RQ5A 4EBEA 3T5HA 2UVRA 1ZQTA 2ISOA 1A76A 3T5KA 5KFMA 1ZQSA 2W8LA 8ICHA 4UB1A 4ECZA 4P4MA 2F1JA 1QTMA 5KG4A 2R8KA 4Z6EA 4C8MA 1XWLA 3RB3A 4O3NA 1BPZA 3PR4A 1TK0A 4DQRA 1S76D 5D4BA 5CWRA 4J9LA 1UT5A 4BDPA 4R63A 3MABA 2KTQA 3LWLA 4DL6A 4B9VA 4B9LA 4ECRA 3QZ7A 4JV2A 3BQTA 4QZ9A 4XUSA 5J2HA 2J6TA 3G6XA 1BPEA 4B9NA 9ICEA 3MDAA 4DFPA 4PHAA 2PFQA 5CHGA 8ICKA 1COOA 3OHAA 2P6UA 5IIIA 4DL7A 3RH6A 3RJJA 5TZVA 1D8YA 3UXNA 4KITB 4KLDA 1B43A 1ZQWA 5KFRA 2ISPA 1TK5A 4KLQA 2VA2A 9ICVA 4LZDA 8ICBA 5IIMA 9ICCA 3QEAZ 3PW2A 5HP4A 4ED3A 2DPJA 2NRWA 3GQCA 4RQ2A 2C2EA 1JN3A 5DB6A 1XS9D 4ECXA 4YVZA 4DO9A 1ZQEA 3KHHA 1NKBA 5KFSA 3HPOA 4IQVA 4PHPA 4J9QA 1JX4A 5KFPA 3EZ5A 3C2MA 5DLGA 8ICUA 2NRVA 8ICEA 2R8IA 2R8HA 2KFZA 4M9JA 4O3RA 4KLEA 5J2DA 3B0XA 2XC9A 5BOLA 4QWAA 1RPLA 1NJXA 1ZQZA 3JPSA 1ZQCA 3BDPA 9ICFA 3RJKA 2ATLA 3Q8RB 4R8UB 1Y88A 4YD2A 3AUOA 3PX0A 2AGQA 4J9PA 4BXOB 1NK7A 4F5PA 5KFHA 2VA3A 1S10A 2Y1JA 2IA6A 1CEZA 3OHBA 1MQ2A 4GXJA 8ICGA 4Q44A 5J2EA 3GIJA 1KSPA 4J9RA 1KRPA 4G3IA 4DFKA 4KLFA 2PXIA 1ZQXA 2B21A 2XY7A 1ZQBA 4IRCA 4MFCA 1MQ3A 4DSFA 3SV3A 4CCHA 5DKWA 3GV5B 4KLSA 3T5JA 3GDXA 4UB3A 3PW4A 4JV0A 4PHEA 4ECWA 1SKSA 5IIOA 1BPYA 5EWFA 3ISDA 4I2BA 3Q8LA 5BPCA 2BCVA 4ED6A 1XO1A 2C28A 4QZ8A 3ORYA 4J9KA 2ZJAA 4RQ4A 9ICOA 2FPKA 1X9MA 3JPNA 1ZQOA 4KLIA 2W8KA 3NGDA 3TAQA 2AGOA 1U45A 5J2IA 5KFEA 5J0QA 4UB5A 3OGUA 3HT3A 5DQGA 4ECSA 3V6HA 1X9WA 2BGWA 1ZQKA 4QZIA 4RPYA 1NKCA 4KLJA 4DQQA 3ZDDA 8ICQA 4F50A 4DSEA 2BCQA 4B9UA 1L3TA 5J2AA 1JIHA 1JXEA 4QZFA 3Q8QB 3ISBA 3C1ZA 2P6RA 4NLZA 2BDPA 9ICAA 4IRDA 3ZDCA 3C2LA 5CB1A 4I27A 5DBBA 4EZ6A 3H8JA 2ZUDA 4QZHA 3RBDA 4DEZA 3GFKB 2XCAA 2AQ4A 4B9TA 5KFXA 1NK9A 1K1QA 5DDMA 3M9MB 2RDIA 3H40A 1TK8A 1TKDA 3BQ1A 3ZDBA 3M9OB 1T8EA 9ICXA 5IINA 4BWMA 4RQ0A 2FPLA 4ED0A 3AU6A 4DQSA 4JWNA 4I2FA 1LB2B 2IHNA 5L1LA 1L3SA 5DBAA 2JEJA 5J0XA 4DQPA 4DSLA 1TV9A 4Q8EA 2JEIA 1DGSA 5J2CA 3G6YA 5J0WA 1ZQLA 1D9DA 4JWMA 3C23A 3ZD8A 2HHQA 3V7LA 3Q8MA 1ZQQA 5KFGA 4M04A 4ED1A 3HP6A 4R8UA 4UAYA 3BQ0A 2V9WA 4UAZA 8ICIA 2GWSA 5DB8A 2HW3A 3C21A 5KFIA 3UQ0A 2W9CB 1XC9A 9ICMA 1ZQMA 9ICJA 3RAQA 5J2GA 1DOQA 2FPMA 2MUTA 2I1QA 3OSNA 5J0RA 3SI8A 3H8WA 4YR2A 2FMQA 4XRHA 2NRTA 9ICSA 2XCPA 4RZRA 4TQSA 3RB4A 3PY8A 2WTFA 1TAUA 5KFBA 4O5KA 2R8JA 3TI0A 1QSYA 5KT3A 1C7YA 3M8RA 2AU0A 5KFYA 3MDCA 2M9NA 3PMNA 5EWGA 1NK6A 4UQGA 4KLTA 1KFTA 4YG2A 3QEBZ 4TUQA 5L1IA 5DG7A 3MR6A 5J0YA 4DOAA 3RR7A 4R65A 4ELVA 5KFFA 4RQ3A 3V7JA 1ZJNA 1N56A 4K4GA 2HHTA 4IRKA 2KN7A 1D8LA 3ZD9A 3EWAA 2DFLA 2UVWA 7ICJA 7ICSA 9ICGA 3QZ8A 4J9OA 1KEJA 1Z00A 4YN4A 4MF8A 3GV8B 2ALZA 4YXMA 5DBCA 4MFFA 5KT2A 3V72A 7ICLA 3SV4A 1SKWA 9ICRA 1NJZA 8ICXA 4KN7A 1A77A 2JZBB 2OWOA 5DQIA 2NRZA 4QWDA 3RJFA 3HWTA 4QZCA 3HW8A 3GV7B 1Z00B 3M8SA 1SL0A 1BGXT 3PMLA 5CP2A 8ICMA 2R8GA 5J0UA 4B9MA 2V4QA 4XQ8A 5F9LA 3PV8A 1ZJMA 1HUZA 5L1JA 1NJYA 8ICJA 1U49A 4DL5A 1XSNA 8ICNA 4MEXA 3IHQB 1S0OA 4NY8A 3B0YA 4F5NA 4ZH4A 4RQ6A 2BQ3A 3MR3A 3T3FA 3LWMA 4EBDA 3K75D 5IIKA 5KG2A 5KFUA 4JV1A 1HJPA 4FS2A 2Y1IA 3C5FA 4GC6A 4QZEA 3H8SA 1QSLA 2IHMA 7ICHA 2ZUCA 3M9NB 4I2EA 3JPRA 2LYHA 1QLNA 3RR8A 1LV5A 1BVSA 1L3UA 4ECQA 7ICFA 5DQHA 2PI5A 3HX0A 9ICPA 4LVSA 3V7KA 8ICWA 1S77D 4DF4A 4YR3A 2AJQA 3Q8KA 2BCUA 4KLUA 3FDSA 5KG3A 5KFDA 3OJUA 4DOCA 5HMMA 4O0IA 4I28A 3EYZA 3RJIA 5KFZA 5DGBA 5J29A 5KFNA 7ICMA 4DL3A 5KFWA 4Q45A 4ECUA 1ZQNA 4NLGA 3GIMA 3KTQA 4TQRA 4P2HA 1X9SA 2HHUA 5KG7A 4EZ9A 5DB9A 2V4RA 3MGIA 3MR2A 3SZ2A 4I29A 4RPZA 9ICLA 4GLXA 1D9FA 5CA7A 1T7PA 3EPIA 3GIKA 4F3OA 5KFLA 5KFCA 4BGDA 4O3SA 4RQ8A 2XGQA 4PPXA 4M6WA 5KT7A 3RTVA 4M9NA 5DGAA 8ICTA 4UBBA 2BQUA 1U9LA 1RXVA 1NKEA 4YCXA 2A1JA 4QZGA 4O9MA 4RQ7A 4ED8A 3OJSA 4F4ZA 1BPDA 1TAQA 4C8LA 2ASLA 1TVAA 5HHHA 1AROP 3MBYA 5JUMA 2ZTDA 2HVIA 3QE9Y 1T4GA 3JPTA 4F4KA 4F93B 5CJ7A 3TANA 5J0TA 1UT8A 1K1SA 5KFTA 5KT5A 4I2AA 1ZQDA 4O5EA 1ZQRA 5D46A 1ZQUA 4C8NA 3MGHA 3RB0A 1HUOA 9ICQA 9ICNA 4P4OA 5KG1A 2VANA 4DF8A 4Q8FA 4QWEA 3MR5A 4I2CA 8ICFA 2RDJA 1SL1A 4YD1A 1RZTA 4RNMA 4F92B 3GILA 4PGQA 3BJYA 3G6VA 4F4XA 1ZQGA 4Q43A 3RH5A 4ELTA 8ICAA 4P4PA 3PO5A 5HNKA 1KDHA 1IXRA 3H4DA 1ZQIA 2AQ0A 4YXJA 4DLGA 4NM2A 4LZGA 3C1YA 4RNOA 4MFAA 5KT6A 2C2RA 1JXLA 3UXOA 2W9BA 3H4BA 3RAXA 5BOMA 2ASJA 2HHSA 1EXNA 4RNNA 4HYKA 1X2IA 1T3NA 4QW8A 3UXPA 4QW9A 4DL2A 4QZDA 4UAWA 1IM4A 4J9SA 1NK8A 2XY6A 1SL2A 2BPFA 3JPQA 2IBKA 3PO4A 1KFDA 4O3PA 5J2KA 3PX6A 2FLLA 2ZTCA 5J2BA 4NXZA 2F1HA 1S0MA 2PFOA 4GXIA 2Q0ZX 3LK9A 4IQTA 9ICBA 3V6KA 7ICKA 3K4GA 4F5RA 3TFSA 1XU4A 4DQIA 3EW9A 5KTQA 4Z6CA 4PGXA 4C8KA 4YMOA 3LDAA 1ZQAA 1UA0A 4NLNA 4RPXA 2PFPA 3N4MB 2ZUBA 4EYHB 4O5CA 5EWEA 4RU9A 5DB7A 5IIJA 2J6UA 4IR1A 4QWBA 4O3QA 4KLOA 1NOMA 4KLGA 1KLNA 5EOZA 2XO7A 1L5UA 4ED2A 1RYRA 4M9GA 2J6SA 2ZJ5A 3PNCA 2JEFA 1CUKA 2ZTEA 3C2KA 3MFIA 2JEGA 4YQWA 2BQRA 3TAPA 1ZQPA 5KG5A 4F2RA 4YP3A 2JZBA 5J2JA 4DSJA 4EEYA 4M6WB 2BCSA 4DS4A 2XY5A 8ICOA 4F4WA 1XSLA 2BCRA 3ETLA 4PH5A 1XSPA 3RJHA 8ICSA 3ZDAA 4K4IA 2HVHA 4DFJA 5C5JA 4R64A 2DPIA 3RJGA 2KZZA 7ICTA 1S9FA 4M0AA 4DSIA 4DL4A 4NM1A 1NJWA 4UB2A 2C22A 2UVVA 3KHRA 1RXWA 1NK5A 3FYHA 4Z6FA 5J0OA 2UVUA 4J9NA 4RUAA 1U4BA 4M9HA 3TFRA 1ZETA 1N48A 4ED7A 8ICVA 1TFRA 3RH4A 3JPPA 7ICIA 1S0NA 2VA8A 3PW5A 5CR0A 4J9MA 2ASDA 2FMSA 3TQ1A 9ICHA 4XA5A 4KN4A 3SYZA 4RT3A 4TURA 3E2EA 3RRGA 1NK0A 4DOBA 1ZQYA 1H38A 5J0PA 2H5XA 3RBEA 4X5VA 7ICPA 4ECTA 3NTUA 1NK4A 2XGPA 4B9SA 4MF2A 5DG8A 4UBCA 3JPOA 5J2FA 4TUSA 4TUPA 3PVXA 3KHLA 4C8OA 1JMSA 3Q8SB 4I2JA 4F8RA 3KHGA 3N97B 1L3VA 4KLHA 2BR0A 3ISCA 4ELUA 5KFVA 4QZAA 4YR0A 2BKEA 3GIIA 2KFNA 9ICTA 4FS1A 3RB6A 1U48A 4R66A 4GXKA 1WCNA 5J0SA 4ECYA 3RJEA 4I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICO A;  2W9C A;  4JUZ A;  3MFH A;  1ZQJ A;  4QWC A;  2A1J B;  4EBC A;  4DWI A;  1BPX A;  5KG0 A;  4O3O A;  4QZB A;  1ZQH A;  4I2I A;  5DG9 A;  4PHD A;  5D49 A;  4FBU A;  1RYS A;  4BXO A;  4F2S A;  1WCL A;  4K4H A;  1SZP A;  4DS5 A;  4GC7 A;  3OSP A;  4M9L A;  2ZJ8 A;  1MSW D;  3PX4 A;  5L9X A;  2NRX A;  2AGP A;  2HHW A;  1UA1 A;  4I2H A;  8ICR A;  3T5L A;  9ICW A;  1S97 A;  8ICC A;  5KFA A;  8ICY A;  4UB4 A;  7ICR A;  4MEY A;  2FLP A;  2F1I A;  1MC8 A;  5KG6 A;  1V9P A;  4IR9 A;  5KT4 A;  4EYI B;  4ECV A;  7ICU A;  5L1K A;  1U47 A;  5KFK A;  2KZM A;  5HHI A;  5IIL A;  7ICN A;  4KLL A;  5HML A;  2HHV A;  4FO6 A;  8ICL A;  4KLM A;  4F91 B;  3PR5 B;  4JK1 A;  1PZN A;  4RQ1 A;  2FLN A;  4BWJ A;  3PW7 A;  4RUC A;  3TAR A;  2IMW P;  4FBT A;  4M2Y A;  4M47 A;  7ICG A;  4NLK A;  2HHX A;  5KFQ A;  2PI4 A;  3BQ2 A;  4DSK A;  4I2G A;  3V6J A;  5DLF A;  4YFK A;  3THV A;  4KMU A;  4F5O A;  4DLE A;  4DFM A;  3RRH A;  2C2D A;  2MUT B;  1SKR A;  4E0D A;  2BHN A;  2MAX A;  4IQW A;  9ICK A;  7ICE A;  1B22 A;  7ICV A;  3AU2 A;  3H7I A;  4F4Y A;  3C5G A;  4IQU A;  3Q8P B;  4F5Q A;  3PW0 A;  4KTQ A;  4PGY A;  2W9M A;  5KFJ A;  3EPG A;  5F9N A;  8ICP A;  1S0V A;  2BPC A;  1QSS A;  3ZDE A;  1ZQF A;  2P66 A;  4YMN A;  3UPQ A;  9ICU A;  1KTQ A;  1ZYQ A;  4Z6D A;  1ZQV A;  7ICQ A;  1KFS A;  3IM1 A;  2I9G A;  2W9A A;  2BPG A;  2PFN A;  2KZ3 A;  1BPB A;  4YMM A;  2W9B B;  3UQ2 A;  8ICZ A;  5DDY A;  5KFO A;  2FMP A;  9ICI A;  4RT2 A;  1Z3E B;  4RQ5 A;  4EBE A;  3T5H A;  2UVR A;  1ZQT A;  2ISO A;  1A76 A;  3T5K A;  5KFM A;  1ZQS A;  2W8L A;  8ICH A;  4UB1 A;  4ECZ A;  4P4M A;  2F1J A;  1QTM A;  5KG4 A;  2R8K A;  4Z6E A;  4C8M A;  1XWL A;  3RB3 A;  4O3N A;  1BPZ A;  3PR4 A;  1TK0 A;  4DQR A;  1S76 D;  5D4B A;  5CWR A;  4J9L A;  1UT5 A;  4BDP A;  4R63 A;  3MAB A;  2KTQ A;  3LWL A;  4DL6 A;  4B9V A;  4B9L A;  4ECR A;  3QZ7 A;  4JV2 A;  3BQT A;  4QZ9 A;  4XUS A;  5J2H A;  2J6T A;  3G6X A;  1BPE A;  4B9N A;  9ICE A;  3MDA A;  4DFP A;  4PHA A;  2PFQ A;  5CHG A;  8ICK A;  1COO A;  3OHA A;  2P6U A;  5III A;  4DL7 A;  3RH6 A;  3RJJ A;  5TZV A;  1D8Y A;  3UXN A;  4KIT B;  4KLD A;  1B43 A;  1ZQW A;  5KFR A;  2ISP A;  1TK5 A;  4KLQ A;  2VA2 A;  9ICV A;  4LZD A;  8ICB A;  5IIM A;  9ICC A;  3QEA Z;  3PW2 A;  5HP4 A;  4ED3 A;  2DPJ A;  2NRW A;  3GQC A;  4RQ2 A;  2C2E A;  1JN3 A;  5DB6 A;  1XS9 D;  4ECX A;  4YVZ A;  4DO9 A;  1ZQE A;  3KHH A;  1NKB A;  5KFS A;  3HPO A;  4IQV A;  4PHP A;  4J9Q A;  1JX4 A;  5KFP A;  3EZ5 A;  3C2M A;  5DLG A;  8ICU A;  2NRV A;  8ICE A;  2R8I A;  2R8H A;  2KFZ A;  4M9J A;  4O3R A;  4KLE A;  5J2D A;  3B0X A;  2XC9 A;  5BOL A;  4QWA A;  1RPL A;  1NJX A;  1ZQZ A;  3JPS A;  1ZQC A;  3BDP A;  9ICF A;  3RJK A;  2ATL A;  3Q8R B;  4R8U B;  1Y88 A;  4YD2 A;  3AUO A;  3PX0 A;  2AGQ A;  4J9P A;  4BXO B;  1NK7 A;  4F5P A;  5KFH A;  2VA3 A;  1S10 A;  2Y1J A;  2IA6 A;  1CEZ A;  3OHB A;  1MQ2 A;  4GXJ A;  8ICG A;  4Q44 A;  5J2E A;  3GIJ A;  1KSP A;  4J9R A;  1KRP A;  4G3I A;  4DFK A;  4KLF A;  2PXI A;  1ZQX A;  2B21 A;  2XY7 A;  1ZQB A;  4IRC A;  4MFC A;  1MQ3 A;  4DSF A;  3SV3 A;  4CCH A;  5DKW A;  3GV5 B;  4KLS A;  3T5J A;  3GDX A;  4UB3 A;  3PW4 A;  4JV0 A;  4PHE A;  4ECW A;  1SKS A;  5IIO A;  1BPY A;  5EWF A;  3ISD A;  4I2B A;  3Q8L A;  5BPC A;  2BCV A;  4ED6 A;  1XO1 A;  2C28 A;  4QZ8 A;  3ORY A;  4J9K A;  2ZJA A;  4RQ4 A;  9ICO A;  2FPK A;  1X9M A;  3JPN A;  1ZQO A;  4KLI A;  2W8K A;  3NGD A;  3TAQ A;  2AGO A;  1U45 A;  5J2I A;  5KFE A;  5J0Q A;  4UB5 A;  3OGU A;  3HT3 A;  5DQG A;  4ECS A;  3V6H A;  1X9W A;  2BGW A;  1ZQK A;  4QZI A;  4RPY A;  1NKC A;  4KLJ A;  4DQQ A;  3ZDD A;  8ICQ A;  4F50 A;  4DSE A;  2BCQ A;  4B9U A;  1L3T A;  5J2A A;  1JIH A;  1JXE A;  4QZF A;  3Q8Q B;  3ISB A;  3C1Z A;  2P6R A;  4NLZ A;  2BDP A;  9ICA A;  4IRD A;  3ZDC A;  3C2L A;  5CB1 A;  4I27 A;  5DBB A;  4EZ6 A;  3H8J A;  2ZUD A;  4QZH A;  3RBD A;  4DEZ A;  3GFK B;  2XCA A;  2AQ4 A;  4B9T A;  5KFX A;  1NK9 A;  1K1Q A;  5DDM A;  3M9M B;  2RDI A;  3H40 A;  1TK8 A;  1TKD A;  3BQ1 A;  3ZDB A;  3M9O B;  1T8E A;  9ICX A;  5IIN A;  4BWM A;  4RQ0 A;  2FPL A;  4ED0 A;  3AU6 A;  4DQS A;  4JWN A;  4I2F A;  1LB2 B;  2IHN A;  5L1L A;  1L3S A;  5DBA A;  2JEJ A;  5J0X A;  4DQP A;  4DSL A;  1TV9 A;  4Q8E A;  2JEI A;  1DGS A;  5J2C A;  3G6Y A;  5J0W A;  1ZQL A;  1D9D A;  4JWM A;  3C23 A;  3ZD8 A;  2HHQ A;  3V7L A;  3Q8M A;  1ZQQ A;  5KFG A;  4M04 A;  4ED1 A;  3HP6 A;  4R8U A;  4UAY A;  3BQ0 A;  2V9W A;  4UAZ A;  8ICI A;  2GWS A;  5DB8 A;  2HW3 A;  3C21 A;  5KFI A;  3UQ0 A;  2W9C B;  1XC9 A;  9ICM A;  1ZQM A;  9ICJ A;  3RAQ A;  5J2G A;  1DOQ A;  2FPM A;  2MUT A;  2I1Q A;  3OSN A;  5J0R A;  3SI8 A;  3H8W A;  4YR2 A;  2FMQ A;  4XRH A;  2NRT A;  9ICS A;  2XCP A;  4RZR A;  4TQS A;  3RB4 A;  3PY8 A;  2WTF A;  1TAU A;  5KFB A;  4O5K A;  2R8J A;  3TI0 A;  1QSY A;  5KT3 A;  1C7Y A;  3M8R A;  2AU0 A;  5KFY A;  3MDC A;  2M9N A;  3PMN A;  5EWG A;  1NK6 A;  4UQG A;  4KLT A;  1KFT A;  4YG2 A;  3QEB Z;  4TUQ A;  5L1I A;  5DG7 A;  3MR6 A;  5J0Y A;  4DOA A;  3RR7 A;  4R65 A;  4ELV A;  5KFF A;  4RQ3 A;  3V7J A;  1ZJN A;  1N56 A;  4K4G A;  2HHT A;  4IRK A;  2KN7 A;  1D8L A;  3ZD9 A;  3EWA A;  2DFL A;  2UVW A;  7ICJ A;  7ICS A;  9ICG A;  3QZ8 A;  4J9O A;  1KEJ A;  1Z00 A;  4YN4 A;  4MF8 A;  3GV8 B;  2ALZ A;  4YXM A;  5DBC A;  4MFF A;  5KT2 A;  3V72 A;  7ICL A;  3SV4 A;  1SKW A;  9ICR A;  1NJZ A;  8ICX A;  4KN7 A;  1A77 A;  2JZB B;  2OWO A;  5DQI A;  2NRZ A;  4QWD A;  3RJF A;  3HWT A;  4QZC A;  3HW8 A;  3GV7 B;  1Z00 B;  3M8S A;  1SL0 A;  1BGX T;  3PML A;  5CP2 A;  8ICM A;  2R8G A;  5J0U A;  4B9M A;  2V4Q A;  4XQ8 A;  5F9L A;  3PV8 A;  1ZJM A;  1HUZ A;  5L1J A;  1NJY A;  8ICJ A;  1U49 A;  4DL5 A;  1XSN A;  8ICN A;  4MEX A;  3IHQ B;  1S0O A;  4NY8 A;  3B0Y A;  4F5N A;  4ZH4 A;  4RQ6 A;  2BQ3 A;  3MR3 A;  3T3F A;  3LWM A;  4EBD A;  3K75 D;  5IIK A;  5KG2 A;  5KFU A;  4JV1 A;  1HJP A;  4FS2 A;  2Y1I A;  3C5F A;  4GC6 A;  4QZE A;  3H8S A;  1QSL A;  2IHM A;  7ICH A;  2ZUC A;  3M9N B;  4I2E A;  3JPR A;  2LYH A;  1QLN A;  3RR8 A;  1LV5 A;  1BVS A;  1L3U A;  4ECQ A;  7ICF A;  5DQH A;  2PI5 A;  3HX0 A;  9ICP A;  4LVS A;  3V7K A;  8ICW A;  1S77 D;  4DF4 A;  4YR3 A;  2AJQ A;  3Q8K A;  2BCU A;  4KLU A;  3FDS A;  5KG3 A;  5KFD A;  3OJU A;  4DOC A;  5HMM A;  4O0I A;  4I28 A;  3EYZ A;  3RJI A;  5KFZ A;  5DGB A;  5J29 A;  5KFN A;  7ICM A;  4DL3 A;  5KFW A;  4Q45 A;  4ECU A;  1ZQN A;  4NLG A;  3GIM A;  3KTQ A;  4TQR A;  4P2H A;  1X9S A;  2HHU A;  5KG7 A;  4EZ9 A;  5DB9 A;  2V4R A;  3MGI A;  3MR2 A;  3SZ2 A;  4I29 A;  4RPZ A;  9ICL A;  4GLX A;  1D9F A;  5CA7 A;  1T7P A;  3EPI A;  3GIK A;  4F3O A;  5KFL A;  5KFC A;  4BGD A;  4O3S A;  4RQ8 A;  2XGQ A;  4PPX A;  4M6W A;  5KT7 A;  3RTV A;  4M9N A;  5DGA A;  8ICT A;  4UBB A;  2BQU A;  1U9L A;  1RXV A;  1NKE A;  4YCX A;  2A1J A;  4QZG A;  4O9M A;  4RQ7 A;  4ED8 A;  3OJS A;  4F4Z A;  1BPD A;  1TAQ A;  4C8L A;  2ASL A;  1TVA A;  5HHH A;  1ARO P;  3MBY A;  5JUM A;  2ZTD A;  2HVI A;  3QE9 Y;  1T4G A;  3JPT A;  4F4K A;  4F93 B;  5CJ7 A;  3TAN A;  5J0T A;  1UT8 A;  1K1S A;  5KFT A;  5KT5 A;  4I2A A;  1ZQD A;  4O5E A;  1ZQR A;  5D46 A;  1ZQU A;  4C8N A;  3MGH A;  3RB0 A;  1HUO A;  9ICQ A;  9ICN A;  4P4O A;  5KG1 A;  2VAN A;  4DF8 A;  4Q8F A;  4QWE A;  3MR5 A;  4I2C A;  8ICF A;  2RDJ A;  1SL1 A;  4YD1 A;  1RZT A;  4RNM A;  4F92 B;  3GIL A;  4PGQ A;  3BJY A;  3G6V A;  4F4X A;  1ZQG A;  4Q43 A;  3RH5 A;  4ELT A;  8ICA A;  4P4P A;  3PO5 A;  5HNK A;  1KDH A;  1IXR A;  3H4D A;  1ZQI A;  2AQ0 A;  4YXJ A;  4DLG A;  4NM2 A;  4LZG A;  3C1Y A;  4RNO A;  4MFA A;  5KT6 A;  2C2R A;  1JXL A;  3UXO A;  2W9B A;  3H4B A;  3RAX A;  5BOM A;  2ASJ A;  2HHS A;  1EXN A;  4RNN A;  4HYK A;  1X2I A;  1T3N A;  4QW8 A;  3UXP A;  4QW9 A;  4DL2 A;  4QZD A;  4UAW A;  1IM4 A;  4J9S A;  1NK8 A;  2XY6 A;  1SL2 A;  2BPF A;  3JPQ A;  2IBK A;  3PO4 A;  1KFD A;  4O3P A;  5J2K A;  3PX6 A;  2FLL A;  2ZTC A;  5J2B A;  4NXZ A;  2F1H A;  1S0M A;  2PFO A;  4GXI A;  2Q0Z X;  3LK9 A;  4IQT A;  9ICB A;  3V6K A;  7ICK A;  3K4G A;  4F5R A;  3TFS A;  1XU4 A;  4DQI A;  3EW9 A;  5KTQ A;  4Z6C A;  4PGX A;  4C8K A;  4YMO A;  3LDA A;  1ZQA A;  1UA0 A;  4NLN A;  4RPX A;  2PFP A;  3N4M B;  2ZUB A;  4EYH B;  4O5C A;  5EWE A;  4RU9 A;  5DB7 A;  5IIJ A;  2J6U A;  4IR1 A;  4QWB A;  4O3Q A;  4KLO A;  1NOM A;  4KLG A;  1KLN A;  5EOZ A;  2XO7 A;  1L5U A;  4ED2 A;  1RYR A;  4M9G A;  2J6S A;  2ZJ5 A;  3PNC A;  2JEF A;  1CUK A;  2ZTE A;  3C2K A;  3MFI A;  2JEG A;  4YQW A;  2BQR A;  3TAP A;  1ZQP A;  5KG5 A;  4F2R A;  4YP3 A;  2JZB A;  5J2J A;  4DSJ A;  4EEY A;  4M6W B;  2BCS A;  4DS4 A;  2XY5 A;  8ICO A;  4F4W A;  1XSL A;  2BCR A;  3ETL A;  4PH5 A;  1XSP A;  3RJH A;  8ICS A;  3ZDA A;  4K4I A;  2HVH A;  4DFJ A;  5C5J A;  4R64 A;  2DPI A;  3RJG A;  2KZZ A;  7ICT A;  1S9F A;  4M0A A;  4DSI A;  4DL4 A;  4NM1 A;  1NJW A;  4UB2 A;  2C22 A;  2UVV A;  3KHR A;  1RXW A;  1NK5 A;  3FYH A;  4Z6F A;  5J0O A;  2UVU A;  4J9N A;  4RUA A;  1U4B A;  4M9H A;  3TFR A;  1ZET A;  1N48 A;  4ED7 A;  8ICV A;  1TFR A;  3RH4 A;  3JPP A;  7ICI A;  1S0N A;  2VA8 A;  3PW5 A;  5CR0 A;  4J9M A;  2ASD A;  2FMS A;  3TQ1 A;  9ICH A;  4XA5 A;  4KN4 A;  3SYZ A;  4RT3 A;  4TUR A;  3E2E A;  3RRG A;  1NK0 A;  4DOB A;  1ZQY A;  1H38 A;  5J0P A;  2H5X A;  3RBE A;  4X5V A;  7ICP A;  4ECT A;  3NTU A;  1NK4 A;  2XGP A;  4B9S A;  4MF2 A;  5DG8 A;  4UBC A;  3JPO A;  5J2F A;  4TUS A;  4TUP A;  3PVX A;  3KHL A;  4C8O A;  1JMS A;  3Q8S B;  4I2J A;  4F8R A;  3KHG A;  3N97 B;  1L3V A;  4KLH A;  2BR0 A;  3ISC A;  4ELU A;  5KFV A;  4QZA A;  4YR0 A;  2BKE A;  3GII A;  2KFN A;  9ICT A;  4FS1 A;  3RB6 A;  1U48 A;  4R66 A;  4GXK A;  1WCN A;  5J0S A;  4ECY A;  3RJE A;  4I2D A; 
#chains in the Genus database with same CATH topology
 4A8E A;  7ICO A;  4JUZ A;  1ZQJ A;  1LKY A;  4EBC A;  3ETR A;  4DWI A;  1L8O A;  2CPR A;  2JR5 A;  4BXO A;  2KOB A;  2W04 A;  2F8K A;  4F2S A;  2ZJ8 A;  5K4L A;  2AGP A;  8ICR A;  3QXG A;  5KFA A;  8ICY A;  4MEY A;  1MC8 A;  4EYI B;  4WJ3 B;  4Y2J A;  5L1K A;  5G5G A;  5IIL A;  1PVR A;  4RQ1 A;  1PZN A;  1L7O A;  1N62 A;  5AM0 A;  4P0Q B;  2IMW P;  4BJQ A;  4FBT A;  4M47 A;  4NLK A;  5KFQ A;  4I2G A;  4YFK A;  4KMU A;  4DLE A;  4IQW A;  2BHN A;  2MAX A;  4F4Y A;  4IQU A;  8ICP A;  3I28 A;  5AKG A;  1ZQF A;  4KX3 A;  9ICU A;  3UPQ A;  5B5E U;  4B6J A;  2KV2 A;  7ICQ A;  3F53 A;  1KFS A;  2KSO B;  4YMM A;  3UQ2 A;  3F2C A;  9ICI A;  4RT2 A;  2N1R A;  1ZQT A;  3T5K A;  4IC9 A;  2RRD A;  4UB1 A;  5AKE A;  2F1J A;  2KVS A;  1B4F A;  4ZOH C;  4J9L A;  4BDP A;  1J2M A;  2OCE A;  3KZX A;  4ECR A;  5J2H A;  2J6T A;  9ICE A;  4G9B A;  8ICK A;  2PFQ A;  5CHG A;  3OHA A;  2P6U A;  5III A;  2KJ5 A;  5TZV A;  1ZQW A;  5KFR A;  2I6X A;  4LZD A;  2VKQ A;  5ALZ A;  2QKQ A;  9ICC A;  2W3S A;  4DCC A;  1NZB A;  2DPJ A;  1JN3 A;  5DB6 A;  1XS9 D;  3KZI U;  1NKB A;  3HPO A;  1RG6 A;  3C2M A;  8ICU A;  2R8I A;  2XC9 A;  1NJX A;  2YN4 A;  1ZQZ A;  4UAS A;  2H3V A;  3Q8R B;  4R8U B;  1Y88 A;  1GO3 F;  4J9P A;  4BXO B;  4CRX A;  3A0B U;  4GXJ A;  4JMU A;  5J2E A;  4G3I A;  4KLF A;  2LBO A;  3H0M B;  2PXI A;  2B21 A;  2XY7 A;  1ZQB A;  4MFC A;  3CRX A;  1MQ3 A;  2Y0S C;  3SV3 A;  3GV5 B;  3T5J A;  4ECW A;  3MGV A;  3B9J A;  4I2B A;  3F2B A;  3ICX A;  2C28 A;  4QZ8 A;  2ZJA A;  4RQ4 A;  4KLI A;  4ECS A;  7ICE A;  5DQG A;  2KNJ A;  4DQQ A;  4DSE A;  2P6R A;  3ISB A;  1JIH A;  1JXE A;  3Q8Q B;  4NLZ A;  3C2L A;  3PZP A;  4EZ6 A;  3RBD A;  1JRO A;  2XCA A;  2AQ4 A;  2ZIX B;  5KFX A;  5DDM A;  2BDU A;  3M9O B;  5ALQ A;  4ED0 A;  4DQS A;  1LB2 B;  1L7M A;  4DSL A;  4Q8E A;  1TV9 A;  3G6Y A;  2OXO A;  3QU2 A;  5J0W A;  1ZQL A;  1D9D A;  3C23 A;  3QU4 A;  2HHQ A;  3V7L A;  2DBY A;  3WKC A;  8ICI A;  2GWS A;  1MA7 A;  2E8O A;  3C21 A;  5KFI A;  3UQ0 A;  5AKX A;  2G08 A;  4FFD A;  5J2G A;  3RAQ A;  2MUT A;  2I1Q A;  5J0R A;  1HIW A;  3H8W A;  1F5S A;  4RZR A;  3KKA A;  3PY8 A;  5KFB A;  5KT3 A;  2FJ6 A;  2AU0 A;  3M1Y A;  1NK6 A;  4KLT A;  2E1F A;  4TUQ A;  5L1I A;  3MR6 A;  4DOA A;  3RR7 A;  4ELV A;  1PUZ A;  5CRX A;  2HOF A;  4RQ3 A;  1LVH A;  3V7J A;  3LVW A;  1ZJN A;  1D8L A;  2YQE A;  3UMB A;  5ALD A;  1KEJ A;  2QB0 A;  3GV8 B;  2GO7 A;  5KT2 A;  3V72 A;  1A77 A;  2IOF K;  3RFA A;  5DQI A;  5AKH A;  4QWD A;  1Z00 B;  5ALT A;  3PML A;  1N5W A;  1Z1B A;  2JXJ A;  5J0U A;  2V4Q A;  2WF5 A;  3PV8 A;  1NJY A;  1J2N A;  1U49 A;  2WF9 A;  4NL9 C;  3HRD D;  5AM4 A;  3B0Y A;  4RQ6 A;  3R9K A;  1HJP A;  4FS2 A;  2Y1I A;  1QSL A;  4QZE A;  3H8S A;  2EAN A;  2ZUC A;  1LV5 A;  7ICF A;  2XID A;  5DQH A;  4Y2Y A;  1AQ6 A;  3V7K A;  2G09 A;  2JH1 A;  1S77 D;  4DF4 A;  5KFD A;  5HMM A;  3IDW A;  4PZN A;  3EYZ A;  3RJI A;  5DGB A;  4Q45 A;  4ECU A;  3NRZ A;  1ZD4 A;  1X9S A;  5ALS A;  3FAH A;  5AM2 A;  5KG7 A;  4EZ9 A;  4UW9 A;  3SZ2 A;  4I29 A;  4OJ5 A;  1V38 A;  3KOO A;  5ALI A;  2JV3 A;  1CRX A;  3VC8 A;  4RQ7 A;  1TAQ A;  4C8L A;  1QQ6 A;  2ZTD A;  5AIB A;  2HSZ A;  3QE9 Y;  2F44 A;  1T4G A;  4F4K A;  4IS7 A;  5CJ7 A;  3TAN A;  1K1S A;  2K89 A;  5KFT A;  4I2A A;  1T94 A;  4O3M A;  4O5E A;  2HOI A;  3RB0 A;  4P4O A;  5KG1 A;  2VAN A;  5A0L A;  4QWE A;  4I2C A;  2RDJ A;  2EZZ A;  1SL1 A;  1RZT A;  4RNM A;  4PGQ A;  1C20 A;  5T14 A;  2HI0 A;  1QQ7 A;  1IXR A;  4YXJ A;  4NJ8 A;  5JU5 A;  4NM2 A;  2WAQ F;  5ALR A;  3CW2 C;  3UXO A;  3RAX A;  1PVQ A;  1X2I A;  1T3N A;  4QW8 A;  4DL2 A;  1IM4 A;  4F72 A;  2BPF A;  1KFD A;  2FLL A;  5J2K A;  2G0A A;  4US9 A;  3OTQ A;  4OCZ A;  5AIC A;  1NI3 A;  7ICK A;  2K4I A;  3SEI A;  3DDH A;  4DQI A;  3EW9 A;  4Z6C A;  2KJ8 A;  5FP0 A;  2K4H A;  4EYH B;  5EWE A;  1WWU A;  4QWB A;  4O3Q A;  1LKY B;  4KLO A;  4KLG A;  1SV0 C;  2EDU A;  1L5U A;  4ED2 A;  5J8Y C;  2WF8 A;  2ZJ5 A;  3BQ7 A;  1JI7 A;  4CDG A;  3PNC A;  3C2K A;  2JEG A;  3QUQ A;  1L6N A;  2W55 A;  4YP3 A;  2NYV A;  4F4W A;  3ZDA A;  2LHT A;  4EX6 A;  3BZK A;  1Z4N A;  4NM1 A;  3NVY A;  5KAF U;  2MSN A;  5J0O A;  4Y2X A;  4EEL A;  7ICI A;  8ICV A;  1N61 A;  2ASD A;  2WF6 A;  9ICH A;  4RT3 A;  3E2E A;  4DOB A;  5AI6 A;  4B9S A;  4C7Z A;  1NK4 A;  5JTI A;  3PVX A;  5AI9 A;  3F5E A;  5AI0 A;  3KHG A;  3N97 B;  1FIQ A;  4QZA A;  4YR0 A;  2BKE A;  4NLC A;  5AM1 A;  4R66 A;  2YML A;  3D2Q A;  1ECW A;  1WYG A;  2W9C A;  3MFH A;  4QWC A;  3GU3 A;  5EE3 A;  5KG0 A;  4QZB A;  1ZQH A;  4I2I A;  5D49 A;  4FBU A;  3SEN A;  3OSP A;  5ALM A;  1UA1 A;  3SQI A;  1S97 A;  3M6Z A;  5KG6 A;  4IR9 A;  5KT4 A;  7ICU A;  1Z4O A;  3IP4 B;  2KZM A;  5HHI A;  4KLL A;  2F76 X;  5HML A;  2HHV A;  2HBM A;  8ICL A;  4F91 B;  3WKD A;  4RUC A;  3TAR A;  2QAR A;  1JRP A;  2PI4 A;  2KJ9 A;  1Q46 A;  3THV A;  1RDF A;  2ZIV B;  4E0D A;  1SKR A;  3H7I A;  4F5Q A;  4KTQ A;  1PK1 B;  5KFJ A;  2W9M A;  3EPG A;  5F9N A;  2AXT U;  1QSS A;  4YMN A;  1V85 A;  3WK4 A;  2I9G A;  2LPE A;  5KFO A;  2FMP A;  4EBE A;  2UVR A;  2GLE A;  3ALR A;  2ISO A;  3WK5 A;  5KFM A;  2W8L A;  4CGZ A;  2R8K A;  4Z6E A;  1XWL A;  3RB3 A;  1BPZ A;  3PR4 A;  1TK0 A;  4DQR A;  1S76 D;  2HBK A;  5D4B A;  4R63 A;  2K8B B;  4DL6 A;  3BQT A;  4QZ9 A;  4XUS A;  4B9N A;  3MDA A;  2AH5 A;  4DL7 A;  3IG8 A;  3AL0 B;  4KLD A;  1B43 A;  2ISP A;  1TK5 A;  9ICV A;  3PW2 A;  5HP4 A;  1BNP A;  1JAL A;  3TAC B;  5DLG A;  2R8H A;  2KG5 A;  3B0X A;  5BOL A;  4QWA A;  3RJK A;  2VJ5 A;  4UB6 U;  3EUB 2;  4YD2 A;  2AGQ A;  1ZD2 P;  3PX0 A;  3GZF A;  5AKZ A;  2KP7 A;  5KFH A;  1S10 A;  4P0P B;  2IA6 A;  1CEZ A;  8ICG A;  2E8P A;  3GIJ A;  1KSP A;  5EE9 A;  4IRC A;  1N63 A;  4CCH A;  4KLS A;  4UB3 A;  4JV0 A;  1SKS A;  5IIO A;  4DFD A;  2BCV A;  2QAR B;  2W43 A;  4NV0 A;  3JPN A;  5AK3 A;  1U45 A;  5J0Q A;  2BPG A;  3V6H A;  4RPY A;  2YX8 A;  3ZDD A;  1J97 A;  4B9U A;  4QZF A;  3KD3 A;  4IRD A;  4AYB C;  3QUC A;  2IOH A;  3GFK B;  4B9T A;  2BZF A;  2HOQ A;  5E79 U;  1K1Q A;  3M9M B;  1TK8 A;  3BQ1 A;  5EE1 A;  1T8E A;  4PJ0 U;  4BWM A;  2W54 A;  4JWN A;  2IHN A;  5TIS U;  1O03 A;  4UAR A;  5J2C A;  2W7O A;  2IOF A;  1KKX A;  1IG6 A;  5KFG A;  4M04 A;  3BQ0 A;  2V9W A;  1XC9 A;  9ICJ A;  1ZQM A;  2K8A A;  3OSN A;  3SI8 A;  3NS1 A;  4XRH A;  2DWQ A;  9ICS A;  1SV0 A;  3RB4 A;  3QU5 A;  3TI0 A;  5J8Y A;  1QSY A;  5AM5 A;  2VIX A;  2M9N A;  2G5H B;  4UQG A;  1RYU A;  5J0Y A;  1KBU A;  5AHX A;  1SXE A;  1N56 A;  2HHT A;  2G5I B;  4USA A;  1ZQ1 C;  2UVW A;  3QZ8 A;  1ZXI A;  4J9O A;  4MF8 A;  1Z00 A;  1KW4 A;  4KN7 A;  1XNS A;  3RJF A;  3DV9 A;  3GV7 B;  1BGX T;  2R8G A;  1HUZ A;  5F9L A;  4HAI A;  5L1J A;  8ICJ A;  5G5H A;  4MEX A;  1SZH A;  2ESE A;  3T79 A;  3C28 A;  2CRX A;  3LWM A;  5KG2 A;  3NVZ A;  2IHM A;  7ICH A;  3M9N B;  3JPR A;  1N60 A;  4LJX A;  2K60 A;  1L3U A;  2PI5 A;  9ICP A;  3Q8K A;  3FDS A;  4DOC A;  3TAD C;  1Z19 A;  5KFZ A;  5L1M A;  2KK0 A;  5DB9 A;  2V4R A;  4RPZ A;  2RP5 A;  9ICL A;  4GLX A;  1D9F A;  5CA7 A;  2OM6 A;  2F77 X;  5KFL A;  5KFC A;  2FE9 A;  2PKE A;  4PPX A;  4M6W A;  1URJ A;  3RTV A;  5AKL A;  2BQU A;  1NKE A;  2A1J A;  4O9M A;  1BPD A;  2ASL A;  1ARO P;  5JUM A;  2HVI A;  4IL6 U;  3JPT A;  4F93 B;  1UT8 A;  2HBL A;  5KT5 A;  2WHE A;  1ZQR A;  2P35 A;  1ZQU A;  9ICQ A;  5AK5 A;  3WKB A;  4YD1 A;  4F4X A;  1ZQG A;  8ICA A;  2YY6 A;  3PO5 A;  2AQ0 A;  4DLG A;  2C2R A;  5KT6 A;  5BOM A;  1EXN A;  1RQN A;  3IN5 A;  4UAW A;  1SL2 A;  2IBK A;  3JPQ A;  3PO4 A;  3PX6 A;  2DUY A;  5J2B A;  3AN1 A;  1DK2 A;  1SXD A;  3K4G A;  2DQN B;  2DL0 A;  4YMO A;  5DB7 A;  3D6J A;  1UCV A;  5EOZ A;  1RYR A;  4M9G A;  3K1Z A;  2JEF A;  2YMQ A;  3MFI A;  3QYP A;  3FM9 A;  4Y2P A;  4YQW A;  3TAP A;  3E0F A;  5J2J A;  2YTU A;  4CF3 A;  1X40 A;  2BCR A;  4PH5 A;  1XSP A;  3F5A A;  8ICS A;  4K4I A;  2A1A A;  1S9F A;  1WG8 A;  3SD7 A;  1NJW A;  3NUQ A;  2C22 A;  2UVU A;  5ALO A;  4J9N A;  1U4B A;  4M9H A;  1N48 A;  1TFR A;  3RH4 A;  2W7P A;  3H0R B;  5CR0 A;  2QB1 A;  3SYZ A;  4C4S A;  3RRG A;  2D8C A;  2HCF A;  1ZQY A;  2ZIV A;  2H5X A;  3RBE A;  4X5V A;  5DG8 A;  2MU2 A;  2NO4 A;  4TUP A;  3PSI A;  4I2J A;  4UAV A;  2NO5 A;  3K1R B;  2DKX A;  2KKV A;  4FS1 A;  1U48 A;  5ALH A;  1Q3V A;  4JB3 A;  4ECY A;  4I2D A;  3NAS A;  4OO1 J;  2OEH A;  2K8C B;  1BPX A;  4O3O A;  4EX7 A;  5DG9 A;  5ALX A;  4GC7 A;  3HIL A;  4M9L A;  1MSW D;  5L9X A;  2NRX A;  2HHW A;  3T5L A;  2FLP A;  2F1I A;  2KHQ A;  1U47 A;  4KMO B;  4U6P A;  2WF7 A;  4JK1 A;  2FLN A;  5ALL A;  4BWJ A;  4M2Y A;  2D6F C;  2HHX A;  3UMG A;  5DLF A;  3RF9 A;  2WFA A;  4C80 A;  2Z7J A;  4DFM A;  2C2D A;  3D2N A;  7ICV A;  3AU2 A;  3WKE A;  3Q8P B;  4PGY A;  3IV6 A;  2HDO A;  1WUD A;  1S0V A;  1KTQ A;  1ZYQ A;  3WK8 A;  2FDR A;  1OW5 A;  2W9A A;  4QNL A;  3NVV A;  2YMP A;  3T5H A;  1A76 A;  3FC4 A;  8ICH A;  3DEE A;  1QTM A;  4C8M A;  2AHO B;  2KD1 A;  4O3N A;  5AI4 A;  5AM3 A;  3MAB A;  2KTQ A;  2KMD A;  5EE0 A;  3LYS A;  3QZ7 A;  5KL8 B;  2LMR A;  2A19 A;  4PHA A;  4DFP A;  2DGZ A;  3RJJ A;  3H8M A;  1NNL A;  5ALY A;  3OPX A;  3UXN A;  4KIT B;  2KIV A;  8ICB A;  3QEA Z;  4ED3 A;  4BUG A;  2C2E A;  4ECX A;  4YVZ A;  4DO9 A;  2OYY A;  4IQV A;  4PHP A;  4J9Q A;  2Y0S F;  3C29 A;  5KFP A;  1TE2 A;  4NL9 A;  1N5X A;  4MHV A;  2D3D A;  2NRV A;  2K4E A;  4M9J A;  4KLE A;  5J2D A;  3JPS A;  9ICF A;  5AI5 A;  3PSP A;  2VA3 A;  1K5O A;  2Y1J A;  3PSF A;  2KIC A;  1MQ2 A;  3WKA A;  4Q44 A;  3BZC A;  1KRP A;  4DSF A;  5DKW A;  3J81 j;  3GDX A;  3PW4 A;  4PHE A;  1BPY A;  5EWF A;  2H3Z A;  5BPC A;  2E5S A;  2OH2 A;  1L7P A;  2K4P A;  3ORY A;  1RM6 C;  4J9K A;  1F44 A;  5GTH U;  2JGA A;  9ICO A;  3BS5 B;  1X9M A;  1ZQO A;  2W8K A;  3NGD A;  3TAQ A;  2AGO A;  4GFJ A;  5KFE A;  4UB5 A;  3HT3 A;  3OGU A;  5J2I A;  9ICW A;  3BS7 A;  1X9W A;  2BGW A;  8ICQ A;  4QZI A;  1NKC A;  4KLJ A;  4F50 A;  2BCQ A;  1L3T A;  5J2A A;  3I1Y A;  3C1Z A;  3ZI4 A;  2BDP A;  9ICA A;  3ZDC A;  5DBB A;  4J03 A;  2MRL A;  2ZUD A;  3SAH A;  5KNI A;  1DK3 A;  1NK9 A;  2RDI A;  5AKK A;  5ALF A;  4C7Y A;  5C0Y A;  5IIN A;  2FPL A;  1O08 A;  2MA1 A;  1L3S A;  5DBA A;  2JEJ A;  5J0X A;  5F3X B;  2F2A B;  1DGS A;  2F8L A;  4JWM A;  4Y2T A;  2KKP A;  3ZD8 A;  2XIC A;  1ZQQ A;  4UB8 U;  4UAZ A;  1PK1 A;  9ICM A;  1SWW A;  2FPM A;  4YR2 A;  2Y9U A;  2NRT A;  4QJF B;  2XCP A;  4TQS A;  2WTF A;  2R8J A;  3M8R A;  5KFY A;  3MDC A;  1ED1 A;  3SR6 A;  5EWG A;  3QEB Z;  3TKA A;  1OUQ A;  3QUT A;  2KN7 A;  3ZD9 A;  3EWA A;  2DFL A;  4OJO A;  7ICS A;  9ICG A;  2E3T A;  4YN4 A;  2ALZ A;  4YXM A;  5DBC A;  4MFF A;  7ICL A;  3SV4 A;  1SKW A;  2JZB B;  2OWO A;  3QX7 A;  4Y2Q A;  3HWT A;  4QZC A;  1FFU A;  3HW8 A;  1KQQ A;  2EZX A;  4B9M A;  4I2H A;  2EH9 A;  4XQ8 A;  2E8M A;  3U26 A;  3S6J A;  5AIA A;  4DL5 A;  1XSN A;  8ICN A;  2O6K A;  4ZH4 A;  4EBD A;  3K75 D;  5IIK A;  5KFU A;  5CEH A;  3C5F A;  2LYH A;  1B0X A;  1DRG A;  4LVS A;  8ICW A;  2E1E A;  4FZL A;  2PMZ F;  2Y9T A;  2BCU A;  2AJQ A;  4KLU A;  3OJU A;  4O0I A;  4I28 A;  5KFN A;  7ICM A;  4DL3 A;  3AQF A;  5KFW A;  4NLG A;  3GIM A;  3KTQ A;  3F2D A;  2ZIW A;  3MGI A;  3VCB A;  4PZO A;  5AK4 A;  3HJE A;  3AMZ A;  3EPI A;  3GIK A;  4F3O A;  4BGD A;  4O3S A;  1PVP A;  2XGQ A;  4AYB F;  1Q3U A;  2L5Y A;  3WK9 A;  4M9N A;  3M6K A;  1RXV A;  4QZG A;  3N7R C;  4ED8 A;  3OJS A;  1X9X A;  3WK7 A;  1TVA A;  5HHH A;  3MBY A;  2CXY A;  4Y2V A;  2PMZ C;  2JH7 A;  3QU9 A;  1ZQD A;  4C8N A;  3MGH A;  9ICN A;  4P0P A;  1YT3 A;  3I76 A;  3MR5 A;  4C4T A;  5AK6 A;  1M6Y A;  4F92 B;  3GIL A;  3SAF A;  3BJY A;  3G6V A;  3RH5 A;  3QU7 A;  4ELT A;  2DKZ A;  5HNK A;  1KDH A;  5GTI U;  3H4D A;  1SGG A;  1ZRM A;  4LZG A;  3C1Y A;  2W9B A;  3H4B A;  1KN5 A;  2HHS A;  4HYK A;  3UXP A;  2XVT A;  4QZD A;  2XY6 A;  1F0M A;  1D8B A;  1T3Q A;  5AKY A;  3WU2 U;  4NXZ A;  2F1H A;  2PFO A;  4GXI A;  3D2S A;  3N7S C;  3O0F A;  2Q4T A;  1XU4 A;  3BS5 A;  2H3F A;  2FI1 A;  5KTQ A;  4C8K A;  1ZQA A;  2HMX A;  4NLN A;  3N4M B;  2ZUB A;  5IIJ A;  2J6U A;  2EAO A;  2XO7 A;  3PST A;  2J6S A;  1BNO A;  1SV4 A;  4F2R A;  1FO4 A;  4CNQ A;  4DSJ A;  4M6W B;  2BCS A;  4DS4 A;  2XY5 A;  1XSL A;  3ETL A;  3KFU F;  2HVH A;  4R64 A;  7ICT A;  4M0A A;  4UB2 A;  3FYH A;  4Z6F A;  1COK A;  4RUA A;  2KIW A;  2KSO A;  3TFR A;  3JPP A;  1S0N A;  5ALU A;  4J9M A;  4XA5 A;  4KN4 A;  2KVC A;  4ICA A;  5J0P A;  4ECT A;  3QUB A;  2XGP A;  4MF2 A;  3E58 A;  5J2F A;  3KHL A;  4KLH A;  2BR0 A;  4RQM A;  3ISC A;  4ELU A;  3CP8 A;  3GII A;  9ICT A;  3RB6 A;  4CE6 A;  4GXK A;  4F71 A;  1RQL A;  2ODG A;  3H0L B;  2A1J B;  4PHD A;  1RYS A;  2ZIX A;  4NWI A;  4K4H A;  1WCL A;  1SZP A;  2ZIU B;  4DS5 A;  4FZN A;  3PX4 A;  2GH1 A;  1S8O A;  8ICC A;  4UB4 A;  7ICR A;  1V9P A;  1VDV A;  4ECV A;  2R18 A;  4U7C A;  5KFK A;  7ICN A;  4FO6 A;  4KLM A;  3PR5 B;  1IIP A;  3PW7 A;  7ICG A;  3BQ2 A;  4DSK A;  3V6J A;  4Y2S A;  2LYA A;  5ALN A;  4F5O A;  9ICK A;  3RRH A;  2MUT B;  1B22 A;  3C5G A;  3PW0 A;  3L5K A;  2DF4 B;  2BPC A;  3ZDE A;  2P66 A;  4P0Q A;  4Z6D A;  1ZQV A;  3IM1 A;  2PFN A;  2KZ3 A;  1BPB A;  2W03 A;  2W9B B;  8ICZ A;  3IRU A;  5DDY A;  3UMC A;  1Z3E B;  3N28 A;  4RQ5 A;  2G07 A;  1ZQS A;  2W3R A;  4ECZ A;  4P4M A;  2ES6 A;  5KG4 A;  2KE7 A;  4EEN A;  3SAG A;  5CWR A;  4Y2U A;  1UT5 A;  3LWL A;  4B9V A;  2QB0 B;  1JUD A;  4CF4 A;  4B9L A;  4JV2 A;  4QIW C;  1A0P A;  3G6X A;  1BPE A;  3A0H U;  1COO A;  3RH6 A;  1D8Y A;  4KLQ A;  1XO0 A;  2VA2 A;  5IIM A;  2NRW A;  3GQC A;  4RQ2 A;  1ZQE A;  3KHH A;  5KFS A;  1JX4 A;  4PL2 A;  3EZ5 A;  2YB4 A;  3L4P A;  8ICE A;  2KHV A;  2KFZ A;  4O3R A;  1ZQC A;  1RPL A;  2NV3 A;  3BDP A;  2EZY A;  2ATL A;  2I5H A;  3AUO A;  1ZRN A;  2YMM A;  1NK7 A;  4F5P A;  2EAM A;  4CF5 A;  2WAQ C;  2JRZ A;  3M7D A;  2ZIU A;  3OHB A;  1IV8 A;  3N7P D;  5AKJ A;  4J9R A;  2YB1 A;  4DFK A;  1ZQX A;  3NVW A;  4FZM A;  4ACO A;  1YZ7 A;  2KEY A;  3QNM A;  5ALG A;  1UQV A;  2XI9 A;  3ISD A;  2RLT A;  3Q8L A;  4ED6 A;  1XO1 A;  2FPK A;  1V97 A;  4BX9 C;  1S0M A;  4JV1 A;  1ZQK A;  2WB1 C;  2LKY A;  4OJP A;  1CI4 A;  1SIJ A;  5CB1 A;  4I27 A;  3H8J A;  4QZH A;  4OD0 A;  4DEZ A;  1Q8K A;  3HKZ F;  3H40 A;  1TKD A;  3ZDB A;  9ICX A;  1FEZ A;  5AI8 A;  4RQ0 A;  2ZXI A;  3AU6 A;  1ZOL A;  4I2F A;  4DQP A;  5L1L A;  2JEI A;  5ALP A;  3UM9 A;  1DXS A;  3Q8M A;  4ED1 A;  1X42 A;  3HKZ C;  3HP6 A;  4R8U A;  4UAY A;  5DB8 A;  2HW3 A;  2W9C B;  3AM9 A;  1DOQ A;  2QLT A;  2FMQ A;  5ALK A;  1TAU A;  3L3F X;  2WB1 F;  4O5K A;  3CNH A;  1WWV A;  1C7Y A;  3LVV A;  3PMN A;  1L7N A;  1KFT A;  4YG2 A;  5DG7 A;  2ZG6 A;  1SWV A;  2OHF A;  4EEK A;  4R65 A;  2HBJ A;  5KFF A;  4K4G A;  4IRK A;  2ZIW B;  7ICJ A;  1ZD3 A;  2H3Q A;  5AKI A;  4C0Z A;  8ICX A;  3KKA C;  1NJZ A;  9ICR A;  2NRZ A;  4UAT A;  3NRW A;  3M8S A;  1SL0 A;  5CP2 A;  8ICM A;  1ZJM A;  3IHQ B;  1S0O A;  4NY8 A;  4F5N A;  2BQ3 A;  3MR3 A;  3T3F A;  5HR7 A;  1SB3 C;  4GC6 A;  4Y2R A;  5ALV A;  4I2E A;  4UAU A;  1QLN A;  3RR8 A;  1BVS A;  4ECQ A;  3HX0 A;  4FE3 A;  1P7D A;  2E8N A;  4YR3 A;  5KG3 A;  1VJ5 A;  1PK3 A;  5J29 A;  4QIW F;  1ZQN A;  4TQR A;  1FFV A;  2EAP A;  4P2H A;  1X66 A;  3ONN A;  2HHU A;  4PL1 A;  3MR2 A;  4OJ6 A;  1T7P A;  4US8 A;  4RQ8 A;  4KX5 A;  5KT7 A;  8ICT A;  5DGA A;  4UBB A;  1U9L A;  1A6S A;  4YCX A;  3ED5 A;  4F4Z A;  5ALW A;  1OXJ A;  1QH9 A;  4OJL A;  5J0T A;  2G06 A;  5D46 A;  1X6I A;  1HUO A;  3MC1 A;  4Q8F A;  4DF8 A;  3CYM A;  3AEV A;  8ICF A;  5ALE A;  1UPH A;  2LM4 A;  4NLB A;  3KBB A;  4Q43 A;  1KL9 A;  2RQ5 A;  2RHF A;  4P4P A;  1ZQI A;  3AQE A;  2LM1 A;  4RNO A;  4MFA A;  2VJ4 A;  1JXL A;  2ASJ A;  4RNN A;  2EQY A;  4QW9 A;  4J9S A;  1NK8 A;  1ZD5 A;  2GOL A;  4O3P A;  2ZTC A;  2CN1 A;  1DGJ A;  2B6G A;  2Q0Z X;  3LK9 A;  4IQT A;  9ICB A;  3V6K A;  3TFS A;  1TAM A;  4F5R A;  1UHU A;  4PGX A;  3LDA A;  5KAI U;  1UA0 A;  4RPX A;  2PFP A;  4O5C A;  4RU9 A;  4IR1 A;  2JHD A;  1NZP A;  2LYB A;  2ZXH A;  1NOM A;  1HEK A;  2W11 A;  1KLN A;  4AP9 A;  5HR6 A;  2A3V A;  1CUK A;  2ZTE A;  1QCK A;  1S5L U;  5H2F U;  2BQR A;  1ZQP A;  5KG5 A;  2JZB A;  2JMG A;  3WK6 A;  4EEY A;  8ICO A;  2M0N A;  4GIB A;  3RJH A;  5JRT A;  5ALJ A;  4DFJ A;  5C5J A;  3RJG A;  2DPI A;  2KZZ A;  2H3I A;  4DSI A;  1Z1V A;  4DL4 A;  2LI6 A;  2F3N A;  2UVV A;  3KHR A;  1RXW A;  2B0C A;  1NK5 A;  4RQN A;  1ZET A;  1MN8 A;  3TAD A;  5KL1 B;  4ED7 A;  2VA8 A;  3PW5 A;  1L8L A;  2FMS A;  3TQ1 A;  4TUR A;  1NK0 A;  1H38 A;  1X6J A;  7ICP A;  3NTU A;  4UBC A;  3JPO A;  5B66 U;  4TUS A;  4C4R A;  4C8O A;  1JMS A;  3Q8S B;  1VLB A;  4F8R A;  1L3V A;  3IG5 A;  5KFV A;  1YZ6 A;  1N2X A;  2KFN A;  3SMV A;  1WCN A;  5J0S A;  3RJE A;  1QQ5 A; 
#chains in the Genus database with same CATH homology
 7ICO A;  2W9C A;  4JUZ A;  3MFH A;  1ZQJ A;  4QWC A;  2A1J B;  4EBC A;  4DWI A;  1BPX A;  5KG0 A;  4O3O A;  4QZB A;  1ZQH A;  4I2I A;  5DG9 A;  4PHD A;  5D49 A;  4FBU A;  1RYS A;  4BXO A;  4F2S A;  1WCL A;  4K4H A;  1SZP A;  4DS5 A;  4GC7 A;  3OSP A;  4M9L A;  2ZJ8 A;  1MSW D;  3PX4 A;  5L9X A;  2NRX A;  2AGP A;  2HHW A;  1UA1 A;  4I2H A;  8ICR A;  3T5L A;  9ICW A;  1S97 A;  8ICC A;  5KFA A;  8ICY A;  4UB4 A;  7ICR A;  4MEY A;  2FLP A;  2F1I A;  1MC8 A;  5KG6 A;  1V9P A;  4IR9 A;  5KT4 A;  4EYI B;  4ECV A;  7ICU A;  5L1K A;  1U47 A;  5KFK A;  2KZM A;  5HHI A;  5IIL A;  7ICN A;  4KLL A;  5HML A;  2HHV A;  4FO6 A;  8ICL A;  4KLM A;  4F91 B;  3PR5 B;  4JK1 A;  1PZN A;  4RQ1 A;  2FLN A;  4BWJ A;  3PW7 A;  4RUC A;  3TAR A;  2IMW P;  4FBT A;  4M2Y A;  4M47 A;  7ICG A;  4NLK A;  2HHX A;  5KFQ A;  2PI4 A;  3BQ2 A;  4DSK A;  4I2G A;  3V6J A;  5DLF A;  4YFK A;  3THV A;  4KMU A;  4F5O A;  4DLE A;  4DFM A;  3RRH A;  2C2D A;  2MUT B;  1SKR A;  4E0D A;  2BHN A;  2MAX A;  4IQW A;  9ICK A;  7ICE A;  1B22 A;  7ICV A;  3AU2 A;  3H7I A;  4F4Y A;  3C5G A;  4IQU A;  3Q8P B;  4F5Q A;  3PW0 A;  4KTQ A;  4PGY A;  2W9M A;  5KFJ A;  3EPG A;  5F9N A;  8ICP A;  1S0V A;  2BPC A;  1QSS A;  3ZDE A;  1ZQF A;  2P66 A;  4YMN A;  3UPQ A;  9ICU A;  1KTQ A;  1ZYQ A;  4Z6D A;  1ZQV A;  7ICQ A;  1KFS A;  3IM1 A;  2I9G A;  2W9A A;  2BPG A;  2PFN A;  2KZ3 A;  1BPB A;  4YMM A;  2W9B B;  3UQ2 A;  8ICZ A;  5DDY A;  5KFO A;  2FMP A;  9ICI A;  4RT2 A;  1Z3E B;  4RQ5 A;  4EBE A;  3T5H A;  2UVR A;  1ZQT A;  2ISO A;  1A76 A;  3T5K A;  5KFM A;  1ZQS A;  2W8L A;  8ICH A;  4UB1 A;  4ECZ A;  4P4M A;  2F1J A;  1QTM A;  5KG4 A;  2R8K A;  4Z6E A;  4C8M A;  1XWL A;  3RB3 A;  4O3N A;  1BPZ A;  3PR4 A;  1TK0 A;  4DQR A;  1S76 D;  5D4B A;  5CWR A;  4J9L A;  1UT5 A;  4BDP A;  4R63 A;  3MAB A;  2KTQ A;  3LWL A;  4DL6 A;  4B9V A;  4B9L A;  4ECR A;  3QZ7 A;  4JV2 A;  3BQT A;  4QZ9 A;  4XUS A;  5J2H A;  2J6T A;  3G6X A;  1BPE A;  4B9N A;  9ICE A;  3MDA A;  4DFP A;  4PHA A;  2PFQ A;  5CHG A;  8ICK A;  1COO A;  3OHA A;  2P6U A;  5III A;  4DL7 A;  3RH6 A;  3RJJ A;  5TZV A;  1D8Y A;  3UXN A;  4KIT B;  4KLD A;  1B43 A;  1ZQW A;  5KFR A;  2ISP A;  1TK5 A;  4KLQ A;  2VA2 A;  9ICV A;  4LZD A;  8ICB A;  5IIM A;  9ICC A;  3QEA Z;  3PW2 A;  5HP4 A;  4ED3 A;  2DPJ A;  2NRW A;  3GQC A;  4RQ2 A;  2C2E A;  1JN3 A;  5DB6 A;  1XS9 D;  4ECX A;  4YVZ A;  4DO9 A;  1ZQE A;  3KHH A;  1NKB A;  5KFS A;  3HPO A;  4IQV A;  4PHP A;  4J9Q A;  1JX4 A;  5KFP A;  3EZ5 A;  3C2M A;  5DLG A;  8ICU A;  2NRV A;  8ICE A;  2R8I A;  2R8H A;  2KFZ A;  4M9J A;  4O3R A;  4KLE A;  5J2D A;  3B0X A;  2XC9 A;  5BOL A;  4QWA A;  1RPL A;  1NJX A;  1ZQZ A;  3JPS A;  1ZQC A;  3BDP A;  9ICF A;  3RJK A;  2ATL A;  3Q8R B;  4R8U B;  1Y88 A;  4YD2 A;  3AUO A;  3PX0 A;  2AGQ A;  4J9P A;  4BXO B;  1NK7 A;  4F5P A;  5KFH A;  2VA3 A;  1S10 A;  2Y1J A;  2IA6 A;  1CEZ A;  3OHB A;  1MQ2 A;  4GXJ A;  8ICG A;  4Q44 A;  5J2E A;  3GIJ A;  1KSP A;  4J9R A;  1KRP A;  4G3I A;  4DFK A;  4KLF A;  2PXI A;  1ZQX A;  2B21 A;  2XY7 A;  1ZQB A;  4IRC A;  4MFC A;  1MQ3 A;  4DSF A;  3SV3 A;  4CCH A;  5DKW A;  3GV5 B;  4KLS A;  3T5J A;  3GDX A;  4UB3 A;  3PW4 A;  4JV0 A;  4PHE A;  4ECW A;  1SKS A;  5IIO A;  1BPY A;  5EWF A;  3ISD A;  4I2B A;  3Q8L A;  5BPC A;  2BCV A;  4ED6 A;  1XO1 A;  2C28 A;  4QZ8 A;  3ORY A;  4J9K A;  2ZJA A;  4RQ4 A;  9ICO A;  2FPK A;  1X9M A;  3JPN A;  1ZQO A;  4KLI A;  2W8K A;  3NGD A;  3TAQ A;  2AGO A;  1U45 A;  5J2I A;  5KFE A;  5J0Q A;  4UB5 A;  3OGU A;  3HT3 A;  5DQG A;  4ECS A;  3V6H A;  1X9W A;  2BGW A;  1ZQK A;  4QZI A;  4RPY A;  1NKC A;  4KLJ A;  4DQQ A;  3ZDD A;  8ICQ A;  4F50 A;  4DSE A;  2BCQ A;  4B9U A;  1L3T A;  5J2A A;  1JIH A;  1JXE A;  4QZF A;  3Q8Q B;  3ISB A;  3C1Z A;  2P6R A;  4NLZ A;  2BDP A;  9ICA A;  4IRD A;  3ZDC A;  3C2L A;  5CB1 A;  4I27 A;  5DBB A;  4EZ6 A;  3H8J A;  2ZUD A;  4QZH A;  3RBD A;  4DEZ A;  3GFK B;  2XCA A;  2AQ4 A;  4B9T A;  5KFX A;  1NK9 A;  1K1Q A;  5DDM A;  3M9M B;  2RDI A;  3H40 A;  1TK8 A;  1TKD A;  3BQ1 A;  3ZDB A;  3M9O B;  1T8E A;  9ICX A;  5IIN A;  4BWM A;  4RQ0 A;  2FPL A;  4ED0 A;  3AU6 A;  4DQS A;  4JWN A;  4I2F A;  1LB2 B;  2IHN A;  5L1L A;  1L3S A;  5DBA A;  2JEJ A;  5J0X A;  4DQP A;  4DSL A;  1TV9 A;  4Q8E A;  2JEI A;  1DGS A;  5J2C A;  3G6Y A;  5J0W A;  1ZQL A;  1D9D A;  4JWM A;  3C23 A;  3ZD8 A;  2HHQ A;  3V7L A;  3Q8M A;  1ZQQ A;  5KFG A;  4M04 A;  4ED1 A;  3HP6 A;  4R8U A;  4UAY A;  3BQ0 A;  2V9W A;  4UAZ A;  8ICI A;  2GWS A;  5DB8 A;  2HW3 A;  3C21 A;  5KFI A;  3UQ0 A;  2W9C B;  1XC9 A;  9ICM A;  1ZQM A;  9ICJ A;  3RAQ A;  5J2G A;  1DOQ A;  2FPM A;  2MUT A;  2I1Q A;  3OSN A;  5J0R A;  3SI8 A;  3H8W A;  4YR2 A;  2FMQ A;  4XRH A;  2NRT A;  9ICS A;  2XCP A;  4RZR A;  4TQS A;  3RB4 A;  3PY8 A;  2WTF A;  1TAU A;  5KFB A;  4O5K A;  2R8J A;  3TI0 A;  1QSY A;  5KT3 A;  1C7Y A;  3M8R A;  2AU0 A;  5KFY A;  3MDC A;  2M9N A;  3PMN A;  5EWG A;  1NK6 A;  4UQG A;  4KLT A;  1KFT A;  4YG2 A;  3QEB Z;  4TUQ A;  5L1I A;  5DG7 A;  3MR6 A;  5J0Y A;  4DOA A;  3RR7 A;  4R65 A;  4ELV A;  5KFF A;  4RQ3 A;  3V7J A;  1ZJN A;  1N56 A;  4K4G A;  2HHT A;  4IRK A;  2KN7 A;  1D8L A;  3ZD9 A;  3EWA A;  2DFL A;  2UVW A;  7ICJ A;  7ICS A;  9ICG A;  3QZ8 A;  4J9O A;  1KEJ A;  1Z00 A;  4YN4 A;  4MF8 A;  3GV8 B;  2ALZ A;  4YXM A;  5DBC A;  4MFF A;  5KT2 A;  3V72 A;  7ICL A;  3SV4 A;  1SKW A;  9ICR A;  1NJZ A;  8ICX A;  4KN7 A;  1A77 A;  2JZB B;  2OWO A;  5DQI A;  2NRZ A;  4QWD A;  3RJF A;  3HWT A;  4QZC A;  3HW8 A;  3GV7 B;  1Z00 B;  3M8S A;  1SL0 A;  1BGX T;  3PML A;  5CP2 A;  8ICM A;  2R8G A;  5J0U A;  4B9M A;  2V4Q A;  4XQ8 A;  5F9L A;  3PV8 A;  1ZJM A;  1HUZ A;  5L1J A;  1NJY A;  8ICJ A;  1U49 A;  4DL5 A;  1XSN A;  8ICN A;  4MEX A;  3IHQ B;  1S0O A;  4NY8 A;  3B0Y A;  4F5N A;  4ZH4 A;  4RQ6 A;  2BQ3 A;  3MR3 A;  3T3F A;  3LWM A;  4EBD A;  3K75 D;  5IIK A;  5KG2 A;  5KFU A;  4JV1 A;  1HJP A;  4FS2 A;  2Y1I A;  3C5F A;  4GC6 A;  4QZE A;  3H8S A;  1QSL A;  2IHM A;  7ICH A;  2ZUC A;  3M9N B;  4I2E A;  3JPR A;  2LYH A;  1QLN A;  3RR8 A;  1LV5 A;  1BVS A;  1L3U A;  4ECQ A;  7ICF A;  5DQH A;  2PI5 A;  3HX0 A;  9ICP A;  4LVS A;  3V7K A;  8ICW A;  1S77 D;  4DF4 A;  4YR3 A;  2AJQ A;  3Q8K A;  2BCU A;  4KLU A;  3FDS A;  5KG3 A;  5KFD A;  3OJU A;  4DOC A;  5HMM A;  4O0I A;  4I28 A;  3EYZ A;  3RJI A;  5KFZ A;  5DGB A;  5J29 A;  5KFN A;  7ICM A;  4DL3 A;  5KFW A;  4Q45 A;  4ECU A;  1ZQN A;  4NLG A;  3GIM A;  3KTQ A;  4TQR A;  4P2H A;  1X9S A;  2HHU A;  5KG7 A;  4EZ9 A;  5DB9 A;  2V4R A;  3MGI A;  3MR2 A;  3SZ2 A;  4I29 A;  4RPZ A;  9ICL A;  4GLX A;  1D9F A;  5CA7 A;  1T7P A;  3EPI A;  3GIK A;  4F3O A;  5KFL A;  5KFC A;  4BGD A;  4O3S A;  4RQ8 A;  2XGQ A;  4PPX A;  4M6W A;  5KT7 A;  3RTV A;  4M9N A;  5DGA A;  8ICT A;  4UBB A;  2BQU A;  1U9L A;  1RXV A;  1NKE A;  4YCX A;  2A1J A;  4QZG A;  4O9M A;  4RQ7 A;  4ED8 A;  3OJS A;  4F4Z A;  1BPD A;  1TAQ A;  4C8L A;  2ASL A;  1TVA A;  5HHH A;  1ARO P;  3MBY A;  5JUM A;  2ZTD A;  2HVI A;  3QE9 Y;  1T4G A;  3JPT A;  4F4K A;  4F93 B;  5CJ7 A;  3TAN A;  5J0T A;  1UT8 A;  1K1S A;  5KFT A;  5KT5 A;  4I2A A;  1ZQD A;  4O5E A;  1ZQR A;  5D46 A;  1ZQU A;  4C8N A;  3MGH A;  3RB0 A;  1HUO A;  9ICQ A;  9ICN A;  4P4O A;  5KG1 A;  2VAN A;  4DF8 A;  4Q8F A;  4QWE A;  3MR5 A;  4I2C A;  8ICF A;  2RDJ A;  1SL1 A;  4YD1 A;  1RZT A;  4RNM A;  4F92 B;  3GIL A;  4PGQ A;  3BJY A;  3G6V A;  4F4X A;  1ZQG A;  4Q43 A;  3RH5 A;  4ELT A;  8ICA A;  4P4P A;  3PO5 A;  5HNK A;  1KDH A;  1IXR A;  3H4D A;  1ZQI A;  2AQ0 A;  4YXJ A;  4DLG A;  4NM2 A;  4LZG A;  3C1Y A;  4RNO A;  4MFA A;  5KT6 A;  2C2R A;  1JXL A;  3UXO A;  2W9B A;  3H4B A;  3RAX A;  5BOM A;  2ASJ A;  2HHS A;  1EXN A;  4RNN A;  4HYK A;  1X2I A;  1T3N A;  4QW8 A;  3UXP A;  4QW9 A;  4DL2 A;  4QZD A;  4UAW A;  1IM4 A;  4J9S A;  1NK8 A;  2XY6 A;  1SL2 A;  2BPF A;  3JPQ A;  2IBK A;  3PO4 A;  1KFD A;  4O3P A;  5J2K A;  3PX6 A;  2FLL A;  2ZTC A;  5J2B A;  4NXZ A;  2F1H A;  1S0M A;  2PFO A;  4GXI A;  2Q0Z X;  3LK9 A;  4IQT A;  9ICB A;  3V6K A;  7ICK A;  3K4G A;  4F5R A;  3TFS A;  1XU4 A;  4DQI A;  3EW9 A;  5KTQ A;  4Z6C A;  4PGX A;  4C8K A;  4YMO A;  3LDA A;  1ZQA A;  1UA0 A;  4NLN A;  4RPX A;  2PFP A;  3N4M B;  2ZUB A;  4EYH B;  4O5C A;  5EWE A;  4RU9 A;  5DB7 A;  5IIJ A;  2J6U A;  4IR1 A;  4QWB A;  4O3Q A;  4KLO A;  1NOM A;  4KLG A;  1KLN A;  5EOZ A;  2XO7 A;  1L5U A;  4ED2 A;  1RYR A;  4M9G A;  2J6S A;  2ZJ5 A;  3PNC A;  2JEF A;  1CUK A;  2ZTE A;  3C2K A;  3MFI A;  2JEG A;  4YQW A;  2BQR A;  3TAP A;  1ZQP A;  5KG5 A;  4F2R A;  4YP3 A;  2JZB A;  5J2J A;  4DSJ A;  4EEY A;  4M6W B;  2BCS A;  4DS4 A;  2XY5 A;  8ICO A;  4F4W A;  1XSL A;  2BCR A;  3ETL A;  4PH5 A;  1XSP A;  3RJH A;  8ICS A;  3ZDA A;  4K4I A;  2HVH A;  4DFJ A;  5C5J A;  4R64 A;  2DPI A;  3RJG A;  2KZZ A;  7ICT A;  1S9F A;  4M0A A;  4DSI A;  4DL4 A;  4NM1 A;  1NJW A;  4UB2 A;  2C22 A;  2UVV A;  3KHR A;  1RXW A;  1NK5 A;  3FYH A;  4Z6F A;  5J0O A;  2UVU A;  4J9N A;  4RUA A;  1U4B A;  4M9H A;  3TFR A;  1ZET A;  1N48 A;  4ED7 A;  8ICV A;  1TFR A;  3RH4 A;  3JPP A;  7ICI A;  1S0N A;  2VA8 A;  3PW5 A;  5CR0 A;  4J9M A;  2ASD A;  2FMS A;  3TQ1 A;  9ICH A;  4XA5 A;  4KN4 A;  3SYZ A;  4RT3 A;  4TUR A;  3E2E A;  3RRG A;  1NK0 A;  4DOB A;  1ZQY A;  1H38 A;  5J0P A;  2H5X A;  3RBE A;  4X5V A;  7ICP A;  4ECT A;  3NTU A;  1NK4 A;  2XGP A;  4B9S A;  4MF2 A;  5DG8 A;  4UBC A;  3JPO A;  5J2F A;  4TUS A;  4TUP A;  3PVX A;  3KHL A;  4C8O A;  1JMS A;  3Q8S B;  4I2J A;  4F8R A;  3KHG A;  3N97 B;  1L3V A;  4KLH A;  2BR0 A;  3ISC A;  4ELU A;  5KFV A;  4QZA A;  4YR0 A;  2BKE A;  3GII A;  2KFN A;  9ICT A;  4FS1 A;  3RB6 A;  1U48 A;  4R66 A;  4GXK A;  1WCN A;  5J0S A;  4ECY A;  3RJE A;  4I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...