2KZ3A

Backbone 1h, 13c, and 15n chemical shift assignments for human rad51d from 1 to 83
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional characterization of the N-terminal domain of human Rad51D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords Putative uncharacterized protein RAD51L3
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kz3A00
5EWEA 5KFDA 5KFYA 5KFHA 3RB3A 3QZ7A 2FLNA 2IHNA 5DBCA 1UT5A 4KMUA 2VA8A 5KG2A 4PGQA 2W9CB 1RXWA 1BPZA 1KRPA 3RJHA 5KFJA 1S0VA 4ECQA 1KEJA 1ZQQA 2C2EA 2BPGA 4DEZA 5EWGA 4QWAA 4C8LA 8ICXA 3ETLA 1ZYQA 8ICCA 2R8GA 3TI0A 2PXIA 4DQRA 4EZ9A 2JZBB 8ICJA 5DQHA 4LVSA 2XCAA 3ORYA 4RQ0A 7ICOA 5KFVA 3C1YA 5HNKA 3JPQA 4NXZA 4R8UB 5L9XA 4KLIA 2HHQA 2AGQA 1A77A 3OSNA 4KLSA 5F9LA 5KT6A 2KTQA 4NLKA 8ICQA 4J9NA 4PHAA 1X9WA 4I28A 1Y88A 5J0XA 2FMSA 4F4XA 1S97A 4MEYA 4IQVA 9ICQA 4GLXA 3C2MA 3C21A 7ICEA 9ICTA 4KLOA 7ICGA 4F91B 3RJGA 2ZTEA 4DFKA 1X9SA 1D8YA 2XY5A 3H8WA 4RPZA 2UVVA 5J2HA 3RJJA 3MR5A 4EZ6A 3OHBA 1TKDA 4GC7A 1UT8A 3M9NB 4EEYA 5KFLA 3H40A 4F50A 5L1LA 5J0UA 5DB7A 3RBEA 1SZPA 4C8MA 2BDPA 1BPBA 4B9MA 1ZETA 9ICLA 1ZQAA 9ICAA 3GIMA 2KZ3A 9ICHA 4Q44A 4K4IA 2ZJ8A 5J0QA 1U45A 1ZQHA 2F1IA 5KFPA 4I2GA 9ICBA 1EXNA 4RQ3A 1SKWA 1X2IA 3ZDAA 3H4DA 2XGPA 3HX0A 3ZD8A 2W9BB 8ICWA 2B21A 3EYZA 1NK5A 5IIOA 9ICUA 4Z6FA 5J2EA 1KTQA 5KG1A 4FBTA 2A1JB 3EWAA 3KHRA 4ECRA 4RNOA 3QZ8A 3SZ2A 3GILA 1ZQBA 1XC9A 2W8KA 4F3OA 5J2FA 2HVHA 5J2JA 8ICTA 1N48A 4F5RA 4O9MA 3PW2A 2ZUDA 3N4MB 4ED7A 1TFRA 3MGIA 3T5LA 3RBDA 1LV5A 1Z3EB 4GXIA 1NKBA 1Z00B 3PO5A 1Z00A 3RAQA 4O3QA 3MFIA 3MABA 4P4PA 4J9OA 3Q8KA 4I29A 2DPJA 1H38A 3T3FA 5DKWA 4O5CA 1KFSA 4R65A 4F92B 1AROP 4XA5A 3V6HA 7ICLA 4MF8A 2BQRA 2HHVA 9ICCA 4Z6DA 3GIKA 4Q45A 1XSNA 3QE9Y 2Y1IA 9ICSA 4Z6CA 4YR3A 5HMMA 4RT3A 1RPLA 5IIKA 4PHDA 3JPOA 4DL3A 3TAPA 1KLNA 5J0PA 1XSLA 1QTMA 2JEGA 1NJYA 3M9OB 5J0TA 1TK0A 4NY8A 5CHGA 4B9UA 1T7PA 4DQPA 4R66A 2BQUA 3THVA 7ICMA 8ICUA 2NRXA 3FDSA 2FLLA 1S9FA 3PW7A 4KLUA 1ZQOA 4PGYA 1C7YA 3RTVA 1RZTA 2ALZA 4QZAA 4UBCA 7ICTA 4QWCA 5KFWA 8ICZA 4DSLA 4ECTA 4RUCA 4J9SA 4RUAA 1D9FA 7ICIA 4IR1A 3GIIA 8ICBA 4PGXA 9ICPA 4KLQA 4E0DA 3LWLA 4B9VA 4ELTA 1ZQMA 2NRVA 5L1IA 1NK4A 4IQWA 5J0OA 5KG4A 5CA7A 4ED0A 3C23A 4KLDA 5KFBA 4DL5A 2BR0A 9ICWA 2C2RA 4QZFA 1X9MA 3Q8MA 2KZZA 4RT2A 2AQ4A 4UB1A 3RJIA 4NM2A 4QZDA 2XO7A 1JMSA 2HW3A 4DFPA 5KT7A 4O3SA 2ZTDA 9ICGA 3KHLA 5KFAA 3OGUA 2XY7A 2PFNA 3K75D 3PX4A 1JN3A 4XUSA 4R64A 2KN7A 4F4WA 4NLZA 1XSPA 1RYRA 3MR3A 4DOBA 3ISBA 4GC6A 3GDXA 8ICAA 3E2EA 3RH5A 9ICXA 5KT2A 3JPRA 4M47A 9ICMA 4UAYA 3OSPA 4I2EA 2BGWA 4BXOB 7ICRA 4ELVA 9ICFA 7ICSA 2BPCA 7ICHA 4YVZA 3HW8A 3ZD9A 5C5JA 4M2YA 4KLEA 5KFRA 8ICSA 4O3OA 4BWJA 4YCXA 5CWRA 4DSEA 2BCSA 4PPXA 5J2CA 3RB0A 9ICNA 1TAQA 1ZQDA 5KFSA 2GWSA 4DL4A 4ELUA 4UQGA 2C2DA 1NK8A 4RQ4A 4EYIB 2P66A 4DFJA 5IIMA 1HUOA 1NK7A 2HHUA 3BQTA 2W9BA 1NK6A 2PI5A 4HYKA 5D46A 4JV1A 2KFNA 3MFHA 3BJYA 2ASJA 4IRKA 3UXOA 2W9MA 5J0SA 3Q8RB 1U9LA 1CEZA 1ZQXA 1ZQGA 4ECYA 2XCPA 4B9NA 3SI8A 3OJSA 4QZGA 3RJFA 5CR0A 3UQ2A 4CCHA 4UB5A 4UB3A 3HT3A 1MSWD 5F9NA 1BPXA 4K4GA 4ECVA 3V7KA 4EBDA 7ICQA 4DSKA 4QZCA 4YD1A 3EPIA 2MUTB 1NOMA 3BQ0A 4X5VA 5DGAA 4F4KA 5J2AA 4RPYA 8ICMA 2JEIA 4C8NA 4YG2A 3SV4A 4TURA 4ECWA 3NTUA 3T5JA 4DSIA 1TAUA 1L3VA 2R8JA 4XRHA 1S0OA 3GQCA 4Q8EA 4J9PA 3PO4A 4JV0A 3QEBZ 2J6UA 4RNMA 5DGBA 5IIIA 3C2KA 3HWTA 5KFNA 3LDAA 4YMMA 4KLLA 4O5KA 3V6KA 1BPEA 5J2KA 1U4BA 5KFIA 8ICYA 1XO1A 3IHQB 3UQ0A 4M9HA 5KFQA 2HHWA 5J29A 4DO9A 4ED1A 4IRCA 4YR0A 5KG6A 2UVUA 1CUKA 4QW9A 2OWOA 5IIJA 3LK9A 4KN7A 2XC9A 3RJKA 5KFXA 5DBBA 4G3IA 1PZNA 4QZEA 1KDHA 4Q8FA 4R63A 5TZVA 1NJZA 5KFZA 4QW8A 1NK9A 1IXRA 3RH4A 4NM1A 4RQ7A 2JEJA 4RNNA 3RRHA 1QSYA 1QSLA 2FPMA 4TUPA 3MR2A 4ECUA 4DF4A 1KFTA 2ISOA 3Q8SB 4F5OA 1KSPA 4ED8A 3IM1A 1BGXT 2IA6A 4NLNA 4JV2A 3TFRA 5KT3A 4EBEA 1RYSA 1L3TA 4IRDA 4UAZA 4K4HA 4DQSA 3UXNA 2C22A 2RDIA 1U48A 5KFUA 1QSSA 4I27A 4Z6EA 4YXJA 5CB1A 2HVIA 4ED3A 4GXKA 5D49A 1L5UA 3RR7A 5D4BA 2ASLA 1ZQSA 4I2IA 4O3PA 1S0NA 4P2HA 4M6WA 4DLGA 4DS4A 5L1JA 4BWMA 5KT4A 3MGHA 4BGDA 5L1KA 3MDCA 4M9NA 4B9LA 3FYHA 3RAXA 5DG9A 1ZQJA 5HMLA 3SYZA 3PW0A 2PI4A 3Q8LA 4Q43A 4UB4A 2BHNA 4KITB 5DB6A 5DB8A 2AGPA 2VA3A 4MFCA 3PX0A 2R8HA 1L3SA 2UVWA 2KFZA 2JEFA 2BCRA 5KFKA 4F5NA 2I9GA 4MF2A 4KLJA 2XGQA 4ED6A 2VANA 4I2JA 5J2BA 4DL2A 3JPPA 8ICKA 9ICVA 4KLGA 4YR2A 3ISDA 2NRZA 4BDPA 4DSJA 1DOQA 5DLGA 3GV5B 2JZBA 5DBAA 3H4BA 3PY8A 4YFKA 3EW9A 4J9MA 5KFEA 3LWMA 3TQ1A 4YN4A 4J9KA 4QZ8A 5J2IA 2AU0A 4I2HA 3G6YA 3JPTA 4I2CA 2AQ0A 2DFLA 2V4QA 1V9PA 8ICHA 8ICRA 1ZQIA 3AU6A 2V9WA 3RR8A 1WCNA 4MFAA 4RQ5A 3Q8PB 4KTQA 5IILA 4QWBA 1BPDA 2FMPA 4QZ9A 4MFFA 1ZQKA 8ICVA 3PW5A 3EZ5A 3K4GA 4YMNA 3H7IA 4R8UA 3RJEA 3C5GA 3GV8B 5J0YA 4F5QA 3BDPA 8ICGA 5J0RA 5KFOA 3B0YA 5KFCA 3V7LA 4GXJA 3HP6A 4FO6A 1ZQFA 8ICFA 4PH5A 2IHMA 9ICJA 2C28A 1ZQTA 2M9NA 2LYHA 2NRWA 3ZDCA 2FPLA 4QWDA 2PFPA 3V72A 1S0MA 1SL2A 2ZJAA 3M8SA 1S10A 2IMWP 1SL0A 3TAQA 2AGOA 1ZQRA 4UAWA 3M9MB 3PR5B 4M9JA 4UBBA 1A76A 5DQIA 3BQ2A 1T3NA 1MQ3A 1NJXA 4YXMA 1DGSA 9ICEA 3KHHA 3V7JA 4TQSA 4RPXA 1WCLA 4I2DA 2VA2A 5EOZA 5HHHA 5DDMA 4F93B 1K1QA 2HHSA 4RQ6A 5KTQA 4F4YA 4FS2A 5KFFA 1NKEA 4KLFA 1U47A 5KFMA 1QLNA 2AJQA 5DG7A 2H5XA 4DLEA 3NGDA 1NKCA 2WTFA 4DSFA 2V4RA 3EPGA 1BPYA 4M9GA 1ZQUA 4F5PA 7ICJA 3MR6A 2W9AA 4DL7A 1U49A 2MAXA 1UA0A 3ZDDA 4C8KA 3UPQA 2ATLA 3HPOA 4KLTA 3MBYA 3G6VA 5J2GA 4JUZA 3GIJA 4M0AA 4O3NA 1SKRA 2BCUA 3KTQA 1ZJNA 1HUZA 1UA1A 3T5KA 2PFQA 2FPKA 4YMOA 5CP2A 2J6SA 4PHPA 3JPSA 2XY6A 4C8OA 1TV9A 2NRTA 1ZQEA 3QEAZ 4DOAA 4TQRA 4J9RA 5KFGA 2R8KA 4ECSA 1ZQWA 4J9LA 3PW4A 1SL1A 2FLPA 7ICKA 9ICKA 3M8RA 1LB2B 1KFDA 1K1SA 4DS5A 4LZDA 3GFKB 4QWEA 2RDJA 4RZRA 7ICUA 2W8LA 1ZQLA 5EWFA 3AUOA 1T8EA 1ZQYA 4RQ1A 2ASDA 1HJPA 1ZQZA 4QZBA 4JWMA 4I2AA 9ICRA 1D8LA 1JXEA 3AU2A 5J2DA 2BCQA 3N97B 3OJUA 1NK0A 7ICNA 4QZIA 1XU4A 4QZHA 3V6JA 2R8IA 3Q8QB 3SV3A 2P6UA 5HHIA 3PNCA 1JXLA 4ECZA 4O0IA 4KLHA 4RQ2A 2MUTA 4DF8A 2Y1JA 1B22A 3H8SA 9ICOA 4O3RA 4PHEA 3UXPA 4DL6A 4ED2A 3ZDBA 2W9CA 1ZQCA 3C2LA 3TARA 1NJWA 1JX4A 1ZQNA 3JPNA 3TFSA 4F4ZA 1TVAA 1TK5A 3G6XA 1ZQVA 4IQUA 4JK1A 3TANA 4F8RA 4MEXA 4M9LA 2Q0ZX 1MQ2A 9ICIA 1S77D 8ICOA 5KG7A 5KG5A 5JUMA 3PV8A 2ZUBA 5BPCA 4RQ8A 2P6RA 1BVSA 2KZMA 4O5EA 4IQTA 1IM4A 1RXVA 2BCVA 1COOA 1MC8A 5BOMA 3PX6A 5KG0A 4EYHB 2ZUCA 4DOCA 2J6TA 4ECXA 4DQIA 2IBKA 4FBUA 4J9QA 5DQGA 5IINA 3RB6A 4LZGA 4FS1A 1T4GA 8ICEA 4TUSA 4EBCA 2ZJ5A 3GV7B 1TK8A 5HP4A 5DLFA 4IR9A 4F2SA 2A1JA 5KG3A 4TUQA 1XS9D 4F2RA 2HHTA 5KFTA 5J0WA 1ZQPA 3PVXA 2PFOA 1ZJMA 2HHXA 4NLGA 3T5HA 4DFMA 4B9TA 3OHAA 1S76D 5BOLA 3B0XA 5CJ7A 4B9SA 3KHGA 3RRGA 3C1ZA 4P4OA 3ISCA 3PMNA 7ICPA 4KN4A 2BKEA 3MDAA 3C5FA 3BQ1A 4I2FA 7ICVA 3H8JA 2F1JA 4DQQA 4JWNA 4M04A 4KLMA 3ZDEA 5DG8A 4YQWA 1B43A 8ICPA 5DDYA 3RH6A 1D9DA 4YD2A 2I1QA 4UB2A 5DB9A 4P4MA 5KT5A 4YP3A 2FMQA 2ISPA 4M6WB 2UVRA 4XQ8A 4RU9A 2BPFA 4ZH4A 4BXOA 3PR4A 3RB4A 1N56A 1XWLA 2F1HA 8ICIA 2BQ3A 2ZTCA 7ICFA 1JIHA 8ICLA 4I2BA 1SKSA 8ICNA 4DWIA 1L3UA 3PMLA 2DPIA
chains in the Genus database with same CATH superfamily
3HRDD 5EE0A 5DBCA 4PGQA 3RF9A 2WF5A 1KRPA 4FE3A 5KFJA 2QB1A 2LYBA 3F5EA 8ICCA 2EDUA 1A6SA 3TI0A 4Y2SA 2JZBB 8ICJA 4LVSA 1V85A 2B0CA 2O6KA 5KFVA 3JPQA 4KLIA 5L9XA 3QXGA 1WUDA 1UCVA 5KT6A 4J9NA 4PHAA 3WKDA 3C2MA 3C21A 7ICGA 2ZTEA 1D8YA 2E1EA 5J2HA 4FZLA 1NZBA 3OHBA 1TKDA 1UT8A 3M9NB 4EEYA 3PZPA 5AK3A 5KFLA 4B9TA 5L1LA 5DB7A 4C8MA 3O0FA 1BPBA 9ICAA 4QNLA 4Q44A 4K4IA 1U45A 4NJ8A 9ICBA 3NVYA 1SKWA 2XGPA 5AI4A 4OJ5A 3EYZA 4Z6FA 5ALMA 2Z7JA 4FBTA 2WAQC 3QZ8A 1XC9A 4F3OA 1JRPA 1Q8KA 3N4MB 1TFRA 3MGIA 1NKBA 1Z00A 3MFIA 3MABA 4J9OA 2A19A 2K4EA 5KAFU 4I29A 1H38A 1IV8A 4XA5A 2LHTA 2LM4A 1KLNA 4RT3A 1RPLA 5J0PA 4B9UA 7ICMA 2E8OA 3THVA 5EE9A 2NRXA 1N5WA 3FDSA 2FLLA 2RP5A 4KLUA 1C7YA 1RZTA 2ALZA 2KMDA 4UBCA 4DSLA 4ECTA 5KL8B 4B9VA 4ELTA 1NK4A 3QUCA 4ED0A 9ICWA 5KFBA 2BR0A 2W03A 1X9MA 2KZZA 2Q4TA 4RT2A 4UB1A 3RJIA 4NM2A 4RQNA 2XO7A 2HW3A 4O3SA 1L8LA 2QB0B 2XY7A 4NLZA 3OTQA 3ISBA 4GC6A 3GDXA 2WF6A 3L5KA 4M47A 4BUGA 4UAYA 3D2NA 4BXOB 7ICHA 3LYSA 3LVVA 2BCSA 9ICNA 1TAQA 4NWIA 5KFSA 2GWSA 4UQGA 2C2DA 2KVCA 5IIMA 2NO5A 3BQTA 4HYKA 2KK0A 2YMPA 4JV1A 3MFHA 3L4PA 2ASJA 4IRKA 1X40A 5J0SA 1U9LA 1CEZA 1ZQXA 2W04A 5TISU 1ZQGA 3F5AA 3RJFA 5T14A 3UQ2A 1Z1BA 3AMZA 1MSWD 5F9NA 1BPXA 4YD1A 1XO0A 4F4KA 2A1AA 2YB4A 4UW9A 3SV4A 4DSIA 3N28A 2HBMA 5AKXA 3ALRA 5IIIA 3C2KA 3LDAA 4KLLA 2KICA 3V6KA 5AKKA 2KNJA 4P0QA 1FO4A 1TE2A 2YY6A 1CUKA 2KHVA 1SV0A 5KFXA 2KEYA 1KDHA 4R63A 5AK5A 5KFZA 3RH4A 2JEJA 4RNNA 1QSYA 2KOBA 3MR2A 1KFTA 3QNMA 1KSPA 2LM1A 4ED8A 3T79A 1BGXT 4CF3A 4Y2VA 2NYVA 1RYSA 1L3TA 4UAZA 1U48A 2WF7A 5D49A 2KIVA 5AM2A 2ASLA 4I2IA 1GO3F 4DLGA 3QX7A 3SAGA 3FYHA 1ZQJA 5HMLA 4FZNA 3SYZA 4Q43A 3M7DA 4ACOA 5DB6A 5DB8A 5K4LA 2F2AB 2R8HA 2UVWA 2PMZC 2I9GA 4MF2A 2AH5A 3A0BU 4ED6A 4I2JA 8ICKA 9ICVA 1L6NA 2XVTA 2DWQA 4UB6U 4BDPA 1DOQA 1DRGA 4CF4A 5DBAA 1SZHA 3PY8A 4J9MA 3TQ1A 1LKYA 4YN4A 5AHXA 4QZ8A 2AU0A 3G6YA 2HOQA 2DFLA 8ICHA 1WWVA 8ICRA 3QU9A 2V9WA 1WCNA 4QWBA 1BPDA 4QZ9A 3BZKA 3WKAA 3PW5A 3NRZA 3GV8B 2DKXA 4PH5A 9ICJA 2C28A 4AYBF 2LYHA 2FPLA 3V72A 1S0MA 4P0PA 5AM0A 5ALFA 2IMWP 1XNSA 2K8CB 2AGOA 1A76A 3BQ2A 4YXMA 2W54A 3KHHA 1SV0C 1WCLA 4RPXA 2VA2A 5DDMA 4WJ3B 3H0LB 2HHSA 4RQ6A 4F4YA 4FS2A 2W7PA 1NKEA 3N7SC 2W3SA 4IS7A 9ICIA 1DK3A 1KQQA 4DSFA 3EPGA 1BPYA 4QIWF 7ICJA 2W9AA 1U49A 5AKJA 5ALHA 4M0AA 1SKRA 2JMGA 3T5KA 3R9KA 3I76A 2XY6A 2EAMA 4UATA 2D6FC 5AM4A 1NNLA 5KFGA 2QARA 1ZQWA 4ECSA 3PW4A 4NLCA 7ICKA 1Q3UA 1K1SA 4DS5A 1DXSA 1ZQYA 1ZQZA 1D8LA 1JXEA 3H0MB 2BCQA 1L7NA 3OJUA 4QZIA 2CN1A 2XICA 5JU5A 4KLHA 1B22A 2Y1JA 1QQ5A 2KKPA 9ICOA 5ALEA 2HBLA 4ED2A 3ZDBA 1ZQCA 1ZQNA 4F8RA 1RDFA 2Q0ZX 8ICOA 4RQ8A 2KZMA 4O5EA 2QLTA 2ZG6A 5KG0A 4UARA 3L3FX 4J9QA 4LZGA 1MN8A 1T4GA 4TUSA 3UMBA 3GV7B 1TK8A 3BQ7A 5DLFA 1XS9D 2BDUA 2DBYA 2HHXA 2PFOA 3T5HA 2G06A 1CRXA 5BOLA 3B0XA 5CJ7A 4P0PB 2BKEA 3MDAA 3C5FA 2HOIA 1TAMA 4KLMA 4M04A 1B43A 2BZFA 5DB9A 2H3FA 3QUBA 3SMVA 2FMQA 4RU9A 3WKEA 4BXOA 5ALKA 4EEKA 4UASA 1P7DA 3FC4A 2ZTCA 1FEZA 1JIHA 7ICFA 2VJ5A 8ICBA 5KFDA 5KFYA 5KFHA 3QZ7A 1UT5A 1S0VA 4ECQA 1ZQQA 4QWAA 4C8LA 8ICXA 3H0RB 4DQRA 2XCAA 5JRTA 2KIWA 4RQ0A 3C1YA 5HNKA 2HHQA 2HSZA 4KLSA 3MC1A 5AM5A 3QU5A 1X9WA 5J0XA 1S97A 3QUQA 1ZD4A 4KLOA 2ZIWA 4DFKA 2JH7A 2XY5A 4RPZA 2UVVA 1B0XA 2D3DA 1X6JA 3NUQA 2LPEA 3CNHA 9ICLA 1X66A 5J8YA 3GIMA 4F72A 4FFDA 1SB3C 2ZJ8A 5KFPA 3B9JA 1X9XA 1X2IA 3H4DA 4Y2UA 2K60A 2FDRA 2DUYA 1NK5A 9ICUA 4RQMA 5J2EA 3KOOA 4BX9C 1KTQA 5KG1A 2E3TA 2LYAA 3GU3A 5FP0A 3PSPA 3HILA 1SIJA 8ICTA 1N48A 2ZUDA 1LV5A 4GXIA 1Z00B 3IRUA 4O3QA 4NLBA 1ED1A 2F44A 1KFSA 3AQEA 4MF8A 3UMGA 1JI7A 2ZIVA 2RQ5A 4Q45A 3QE9Y 2Y1IA 4Z6CA 3TAPA 5AKIA 3JPOA 5B66U 1XSLA 1NJYA 1KL9A 4KX5A 1F5SA 1S9FA 3PW7A 1ZQOA 4PGYA 4UB8U 3RTVA 4JMUA 1J97A 4QWCA 8ICZA 4RUAA 1D9FA 3GIIA 9ICPA 4J03A 1N2XA 2KSOB 1JUDA 5KG4A 1ZD2P 1F44A 1PK1A 4EX6A 1JMSA 5ALWA 4DFPA 5KFAA 3OGUA 2E8NA 3K75D 1JN3A 4R64A 2KN7A 4AP9A 1J2MA 4DOBA 1NI3A 4GFJA 3E2EA 9ICXA 3QU2A 5KT2A 2G5IB 2KG5A 2BGWA 7ICRA 4G9BA 3HW8A 5CWRA 5J2CA 2GOLA 1SXEA 3RB0A 4ELUA 4PZNA 1UQVA 5D46A 2KFNA 3BJYA 3UXOA 3Q8RB 3KKAC 4A8EA 4ECYA 4O3MA 3HT3A 3HJEA 3V7KA 3SQIA 4QZCA 2MUTB 1NOMA 4X5VA 3BS7A 1ZD3A 2JXJA 4RPYA 8ICMA 2G07A 4PL1A 4ECWA 4TURA 3WK4A 3NTUA 2R8JA 1S0OA 4Q8EA 4J9PA 3PO4A 2J6UA 4RNMA 5DGBA 1COKA 5KFNA 4O5KA 1DGJA 8ICYA 1QCKA 5J29A 4DO9A 4KN7A 2XC9A 5DBBA 4C4SA 4Q8FA 5AI5A 3SD7A 1IXRA 2FPMA 4TUPA 2ISOA 4OCZA 3IM1A 2IA6A 3TFRA 4EBEA 3UXNA 2RDIA 2OHFA 5HR6A 4GXKA 1L5UA 3RR7A 4O3PA 1S0NA 5AKLA 5L1KA 5DG9A 3Q8LA 2FE9A 4UB4A 2EAOA 3BS5B 2AGPA 4MFCA 3PX0A 3WKCA 3SR6A 5ALGA 4U6PA 5KFKA 4F5NA 5KL1B 3NVVA 2R18A 5AIBA 5J2BA 3JPPA 4YR2A 3GV5B 3H4BA 3C28A 3EW9A 5KFEA 5ALJA 3WK7A 4OD0A 5GTHU 3JPTA 2AQ0A 2WB1F 4Y2TA 3Q8PB 4KTQA 3PSIA 3HKZC 3ONNA 3H7IA 3RJEA 3NS1A 4GXJA 4FO6A 3B0YA 2E5SA 5KFOA 1VDVA 3HP6A 8ICFA 1ZQTA 2M9NA 1OW5A 1Z4NA 2KJ8A 1S10A 4UAWA 3PR5B 4M9JA 4UBBA 1NJXA 3V7JA 4TQSA 2JV3A 1K1QA 5AK6A 1QLNA 2AJQA 5DG7A 3NGDA 1NKCA 2WTFA 4F5PA 2PMZF 2ATLA 4KLTA 3G6VA 3GIJA 3K1ZA 4O3NA 2BCUA 3KTQA 1HUZA 4YMOA 2YX8A 1D8BA 4NL9C 2CRXA 2NRTA 2WF8A 3QEAZ 4J9RA 2FLPA 4PL2A 1KFDA 5EE1A 4QWEA 5HR7A 3WK5A 5EWFA 4RQ1A 9ICRA 5J2DA 3N97B 1NK0A 2K8BB 4QZHA 2P6UA 3F2BA 3PNCA 2NV3A 4ECZA 4RQ2A 2N1RA 3UXPA 2PKEA 3C2LA 1JX4A 3AN1A 3JPNA 1TVAA 1TK5A 3TANA 4M9LA 3VCBA 1PVPA 5JTIA 5BPCA 1O08A 2P6RA 1BVSA 2BCVA 3PX6A 2YTUA 4DOCA 1PUZA 2H3IA 2IBKA 4FBUA 5IINA 2KSOA 5F3XB 2IOHA 5G5GA 1URJA 4IR9A 5KFTA 5J0WA 3PVXA 1ZJMA 5AKYA 4NLGA 3D2SA 5ALDA 3WK6A 2ODGA 2EH9A 3NVZA 7ICPA 4P4OA 2HBKA 3ISCA 4KN4A 2OYYA 7ICVA 3H8JA 2F1JA 4JWNA 3ZDEA 5DG8A 5DDYA 3UM9A 1RM6C 4US8A 4UB2A 1ZRMA 2RRDA 4YP3A 2JHDA 2BPFA 3M1YA 3RFAA 1J2NA 3PR4A 3RB4A 2WF9A 8ICLA 4I2BA 2DPIA 5EWEA 2W9CB 1RXWA 4CRXA 2BPGA 2G09A 4IL6U 1LKYB 5EWGA 3ETLA 2JGAA 3KFUF 5A0LA 2R8GA 2PXIA 4C7YA 4Y2YA 1JROA 3UMCA 5ALRA 3IG8A 1OXJA 4NXZA 1A77A 3OSNA 3IDWA 4LJXA 5F9LA 3AL0B 2KTQA 4I28A 2FMSA 4F4XA 4IQVA 2EAPA 4GLXA 7ICEA 3VC8A 2VIXA 3RJGA 1X9SA 4FZMA 3RJJA 4EZ6A 1KBUA 4F50A 5J0UA 2BDPA 4B9MA 1WWUA 1ZQ1C 5ALQA 5J0QA 1SWWA 4I2GA 1UPHA 2WHEA 2DGZA 3ZDAA 2H3ZA 5ALPA 4OJ6A 3AQFA 8ICWA 2B21A 4EENA 5AKGA 2W3RA 2GLEA 3EWAA 3ED5A 2IOFA 3SZ2A 3GILA 1ZQBA 1KW4A 2W8KA 3AEVA 3CP8A 3RBDA 4B6JA 3RAQA 4Y2XA 2DPJA 4O5CA 5CRXA 2VJ4A 4F92B 2XIDA 2AHOB 7ICLA 4QIWC 4Z6DA 3GIKA 9ICSA 2KJ5A 5HMMA 2JEGA 3M9OB 5J0TA 4NY8A 4C4TA 4R66A 5AICA 3SAFA 4QZAA 5KFWA 5KNIA 4RUCA 3E0FA 7ICIA 4IR1A 3TKAA 3CW2C 5L1IA 4IQWA 3EUB2 1NZPA 4KLDA 3C23A 3Q8MA 2AQ4A 2K8AA 3M6KA 5KT7A 9ICGA 3KHLA 2PFNA 5AI8A 3PX4A 4XUSA 4F4WA 3ETRA 1PVRA 4P0QB 3DV9A 1N63A 3QYPA 1Q3VA 4PJ0U 9ICMA 3OSPA 9ICFA 2F3NA 4U7CA 2G0AA 2BPCA 3IG5A 4EELA 3ZD9A 4O3OA 4DSEA 2LMRA 4PPXA 2YMMA 1NK8A 4OJPA 3FAHA 1Z1VA 4RQ4A 1SV4A 4EYIB 2P66A 3QU7A 2EANA 5AM3A 5B5EU 2HHUA 1NK6A 1C20A 4UAUA 2A3VA 3ZI4A 3SI8A 2WFAA 4QZGA 4AYBC 4CCHA 2MU2A 1Z19A 1FIQA 4C80A 4ECVA 3C29A 4MHVA 1QQ7A 1QH9A 3HKZF 2WB1C 2XI9A 5J2AA 4OO1J 1K5OA 2JEIA 4C8NA 1TAUA 1L3VA 4XRHA 3IV6A 1N62A 4JV0A 3QEBZ 4US9A 4YMMA 1BPEA 4CDGA 5J2KA 1U4BA 5KFIA 1ZXIA 3IHQB 4M9HA 2ZIWB 5AKEA 5KFQA 4ED1A 3KD3A 5KG6A 1PZNA 4QZEA 2DF4B 1NJZA 5ALVA 1NK9A 1QSLA 2P35A 4ECUA 4DF4A 3WK8A 4C4RA 2I6XA 4F5OA 5ALTA 2G08A 1X6IA 4NLNA 4JV2A 5KT3A 2K4PA 4IRDA 4K4HA 2C22A 5AKHA 4JB3A 5KFUA 4I27A 3S6JA 4YXJA 2DKZA 5CB1A 2HVIA 4ED3A 4M6WA 1YZ7A 4ZOHC 5L1JA 5KT4A 4B9LA 1SWVA 5EE3A 1A0PA 1DK2A 3KKAA 2KFZA 2VA3A 2JEFA 2BCRA 3WU2U 4KLJA 2XGQA 4KLGA 2ZIVB 2NRZA 4QJFB 2HI0A 2Y0SC 2JZBA 2ZXHA 4YFKA 3LWMA 4J9KA 2D8CA 2JH1A 4I2CA 2YMLA 2OCEA 3AU6A 3RR8A 4MFAA 4RQ5A 1WYGA 8ICVA 1ZQKA 3K4GA 8ICGA 2JRZA 2W55A 5J0YA 4F5QA 3BDPA 5J0RA 1VLBA 2IHMA 3ZDCA 2PFPA 4GIBA 3FM9A 2ZJAA 3M8SA 3TAQA 1BNOA 3M9MB 2EZXA 2ZIXA 5G5HA 2F8KA 4I2DA 5EOZA 1L7PA 1ZOLA 5KFMA 3F2DA 4Y2QA 2V4RA 2EQYA 1FFUA 2MAXA 1UA0A 2F76X 4JUZA 2ZXIA 1ZJNA 2FPKA 5CP2A 1JALA 2J6SA 4C8OA 2HCFA 2R8KA 4CE6A 4USAA 9ICKA 1PK3A 3M8RA 4LZDA 2KP7A 2RDJA 7ICUA 3AUOA 4JWMA 1KKXA 2W11A 1RQNA 1XU4A 3Q8QB 3SAHA 2QB0A 5HHIA 1M6YA 1JXLA 2MUTA 3H8SA 4O3RA 4DL6A 3SEIA 4F4ZA 3G6XA 1ZQVA 4IQUA 2FJ6A 2Y9UA 5AI0A 1N60A 2KVSA 5JUMA 3PV8A 2ZUBA 1MA7A 5AKZA 4IQTA 1IM4A 1HIWA 1COOA 5BOMA 2ES6A 5AI6A 2E1FA 2ZUCA 2J6TA 4ECXA 3RB6A 2YN4A 8ICEA 4EBCA 2ZJ5A 2IOFK 5HP4A 4F2SA 2A1JA 4F2RA 3ICXA 4CNQA 3OHAA 4F71A 4CF5A 4B9SA 3PMNA 3IN5A 2HOFA 8ICPA 2OM6A 2ZIXB 2DQNB 1D9DA 4YD2A 2KV2A 4P4MA 5KT5A 2ISPA 4XQ8A 4ZH4A 2HMXA 1N56A 1XWLA 8ICIA 2BQ3A 2OXOA 3RRGA 4M9NA 4C7ZA 3RB3A 2FLNA 2IHNA 4KMUA 2VA8A 5KG2A 1BPZA 3RJHA 1KEJA 2C2EA 4DEZA 2L5YA 5ALXA 1ZYQA 4Y2JA 3D2QA 2OH2A 4EZ9A 5DQHA 1BNPA 3ORYA 2DL0A 1L8OA 7ICOA 3PSTA 4R8UB 2AGQA 2E8MA 2W43A 4NLKA 8ICQA 3U26A 3N7PD 1Y88A 1V97A 1RQLA 1PK1B 4MEYA 3H8MA 1PVQA 9ICQA 9ICTA 5AIAA 4F91B 3KZIU 3H8WA 2KKVA 3MR5A 4GC7A 3SENA 3OPXA 3H40A 4Y2RA 2K4IA 2YMQA 3I1YA 3RBEA 1SZPA 3TADA 1ZETA 1ZQAA 2KZ3A 9ICHA 1L7MA 3WK9A 5ALSA 4DFDA 1ZQHA 2F1IA 1EXNA 5C0YA 5AM1A 2HDOA 4RQ3A 2KE7A 1VJ5A 3HX0A 3ZD8A 2W9BB 5IIOA 2A1JB 3KHRA 5L1MA 4ECRA 4RNOA 5J2FA 2HVHA 5J2JA 4F5RA 4O9MA 3PW2A 4C0ZA 4ED7A 2YB1A 3T5LA 1AQ6A 1Z3EB 5ALZA 3PO5A 5GTIU 4P4PA 3Q8KA 3T3FA 2H3QA 5DKWA 4R65A 4CGZA 1AROP 3V6HA 2BQRA 2HHVA 9ICCA 2F8LA 1XSNA 1YZ6A 4YR3A 1RYUA 4OJLA 4DL3A 5IIKA 4PHDA 1QTMA 1TK0A 3KZXA 5CHGA 1SXDA 3F53A 1T7PA 4DQPA 2BQUA 4Y2PA 8ICUA 2EZZA 2F77X 2ESEA 7ICTA 4J9SA 4PGXA 4KLQA 4E0DA 3LWLA 1ZQMA 1O03A 2NRVA 1CI4A 5J0OA 5CA7A 4DL5A 2C2RA 4QZFA 1SGGA 4QZDA 3AM9A 2ZTDA 2W7OA 1XSPA 1RYRA 3MR3A 3CRXA 8ICAA 5H2FU 3RH5A 1ZD5A 3JPRA 5J8YC 4I2EA 4ELVA 5AK4A 7ICSA 4YVZA 1WG8A 5C5JA 4M2YA 4KLEA 5KFRA 8ICSA 4BWJA 4YCXA 1FFVA 2KJ9A 1ZQDA 1F0MA 4DL4A 4PZOA 2QARB 2VKQA 3DEEA 2MRLA 3PSFA 4DFJA 1HUOA 1NK7A 2W9BA 2PI5A 2RLTA 1ECWA 2W9MA 2XCPA 4B9NA 3OJSA 5CR0A 4UB5A 4UB3A 4K4GA 7ICQA 4EBDA 4DSKA 3EPIA 3BQ0A 4IC9A 2B6GA 5DGAA 3LVWA 4YG2A 2LI6A 3T5JA 2HBJA 3GQCA 3E58A 2Y0SF 1UHUA 4KMOB 3HWTA 3DDHA 5KAIU 1XO1A 3I28A 3UQ0A 2E8PA 1LVHA 4IRCA 4YR0A 2UVUA 4BJQA 4QW9A 2OWOA 5IIJA 3LK9A 3RJKA 4G3IA 3MGVA 4ICAA 5TZVA 4QW8A 4NM1A 4HAIA 4RQ7A 3RRHA 3Q8SB 2MA1A 5CEHA 5ALOA 1V38A 4DQSA 1IIPA 2ZIUB 5ALUA 1QSSA 4Z6EA 5D4BA 1ZQSA 4P2HA 4DS4A 3CYMA 4BWMA 3MGHA 4BGDA 3MDCA 3RAXA 3PW0A 2PI4A 2G5HB 2BHNA 4KITB 5ALLA 1L3SA 3NRWA 2VANA 4DL2A 1X42A 5ALNA 3ISDA 4DSJA 1Z4OA 5DLGA 2KHQA 4NV0A 5J2IA 4I2HA 3J81j 2EZYA 2MSNA 2V4QA 1V9PA 4DCCA 1ZQIA 2LBOA 3BZCA 2HHWA 5IILA 2FMPA 4MFFA 3EZ5A 4YMNA 4R8UA 3C5GA 5KFCA 1ZQFA 3V7LA 3QUTA 2NRWA 3IP4B 4QWDA 1KN5A 3NVWA 5ALIA 3WKBA 1SL2A 2WAQF 1SL0A 1ZQRA 5DQIA 1T3NA 1MQ3A 9ICEA 1DGSA 5HHHA 4F93B 2M0NA 5KTQA 5KFFA 4KLFA 2K4HA 1U47A 3F2CA 4DLEA 2H5XA 2Y9TA 3BS5A 2KD1A 1ZQUA 4M9GA 3MR6A 4DL7A 3ZDDA 4C8KA 3UPQA 3HPOA 3MBYA 5J2GA 1RG6A 1UA1A 3NASA 2PFQA 4PHPA 3JPSA 1TV9A 1ZQEA 4DOAA 4TQRA 1OUQA 1SL1A 4J9LA 1HEKA 1LB2B 3GFKB 3A0HU 4UAVA 4RZRA 1B4FA 2ZIUA 2W8LA 1ZQLA 1T8EA 2ASDA 1HJPA 2FI1A 4QZBA 4I2AA 1IG6A 2GO7A 3AU2A 2RHFA 7ICNA 5AI9A 2AXTU 3V6JA 3M6ZA 3SV3A 2GH1A 2R8IA 2K89A 2H3VA 4O0IA 4NL9A 4DF8A 1S8OA 4PHEA 1N61A 2W9CA 3TARA 1NJWA 1Q46A 1ZRNA 3TFSA 2NO4A 4JK1A 2QKQA 4OJOA 4MEXA 1N5XA 1MQ2A 1L7OA 1S77D 5KG7A 5KG5A 1RXVA 1MC8A 3D6JA 2I5HA 4EYHB 4DQIA 5E79U 5DQGA 3TACB 4FS1A 5KG3A 4TUQA 5ALYA 2HHTA 2YQEA 1ZQPA 2OEHA 1YT3A 2CXYA 4DFMA 4KX3A 3N7RC 2CPRA 1S76D 3KHGA 3GZFA 3C1ZA 4EX7A 1QQ6A 3BQ1A 4I2FA 1T94A 4DQQA 2LKYA 4YQWA 3RH6A 2I1QA 3TADC 3K1RB 3QU4A 4M6WB 2UVRA 1S5LU 1T3QA 2F1HA 3KBBA 1SKSA 8ICNA 2JR5A 4DWIA 1L3UA 3PMLA
chains in the Genus database with same CATH topology
5EWEA 5KFDA 5KFYA 5KFHA 3RB3A 3QZ7A 2FLNA 2IHNA 5DBCA 1UT5A 4KMUA 2VA8A 5KG2A 4PGQA 2W9CB 1RXWA 1BPZA 1KRPA 3RJHA 5KFJA 1S0VA 4ECQA 1KEJA 1ZQQA 2C2EA 2BPGA 4DEZA 5EWGA 4QWAA 4C8LA 8ICXA 3ETLA 1ZYQA 8ICCA 2R8GA 3TI0A 2PXIA 4DQRA 4EZ9A 2JZBB 8ICJA 5DQHA 4LVSA 2XCAA 3ORYA 4RQ0A 7ICOA 5KFVA 3C1YA 5HNKA 3JPQA 4NXZA 4R8UB 5L9XA 4KLIA 2HHQA 2AGQA 1A77A 3OSNA 4KLSA 5F9LA 5KT6A 2KTQA 4NLKA 8ICQA 4J9NA 4PHAA 1X9WA 4I28A 1Y88A 5J0XA 2FMSA 4F4XA 1S97A 4MEYA 4IQVA 9ICQA 4GLXA 3C2MA 3C21A 7ICEA 9ICTA 4KLOA 7ICGA 4F91B 3RJGA 2ZTEA 4DFKA 1X9SA 1D8YA 2XY5A 3H8WA 4RPZA 2UVVA 5J2HA 3RJJA 3MR5A 4EZ6A 3OHBA 1TKDA 4GC7A 1UT8A 3M9NB 4EEYA 5KFLA 3H40A 4F50A 5L1LA 5J0UA 5DB7A 3RBEA 1SZPA 4C8MA 2BDPA 1BPBA 4B9MA 1ZETA 9ICLA 1ZQAA 9ICAA 3GIMA 2KZ3A 9ICHA 4Q44A 4K4IA 2ZJ8A 5J0QA 1U45A 1ZQHA 2F1IA 5KFPA 4I2GA 9ICBA 1EXNA 4RQ3A 1SKWA 1X2IA 3ZDAA 3H4DA 2XGPA 3HX0A 3ZD8A 2W9BB 8ICWA 2B21A 3EYZA 1NK5A 5IIOA 9ICUA 4Z6FA 5J2EA 1KTQA 5KG1A 4FBTA 2A1JB 3EWAA 3KHRA 4ECRA 4RNOA 3QZ8A 3SZ2A 3GILA 1ZQBA 1XC9A 2W8KA 4F3OA 5J2FA 2HVHA 5J2JA 8ICTA 1N48A 4F5RA 4O9MA 3PW2A 2ZUDA 3N4MB 4ED7A 1TFRA 3MGIA 3T5LA 3RBDA 1LV5A 1Z3EB 4GXIA 1NKBA 1Z00B 3PO5A 1Z00A 3RAQA 4O3QA 3MFIA 3MABA 4P4PA 4J9OA 3Q8KA 4I29A 2DPJA 1H38A 3T3FA 5DKWA 4O5CA 1KFSA 4R65A 4F92B 1AROP 4XA5A 3V6HA 7ICLA 4MF8A 2BQRA 2HHVA 9ICCA 4Z6DA 3GIKA 4Q45A 1XSNA 3QE9Y 2Y1IA 9ICSA 4Z6CA 4YR3A 5HMMA 4RT3A 1RPLA 5IIKA 4PHDA 3JPOA 4DL3A 3TAPA 1KLNA 5J0PA 1XSLA 1QTMA 2JEGA 1NJYA 3M9OB 5J0TA 1TK0A 4NY8A 5CHGA 4B9UA 1T7PA 4DQPA 4R66A 2BQUA 3THVA 7ICMA 8ICUA 2NRXA 3FDSA 2FLLA 1S9FA 3PW7A 4KLUA 1ZQOA 4PGYA 1C7YA 3RTVA 1RZTA 2ALZA 4QZAA 4UBCA 7ICTA 4QWCA 5KFWA 8ICZA 4DSLA 4ECTA 4RUCA 4J9SA 4RUAA 1D9FA 7ICIA 4IR1A 3GIIA 8ICBA 4PGXA 9ICPA 4KLQA 4E0DA 3LWLA 4B9VA 4ELTA 1ZQMA 2NRVA 5L1IA 1NK4A 4IQWA 5J0OA 5KG4A 5CA7A 4ED0A 3C23A 4KLDA 5KFBA 4DL5A 2BR0A 9ICWA 2C2RA 4QZFA 1X9MA 3Q8MA 2KZZA 4RT2A 2AQ4A 4UB1A 3RJIA 4NM2A 4QZDA 2XO7A 1JMSA 2HW3A 4DFPA 5KT7A 4O3SA 2ZTDA 9ICGA 3KHLA 5KFAA 3OGUA 2XY7A 2PFNA 3K75D 3PX4A 1JN3A 4XUSA 4R64A 2KN7A 4F4WA 4NLZA 1XSPA 1RYRA 3MR3A 4DOBA 3ISBA 4GC6A 3GDXA 8ICAA 3E2EA 3RH5A 9ICXA 5KT2A 3JPRA 4M47A 9ICMA 4UAYA 3OSPA 4I2EA 2BGWA 4BXOB 7ICRA 4ELVA 9ICFA 7ICSA 2BPCA 7ICHA 4YVZA 3HW8A 3ZD9A 5C5JA 4M2YA 4KLEA 5KFRA 8ICSA 4O3OA 4BWJA 4YCXA 5CWRA 4DSEA 2BCSA 4PPXA 5J2CA 3RB0A 9ICNA 1TAQA 1ZQDA 5KFSA 2GWSA 4DL4A 4ELUA 4UQGA 2C2DA 1NK8A 4RQ4A 4EYIB 2P66A 4DFJA 5IIMA 1HUOA 1NK7A 2HHUA 3BQTA 2W9BA 1NK6A 2PI5A 4HYKA 5D46A 4JV1A 2KFNA 3MFHA 3BJYA 2ASJA 4IRKA 3UXOA 2W9MA 5J0SA 3Q8RB 1U9LA 1CEZA 1ZQXA 1ZQGA 4ECYA 2XCPA 4B9NA 3SI8A 3OJSA 4QZGA 3RJFA 5CR0A 3UQ2A 4CCHA 4UB5A 4UB3A 3HT3A 1MSWD 5F9NA 1BPXA 4K4GA 4ECVA 3V7KA 4EBDA 7ICQA 4DSKA 4QZCA 4YD1A 3EPIA 2MUTB 1NOMA 3BQ0A 4X5VA 5DGAA 4F4KA 5J2AA 4RPYA 8ICMA 2JEIA 4C8NA 4YG2A 3SV4A 4TURA 4ECWA 3NTUA 3T5JA 4DSIA 1TAUA 1L3VA 2R8JA 4XRHA 1S0OA 3GQCA 4Q8EA 4J9PA 3PO4A 4JV0A 3QEBZ 2J6UA 4RNMA 5DGBA 5IIIA 3C2KA 3HWTA 5KFNA 3LDAA 4YMMA 4KLLA 4O5KA 3V6KA 1BPEA 5J2KA 1U4BA 5KFIA 8ICYA 1XO1A 3IHQB 3UQ0A 4M9HA 5KFQA 2HHWA 5J29A 4DO9A 4ED1A 4IRCA 4YR0A 5KG6A 2UVUA 1CUKA 4QW9A 2OWOA 5IIJA 3LK9A 4KN7A 2XC9A 3RJKA 5KFXA 5DBBA 4G3IA 1PZNA 4QZEA 1KDHA 4Q8FA 4R63A 5TZVA 1NJZA 5KFZA 4QW8A 1NK9A 1IXRA 3RH4A 4NM1A 4RQ7A 2JEJA 4RNNA 3RRHA 1QSYA 1QSLA 2FPMA 4TUPA 3MR2A 4ECUA 4DF4A 1KFTA 2ISOA 3Q8SB 4F5OA 1KSPA 4ED8A 3IM1A 1BGXT 2IA6A 4NLNA 4JV2A 3TFRA 5KT3A 4EBEA 1RYSA 1L3TA 4IRDA 4UAZA 4K4HA 4DQSA 3UXNA 2C22A 2RDIA 1U48A 5KFUA 1QSSA 4I27A 4Z6EA 4YXJA 5CB1A 2HVIA 4ED3A 4GXKA 5D49A 1L5UA 3RR7A 5D4BA 2ASLA 1ZQSA 4I2IA 4O3PA 1S0NA 4P2HA 4M6WA 4DLGA 4DS4A 5L1JA 4BWMA 5KT4A 3MGHA 4BGDA 5L1KA 3MDCA 4M9NA 4B9LA 3FYHA 3RAXA 5DG9A 1ZQJA 5HMLA 3SYZA 3PW0A 2PI4A 3Q8LA 4Q43A 4UB4A 2BHNA 4KITB 5DB6A 5DB8A 2AGPA 2VA3A 4MFCA 3PX0A 2R8HA 1L3SA 2UVWA 2KFZA 2JEFA 2BCRA 5KFKA 4F5NA 2I9GA 4MF2A 4KLJA 2XGQA 4ED6A 2VANA 4I2JA 5J2BA 4DL2A 3JPPA 8ICKA 9ICVA 4KLGA 4YR2A 3ISDA 2NRZA 4BDPA 4DSJA 1DOQA 5DLGA 3GV5B 2JZBA 5DBAA 3H4BA 3PY8A 4YFKA 3EW9A 4J9MA 5KFEA 3LWMA 3TQ1A 4YN4A 4J9KA 4QZ8A 5J2IA 2AU0A 4I2HA 3G6YA 3JPTA 4I2CA 2AQ0A 2DFLA 2V4QA 1V9PA 8ICHA 8ICRA 1ZQIA 3AU6A 2V9WA 3RR8A 1WCNA 4MFAA 4RQ5A 3Q8PB 4KTQA 5IILA 4QWBA 1BPDA 2FMPA 4QZ9A 4MFFA 1ZQKA 8ICVA 3PW5A 3EZ5A 3K4GA 4YMNA 3H7IA 4R8UA 3RJEA 3C5GA 3GV8B 5J0YA 4F5QA 3BDPA 8ICGA 5J0RA 5KFOA 3B0YA 5KFCA 3V7LA 4GXJA 3HP6A 4FO6A 1ZQFA 8ICFA 4PH5A 2IHMA 9ICJA 2C28A 1ZQTA 2M9NA 2LYHA 2NRWA 3ZDCA 2FPLA 4QWDA 2PFPA 3V72A 1S0MA 1SL2A 2ZJAA 3M8SA 1S10A 2IMWP 1SL0A 3TAQA 2AGOA 1ZQRA 4UAWA 3M9MB 3PR5B 4M9JA 4UBBA 1A76A 5DQIA 3BQ2A 1T3NA 1MQ3A 1NJXA 4YXMA 1DGSA 9ICEA 3KHHA 3V7JA 4TQSA 4RPXA 1WCLA 4I2DA 2VA2A 5EOZA 5HHHA 5DDMA 4F93B 1K1QA 2HHSA 4RQ6A 5KTQA 4F4YA 4FS2A 5KFFA 1NKEA 4KLFA 1U47A 5KFMA 1QLNA 2AJQA 5DG7A 2H5XA 4DLEA 3NGDA 1NKCA 2WTFA 4DSFA 2V4RA 3EPGA 1BPYA 4M9GA 1ZQUA 4F5PA 7ICJA 3MR6A 2W9AA 4DL7A 1U49A 2MAXA 1UA0A 3ZDDA 4C8KA 3UPQA 2ATLA 3HPOA 4KLTA 3MBYA 3G6VA 5J2GA 4JUZA 3GIJA 4M0AA 4O3NA 1SKRA 2BCUA 3KTQA 1ZJNA 1HUZA 1UA1A 3T5KA 2PFQA 2FPKA 4YMOA 5CP2A 2J6SA 4PHPA 3JPSA 2XY6A 4C8OA 1TV9A 2NRTA 1ZQEA 3QEAZ 4DOAA 4TQRA 4J9RA 5KFGA 2R8KA 4ECSA 1ZQWA 4J9LA 3PW4A 1SL1A 2FLPA 7ICKA 9ICKA 3M8RA 1LB2B 1KFDA 1K1SA 4DS5A 4LZDA 3GFKB 4QWEA 2RDJA 4RZRA 7ICUA 2W8LA 1ZQLA 5EWFA 3AUOA 1T8EA 1ZQYA 4RQ1A 2ASDA 1HJPA 1ZQZA 4QZBA 4JWMA 4I2AA 9ICRA 1D8LA 1JXEA 3AU2A 5J2DA 2BCQA 3N97B 3OJUA 1NK0A 7ICNA 4QZIA 1XU4A 4QZHA 3V6JA 2R8IA 3Q8QB 3SV3A 2P6UA 5HHIA 3PNCA 1JXLA 4ECZA 4O0IA 4KLHA 4RQ2A 2MUTA 4DF8A 2Y1JA 1B22A 3H8SA 9ICOA 4O3RA 4PHEA 3UXPA 4DL6A 4ED2A 3ZDBA 2W9CA 1ZQCA 3C2LA 3TARA 1NJWA 1JX4A 1ZQNA 3JPNA 3TFSA 4F4ZA 1TVAA 1TK5A 3G6XA 1ZQVA 4IQUA 4JK1A 3TANA 4F8RA 4MEXA 4M9LA 2Q0ZX 1MQ2A 9ICIA 1S77D 8ICOA 5KG7A 5KG5A 5JUMA 3PV8A 2ZUBA 5BPCA 4RQ8A 2P6RA 1BVSA 2KZMA 4O5EA 4IQTA 1IM4A 1RXVA 2BCVA 1COOA 1MC8A 5BOMA 3PX6A 5KG0A 4EYHB 2ZUCA 4DOCA 2J6TA 4ECXA 4DQIA 2IBKA 4FBUA 4J9QA 5DQGA 5IINA 3RB6A 4LZGA 4FS1A 1T4GA 8ICEA 4TUSA 4EBCA 2ZJ5A 3GV7B 1TK8A 5HP4A 5DLFA 4IR9A 4F2SA 2A1JA 5KG3A 4TUQA 1XS9D 4F2RA 2HHTA 5KFTA 5J0WA 1ZQPA 3PVXA 2PFOA 1ZJMA 2HHXA 4NLGA 3T5HA 4DFMA 4B9TA 3OHAA 1S76D 5BOLA 3B0XA 5CJ7A 4B9SA 3KHGA 3RRGA 3C1ZA 4P4OA 3ISCA 3PMNA 7ICPA 4KN4A 2BKEA 3MDAA 3C5FA 3BQ1A 4I2FA 7ICVA 3H8JA 2F1JA 4DQQA 4JWNA 4M04A 4KLMA 3ZDEA 5DG8A 4YQWA 1B43A 8ICPA 5DDYA 3RH6A 1D9DA 4YD2A 2I1QA 4UB2A 5DB9A 4P4MA 5KT5A 4YP3A 2FMQA 2ISPA 4M6WB 2UVRA 4XQ8A 4RU9A 2BPFA 4ZH4A 4BXOA 3PR4A 3RB4A 1N56A 1XWLA 2F1HA 8ICIA 2BQ3A 2ZTCA 7ICFA 1JIHA 8ICLA 4I2BA 1SKSA 8ICNA 4DWIA 1L3UA 3PMLA 2DPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWE A;  5KFD A;  5KFY A;  5KFH A;  3RB3 A;  3QZ7 A;  2FLN A;  2IHN A;  5DBC A;  1UT5 A;  4KMU A;  2VA8 A;  5KG2 A;  4PGQ A;  2W9C B;  1RXW A;  1BPZ A;  1KRP A;  3RJH A;  5KFJ A;  1S0V A;  4ECQ A;  1KEJ A;  1ZQQ A;  2C2E A;  2BPG A;  4DEZ A;  5EWG A;  4QWA A;  4C8L A;  8ICX A;  3ETL A;  1ZYQ A;  8ICC A;  2R8G A;  3TI0 A;  2PXI A;  4DQR A;  4EZ9 A;  2JZB B;  8ICJ A;  5DQH A;  4LVS A;  2XCA A;  3ORY A;  4RQ0 A;  7ICO A;  5KFV A;  3C1Y A;  5HNK A;  3JPQ A;  4NXZ A;  4R8U B;  5L9X A;  4KLI A;  2HHQ A;  2AGQ A;  1A77 A;  3OSN A;  4KLS A;  5F9L A;  5KT6 A;  2KTQ A;  4NLK A;  8ICQ A;  4J9N A;  4PHA A;  1X9W A;  4I28 A;  1Y88 A;  5J0X A;  2FMS A;  4F4X A;  1S97 A;  4MEY A;  4IQV A;  9ICQ A;  4GLX A;  3C2M A;  3C21 A;  7ICE A;  9ICT A;  4KLO A;  7ICG A;  4F91 B;  3RJG A;  2ZTE A;  4DFK A;  1X9S A;  1D8Y A;  2XY5 A;  3H8W A;  4RPZ A;  2UVV A;  5J2H A;  3RJJ A;  3MR5 A;  4EZ6 A;  3OHB A;  1TKD A;  4GC7 A;  1UT8 A;  3M9N B;  4EEY A;  5KFL A;  3H40 A;  4F50 A;  5L1L A;  5J0U A;  5DB7 A;  3RBE A;  1SZP A;  4C8M A;  2BDP A;  1BPB A;  4B9M A;  1ZET A;  9ICL A;  1ZQA A;  9ICA A;  3GIM A;  2KZ3 A;  9ICH A;  4Q44 A;  4K4I A;  2ZJ8 A;  5J0Q A;  1U45 A;  1ZQH A;  2F1I A;  5KFP A;  4I2G A;  9ICB A;  1EXN A;  4RQ3 A;  1SKW A;  1X2I A;  3ZDA A;  3H4D A;  2XGP A;  3HX0 A;  3ZD8 A;  2W9B B;  8ICW A;  2B21 A;  3EYZ A;  1NK5 A;  5IIO A;  9ICU A;  4Z6F A;  5J2E A;  1KTQ A;  5KG1 A;  4FBT A;  2A1J B;  3EWA A;  3KHR A;  4ECR A;  4RNO A;  3QZ8 A;  3SZ2 A;  3GIL A;  1ZQB A;  1XC9 A;  2W8K A;  4F3O A;  5J2F A;  2HVH A;  5J2J A;  8ICT A;  1N48 A;  4F5R A;  4O9M A;  3PW2 A;  2ZUD A;  3N4M B;  4ED7 A;  1TFR A;  3MGI A;  3T5L A;  3RBD A;  1LV5 A;  1Z3E B;  4GXI A;  1NKB A;  1Z00 B;  3PO5 A;  1Z00 A;  3RAQ A;  4O3Q A;  3MFI A;  3MAB A;  4P4P A;  4J9O A;  3Q8K A;  4I29 A;  2DPJ A;  1H38 A;  3T3F A;  5DKW A;  4O5C A;  1KFS A;  4R65 A;  4F92 B;  1ARO P;  4XA5 A;  3V6H A;  7ICL A;  4MF8 A;  2BQR A;  2HHV A;  9ICC A;  4Z6D A;  3GIK A;  4Q45 A;  1XSN A;  3QE9 Y;  2Y1I A;  9ICS A;  4Z6C A;  4YR3 A;  5HMM A;  4RT3 A;  1RPL A;  5IIK A;  4PHD A;  3JPO A;  4DL3 A;  3TAP A;  1KLN A;  5J0P A;  1XSL A;  1QTM A;  2JEG A;  1NJY A;  3M9O B;  5J0T A;  1TK0 A;  4NY8 A;  5CHG A;  4B9U A;  1T7P A;  4DQP A;  4R66 A;  2BQU A;  3THV A;  7ICM A;  8ICU A;  2NRX A;  3FDS A;  2FLL A;  1S9F A;  3PW7 A;  4KLU A;  1ZQO A;  4PGY A;  1C7Y A;  3RTV A;  1RZT A;  2ALZ A;  4QZA A;  4UBC A;  7ICT A;  4QWC A;  5KFW A;  8ICZ A;  4DSL A;  4ECT A;  4RUC A;  4J9S A;  4RUA A;  1D9F A;  7ICI A;  4IR1 A;  3GII A;  8ICB A;  4PGX A;  9ICP A;  4KLQ A;  4E0D A;  3LWL A;  4B9V A;  4ELT A;  1ZQM A;  2NRV A;  5L1I A;  1NK4 A;  4IQW A;  5J0O A;  5KG4 A;  5CA7 A;  4ED0 A;  3C23 A;  4KLD A;  5KFB A;  4DL5 A;  2BR0 A;  9ICW A;  2C2R A;  4QZF A;  1X9M A;  3Q8M A;  2KZZ A;  4RT2 A;  2AQ4 A;  4UB1 A;  3RJI A;  4NM2 A;  4QZD A;  2XO7 A;  1JMS A;  2HW3 A;  4DFP A;  5KT7 A;  4O3S A;  2ZTD A;  9ICG A;  3KHL A;  5KFA A;  3OGU A;  2XY7 A;  2PFN A;  3K75 D;  3PX4 A;  1JN3 A;  4XUS A;  4R64 A;  2KN7 A;  4F4W A;  4NLZ A;  1XSP A;  1RYR A;  3MR3 A;  4DOB A;  3ISB A;  4GC6 A;  3GDX A;  8ICA A;  3E2E A;  3RH5 A;  9ICX A;  5KT2 A;  3JPR A;  4M47 A;  9ICM A;  4UAY A;  3OSP A;  4I2E A;  2BGW A;  4BXO B;  7ICR A;  4ELV A;  9ICF A;  7ICS A;  2BPC A;  7ICH A;  4YVZ A;  3HW8 A;  3ZD9 A;  5C5J A;  4M2Y A;  4KLE A;  5KFR A;  8ICS A;  4O3O A;  4BWJ A;  4YCX A;  5CWR A;  4DSE A;  2BCS A;  4PPX A;  5J2C A;  3RB0 A;  9ICN A;  1TAQ A;  1ZQD A;  5KFS A;  2GWS A;  4DL4 A;  4ELU A;  4UQG A;  2C2D A;  1NK8 A;  4RQ4 A;  4EYI B;  2P66 A;  4DFJ A;  5IIM A;  1HUO A;  1NK7 A;  2HHU A;  3BQT A;  2W9B A;  1NK6 A;  2PI5 A;  4HYK A;  5D46 A;  4JV1 A;  2KFN A;  3MFH A;  3BJY A;  2ASJ A;  4IRK A;  3UXO A;  2W9M A;  5J0S A;  3Q8R B;  1U9L A;  1CEZ A;  1ZQX A;  1ZQG A;  4ECY A;  2XCP A;  4B9N A;  3SI8 A;  3OJS A;  4QZG A;  3RJF A;  5CR0 A;  3UQ2 A;  4CCH A;  4UB5 A;  4UB3 A;  3HT3 A;  1MSW D;  5F9N A;  1BPX A;  4K4G A;  4ECV A;  3V7K A;  4EBD A;  7ICQ A;  4DSK A;  4QZC A;  4YD1 A;  3EPI A;  2MUT B;  1NOM A;  3BQ0 A;  4X5V A;  5DGA A;  4F4K A;  5J2A A;  4RPY A;  8ICM A;  2JEI A;  4C8N A;  4YG2 A;  3SV4 A;  4TUR A;  4ECW A;  3NTU A;  3T5J A;  4DSI A;  1TAU A;  1L3V A;  2R8J A;  4XRH A;  1S0O A;  3GQC A;  4Q8E A;  4J9P A;  3PO4 A;  4JV0 A;  3QEB Z;  2J6U A;  4RNM A;  5DGB A;  5III A;  3C2K A;  3HWT A;  5KFN A;  3LDA A;  4YMM A;  4KLL A;  4O5K A;  3V6K A;  1BPE A;  5J2K A;  1U4B A;  5KFI A;  8ICY A;  1XO1 A;  3IHQ B;  3UQ0 A;  4M9H A;  5KFQ A;  2HHW A;  5J29 A;  4DO9 A;  4ED1 A;  4IRC A;  4YR0 A;  5KG6 A;  2UVU A;  1CUK A;  4QW9 A;  2OWO A;  5IIJ A;  3LK9 A;  4KN7 A;  2XC9 A;  3RJK A;  5KFX A;  5DBB A;  4G3I A;  1PZN A;  4QZE A;  1KDH A;  4Q8F A;  4R63 A;  5TZV A;  1NJZ A;  5KFZ A;  4QW8 A;  1NK9 A;  1IXR A;  3RH4 A;  4NM1 A;  4RQ7 A;  2JEJ A;  4RNN A;  3RRH A;  1QSY A;  1QSL A;  2FPM A;  4TUP A;  3MR2 A;  4ECU A;  4DF4 A;  1KFT A;  2ISO A;  3Q8S B;  4F5O A;  1KSP A;  4ED8 A;  3IM1 A;  1BGX T;  2IA6 A;  4NLN A;  4JV2 A;  3TFR A;  5KT3 A;  4EBE A;  1RYS A;  1L3T A;  4IRD A;  4UAZ A;  4K4H A;  4DQS A;  3UXN A;  2C22 A;  2RDI A;  1U48 A;  5KFU A;  1QSS A;  4I27 A;  4Z6E A;  4YXJ A;  5CB1 A;  2HVI A;  4ED3 A;  4GXK A;  5D49 A;  1L5U A;  3RR7 A;  5D4B A;  2ASL A;  1ZQS A;  4I2I A;  4O3P A;  1S0N A;  4P2H A;  4M6W A;  4DLG A;  4DS4 A;  5L1J A;  4BWM A;  5KT4 A;  3MGH A;  4BGD A;  5L1K A;  3MDC A;  4M9N A;  4B9L A;  3FYH A;  3RAX A;  5DG9 A;  1ZQJ A;  5HML A;  3SYZ A;  3PW0 A;  2PI4 A;  3Q8L A;  4Q43 A;  4UB4 A;  2BHN A;  4KIT B;  5DB6 A;  5DB8 A;  2AGP A;  2VA3 A;  4MFC A;  3PX0 A;  2R8H A;  1L3S A;  2UVW A;  2KFZ A;  2JEF A;  2BCR A;  5KFK A;  4F5N A;  2I9G A;  4MF2 A;  4KLJ A;  2XGQ A;  4ED6 A;  2VAN A;  4I2J A;  5J2B A;  4DL2 A;  3JPP A;  8ICK A;  9ICV A;  4KLG A;  4YR2 A;  3ISD A;  2NRZ A;  4BDP A;  4DSJ A;  1DOQ A;  5DLG A;  3GV5 B;  2JZB A;  5DBA A;  3H4B A;  3PY8 A;  4YFK A;  3EW9 A;  4J9M A;  5KFE A;  3LWM A;  3TQ1 A;  4YN4 A;  4J9K A;  4QZ8 A;  5J2I A;  2AU0 A;  4I2H A;  3G6Y A;  3JPT A;  4I2C A;  2AQ0 A;  2DFL A;  2V4Q A;  1V9P A;  8ICH A;  8ICR A;  1ZQI A;  3AU6 A;  2V9W A;  3RR8 A;  1WCN A;  4MFA A;  4RQ5 A;  3Q8P B;  4KTQ A;  5IIL A;  4QWB A;  1BPD A;  2FMP A;  4QZ9 A;  4MFF A;  1ZQK A;  8ICV A;  3PW5 A;  3EZ5 A;  3K4G A;  4YMN A;  3H7I A;  4R8U A;  3RJE A;  3C5G A;  3GV8 B;  5J0Y A;  4F5Q A;  3BDP A;  8ICG A;  5J0R A;  5KFO A;  3B0Y A;  5KFC A;  3V7L A;  4GXJ A;  3HP6 A;  4FO6 A;  1ZQF A;  8ICF A;  4PH5 A;  2IHM A;  9ICJ A;  2C28 A;  1ZQT A;  2M9N A;  2LYH A;  2NRW A;  3ZDC A;  2FPL A;  4QWD A;  2PFP A;  3V72 A;  1S0M A;  1SL2 A;  2ZJA A;  3M8S A;  1S10 A;  2IMW P;  1SL0 A;  3TAQ A;  2AGO A;  1ZQR A;  4UAW A;  3M9M B;  3PR5 B;  4M9J A;  4UBB A;  1A76 A;  5DQI A;  3BQ2 A;  1T3N A;  1MQ3 A;  1NJX A;  4YXM A;  1DGS A;  9ICE A;  3KHH A;  3V7J A;  4TQS A;  4RPX A;  1WCL A;  4I2D A;  2VA2 A;  5EOZ A;  5HHH A;  5DDM A;  4F93 B;  1K1Q A;  2HHS A;  4RQ6 A;  5KTQ A;  4F4Y A;  4FS2 A;  5KFF A;  1NKE A;  4KLF A;  1U47 A;  5KFM A;  1QLN A;  2AJQ A;  5DG7 A;  2H5X A;  4DLE A;  3NGD A;  1NKC A;  2WTF A;  4DSF A;  2V4R A;  3EPG A;  1BPY A;  4M9G A;  1ZQU A;  4F5P A;  7ICJ A;  3MR6 A;  2W9A A;  4DL7 A;  1U49 A;  2MAX A;  1UA0 A;  3ZDD A;  4C8K A;  3UPQ A;  2ATL A;  3HPO A;  4KLT A;  3MBY A;  3G6V A;  5J2G A;  4JUZ A;  3GIJ A;  4M0A A;  4O3N A;  1SKR A;  2BCU A;  3KTQ A;  1ZJN A;  1HUZ A;  1UA1 A;  3T5K A;  2PFQ A;  2FPK A;  4YMO A;  5CP2 A;  2J6S A;  4PHP A;  3JPS A;  2XY6 A;  4C8O A;  1TV9 A;  2NRT A;  1ZQE A;  3QEA Z;  4DOA A;  4TQR A;  4J9R A;  5KFG A;  2R8K A;  4ECS A;  1ZQW A;  4J9L A;  3PW4 A;  1SL1 A;  2FLP A;  7ICK A;  9ICK A;  3M8R A;  1LB2 B;  1KFD A;  1K1S A;  4DS5 A;  4LZD A;  3GFK B;  4QWE A;  2RDJ A;  4RZR A;  7ICU A;  2W8L A;  1ZQL A;  5EWF A;  3AUO A;  1T8E A;  1ZQY A;  4RQ1 A;  2ASD A;  1HJP A;  1ZQZ A;  4QZB A;  4JWM A;  4I2A A;  9ICR A;  1D8L A;  1JXE A;  3AU2 A;  5J2D A;  2BCQ A;  3N97 B;  3OJU A;  1NK0 A;  7ICN A;  4QZI A;  1XU4 A;  4QZH A;  3V6J A;  2R8I A;  3Q8Q B;  3SV3 A;  2P6U A;  5HHI A;  3PNC A;  1JXL A;  4ECZ A;  4O0I A;  4KLH A;  4RQ2 A;  2MUT A;  4DF8 A;  2Y1J A;  1B22 A;  3H8S A;  9ICO A;  4O3R A;  4PHE A;  3UXP A;  4DL6 A;  4ED2 A;  3ZDB A;  2W9C A;  1ZQC A;  3C2L A;  3TAR A;  1NJW A;  1JX4 A;  1ZQN A;  3JPN A;  3TFS A;  4F4Z A;  1TVA A;  1TK5 A;  3G6X A;  1ZQV A;  4IQU A;  4JK1 A;  3TAN A;  4F8R A;  4MEX A;  4M9L A;  2Q0Z X;  1MQ2 A;  9ICI A;  1S77 D;  8ICO A;  5KG7 A;  5KG5 A;  5JUM A;  3PV8 A;  2ZUB A;  5BPC A;  4RQ8 A;  2P6R A;  1BVS A;  2KZM A;  4O5E A;  4IQT A;  1IM4 A;  1RXV A;  2BCV A;  1COO A;  1MC8 A;  5BOM A;  3PX6 A;  5KG0 A;  4EYH B;  2ZUC A;  4DOC A;  2J6T A;  4ECX A;  4DQI A;  2IBK A;  4FBU A;  4J9Q A;  5DQG A;  5IIN A;  3RB6 A;  4LZG A;  4FS1 A;  1T4G A;  8ICE A;  4TUS A;  4EBC A;  2ZJ5 A;  3GV7 B;  1TK8 A;  5HP4 A;  5DLF A;  4IR9 A;  4F2S A;  2A1J A;  5KG3 A;  4TUQ A;  1XS9 D;  4F2R A;  2HHT A;  5KFT A;  5J0W A;  1ZQP A;  3PVX A;  2PFO A;  1ZJM A;  2HHX A;  4NLG A;  3T5H A;  4DFM A;  4B9T A;  3OHA A;  1S76 D;  5BOL A;  3B0X A;  5CJ7 A;  4B9S A;  3KHG A;  3RRG A;  3C1Z A;  4P4O A;  3ISC A;  3PMN A;  7ICP A;  4KN4 A;  2BKE A;  3MDA A;  3C5F A;  3BQ1 A;  4I2F A;  7ICV A;  3H8J A;  2F1J A;  4DQQ A;  4JWN A;  4M04 A;  4KLM A;  3ZDE A;  5DG8 A;  4YQW A;  1B43 A;  8ICP A;  5DDY A;  3RH6 A;  1D9D A;  4YD2 A;  2I1Q A;  4UB2 A;  5DB9 A;  4P4M A;  5KT5 A;  4YP3 A;  2FMQ A;  2ISP A;  4M6W B;  2UVR A;  4XQ8 A;  4RU9 A;  2BPF A;  4ZH4 A;  4BXO A;  3PR4 A;  3RB4 A;  1N56 A;  1XWL A;  2F1H A;  8ICI A;  2BQ3 A;  2ZTC A;  7ICF A;  1JIH A;  8ICL A;  4I2B A;  1SKS A;  8ICN A;  4DWI A;  1L3U A;  3PML A;  2DPI A; 
#chains in the Genus database with same CATH topology
 3HRD D;  5EE0 A;  5DBC A;  4PGQ A;  3RF9 A;  2WF5 A;  1KRP A;  4FE3 A;  5KFJ A;  2QB1 A;  2LYB A;  3F5E A;  8ICC A;  2EDU A;  1A6S A;  3TI0 A;  4Y2S A;  2JZB B;  8ICJ A;  4LVS A;  1V85 A;  2B0C A;  2O6K A;  5KFV A;  3JPQ A;  4KLI A;  5L9X A;  3QXG A;  1WUD A;  1UCV A;  5KT6 A;  4J9N A;  4PHA A;  3WKD A;  3C2M A;  3C21 A;  7ICG A;  2ZTE A;  1D8Y A;  2E1E A;  5J2H A;  4FZL A;  1NZB A;  3OHB A;  1TKD A;  1UT8 A;  3M9N B;  4EEY A;  3PZP A;  5AK3 A;  5KFL A;  4B9T A;  5L1L A;  5DB7 A;  4C8M A;  3O0F A;  1BPB A;  9ICA A;  4QNL A;  4Q44 A;  4K4I A;  1U45 A;  4NJ8 A;  9ICB A;  3NVY A;  1SKW A;  2XGP A;  5AI4 A;  4OJ5 A;  3EYZ A;  4Z6F A;  5ALM A;  2Z7J A;  4FBT A;  2WAQ C;  3QZ8 A;  1XC9 A;  4F3O A;  1JRP A;  1Q8K A;  3N4M B;  1TFR A;  3MGI A;  1NKB A;  1Z00 A;  3MFI A;  3MAB A;  4J9O A;  2A19 A;  2K4E A;  5KAF U;  4I29 A;  1H38 A;  1IV8 A;  4XA5 A;  2LHT A;  2LM4 A;  1KLN A;  4RT3 A;  1RPL A;  5J0P A;  4B9U A;  7ICM A;  2E8O A;  3THV A;  5EE9 A;  2NRX A;  1N5W A;  3FDS A;  2FLL A;  2RP5 A;  4KLU A;  1C7Y A;  1RZT A;  2ALZ A;  2KMD A;  4UBC A;  4DSL A;  4ECT A;  5KL8 B;  4B9V A;  4ELT A;  1NK4 A;  3QUC A;  4ED0 A;  9ICW A;  5KFB A;  2BR0 A;  2W03 A;  1X9M A;  2KZZ A;  2Q4T A;  4RT2 A;  4UB1 A;  3RJI A;  4NM2 A;  4RQN A;  2XO7 A;  2HW3 A;  4O3S A;  1L8L A;  2QB0 B;  2XY7 A;  4NLZ A;  3OTQ A;  3ISB A;  4GC6 A;  3GDX A;  2WF6 A;  3L5K A;  4M47 A;  4BUG A;  4UAY A;  3D2N A;  4BXO B;  7ICH A;  3LYS A;  3LVV A;  2BCS A;  9ICN A;  1TAQ A;  4NWI A;  5KFS A;  2GWS A;  4UQG A;  2C2D A;  2KVC A;  5IIM A;  2NO5 A;  3BQT A;  4HYK A;  2KK0 A;  2YMP A;  4JV1 A;  3MFH A;  3L4P A;  2ASJ A;  4IRK A;  1X40 A;  5J0S A;  1U9L A;  1CEZ A;  1ZQX A;  2W04 A;  5TIS U;  1ZQG A;  3F5A A;  3RJF A;  5T14 A;  3UQ2 A;  1Z1B A;  3AMZ A;  1MSW D;  5F9N A;  1BPX A;  4YD1 A;  1XO0 A;  4F4K A;  2A1A A;  2YB4 A;  4UW9 A;  3SV4 A;  4DSI A;  3N28 A;  2HBM A;  5AKX A;  3ALR A;  5III A;  3C2K A;  3LDA A;  4KLL A;  2KIC A;  3V6K A;  5AKK A;  2KNJ A;  4P0Q A;  1FO4 A;  1TE2 A;  2YY6 A;  1CUK A;  2KHV A;  1SV0 A;  5KFX A;  2KEY A;  1KDH A;  4R63 A;  5AK5 A;  5KFZ A;  3RH4 A;  2JEJ A;  4RNN A;  1QSY A;  2KOB A;  3MR2 A;  1KFT A;  3QNM A;  1KSP A;  2LM1 A;  4ED8 A;  3T79 A;  1BGX T;  4CF3 A;  4Y2V A;  2NYV A;  1RYS A;  1L3T A;  4UAZ A;  1U48 A;  2WF7 A;  5D49 A;  2KIV A;  5AM2 A;  2ASL A;  4I2I A;  1GO3 F;  4DLG A;  3QX7 A;  3SAG A;  3FYH A;  1ZQJ A;  5HML A;  4FZN A;  3SYZ A;  4Q43 A;  3M7D A;  4ACO A;  5DB6 A;  5DB8 A;  5K4L A;  2F2A B;  2R8H A;  2UVW A;  2PMZ C;  2I9G A;  4MF2 A;  2AH5 A;  3A0B U;  4ED6 A;  4I2J A;  8ICK A;  9ICV A;  1L6N A;  2XVT A;  2DWQ A;  4UB6 U;  4BDP A;  1DOQ A;  1DRG A;  4CF4 A;  5DBA A;  1SZH A;  3PY8 A;  4J9M A;  3TQ1 A;  1LKY A;  4YN4 A;  5AHX A;  4QZ8 A;  2AU0 A;  3G6Y A;  2HOQ A;  2DFL A;  8ICH A;  1WWV A;  8ICR A;  3QU9 A;  2V9W A;  1WCN A;  4QWB A;  1BPD A;  4QZ9 A;  3BZK A;  3WKA A;  3PW5 A;  3NRZ A;  3GV8 B;  2DKX A;  4PH5 A;  9ICJ A;  2C28 A;  4AYB F;  2LYH A;  2FPL A;  3V72 A;  1S0M A;  4P0P A;  5AM0 A;  5ALF A;  2IMW P;  1XNS A;  2K8C B;  2AGO A;  1A76 A;  3BQ2 A;  4YXM A;  2W54 A;  3KHH A;  1SV0 C;  1WCL A;  4RPX A;  2VA2 A;  5DDM A;  4WJ3 B;  3H0L B;  2HHS A;  4RQ6 A;  4F4Y A;  4FS2 A;  2W7P A;  1NKE A;  3N7S C;  2W3S A;  4IS7 A;  9ICI A;  1DK3 A;  1KQQ A;  4DSF A;  3EPG A;  1BPY A;  4QIW F;  7ICJ A;  2W9A A;  1U49 A;  5AKJ A;  5ALH A;  4M0A A;  1SKR A;  2JMG A;  3T5K A;  3R9K A;  3I76 A;  2XY6 A;  2EAM A;  4UAT A;  2D6F C;  5AM4 A;  1NNL A;  5KFG A;  2QAR A;  1ZQW A;  4ECS A;  3PW4 A;  4NLC A;  7ICK A;  1Q3U A;  1K1S A;  4DS5 A;  1DXS A;  1ZQY A;  1ZQZ A;  1D8L A;  1JXE A;  3H0M B;  2BCQ A;  1L7N A;  3OJU A;  4QZI A;  2CN1 A;  2XIC A;  5JU5 A;  4KLH A;  1B22 A;  2Y1J A;  1QQ5 A;  2KKP A;  9ICO A;  5ALE A;  2HBL A;  4ED2 A;  3ZDB A;  1ZQC A;  1ZQN A;  4F8R A;  1RDF A;  2Q0Z X;  8ICO A;  4RQ8 A;  2KZM A;  4O5E A;  2QLT A;  2ZG6 A;  5KG0 A;  4UAR A;  3L3F X;  4J9Q A;  4LZG A;  1MN8 A;  1T4G A;  4TUS A;  3UMB A;  3GV7 B;  1TK8 A;  3BQ7 A;  5DLF A;  1XS9 D;  2BDU A;  2DBY A;  2HHX A;  2PFO A;  3T5H A;  2G06 A;  1CRX A;  5BOL A;  3B0X A;  5CJ7 A;  4P0P B;  2BKE A;  3MDA A;  3C5F A;  2HOI A;  1TAM A;  4KLM A;  4M04 A;  1B43 A;  2BZF A;  5DB9 A;  2H3F A;  3QUB A;  3SMV A;  2FMQ A;  4RU9 A;  3WKE A;  4BXO A;  5ALK A;  4EEK A;  4UAS A;  1P7D A;  3FC4 A;  2ZTC A;  1FEZ A;  1JIH A;  7ICF A;  2VJ5 A;  8ICB A;  5KFD A;  5KFY A;  5KFH A;  3QZ7 A;  1UT5 A;  1S0V A;  4ECQ A;  1ZQQ A;  4QWA A;  4C8L A;  8ICX A;  3H0R B;  4DQR A;  2XCA A;  5JRT A;  2KIW A;  4RQ0 A;  3C1Y A;  5HNK A;  2HHQ A;  2HSZ A;  4KLS A;  3MC1 A;  5AM5 A;  3QU5 A;  1X9W A;  5J0X A;  1S97 A;  3QUQ A;  1ZD4 A;  4KLO A;  2ZIW A;  4DFK A;  2JH7 A;  2XY5 A;  4RPZ A;  2UVV A;  1B0X A;  2D3D A;  1X6J A;  3NUQ A;  2LPE A;  3CNH A;  9ICL A;  1X66 A;  5J8Y A;  3GIM A;  4F72 A;  4FFD A;  1SB3 C;  2ZJ8 A;  5KFP A;  3B9J A;  1X9X A;  1X2I A;  3H4D A;  4Y2U A;  2K60 A;  2FDR A;  2DUY A;  1NK5 A;  9ICU A;  4RQM A;  5J2E A;  3KOO A;  4BX9 C;  1KTQ A;  5KG1 A;  2E3T A;  2LYA A;  3GU3 A;  5FP0 A;  3PSP A;  3HIL A;  1SIJ A;  8ICT A;  1N48 A;  2ZUD A;  1LV5 A;  4GXI A;  1Z00 B;  3IRU A;  4O3Q A;  4NLB A;  1ED1 A;  2F44 A;  1KFS A;  3AQE A;  4MF8 A;  3UMG A;  1JI7 A;  2ZIV A;  2RQ5 A;  4Q45 A;  3QE9 Y;  2Y1I A;  4Z6C A;  3TAP A;  5AKI A;  3JPO A;  5B66 U;  1XSL A;  1NJY A;  1KL9 A;  4KX5 A;  1F5S A;  1S9F A;  3PW7 A;  1ZQO A;  4PGY A;  4UB8 U;  3RTV A;  4JMU A;  1J97 A;  4QWC A;  8ICZ A;  4RUA A;  1D9F A;  3GII A;  9ICP A;  4J03 A;  1N2X A;  2KSO B;  1JUD A;  5KG4 A;  1ZD2 P;  1F44 A;  1PK1 A;  4EX6 A;  1JMS A;  5ALW A;  4DFP A;  5KFA A;  3OGU A;  2E8N A;  3K75 D;  1JN3 A;  4R64 A;  2KN7 A;  4AP9 A;  1J2M A;  4DOB A;  1NI3 A;  4GFJ A;  3E2E A;  9ICX A;  3QU2 A;  5KT2 A;  2G5I B;  2KG5 A;  2BGW A;  7ICR A;  4G9B A;  3HW8 A;  5CWR A;  5J2C A;  2GOL A;  1SXE A;  3RB0 A;  4ELU A;  4PZN A;  1UQV A;  5D46 A;  2KFN A;  3BJY A;  3UXO A;  3Q8R B;  3KKA C;  4A8E A;  4ECY A;  4O3M A;  3HT3 A;  3HJE A;  3V7K A;  3SQI A;  4QZC A;  2MUT B;  1NOM A;  4X5V A;  3BS7 A;  1ZD3 A;  2JXJ A;  4RPY A;  8ICM A;  2G07 A;  4PL1 A;  4ECW A;  4TUR A;  3WK4 A;  3NTU A;  2R8J A;  1S0O A;  4Q8E A;  4J9P A;  3PO4 A;  2J6U A;  4RNM A;  5DGB A;  1COK A;  5KFN A;  4O5K A;  1DGJ A;  8ICY A;  1QCK A;  5J29 A;  4DO9 A;  4KN7 A;  2XC9 A;  5DBB A;  4C4S A;  4Q8F A;  5AI5 A;  3SD7 A;  1IXR A;  2FPM A;  4TUP A;  2ISO A;  4OCZ A;  3IM1 A;  2IA6 A;  3TFR A;  4EBE A;  3UXN A;  2RDI A;  2OHF A;  5HR6 A;  4GXK A;  1L5U A;  3RR7 A;  4O3P A;  1S0N A;  5AKL A;  5L1K A;  5DG9 A;  3Q8L A;  2FE9 A;  4UB4 A;  2EAO A;  3BS5 B;  2AGP A;  4MFC A;  3PX0 A;  3WKC A;  3SR6 A;  5ALG A;  4U6P A;  5KFK A;  4F5N A;  5KL1 B;  3NVV A;  2R18 A;  5AIB A;  5J2B A;  3JPP A;  4YR2 A;  3GV5 B;  3H4B A;  3C28 A;  3EW9 A;  5KFE A;  5ALJ A;  3WK7 A;  4OD0 A;  5GTH U;  3JPT A;  2AQ0 A;  2WB1 F;  4Y2T A;  3Q8P B;  4KTQ A;  3PSI A;  3HKZ C;  3ONN A;  3H7I A;  3RJE A;  3NS1 A;  4GXJ A;  4FO6 A;  3B0Y A;  2E5S A;  5KFO A;  1VDV A;  3HP6 A;  8ICF A;  1ZQT A;  2M9N A;  1OW5 A;  1Z4N A;  2KJ8 A;  1S10 A;  4UAW A;  3PR5 B;  4M9J A;  4UBB A;  1NJX A;  3V7J A;  4TQS A;  2JV3 A;  1K1Q A;  5AK6 A;  1QLN A;  2AJQ A;  5DG7 A;  3NGD A;  1NKC A;  2WTF A;  4F5P A;  2PMZ F;  2ATL A;  4KLT A;  3G6V A;  3GIJ A;  3K1Z A;  4O3N A;  2BCU A;  3KTQ A;  1HUZ A;  4YMO A;  2YX8 A;  1D8B A;  4NL9 C;  2CRX A;  2NRT A;  2WF8 A;  3QEA Z;  4J9R A;  2FLP A;  4PL2 A;  1KFD A;  5EE1 A;  4QWE A;  5HR7 A;  3WK5 A;  5EWF A;  4RQ1 A;  9ICR A;  5J2D A;  3N97 B;  1NK0 A;  2K8B B;  4QZH A;  2P6U A;  3F2B A;  3PNC A;  2NV3 A;  4ECZ A;  4RQ2 A;  2N1R A;  3UXP A;  2PKE A;  3C2L A;  1JX4 A;  3AN1 A;  3JPN A;  1TVA A;  1TK5 A;  3TAN A;  4M9L A;  3VCB A;  1PVP A;  5JTI A;  5BPC A;  1O08 A;  2P6R A;  1BVS A;  2BCV A;  3PX6 A;  2YTU A;  4DOC A;  1PUZ A;  2H3I A;  2IBK A;  4FBU A;  5IIN A;  2KSO A;  5F3X B;  2IOH A;  5G5G A;  1URJ A;  4IR9 A;  5KFT A;  5J0W A;  3PVX A;  1ZJM A;  5AKY A;  4NLG A;  3D2S A;  5ALD A;  3WK6 A;  2ODG A;  2EH9 A;  3NVZ A;  7ICP A;  4P4O A;  2HBK A;  3ISC A;  4KN4 A;  2OYY A;  7ICV A;  3H8J A;  2F1J A;  4JWN A;  3ZDE A;  5DG8 A;  5DDY A;  3UM9 A;  1RM6 C;  4US8 A;  4UB2 A;  1ZRM A;  2RRD A;  4YP3 A;  2JHD A;  2BPF A;  3M1Y A;  3RFA A;  1J2N A;  3PR4 A;  3RB4 A;  2WF9 A;  8ICL A;  4I2B A;  2DPI A;  5EWE A;  2W9C B;  1RXW A;  4CRX A;  2BPG A;  2G09 A;  4IL6 U;  1LKY B;  5EWG A;  3ETL A;  2JGA A;  3KFU F;  5A0L A;  2R8G A;  2PXI A;  4C7Y A;  4Y2Y A;  1JRO A;  3UMC A;  5ALR A;  3IG8 A;  1OXJ A;  4NXZ A;  1A77 A;  3OSN A;  3IDW A;  4LJX A;  5F9L A;  3AL0 B;  2KTQ A;  4I28 A;  2FMS A;  4F4X A;  4IQV A;  2EAP A;  4GLX A;  7ICE A;  3VC8 A;  2VIX A;  3RJG A;  1X9S A;  4FZM A;  3RJJ A;  4EZ6 A;  1KBU A;  4F50 A;  5J0U A;  2BDP A;  4B9M A;  1WWU A;  1ZQ1 C;  5ALQ A;  5J0Q A;  1SWW A;  4I2G A;  1UPH A;  2WHE A;  2DGZ A;  3ZDA A;  2H3Z A;  5ALP A;  4OJ6 A;  3AQF A;  8ICW A;  2B21 A;  4EEN A;  5AKG A;  2W3R A;  2GLE A;  3EWA A;  3ED5 A;  2IOF A;  3SZ2 A;  3GIL A;  1ZQB A;  1KW4 A;  2W8K A;  3AEV A;  3CP8 A;  3RBD A;  4B6J A;  3RAQ A;  4Y2X A;  2DPJ A;  4O5C A;  5CRX A;  2VJ4 A;  4F92 B;  2XID A;  2AHO B;  7ICL A;  4QIW C;  4Z6D A;  3GIK A;  9ICS A;  2KJ5 A;  5HMM A;  2JEG A;  3M9O B;  5J0T A;  4NY8 A;  4C4T A;  4R66 A;  5AIC A;  3SAF A;  4QZA A;  5KFW A;  5KNI A;  4RUC A;  3E0F A;  7ICI A;  4IR1 A;  3TKA A;  3CW2 C;  5L1I A;  4IQW A;  3EUB 2;  1NZP A;  4KLD A;  3C23 A;  3Q8M A;  2AQ4 A;  2K8A A;  3M6K A;  5KT7 A;  9ICG A;  3KHL A;  2PFN A;  5AI8 A;  3PX4 A;  4XUS A;  4F4W A;  3ETR A;  1PVR A;  4P0Q B;  3DV9 A;  1N63 A;  3QYP A;  1Q3V A;  4PJ0 U;  9ICM A;  3OSP A;  9ICF A;  2F3N A;  4U7C A;  2G0A A;  2BPC A;  3IG5 A;  4EEL A;  3ZD9 A;  4O3O A;  4DSE A;  2LMR A;  4PPX A;  2YMM A;  1NK8 A;  4OJP A;  3FAH A;  1Z1V A;  4RQ4 A;  1SV4 A;  4EYI B;  2P66 A;  3QU7 A;  2EAN A;  5AM3 A;  5B5E U;  2HHU A;  1NK6 A;  1C20 A;  4UAU A;  2A3V A;  3ZI4 A;  3SI8 A;  2WFA A;  4QZG A;  4AYB C;  4CCH A;  2MU2 A;  1Z19 A;  1FIQ A;  4C80 A;  4ECV A;  3C29 A;  4MHV A;  1QQ7 A;  1QH9 A;  3HKZ F;  2WB1 C;  2XI9 A;  5J2A A;  4OO1 J;  1K5O A;  2JEI A;  4C8N A;  1TAU A;  1L3V A;  4XRH A;  3IV6 A;  1N62 A;  4JV0 A;  3QEB Z;  4US9 A;  4YMM A;  1BPE A;  4CDG A;  5J2K A;  1U4B A;  5KFI A;  1ZXI A;  3IHQ B;  4M9H A;  2ZIW B;  5AKE A;  5KFQ A;  4ED1 A;  3KD3 A;  5KG6 A;  1PZN A;  4QZE A;  2DF4 B;  1NJZ A;  5ALV A;  1NK9 A;  1QSL A;  2P35 A;  4ECU A;  4DF4 A;  3WK8 A;  4C4R A;  2I6X A;  4F5O A;  5ALT A;  2G08 A;  1X6I A;  4NLN A;  4JV2 A;  5KT3 A;  2K4P A;  4IRD A;  4K4H A;  2C22 A;  5AKH A;  4JB3 A;  5KFU A;  4I27 A;  3S6J A;  4YXJ A;  2DKZ A;  5CB1 A;  2HVI A;  4ED3 A;  4M6W A;  1YZ7 A;  4ZOH C;  5L1J A;  5KT4 A;  4B9L A;  1SWV A;  5EE3 A;  1A0P A;  1DK2 A;  3KKA A;  2KFZ A;  2VA3 A;  2JEF A;  2BCR A;  3WU2 U;  4KLJ A;  2XGQ A;  4KLG A;  2ZIV B;  2NRZ A;  4QJF B;  2HI0 A;  2Y0S C;  2JZB A;  2ZXH A;  4YFK A;  3LWM A;  4J9K A;  2D8C A;  2JH1 A;  4I2C A;  2YML A;  2OCE A;  3AU6 A;  3RR8 A;  4MFA A;  4RQ5 A;  1WYG A;  8ICV A;  1ZQK A;  3K4G A;  8ICG A;  2JRZ A;  2W55 A;  5J0Y A;  4F5Q A;  3BDP A;  5J0R A;  1VLB A;  2IHM A;  3ZDC A;  2PFP A;  4GIB A;  3FM9 A;  2ZJA A;  3M8S A;  3TAQ A;  1BNO A;  3M9M B;  2EZX A;  2ZIX A;  5G5H A;  2F8K A;  4I2D A;  5EOZ A;  1L7P A;  1ZOL A;  5KFM A;  3F2D A;  4Y2Q A;  2V4R A;  2EQY A;  1FFU A;  2MAX A;  1UA0 A;  2F76 X;  4JUZ A;  2ZXI A;  1ZJN A;  2FPK A;  5CP2 A;  1JAL A;  2J6S A;  4C8O A;  2HCF A;  2R8K A;  4CE6 A;  4USA A;  9ICK A;  1PK3 A;  3M8R A;  4LZD A;  2KP7 A;  2RDJ A;  7ICU A;  3AUO A;  4JWM A;  1KKX A;  2W11 A;  1RQN A;  1XU4 A;  3Q8Q B;  3SAH A;  2QB0 A;  5HHI A;  1M6Y A;  1JXL A;  2MUT A;  3H8S A;  4O3R A;  4DL6 A;  3SEI A;  4F4Z A;  3G6X A;  1ZQV A;  4IQU A;  2FJ6 A;  2Y9U A;  5AI0 A;  1N60 A;  2KVS A;  5JUM A;  3PV8 A;  2ZUB A;  1MA7 A;  5AKZ A;  4IQT A;  1IM4 A;  1HIW A;  1COO A;  5BOM A;  2ES6 A;  5AI6 A;  2E1F A;  2ZUC A;  2J6T A;  4ECX A;  3RB6 A;  2YN4 A;  8ICE A;  4EBC A;  2ZJ5 A;  2IOF K;  5HP4 A;  4F2S A;  2A1J A;  4F2R A;  3ICX A;  4CNQ A;  3OHA A;  4F71 A;  4CF5 A;  4B9S A;  3PMN A;  3IN5 A;  2HOF A;  8ICP A;  2OM6 A;  2ZIX B;  2DQN B;  1D9D A;  4YD2 A;  2KV2 A;  4P4M A;  5KT5 A;  2ISP A;  4XQ8 A;  4ZH4 A;  2HMX A;  1N56 A;  1XWL A;  8ICI A;  2BQ3 A;  2OXO A;  3RRG A;  4M9N A;  4C7Z A;  3RB3 A;  2FLN A;  2IHN A;  4KMU A;  2VA8 A;  5KG2 A;  1BPZ A;  3RJH A;  1KEJ A;  2C2E A;  4DEZ A;  2L5Y A;  5ALX A;  1ZYQ A;  4Y2J A;  3D2Q A;  2OH2 A;  4EZ9 A;  5DQH A;  1BNP A;  3ORY A;  2DL0 A;  1L8O A;  7ICO A;  3PST A;  4R8U B;  2AGQ A;  2E8M A;  2W43 A;  4NLK A;  8ICQ A;  3U26 A;  3N7P D;  1Y88 A;  1V97 A;  1RQL A;  1PK1 B;  4MEY A;  3H8M A;  1PVQ A;  9ICQ A;  9ICT A;  5AIA A;  4F91 B;  3KZI U;  3H8W A;  2KKV A;  3MR5 A;  4GC7 A;  3SEN A;  3OPX A;  3H40 A;  4Y2R A;  2K4I A;  2YMQ A;  3I1Y A;  3RBE A;  1SZP A;  3TAD A;  1ZET A;  1ZQA A;  2KZ3 A;  9ICH A;  1L7M A;  3WK9 A;  5ALS A;  4DFD A;  1ZQH A;  2F1I A;  1EXN A;  5C0Y A;  5AM1 A;  2HDO A;  4RQ3 A;  2KE7 A;  1VJ5 A;  3HX0 A;  3ZD8 A;  2W9B B;  5IIO A;  2A1J B;  3KHR A;  5L1M A;  4ECR A;  4RNO A;  5J2F A;  2HVH A;  5J2J A;  4F5R A;  4O9M A;  3PW2 A;  4C0Z A;  4ED7 A;  2YB1 A;  3T5L A;  1AQ6 A;  1Z3E B;  5ALZ A;  3PO5 A;  5GTI U;  4P4P A;  3Q8K A;  3T3F A;  2H3Q A;  5DKW A;  4R65 A;  4CGZ A;  1ARO P;  3V6H A;  2BQR A;  2HHV A;  9ICC A;  2F8L A;  1XSN A;  1YZ6 A;  4YR3 A;  1RYU A;  4OJL A;  4DL3 A;  5IIK A;  4PHD A;  1QTM A;  1TK0 A;  3KZX A;  5CHG A;  1SXD A;  3F53 A;  1T7P A;  4DQP A;  2BQU A;  4Y2P A;  8ICU A;  2EZZ A;  2F77 X;  2ESE A;  7ICT A;  4J9S A;  4PGX A;  4KLQ A;  4E0D A;  3LWL A;  1ZQM A;  1O03 A;  2NRV A;  1CI4 A;  5J0O A;  5CA7 A;  4DL5 A;  2C2R A;  4QZF A;  1SGG A;  4QZD A;  3AM9 A;  2ZTD A;  2W7O A;  1XSP A;  1RYR A;  3MR3 A;  3CRX A;  8ICA A;  5H2F U;  3RH5 A;  1ZD5 A;  3JPR A;  5J8Y C;  4I2E A;  4ELV A;  5AK4 A;  7ICS A;  4YVZ A;  1WG8 A;  5C5J A;  4M2Y A;  4KLE A;  5KFR A;  8ICS A;  4BWJ A;  4YCX A;  1FFV A;  2KJ9 A;  1ZQD A;  1F0M A;  4DL4 A;  4PZO A;  2QAR B;  2VKQ A;  3DEE A;  2MRL A;  3PSF A;  4DFJ A;  1HUO A;  1NK7 A;  2W9B A;  2PI5 A;  2RLT A;  1ECW A;  2W9M A;  2XCP A;  4B9N A;  3OJS A;  5CR0 A;  4UB5 A;  4UB3 A;  4K4G A;  7ICQ A;  4EBD A;  4DSK A;  3EPI A;  3BQ0 A;  4IC9 A;  2B6G A;  5DGA A;  3LVW A;  4YG2 A;  2LI6 A;  3T5J A;  2HBJ A;  3GQC A;  3E58 A;  2Y0S F;  1UHU A;  4KMO B;  3HWT A;  3DDH A;  5KAI U;  1XO1 A;  3I28 A;  3UQ0 A;  2E8P A;  1LVH A;  4IRC A;  4YR0 A;  2UVU A;  4BJQ A;  4QW9 A;  2OWO A;  5IIJ A;  3LK9 A;  3RJK A;  4G3I A;  3MGV A;  4ICA A;  5TZV A;  4QW8 A;  4NM1 A;  4HAI A;  4RQ7 A;  3RRH A;  3Q8S B;  2MA1 A;  5CEH A;  5ALO A;  1V38 A;  4DQS A;  1IIP A;  2ZIU B;  5ALU A;  1QSS A;  4Z6E A;  5D4B A;  1ZQS A;  4P2H A;  4DS4 A;  3CYM A;  4BWM A;  3MGH A;  4BGD A;  3MDC A;  3RAX A;  3PW0 A;  2PI4 A;  2G5H B;  2BHN A;  4KIT B;  5ALL A;  1L3S A;  3NRW A;  2VAN A;  4DL2 A;  1X42 A;  5ALN A;  3ISD A;  4DSJ A;  1Z4O A;  5DLG A;  2KHQ A;  4NV0 A;  5J2I A;  4I2H A;  3J81 j;  2EZY A;  2MSN A;  2V4Q A;  1V9P A;  4DCC A;  1ZQI A;  2LBO A;  3BZC A;  2HHW A;  5IIL A;  2FMP A;  4MFF A;  3EZ5 A;  4YMN A;  4R8U A;  3C5G A;  5KFC A;  1ZQF A;  3V7L A;  3QUT A;  2NRW A;  3IP4 B;  4QWD A;  1KN5 A;  3NVW A;  5ALI A;  3WKB A;  1SL2 A;  2WAQ F;  1SL0 A;  1ZQR A;  5DQI A;  1T3N A;  1MQ3 A;  9ICE A;  1DGS A;  5HHH A;  4F93 B;  2M0N A;  5KTQ A;  5KFF A;  4KLF A;  2K4H A;  1U47 A;  3F2C A;  4DLE A;  2H5X A;  2Y9T A;  3BS5 A;  2KD1 A;  1ZQU A;  4M9G A;  3MR6 A;  4DL7 A;  3ZDD A;  4C8K A;  3UPQ A;  3HPO A;  3MBY A;  5J2G A;  1RG6 A;  1UA1 A;  3NAS A;  2PFQ A;  4PHP A;  3JPS A;  1TV9 A;  1ZQE A;  4DOA A;  4TQR A;  1OUQ A;  1SL1 A;  4J9L A;  1HEK A;  1LB2 B;  3GFK B;  3A0H U;  4UAV A;  4RZR A;  1B4F A;  2ZIU A;  2W8L A;  1ZQL A;  1T8E A;  2ASD A;  1HJP A;  2FI1 A;  4QZB A;  4I2A A;  1IG6 A;  2GO7 A;  3AU2 A;  2RHF A;  7ICN A;  5AI9 A;  2AXT U;  3V6J A;  3M6Z A;  3SV3 A;  2GH1 A;  2R8I A;  2K89 A;  2H3V A;  4O0I A;  4NL9 A;  4DF8 A;  1S8O A;  4PHE A;  1N61 A;  2W9C A;  3TAR A;  1NJW A;  1Q46 A;  1ZRN A;  3TFS A;  2NO4 A;  4JK1 A;  2QKQ A;  4OJO A;  4MEX A;  1N5X A;  1MQ2 A;  1L7O A;  1S77 D;  5KG7 A;  5KG5 A;  1RXV A;  1MC8 A;  3D6J A;  2I5H A;  4EYH B;  4DQI A;  5E79 U;  5DQG A;  3TAC B;  4FS1 A;  5KG3 A;  4TUQ A;  5ALY A;  2HHT A;  2YQE A;  1ZQP A;  2OEH A;  1YT3 A;  2CXY A;  4DFM A;  4KX3 A;  3N7R C;  2CPR A;  1S76 D;  3KHG A;  3GZF A;  3C1Z A;  4EX7 A;  1QQ6 A;  3BQ1 A;  4I2F A;  1T94 A;  4DQQ A;  2LKY A;  4YQW A;  3RH6 A;  2I1Q A;  3TAD C;  3K1R B;  3QU4 A;  4M6W B;  2UVR A;  1S5L U;  1T3Q A;  2F1H A;  3KBB A;  1SKS A;  8ICN A;  2JR5 A;  4DWI A;  1L3U A;  3PML A; 
#chains in the Genus database with same CATH homology
 5EWE A;  5KFD A;  5KFY A;  5KFH A;  3RB3 A;  3QZ7 A;  2FLN A;  2IHN A;  5DBC A;  1UT5 A;  4KMU A;  2VA8 A;  5KG2 A;  4PGQ A;  2W9C B;  1RXW A;  1BPZ A;  1KRP A;  3RJH A;  5KFJ A;  1S0V A;  4ECQ A;  1KEJ A;  1ZQQ A;  2C2E A;  2BPG A;  4DEZ A;  5EWG A;  4QWA A;  4C8L A;  8ICX A;  3ETL A;  1ZYQ A;  8ICC A;  2R8G A;  3TI0 A;  2PXI A;  4DQR A;  4EZ9 A;  2JZB B;  8ICJ A;  5DQH A;  4LVS A;  2XCA A;  3ORY A;  4RQ0 A;  7ICO A;  5KFV A;  3C1Y A;  5HNK A;  3JPQ A;  4NXZ A;  4R8U B;  5L9X A;  4KLI A;  2HHQ A;  2AGQ A;  1A77 A;  3OSN A;  4KLS A;  5F9L A;  5KT6 A;  2KTQ A;  4NLK A;  8ICQ A;  4J9N A;  4PHA A;  1X9W A;  4I28 A;  1Y88 A;  5J0X A;  2FMS A;  4F4X A;  1S97 A;  4MEY A;  4IQV A;  9ICQ A;  4GLX A;  3C2M A;  3C21 A;  7ICE A;  9ICT A;  4KLO A;  7ICG A;  4F91 B;  3RJG A;  2ZTE A;  4DFK A;  1X9S A;  1D8Y A;  2XY5 A;  3H8W A;  4RPZ A;  2UVV A;  5J2H A;  3RJJ A;  3MR5 A;  4EZ6 A;  3OHB A;  1TKD A;  4GC7 A;  1UT8 A;  3M9N B;  4EEY A;  5KFL A;  3H40 A;  4F50 A;  5L1L A;  5J0U A;  5DB7 A;  3RBE A;  1SZP A;  4C8M A;  2BDP A;  1BPB A;  4B9M A;  1ZET A;  9ICL A;  1ZQA A;  9ICA A;  3GIM A;  2KZ3 A;  9ICH A;  4Q44 A;  4K4I A;  2ZJ8 A;  5J0Q A;  1U45 A;  1ZQH A;  2F1I A;  5KFP A;  4I2G A;  9ICB A;  1EXN A;  4RQ3 A;  1SKW A;  1X2I A;  3ZDA A;  3H4D A;  2XGP A;  3HX0 A;  3ZD8 A;  2W9B B;  8ICW A;  2B21 A;  3EYZ A;  1NK5 A;  5IIO A;  9ICU A;  4Z6F A;  5J2E A;  1KTQ A;  5KG1 A;  4FBT A;  2A1J B;  3EWA A;  3KHR A;  4ECR A;  4RNO A;  3QZ8 A;  3SZ2 A;  3GIL A;  1ZQB A;  1XC9 A;  2W8K A;  4F3O A;  5J2F A;  2HVH A;  5J2J A;  8ICT A;  1N48 A;  4F5R A;  4O9M A;  3PW2 A;  2ZUD A;  3N4M B;  4ED7 A;  1TFR A;  3MGI A;  3T5L A;  3RBD A;  1LV5 A;  1Z3E B;  4GXI A;  1NKB A;  1Z00 B;  3PO5 A;  1Z00 A;  3RAQ A;  4O3Q A;  3MFI A;  3MAB A;  4P4P A;  4J9O A;  3Q8K A;  4I29 A;  2DPJ A;  1H38 A;  3T3F A;  5DKW A;  4O5C A;  1KFS A;  4R65 A;  4F92 B;  1ARO P;  4XA5 A;  3V6H A;  7ICL A;  4MF8 A;  2BQR A;  2HHV A;  9ICC A;  4Z6D A;  3GIK A;  4Q45 A;  1XSN A;  3QE9 Y;  2Y1I A;  9ICS A;  4Z6C A;  4YR3 A;  5HMM A;  4RT3 A;  1RPL A;  5IIK A;  4PHD A;  3JPO A;  4DL3 A;  3TAP A;  1KLN A;  5J0P A;  1XSL A;  1QTM A;  2JEG A;  1NJY A;  3M9O B;  5J0T A;  1TK0 A;  4NY8 A;  5CHG A;  4B9U A;  1T7P A;  4DQP A;  4R66 A;  2BQU A;  3THV A;  7ICM A;  8ICU A;  2NRX A;  3FDS A;  2FLL A;  1S9F A;  3PW7 A;  4KLU A;  1ZQO A;  4PGY A;  1C7Y A;  3RTV A;  1RZT A;  2ALZ A;  4QZA A;  4UBC A;  7ICT A;  4QWC A;  5KFW A;  8ICZ A;  4DSL A;  4ECT A;  4RUC A;  4J9S A;  4RUA A;  1D9F A;  7ICI A;  4IR1 A;  3GII A;  8ICB A;  4PGX A;  9ICP A;  4KLQ A;  4E0D A;  3LWL A;  4B9V A;  4ELT A;  1ZQM A;  2NRV A;  5L1I A;  1NK4 A;  4IQW A;  5J0O A;  5KG4 A;  5CA7 A;  4ED0 A;  3C23 A;  4KLD A;  5KFB A;  4DL5 A;  2BR0 A;  9ICW A;  2C2R A;  4QZF A;  1X9M A;  3Q8M A;  2KZZ A;  4RT2 A;  2AQ4 A;  4UB1 A;  3RJI A;  4NM2 A;  4QZD A;  2XO7 A;  1JMS A;  2HW3 A;  4DFP A;  5KT7 A;  4O3S A;  2ZTD A;  9ICG A;  3KHL A;  5KFA A;  3OGU A;  2XY7 A;  2PFN A;  3K75 D;  3PX4 A;  1JN3 A;  4XUS A;  4R64 A;  2KN7 A;  4F4W A;  4NLZ A;  1XSP A;  1RYR A;  3MR3 A;  4DOB A;  3ISB A;  4GC6 A;  3GDX A;  8ICA A;  3E2E A;  3RH5 A;  9ICX A;  5KT2 A;  3JPR A;  4M47 A;  9ICM A;  4UAY A;  3OSP A;  4I2E A;  2BGW A;  4BXO B;  7ICR A;  4ELV A;  9ICF A;  7ICS A;  2BPC A;  7ICH A;  4YVZ A;  3HW8 A;  3ZD9 A;  5C5J A;  4M2Y A;  4KLE A;  5KFR A;  8ICS A;  4O3O A;  4BWJ A;  4YCX A;  5CWR A;  4DSE A;  2BCS A;  4PPX A;  5J2C A;  3RB0 A;  9ICN A;  1TAQ A;  1ZQD A;  5KFS A;  2GWS A;  4DL4 A;  4ELU A;  4UQG A;  2C2D A;  1NK8 A;  4RQ4 A;  4EYI B;  2P66 A;  4DFJ A;  5IIM A;  1HUO A;  1NK7 A;  2HHU A;  3BQT A;  2W9B A;  1NK6 A;  2PI5 A;  4HYK A;  5D46 A;  4JV1 A;  2KFN A;  3MFH A;  3BJY A;  2ASJ A;  4IRK A;  3UXO A;  2W9M A;  5J0S A;  3Q8R B;  1U9L A;  1CEZ A;  1ZQX A;  1ZQG A;  4ECY A;  2XCP A;  4B9N A;  3SI8 A;  3OJS A;  4QZG A;  3RJF A;  5CR0 A;  3UQ2 A;  4CCH A;  4UB5 A;  4UB3 A;  3HT3 A;  1MSW D;  5F9N A;  1BPX A;  4K4G A;  4ECV A;  3V7K A;  4EBD A;  7ICQ A;  4DSK A;  4QZC A;  4YD1 A;  3EPI A;  2MUT B;  1NOM A;  3BQ0 A;  4X5V A;  5DGA A;  4F4K A;  5J2A A;  4RPY A;  8ICM A;  2JEI A;  4C8N A;  4YG2 A;  3SV4 A;  4TUR A;  4ECW A;  3NTU A;  3T5J A;  4DSI A;  1TAU A;  1L3V A;  2R8J A;  4XRH A;  1S0O A;  3GQC A;  4Q8E A;  4J9P A;  3PO4 A;  4JV0 A;  3QEB Z;  2J6U A;  4RNM A;  5DGB A;  5III A;  3C2K A;  3HWT A;  5KFN A;  3LDA A;  4YMM A;  4KLL A;  4O5K A;  3V6K A;  1BPE A;  5J2K A;  1U4B A;  5KFI A;  8ICY A;  1XO1 A;  3IHQ B;  3UQ0 A;  4M9H A;  5KFQ A;  2HHW A;  5J29 A;  4DO9 A;  4ED1 A;  4IRC A;  4YR0 A;  5KG6 A;  2UVU A;  1CUK A;  4QW9 A;  2OWO A;  5IIJ A;  3LK9 A;  4KN7 A;  2XC9 A;  3RJK A;  5KFX A;  5DBB A;  4G3I A;  1PZN A;  4QZE A;  1KDH A;  4Q8F A;  4R63 A;  5TZV A;  1NJZ A;  5KFZ A;  4QW8 A;  1NK9 A;  1IXR A;  3RH4 A;  4NM1 A;  4RQ7 A;  2JEJ A;  4RNN A;  3RRH A;  1QSY A;  1QSL A;  2FPM A;  4TUP A;  3MR2 A;  4ECU A;  4DF4 A;  1KFT A;  2ISO A;  3Q8S B;  4F5O A;  1KSP A;  4ED8 A;  3IM1 A;  1BGX T;  2IA6 A;  4NLN A;  4JV2 A;  3TFR A;  5KT3 A;  4EBE A;  1RYS A;  1L3T A;  4IRD A;  4UAZ A;  4K4H A;  4DQS A;  3UXN A;  2C22 A;  2RDI A;  1U48 A;  5KFU A;  1QSS A;  4I27 A;  4Z6E A;  4YXJ A;  5CB1 A;  2HVI A;  4ED3 A;  4GXK A;  5D49 A;  1L5U A;  3RR7 A;  5D4B A;  2ASL A;  1ZQS A;  4I2I A;  4O3P A;  1S0N A;  4P2H A;  4M6W A;  4DLG A;  4DS4 A;  5L1J A;  4BWM A;  5KT4 A;  3MGH A;  4BGD A;  5L1K A;  3MDC A;  4M9N A;  4B9L A;  3FYH A;  3RAX A;  5DG9 A;  1ZQJ A;  5HML A;  3SYZ A;  3PW0 A;  2PI4 A;  3Q8L A;  4Q43 A;  4UB4 A;  2BHN A;  4KIT B;  5DB6 A;  5DB8 A;  2AGP A;  2VA3 A;  4MFC A;  3PX0 A;  2R8H A;  1L3S A;  2UVW A;  2KFZ A;  2JEF A;  2BCR A;  5KFK A;  4F5N A;  2I9G A;  4MF2 A;  4KLJ A;  2XGQ A;  4ED6 A;  2VAN A;  4I2J A;  5J2B A;  4DL2 A;  3JPP A;  8ICK A;  9ICV A;  4KLG A;  4YR2 A;  3ISD A;  2NRZ A;  4BDP A;  4DSJ A;  1DOQ A;  5DLG A;  3GV5 B;  2JZB A;  5DBA A;  3H4B A;  3PY8 A;  4YFK A;  3EW9 A;  4J9M A;  5KFE A;  3LWM A;  3TQ1 A;  4YN4 A;  4J9K A;  4QZ8 A;  5J2I A;  2AU0 A;  4I2H A;  3G6Y A;  3JPT A;  4I2C A;  2AQ0 A;  2DFL A;  2V4Q A;  1V9P A;  8ICH A;  8ICR A;  1ZQI A;  3AU6 A;  2V9W A;  3RR8 A;  1WCN A;  4MFA A;  4RQ5 A;  3Q8P B;  4KTQ A;  5IIL A;  4QWB A;  1BPD A;  2FMP A;  4QZ9 A;  4MFF A;  1ZQK A;  8ICV A;  3PW5 A;  3EZ5 A;  3K4G A;  4YMN A;  3H7I A;  4R8U A;  3RJE A;  3C5G A;  3GV8 B;  5J0Y A;  4F5Q A;  3BDP A;  8ICG A;  5J0R A;  5KFO A;  3B0Y A;  5KFC A;  3V7L A;  4GXJ A;  3HP6 A;  4FO6 A;  1ZQF A;  8ICF A;  4PH5 A;  2IHM A;  9ICJ A;  2C28 A;  1ZQT A;  2M9N A;  2LYH A;  2NRW A;  3ZDC A;  2FPL A;  4QWD A;  2PFP A;  3V72 A;  1S0M A;  1SL2 A;  2ZJA A;  3M8S A;  1S10 A;  2IMW P;  1SL0 A;  3TAQ A;  2AGO A;  1ZQR A;  4UAW A;  3M9M B;  3PR5 B;  4M9J A;  4UBB A;  1A76 A;  5DQI A;  3BQ2 A;  1T3N A;  1MQ3 A;  1NJX A;  4YXM A;  1DGS A;  9ICE A;  3KHH A;  3V7J A;  4TQS A;  4RPX A;  1WCL A;  4I2D A;  2VA2 A;  5EOZ A;  5HHH A;  5DDM A;  4F93 B;  1K1Q A;  2HHS A;  4RQ6 A;  5KTQ A;  4F4Y A;  4FS2 A;  5KFF A;  1NKE A;  4KLF A;  1U47 A;  5KFM A;  1QLN A;  2AJQ A;  5DG7 A;  2H5X A;  4DLE A;  3NGD A;  1NKC A;  2WTF A;  4DSF A;  2V4R A;  3EPG A;  1BPY A;  4M9G A;  1ZQU A;  4F5P A;  7ICJ A;  3MR6 A;  2W9A A;  4DL7 A;  1U49 A;  2MAX A;  1UA0 A;  3ZDD A;  4C8K A;  3UPQ A;  2ATL A;  3HPO A;  4KLT A;  3MBY A;  3G6V A;  5J2G A;  4JUZ A;  3GIJ A;  4M0A A;  4O3N A;  1SKR A;  2BCU A;  3KTQ A;  1ZJN A;  1HUZ A;  1UA1 A;  3T5K A;  2PFQ A;  2FPK A;  4YMO A;  5CP2 A;  2J6S A;  4PHP A;  3JPS A;  2XY6 A;  4C8O A;  1TV9 A;  2NRT A;  1ZQE A;  3QEA Z;  4DOA A;  4TQR A;  4J9R A;  5KFG A;  2R8K A;  4ECS A;  1ZQW A;  4J9L A;  3PW4 A;  1SL1 A;  2FLP A;  7ICK A;  9ICK A;  3M8R A;  1LB2 B;  1KFD A;  1K1S A;  4DS5 A;  4LZD A;  3GFK B;  4QWE A;  2RDJ A;  4RZR A;  7ICU A;  2W8L A;  1ZQL A;  5EWF A;  3AUO A;  1T8E A;  1ZQY A;  4RQ1 A;  2ASD A;  1HJP A;  1ZQZ A;  4QZB A;  4JWM A;  4I2A A;  9ICR A;  1D8L A;  1JXE A;  3AU2 A;  5J2D A;  2BCQ A;  3N97 B;  3OJU A;  1NK0 A;  7ICN A;  4QZI A;  1XU4 A;  4QZH A;  3V6J A;  2R8I A;  3Q8Q B;  3SV3 A;  2P6U A;  5HHI A;  3PNC A;  1JXL A;  4ECZ A;  4O0I A;  4KLH A;  4RQ2 A;  2MUT A;  4DF8 A;  2Y1J A;  1B22 A;  3H8S A;  9ICO A;  4O3R A;  4PHE A;  3UXP A;  4DL6 A;  4ED2 A;  3ZDB A;  2W9C A;  1ZQC A;  3C2L A;  3TAR A;  1NJW A;  1JX4 A;  1ZQN A;  3JPN A;  3TFS A;  4F4Z A;  1TVA A;  1TK5 A;  3G6X A;  1ZQV A;  4IQU A;  4JK1 A;  3TAN A;  4F8R A;  4MEX A;  4M9L A;  2Q0Z X;  1MQ2 A;  9ICI A;  1S77 D;  8ICO A;  5KG7 A;  5KG5 A;  5JUM A;  3PV8 A;  2ZUB A;  5BPC A;  4RQ8 A;  2P6R A;  1BVS A;  2KZM A;  4O5E A;  4IQT A;  1IM4 A;  1RXV A;  2BCV A;  1COO A;  1MC8 A;  5BOM A;  3PX6 A;  5KG0 A;  4EYH B;  2ZUC A;  4DOC A;  2J6T A;  4ECX A;  4DQI A;  2IBK A;  4FBU A;  4J9Q A;  5DQG A;  5IIN A;  3RB6 A;  4LZG A;  4FS1 A;  1T4G A;  8ICE A;  4TUS A;  4EBC A;  2ZJ5 A;  3GV7 B;  1TK8 A;  5HP4 A;  5DLF A;  4IR9 A;  4F2S A;  2A1J A;  5KG3 A;  4TUQ A;  1XS9 D;  4F2R A;  2HHT A;  5KFT A;  5J0W A;  1ZQP A;  3PVX A;  2PFO A;  1ZJM A;  2HHX A;  4NLG A;  3T5H A;  4DFM A;  4B9T A;  3OHA A;  1S76 D;  5BOL A;  3B0X A;  5CJ7 A;  4B9S A;  3KHG A;  3RRG A;  3C1Z A;  4P4O A;  3ISC A;  3PMN A;  7ICP A;  4KN4 A;  2BKE A;  3MDA A;  3C5F A;  3BQ1 A;  4I2F A;  7ICV A;  3H8J A;  2F1J A;  4DQQ A;  4JWN A;  4M04 A;  4KLM A;  3ZDE A;  5DG8 A;  4YQW A;  1B43 A;  8ICP A;  5DDY A;  3RH6 A;  1D9D A;  4YD2 A;  2I1Q A;  4UB2 A;  5DB9 A;  4P4M A;  5KT5 A;  4YP3 A;  2FMQ A;  2ISP A;  4M6W B;  2UVR A;  4XQ8 A;  4RU9 A;  2BPF A;  4ZH4 A;  4BXO A;  3PR4 A;  3RB4 A;  1N56 A;  1XWL A;  2F1H A;  8ICI A;  2BQ3 A;  2ZTC A;  7ICF A;  1JIH A;  8ICL A;  4I2B A;  1SKS A;  8ICN A;  4DWI A;  1L3U A;  3PML A;  2DPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...