2KZ3A

Backbone 1h, 13c, and 15n chemical shift assignments for human rad51d from 1 to 83
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
83
structure length
83
Chain Sequence
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTSTAILS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein RAD51L3
publication title Structural and functional characterization of the N-terminal domain of human Rad51D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 15
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 2kz3A00
1UT8A 3MFIA 1X9WA 2DPIA 3G6XA 2BCVA 4ED2A 1QSSA 2FLPA 5D4BA 4JV2A 1X9MA 1NOMA 1JIHA 4O0IA 2B21A 1L3VA 4R63A 1IXRA 3QE9Y 5KFSA 4UAWA 1XC9A 1D9FA 4F2SA 1Z3EB 2FLLA 2BKEA 8ICBA 3ORYA 3BJYA 8ICJA 3ZDEA 9ICHA 4YVZA 4Q44A 4ECYA 3ISCA 4M47A 4M04A 9ICOA 2KFZA 3KHRA 4KLLA 1JMSA 2PFOA 4DSKA 2HHQA 2FPKA 1Z00B 3HX0A 3EWAA 3GFKB 2Y1JA 5J2HA 4DL2A 1TVAA 1RXVA 3RJHA 4QZFA 3AU6A 2BDPA 5J0XA 3V7KA 1XO1A 3GV7B 4ELUA 3RJFA 2XY7A 4KITB 5L1IA 2IMWP 4GXIA 3HWTA 3TAPA 1CEZA 1ZETA 5KFIA 5IIOA 3RRGA 8ICEA 4UAZA 2W9BA 3EW9A 1TFRA 1QSYA 1ZQNA 2J6UA 1NK5A 1KTQA 3UXNA 4F4ZA 3T5JA 8ICCA 5KFLA 9ICTA 1PZNA 1RPLA 3OJUA 5DBAA 4B9UA 3MR5A 3T5LA 2ZJ5A 3Q8SB 3UQ0A 2ASLA 1BPZA 2PI4A 4R66A 5BPCA 4YCXA 5KFTA 4RNNA 3PW4A 3C5GA 1S77D 3EPIA 1A77A 4Z6DA 4YXJA 3FYHA 4QZEA 2J6TA 5DDYA 5DBBA 4QZ8A 1TV9A 4KLTA 5L9XA 7ICJA 3H40A 2JEJA 4F4XA 4JV0A 3LWMA 3H8WA 3MABA 3BQ1A 2PFNA 2V9WA 2IA6A 3K75D 3GV5B 5DBCA 3OSNA 1T8EA 3V7JA 1KFSA 2ZTCA 2JZBA 3H8SA 3H7IA 4PGXA 3LWLA 3GIIA 5IINA 1NJWA 2W8LA 4O5CA 4YG2A 3GQCA 4Q43A 1XSLA 3PW7A 5DQHA 3HPOA 1SL2A 4FBUA 4EBCA 4E0DA 3GIMA 5KFJA 5J0SA 9ICAA 3ISDA 2HHXA 1ZJMA 5KFYA 4DL3A 4ECVA 1KSPA 5J2EA 1RZTA 4ECXA 4DFMA 9ICUA 2ZJ8A 3BQ2A 5J2BA 5KFXA 4YR3A 1NKBA 2PFPA 4B9VA 2W9BB 2J6SA 4EZ6A 2ISOA 2C22A 3EZ5A 9ICFA 4I27A 3RB6A 4EBDA 2W9MA 3ZDCA 1BPYA 4I2FA 3V6HA 3RB4A 2VA2A 4TURA 3PW2A 3PV8A 1NKEA 7ICRA 5DB8A 5IIJA 4PHPA 5J2AA 5KFRA 1LV5A 4KMUA 1KFDA 3AUOA 2BQUA 1NK7A 1NK0A 2PXIA 4ECSA 5CWRA 3V7LA 5L1LA 3TFRA 5KFBA 4DFJA 4KN7A 1NK8A 1XS9D 5KFPA 9ICQA 5DQIA 2ZUDA 8ICIA 5DLFA 2C2DA 1DGSA 4I2DA 7ICUA 2AGOA 1WCNA 2FPLA 2ZUBA 1U45A 4Z6CA 2AU0A 4DSFA 1ZQQA 4UB5A 4LZDA 5DQGA 3MR3A 4RQ0A 3ETLA 4HYKA 1QTMA 4C8KA 4KLSA 2HHTA 4EYIB 5HP4A 9ICWA 3C1ZA 5IILA 1U47A 1S0MA 1ZQGA 4ELVA 2NRWA 7ICLA 5KG4A 5DG8A 4QZCA 3RAQA 4B9SA 2P6RA 3PX4A 3UXPA 4P2HA 3K4GA 5KTQA 2XC9A 4F5PA 1MSWD 2ATLA 7ICVA 4I2HA 2ZJAA 4F91B 1Z00A 3TANA 5KFKA 4RQ6A 1TK8A 3KTQA 3C23A 2C2EA 8ICMA 2R8GA 4M6WA 3RR8A 3JPSA 1S0VA 2BHNA 2AQ0A 1NJZA 2BQRA 4KTQA 5EWGA 2C2RA 1KEJA 5KFNA 1ZQKA 4NLKA 4BWJA 9ICRA 3PR5B 2FMPA 4RT2A 9ICCA 1XSNA 5KFGA 2DPJA 1MQ3A 3RH5A 1IM4A 3RBDA 5BOMA 1ZYQA 4YR0A 4RQ1A 1ZQVA 4YP3A 4ED6A 8ICNA 4DFKA 2Y1IA 3RH6A 2AGPA 5DG9A 2P66A 4B9MA 5KFCA 3NGDA 3OJSA 5DGAA 4J9QA 2BPFA 1Y88A 3PR4A 2HW3A 4UQGA 4RQ7A 5CA7A 1ZQYA 4YMNA 4DL4A 2ZTEA 2AGQA 1HUOA 3PY8A 4M0AA 1H38A 4J9LA 4F4KA 1N48A 4RZRA 1C7YA 4XRHA 3SV3A 4KLUA 5J0YA 4GC7A 2FPMA 2I1QA 4DOBA 3RTVA 3RR7A 4B9NA 3KHLA 4DQRA 1SL1A 5HNKA 2V4QA 3T5HA 3IHQB 3PMLA 3PX0A 3G6YA 2BPCA 3HP6A 4M6WB 4BWMA 9ICXA 5KT3A 3ZDBA 5KFAA 2W9AA 9ICIA 2WTFA 4QW8A 7ICPA 4IR9A 3RB0A 4QZ9A 5J2KA 5KT5A 1DOQA 4DO9A 3THVA 1ZQIA 4IR1A 4MF2A 1ZQXA 5KFQA 4M9HA 5BOLA 4YFKA 4EBEA 2JEGA 1HJPA 1ZQTA 4KLJA 1X2IA 1TAUA 4F3OA 4DWIA 9ICBA 9ICLA 3SZ2A 4DSLA 4IQVA 3RH4A 5J0TA 3ISBA 2A1JB 2RDIA 1U48A 3T3FA 2MUTA 4Z6EA 3FDSA 4PGYA 3QZ8A 4QWDA 4F4WA 5DLGA 4O3PA 4QZAA 2ZUCA 5EWFA 4QZHA 5KFDA 1BGXT 5KFHA 5DDMA 3Q8PB 8ICKA 1TK0A 2NRXA 3B0XA 3N4MB 3RB3A 3PVXA 3JPQA 3M8RA 9ICPA 4YD2A 5KG3A 5J2JA 5KT7A 5TZVA 7ICOA 3RJKA 2UVUA 4DS5A 5DKWA 4IRKA 2JEIA 1D8YA 4ED3A 1KDHA 3MDCA 1ZQDA 5KG5A 1D9DA 4TUSA 5JUMA 2IHNA 4TQSA 2BGWA 4I2AA 3TFSA 3JPRA 1XSPA 1RXWA 2HHVA 8ICUA 3MDAA 2V4RA 2UVVA 1XWLA 3ZDAA 4I2BA 3LDAA 4RUAA 2BCQA 3C2LA 5KFMA 1B43A 2MAXA 4QZIA 2IBKA 4EZ9A 2HVHA 4QZBA 7ICQA 4BGDA 5KFWA 4DSJA 2NRTA 1K1SA 9ICSA 4ED7A 4O3OA 1N56A 4YN4A 4BDPA 3TQ1A 3TAQA 4IRCA 8ICLA 1SZPA 4F92B 4YXMA 4F5OA 3GIJA 1ZQOA 2Q0ZX 1S0OA 2VA3A 8ICPA 4LZGA 5KT6A 1ZQUA 2UVRA 8ICZA 2MUTB 3GILA 5CJ7A 4ECTA 8ICWA 2F1IA 1JX4A 9ICVA 9ICJA 3H4BA 4UBBA 2BCSA 2C28A 4DF4A 3E2EA 4PHDA 2XY5A 4F4YA 4F8RA 4QZGA 2HVIA 3ZD8A 4ZH4A 1U9LA 8ICOA 4I29A 2VANA 1S10A 2XCPA 2F1HA 4ED0A 3QEBZ 1JXEA 7ICTA 4XA5A 3MR6A 5DB7A 1KRPA 2HHWA 4YMMA 8ICRA 7ICHA 1S0NA 1BPEA 4YD1A 3ZD9A 4JWMA 2NRVA 4ED8A 2AQ4A 4UAYA 3C2KA 4DQQA 2LYHA 3GIKA 1NK9A 1XU4A 5DGBA 4I2GA 3RJEA 4ECWA 1CUKA 4J9RA 2ASJA 2PFQA 2HHSA 8ICVA 2AJQA 5KT2A 4PPXA 1ZQBA 4NY8A 3M9MB 3B0YA 3C5FA 1L3UA 4JWNA 4M9NA 1COOA 4DL7A 3Q8LA 1X9SA 4F50A 8ICQA 3RBEA 3RJJA 4JV1A 4P4OA 3TARA 2FMQA 3BQTA 1T3NA 2DFLA 2BR0A 1L3SA 5J2FA 4RT3A 4O3NA 4FBTA 4IQTA 4K4IA 5J0UA 3PO5A 4R8UA 4UB1A 4FS2A 4EEYA 3Q8KA 3JPNA 2BPGA 4KLQA 1V9PA 2A1JA 4RU9A 3SI8A 1AROP 4RQ4A 3QEAZ 3RJGA 1SL0A 2IHMA 3MGHA 2XY6A 7ICEA 4DFPA 2KFNA 3T5KA 4Z6FA 3UPQA 1SKSA 4I2IA 4RQ5A 4EYHB 4R64A 3C21A 5CHGA 2KTQA 3BDPA 5KG0A 4QWAA 4IRDA 4J9KA 5IIIA 4XUSA 4QZDA 1S9FA 3Q8RB 1T7PA 3KHHA 1BPBA 4PHEA 4MFAA 7ICIA 1LB2B 2I9GA 4KLIA 4O3RA 3RJIA 5KFEA 4O3QA 1WCLA 3RRHA 2OWOA 7ICFA 1NJYA 4DQPA 5DB9A 3ZDDA 1HUZA 4M2YA 9ICKA 3H4DA 3MFHA 4FO6A 1ZQZA 4RNMA 1ZQFA 3MR2A 4RPXA 4M9JA 4NLNA 3BQ0A 3MGIA 4GXKA 4UBCA 5D46A 2ASDA 4RQ8A 4DOAA 1SKRA 2RDJA 2ISPA 3UQ2A 1D8LA 2KN7A 3JPTA 3OHAA 4DQSA 9ICMA 4J9MA 5KG2A 4LVSA 2H5XA 4R8UB 5J0WA 4GXJA 1RYSA 1MC8A 4RNOA 8ICXA 7ICGA 4C8NA 5EOZA 4JK1A 2XGPA 4RQ3A 4C8LA 4MEYA 1UT5A 4ELTA 3PNCA 4O5EA 4YQWA 4NXZA 1ZQCA 1ZQEA 2P6UA 4RPYA 5KG7A 1ZQAA 4DSIA 5IIMA 8ICTA 3RAXA 5KG6A 4NLZA 4J9SA 3C1YA 4DL5A 4ECRA 4YMOA 3Q8MA 3HW8A 5KFZA 5J2GA 4KN4A 4IQUA 5DB6A 4M9LA 4BXOA 4IQWA 4J9PA 1BPDA 4DF8A 2GWSA 1T4GA 1U4BA 4PGQA 1L3TA 1ZQSA 4B9TA 4X5VA 7ICSA 3V6KA 2ZTDA 5J29A 5CB1A 1ZQHA 2W9CA 1ZQLA 3C2MA 5F9NA 4XQ8A 2R8IA 5HHIA 4CCHA 4DL6A 3AU2A 3OSPA 3OHBA 4F5QA 2M9NA 1TK5A 1NK4A 4DLEA 5F9LA 4NM2A 1ZQJA 3GDXA 4DOCA 3Q8QB 4QWEA 4K4HA 4Q45A 4NM1A 5CP2A 5J0RA 4O5KA 4F5RA 2KZZA 4RPZA 4MEXA 3M8SA 3NTUA 2BQ3A 7ICNA 3OGUA 1U49A 5D49A 4P4PA 1BPXA 3TI0A 2PI5A 4KLGA 4F2RA 2FLNA 4C8OA 1S97A 2UVWA 4I2JA 2BCUA 3GV8B 2XCAA 3PX6A 3IM1A 1NK6A 1SKWA 1JN3A 8ICYA 5J2CA 1TAQA 3PMNA 3QZ7A 5DG7A 1BVSA 3UXOA 4NLGA 3EYZA 4J9OA 4C8MA 4TQRA 4ED1A 8ICSA 4RQ2A 5CR0A 4UB4A 5J2IA 4Q8FA 4UB3A 2W8KA 4BXOB 1S76D 8ICHA 1ZQWA 4RUCA 5KG1A 4MFCA 5HMLA 4KLHA 1QSLA 5J0PA 4FS1A 3EPGA 4DS4A 4J9NA 1TKDA 4KLOA 1L5UA 1ZQMA 4MFFA 5IIKA 2W9CB 1NJXA 5J0QA 1UA1A 5HHHA 4ECUA 5KFUA 4Q8EA 4K4GA 3PW0A 4DSEA 4B9LA 8ICFA 2NRZA 2F1JA 4F93B 5C5JA 5KT4A 4GLXA 3N97B 4TUPA 4TUQA 1ZQRA 3M9NB 1ZQPA 2FMSA 2JEFA 1A76A 4MF8A 1K1QA 4ECQA 2KZ3A 1KLNA 2BCRA 1EXNA 5EWEA 4I2CA 5L1KA 2HHUA 2ALZA 3JPOA 5J0OA 1KFTA 3KHGA 4DEZA 1MQ2A 5L1JA 2R8JA 9ICNA 2JZBB 2R8KA 1B22A 8ICGA 1RYRA 2R8HA 4QW9A 1JXLA 4QWBA 1UA0A 4DQIA 1QLNA 5J2DA 2VA8A 4UB2A 3SYZA 4I28A 4R65A 4G3IA 4YR2A 2XO7A 3HT3A 3M9OB 4GC6A 1ZJNA 5KFVA 1NKCA 2XGQA 3SV4A 2KZMA 4I2EA 9ICEA 4JUZA 3JPPA 5KFFA 4KLFA 3H8JA 4DLGA 3V6JA 8ICAA 3LK9A 4F5NA 4PHAA 4O9MA 4PH5A 3G6VA 3PO4A 4QWCA 4KLEA 9ICGA 4P4MA 4M9GA 5KFOA 7ICMA 4KLMA 3PW5A 4O3SA 3V72A 3MBYA 4ECZA 4KLDA 5HMMA 7ICKA
chains in the Genus database with same CATH superfamily
1UT8A 3DEEA 3MFIA 1X9WA 2WHEA 3F2DA 2ODGA 4C4SA 2ZXHA 4ED2A 2DKXA 1QQ6A 2EAPA 3TADA 3FC4A 4UAWA 4F2SA 8ICBA 3ORYA 3BJYA 3NRWA 3NVZA 3ZDEA 3LVWA 2ZIUB 4M04A 2KMDA 1L6NA 3KHRA 5ALJA 2PMZF 2PFOA 2HHQA 2FPKA 1B4FA 3GFKB 2Y1JA 5J2HA 2XVTA 4QZFA 4OJLA 3AU6A 4ELUA 5KAIU 2EZZA 2XY7A 5L1IA 2XIDA 4GXIA 3HWTA 1CEZA 1JROA 5HR6A 3EUB2 5E79U 4C80A 2EANA 3SMVA 2KJ9A 3DV9A 2OYYA 2A19A 3T5JA 5C0YA 2RRDA 5DBAA 3T5LA 3UQ0A 2ASLA 5AKKA 3C5GA 4QZEA 1TV9A 4KLTA 4JV0A 3BQ1A 2KHVA 2V9WA 2IA6A 4MHVA 2JZBA 4PGXA 3LWLA 2OXOA 3QX7A 2AHOB 1XSLA 3PW7A 1SL2A 2HHXA 5KFYA 1QQ5A 4ECXA 5AM0A 5J2BA 4EZ6A 2E1EA 4KX5A 1BNPA 1KQQA 1YZ6A 3RB6A 4I2FA 3RB4A 1NKEA 5IIJA 4PHPA 2D3DA 1L7OA 4KMUA 1KFDA 2BQUA 1NK8A 3V7LA 1XS9D 5KFPA 5DLFA 4DFDA 2FPLA 3M1YA 1TE2A 5DQGA 4C8KA 4HYKA 2HHTA 4KLSA 9ICWA 5HP4A 4CF4A 5IILA 1U47A 2NRWA 7ICLA 1SXEA 4QZCA 3RAQA 4F5PA 1MSWD 2ATLA 5KFKA 2VIXA 4US8A 1NJZA 3D6JA 2C2RA 4OJ6A 2IOFA 1ZQKA 9ICRA 2FMPA 1DK3A 4RT2A 3PSIA 2DPJA 4EELA 1ZYQA 4YR0A 2K4IA 3RH6A 4G9BA 1RYUA 5AI0A 3TKAA 3NRZA 3O0FA 4UQGA 3PR4A 3PY8A 2ZTEA 2YMQA 1N48A 4UB8U 3WK5A 4RZRA 3SV3A 2F76X 4GC7A 2ZIXA 2FPMA 3R9KA 4DQRA 3T5HA 3KZXA 3TADC 2WTFA 2WAQC 4QZ9A 5J2KA 1DOQA 2VJ4A 3THVA 5CRXA 4EBEA 4KLJA 3IDWA 1ZQTA 3QUBA 1AQ6A 2E1FA 3BS5B 2KIVA 9ICLA 3SZ2A 1A6SA 5J0TA 3ISBA 4Z6EA 4PGYA 3QZ8A 4O3PA 3TACB 4OJOA 4QZHA 5AIBA 5B5EU 1GO3F 8ICKA 2ZIXB 3JPQA 4YD2A 7ICOA 3NUQA 2FDRA 4UB6U 5B66U 4ED3A 1D9DA 4TUSA 2E8OA 2BGWA 1XSPA 2RP5A 3LDAA 4EZ9A 4IS7A 2DWQA 1K1SA 1N56A 2YMPA 1DK2A 2VA3A 2KKPA 1ZQUA 3MGVA 8ICZA 5CJ7A 1JX4A 5ALLA 2BCSA 4DF4A 3SAGA 4FZNA 2XY5A 2HVIA 4ZH4A 1U9LA 2RLTA 2QB0B 1S10A 5EE1A 4ED0A 3A0BU 5DB7A 4YMMA 7ICHA 1S0NA 4YD1A 3M6ZA 3C2KA 4DQQA 2D6FC 2LYHA 5DGBA 3D2SA 4P0PA 4PPXA 3UMGA 3M9MB 4NY8A 2K8BB 4M9NA 2QKQA 4DL7A 1COKA 4FZLA 8ICQA 3RJJA 3PSTA 1T3NA 2BR0A 4RT3A 3HKZC 4O3NA 2KE7A 2MSNA 3Q8KA 2BPGA 4RU9A 3QEAZ 2NO5A 2IHMA 3NVYA 2CXYA 3MGHA 3T5KA 3GU3A 4DCCA 2KVSA 3BDPA 4QZDA 4AYBF 3Q8RB 5ALTA 2DUYA 4PHEA 5AKGA 3WKAA 7ICIA 4Y2PA 2I9GA 4O3RA 4O3QA 1WCLA 7ICFA 1NJYA 4NWIA 5DB9A 1XO0A 4C7YA 3H4DA 5ALEA 4PL1A 3MFHA 4RNMA 3MR2A 4NLNA 4RQ8A 2ISPA 2NV3A 2KN7A 3OHAA 4DQSA 4Y2QA 4J9MA 5KG2A 1Q3VA 1B0XA 2FI1A 2DKZA 4RNOA 1KBUA 4JK1A 4C8LA 3BS7A 2MRLA 5GTHU 4O5EA 4YQWA 1ZQCA 1URJA 1A0PA 3Q8MA 5KFZA 4KN4A 1T4GA 2VKQA 1ZQHA 5F9NA 2LYBA 4CCHA 2W7OA 1TK5A 1NK4A 1IIPA 4NM2A 3N7PD 1ZOLA 5AM3A 5J0RA 4Y2YA 4F5RA 3NTUA 5TISU 2BQ3A 5D49A 4C8OA 1TAMA 2G5IB 2XCAA 8ICYA 1WG8A 3QZ7A 3FAHA 4OD0A 4Q8FA 4UB3A 1S76D 1ZQWA 5KG1A 4KMOB 4KLHA 2DF4B 5J0PA 3EPGA 4DS4A 1ZQMA 4MFFA 2EAOA 4K4GA 4C0ZA 3UMCA 2NRZA 2JRZA 5AI9A 4TUPA 1ZQPA 1A76A 2KZ3A 4I2CA 2IOFK 5EWEA 1UQVA 1MQ2A 2R8KA 8ICGA 2Y0SF 2R8HA 1UA0A 4UB2A 3SYZA 4R65A 2H3ZA 4YR2A 1ZJNA 1P7DA 4DLGA 5ALKA 8ICAA 3LK9A 4F5NA 4O9MA 4UARA 4PH5A 1ZRMA 4QWCA 9ICGA 2DBYA 3PW5A 3F2CA 3SAHA 1SXDA 4CDGA 2FLPA 2OM6A 5D4BA 4JV2A 4C4TA 4O0IA 2QB1A 1Q3UA 1L3VA 4R63A 1IXRA 1XC9A 4UASA 5T14A 2Y9UA 4Q44A 4ECYA 5ALNA 9ICOA 5J8YA 3KKAA 5ALSA 2K4EA 2W7PA 1XO1A 3GV7B 2MU2A 5JRTA 3TAPA 1ZETA 5ALIA 2CN1A 3EW9A 1TFRA 1QSYA 3ALRA 2N1RA 2HDOA 3UXNA 1SGGA 3BZCA 9ICTA 1RPLA 4B9UA 2ZJ5A 5BPCA 2WF5A 5KFTA 3PW4A 4QIWC 1S77D 3EPIA 4RQMA 5DBBA 4QZ8A 2H3VA 5L9XA 2JEJA 3MABA 2KV2A 3GV5B 5H2FU 1T8EA 3KOOA 3H8SA 3GIIA 1Z19A 2W8LA 3FM9A 2LYAA 3SEIA 4FBUA 5DQHA 3HPOA 9ICAA 3ISDA 2R18A 4DL3A 1KSPA 1RZTA 1FEZA 3BQ2A 2J6SA 3QNMA 9ICFA 4I27A 2KSOB 4EBDA 1BPYA 2KKVA 3CYMA 1QCKA 5CWRA 4KN7A 2ZUDA 2F8KA 1DGSA 4I2DA 2ZUBA 2IOHA 1OXJA 3K1RB 3MR3A 2KK0A 3PSFA 4NL9A 5GTIU 2P6RA 3K4GA 4I2HA 1HEKA 3TANA 4RQ6A 1TK8A 2C2EA 3BQ7A 1S8OA 3RR8A 3JPSA 2BHNA 4KTQA 1CI4A 2E5SA 3I28A 4Y2UA 3KFUF 5KFNA 5KFGA 5AM1A 1ZQVA 4YP3A 4ED6A 2ESEA 4DFKA 2Y1IA 4B9MA 5KFCA 2BPFA 2HW3A 4QJFB 4RQ7A 5CA7A 1ZQYA 3M6KA 4YMNA 4DL4A 2AGQA 1HUOA 2K89A 1H38A 2G06A 4J9LA 4XRHA 4KLUA 2I1QA 2RHFA 3RTVA 4B9NA 1CRXA 3KHLA 1SL1A 2V4QA 3PMLA 3PX0A 5ALVA 2BPCA 3HP6A 2YQEA 4USAA 2EQYA 5KT3A 5AIAA 3HRDD 1ZQIA 1S5LU 4C4RA 3AN1A 4M9HA 1SB3C 4YFKA 5J8YC 2YB4A 2E8MA 1J2MA 2KJ8A 3KKAC 3QYPA 2A1JB 3MC1A 3AL0B 1ZD4A 2ZUCA 1F5SA 2L5YA 1TK0A 3RB3A 9ICPA 1N60A 5J2JA 5KT7A 2UVUA 4CGZA 1ZQDA 5JUMA 4TQSA 3N7SC 1O03A 2V4RA 1F44A 3C2LA 3IN5A 4QZBA 4DSJA 4ED7A 4O3OA 1NZBA 3TQ1A 1VJ5A 8ICLA 4F92B 3C29A 3GIJA 2Q0ZX 5AKIA 2YN4A 5ALQA 3RF9A 4LZGA 4EENA 8ICWA 1L8LA 1N2XA 3E2EA 1IG6A 3L5KA 4F8RA 3ZD8A 8ICOA 4I29A 2K60A 2FJ6A 2XCPA 3QEBZ 2E3TA 1X40A 2YMMA 7ICTA 3MR6A 2W54A 2HHWA 2B6GA 2MA1A 5KNIA 2AQ4A 4UAYA 2W3RA 4I2GA 1ZD5A 4ECWA 1CUKA 4J9RA 2PFQA 8ICVA 2G08A 3B0YA 1COOA 2JR5A 3Q8LA 5ALRA 4F50A 2OHFA 3RBEA 4JV1A 4P4OA 3BQTA 3BS5A 4NL9C 5J2FA 1FIQA 4IQTA 2QARA 3WKBA 4R8UA 4UB1A 1DRGA 4KLQA 1UPHA 2K4HA 2KFNA 1N5WA 3WU2U 4Z6FA 1SKSA 4EYHB 3AMZA 2KVCA 5KL8B 1S9FA 1RG6A 1N62A 4MFAA 1LB2B 4KLIA 2H3FA 1LVHA 5AKZA 2OWOA 3I1YA 4DQPA 5G5GA 9ICKA 2WF6A 2JGAA 3ZI4A 5AKHA 3S6JA 1D8LA 5G5HA 4PL2A 3JPTA 2I5HA 9ICMA 2HCFA 2K8AA 2QARB 4LVSA 4R8UB 5J0WA 1MC8A 3E58A 2PKEA 2P35A 4ELTA 1ZQEA 2P6UA 5KG7A 3N7RC 4DSIA 8ICTA 4DL5A 4YMOA 3HW8A 2QB0A 5J2GA 5DB6A 4M9LA 1VDVA 4BXOA 4U6PA 4J9PA 4DF8A 3IG8A 2GWSA 4PGQA 1ZQSA 4B9TA 4X5VA 7ICSA 4OCZA 2BZFA 1ZD3A 2W9CA 5AICA 5HHIA 1ZD2P 3B9JA 1T94A 2M9NA 4F5QA 1ZQJA 3GDXA 2XI9A 4QWEA 4NM1A 2QLTA 5CP2A 4RPZA 4P4PA 1BPXA 4CNQA 3QUTA 2PI5A 3WK4A 1S97A 2BCUA 3QXGA 3PX6A 1SKWA 1TAQA 1J97A 4CRXA 8ICSA 4RQ2A 2ZXIA 5CR0A 4UB4A 2W8KA 4BXOB 4US9A 5HMLA 1QSLA 1TKDA 2W11A 1L5UA 1NI3A 2W9CB 1NJXA 1UA1A 4ECUA 4FZMA 2O6KA 4B9LA 8ICFA 1ZQRA 4F93B 4FFDA 4GLXA 3F5AA 4TUQA 3SQIA 4ECQA 1KLNA 5L1KA 3JPOA 1KFTA 2NYVA 4Y2VA 4Y2XA 3WK8A 4DEZA 1B22A 1RYRA 2W03A 3CNHA 2VA8A 4I28A 4G3IA 3HT3A 1NKCA 5KFVA 3SV4A 4JUZA 3H8JA 3V6JA 4F71A 3WKEA 4PHAA 3G6VA 3PO4A 2KNJA 4FE3A 5KFOA 4O3SA 3V72A 3SD7A 1DXSA 1PVPA 2Z7JA 1QSSA 1X9MA 1NOMA 1JIHA 1NNLA 5KFSA 1D9FA 1Z3EB 8ICJA 2BKEA 9ICHA 1L8OA 3ISCA 2GO7A 5ALPA 2KFZA 4KLLA 1JMSA 3QUQA 4DSKA 1N5XA 1Z00B 3HX0A 2K8CB 3EWAA 5L1MA 1RXVA 5K4LA 4NJ8A 1Z4OA 5J0XA 3F2BA 4KITB 1JUDA 8ICEA 4UAZA 2W9BA 3QU9A 1ZQNA 2AH5A 4F4ZA 1MA7A 3MR5A 2Y9TA 3CP8A 5AK5A 1BPZA 2PMZC 4YCXA 4RNNA 5ALMA 1A77A 4Z6DA 3I76A 4YXJA 5ALUA 5DDYA 4BX9C 3H40A 4F4XA 5EE9A 3K75D 3D2NA 1KFSA 3V7JA 2ZTCA 1NJWA 3H7IA 1PK1A 4O5CA 2KEYA 3GQCA 4Q43A 4E0DA 4EBCA 5J0SA 2LBOA 5J2EA 4DFMA 2ZJ8A 3CW2C 4UAUA 5KFXA 4YR3A 4B9VA 2W9BB 2ISOA 1PVQA 1KN5A 2W9MA 3PW2A 3PV8A 5DB8A 2H3QA 5J2AA 3AUOA 2PXIA 4ECSA 5KFBA 5DQIA 1FFVA 2C2DA 7ICUA 2AGOA 1WCNA 3D2QA 4Z6CA 2AU0A 4DSFA 1ZQQA 4LZDA 4RQ0A 3ETLA 3C1ZA 1S0MA 4EX7A 4ELVA 1PK1B 5DG8A 4B9SA 3UXPA 4P2HA 5KTQA 1Z1VA 7ICVA 2DL0A 3C23A 2WF7A 8ICMA 2R8GA 4M6WA 1S0VA 2WB1C 2BQRA 5EWGA 1KEJA 4Y2SA 5AM4A 4NLKA 2E8PA 3PR5B 9ICCA 1XSNA 1MQ3A 3RH5A 3E0FA 1NZPA 2WAQF 8ICNA 5DG9A 2P66A 1V38A 2FE9A 4J9QA 2W55A 4M0AA 2JHDA 4F4KA 2ZG6A 1C7YA 2K4PA 5J0YA 2NO4A 5HNKA 3IHQB 1WUDA 5EE0A 3G6YA 3A0HU 2YB1A 4M6WB 1DGJA 4MF2A 3AQFA 2LPEA 5BOLA 5AHXA 1ZRNA 1X9XA 5AK6A 3KD3A 2KSOA 4F3OA 4DWIA 5AKJA 1QH9A 3RH4A 5CEHA 4KX3A 2HOQA 3T3FA 3FDSA 4NLCA 4F4WA 5DLGA 5ALWA 4QZAA 1YZ7A 1BGXT 5KL1B 1SWVA 1O08A 3U26A 2NRXA 1BNOA 3RFAA 5KG3A 4QNLA 5TZVA 3RJKA 2HBJA 3K1ZA 5DKWA 3QU4A 3SR6A 1KDHA 3MDCA 3NVVA 3TFSA 3JPRA 2HHVA 8ICUA 4Y2JA 3MDAA 4F72A 2UVVA 3ZDAA 4RUAA 1B43A 1SZHA 2MAXA 2IBKA 3L3FX 2HVHA 7ICQA 4ZOHC 5KFWA 2NRTA 2LHTA 4YN4A 3TAQA 2DQNB 4F5OA 1ZQOA 1XNSA 5JU5A 1ZQ1C 2HMXA 4ECTA 2F1IA 9ICJA 2W3SA 2GH1A 3H4BA 3IP4B 4Y2TA 2RQ5A 3HKZF 2F1HA 2LI6A 1KRPA 3AM9A 8ICRA 3NASA 1BPEA 2NRVA 3NS1A 2ZIVA 4ED8A 2KIWA 1NK9A 3IRUA 2HHSA 4PZOA 2G07A 2JMGA 3C5FA 4JWNA 3TARA 2FMQA 2DFLA 2VJ5A 1SWWA 4FBTA 5J0UA 1SV4A 3PO5A 2HI0A 2BDUA 1V9PA 2A1JA 3QU5A 4RQ4A 2EH9A 3SI8A 2KJ5A 4DFPA 3UPQA 4I2IA 4RQ5A 4R64A 2KTQA 3J81j 5KG0A 2JH1A 4IRDA 1T7PA 3KHHA 3HJEA 2ZIVB 3RJIA 3SENA 1X66A 3ZDDA 1HUZA 2A1AA 4M2YA 1C20A 4FO6A 1ZQZA 5AKYA 2EZYA 1X6IA 4M9JA 3BQ0A 3MGIA 4GXKA 4UBCA 1SKRA 1QQ7A 3UQ2A 1J2NA 1VLBA 3F5EA 4GXJA 2JH7A 1RYSA 2YMLA 2XGPA 4C8NA 4AYBC 5AM5A 4WJ3B 1RM6C 2F3NA 4NXZA 1KKXA 4RPYA 1ZQAA 5IIMA 3WKCA 3RAXA 3C1YA 5AI6A 4IQUA 3WK7A 3KBBA 1BPDA 1U4BA 4OJPA 5J29A 5CB1A 2WFAA 1UCVA 1ZQLA 4XQ8A 2R8IA 2CRXA 2EAMA 3HILA 4DL6A 3AU2A 3OSPA 3OHBA 5AI5A 5F9LA 1T3QA 4DOCA 4CE6A 3Q8QB 1Z1BA 4JB3A 4Q45A 4O5KA 2W43A 4MEXA 5HR7A 3TI0A 1M6YA 4F2RA 3UMBA 4U7CA 4I2JA 3GV8B 1NK6A 2YY6A 3PMNA 5DG7A 2WF8A 1BVSA 3OPXA 3UXOA 3EYZA 4J9OA 5FP0A 4C8MA 5J2IA 3T79A 5ALGA 3L4PA 8ICHA 4RUCA 4MFCA 1JI7A 4FS1A 2WB1F 4J9NA 5J0QA 4Q8EA 4DSEA 2BDPA 5C5JA 5AI4A 2JEFA 2FMSA 3M9NB 1K1QA 1EXNA 5L1JA 1UHUA 2R8JA 2JZBB 1JXLA 4QWBA 5J2DA 4Y2RA 4ACOA 3N28A 2XO7A 3M9OB 4GC6A 2XGQA 4OJ5A 4I2EA 5KFFA 4KLFA 1OW5A 2YX8A 5AK3A 4EEKA 1Q8KA 4P4MA 4M9GA 1D8BA 4KLDA 5HMMA 2OCEA 2M0NA 5AKLA 4AP9A 1FFUA 1IV8A 1OUQA 2DPIA 3G6XA 1X42A 2BCVA 2Y0SC 2B21A 1F0MA 3QE9Y 3QUCA 2FLLA 4YVZA 2LMRA 4M47A 3NVWA 3QU7A 2LM4A 4QIWF 1PVRA 4DL2A 1TVAA 1PK3A 3RJHA 1WYGA 3ICXA 3V7KA 2AXTU 3RJFA 2IMWP 5KFIA 2GOLA 5IIOA 3RRGA 5F3XB 1RDFA 3H0MB 3C28A 2J6UA 4BUGA 1NK5A 1KTQA 3PSPA 8ICCA 1WWUA 5KFLA 1PZNA 3OJUA 3Q8SB 2PI4A 4R66A 3LVVA 1K5OA 2OH2A 3FYHA 2J6TA 3AQEA 3WK6A 7ICJA 3LWMA 4GFJA 3H8WA 2PFNA 5DBCA 3OSNA 5IINA 4YG2A 3SAFA 2F8LA 3GIMA 5KFJA 1ZJMA 2E8NA 4ECVA 9ICUA 1SIJA 1NKBA 3F53A 2PFPA 2C22A 3OTQA 3EZ5A 2F2AB 2KHQA 3ZDCA 3V6HA 2KG5A 2VA2A 4TURA 1V97A 7ICRA 2HBKA 5KFRA 1LV5A 4EX6A 1NK0A 1NK7A 9ICQA 5L1LA 3TFRA 4DFJA 4OO1J 1X6JA 8ICIA 5AI8A 4O3MA 1U45A 5AKEA 4UB5A 1QTMA 4EYIB 1WWVA 1ZQGA 5KG4A 2I6XA 3PX4A 2XC9A 2ZJAA 4F91B 1Z00A 3KTQA 2AQ0A 1PUZA 3LYSA 1ECWA 4LJXA 3BZKA 4BWJA 2W04A 4NLBA 2KD1A 1IM4A 3RBDA 5BOMA 4RQ1A 2AGPA 2EZXA 3NGDA 3OJSA 4IC9A 5DGAA 5AK4A 1Y88A 2Q4TA 3IV6A 4PZNA 4JMUA 4DOBA 3RR7A 4P0QA 4IL6U 1Q46A 3H0RB 2GLEA 4BWMA 4P0PB 9ICXA 3ZDBA 5KFAA 2W9AA 9ICIA 4QW8A 7ICPA 4IR9A 3RB0A 4IR1A 3DDHA 5KT5A 4DO9A 1ZQXA 2EDUA 5KFQA 2JEGA 1HJPA 1X2IA 1TAUA 9ICBA 4DSLA 4IQVA 4CF3A 2JV3A 2RDIA 1U48A 2MUTA 4QWDA 5EE3A 5EWFA 5AM2A 5KFDA 5KFHA 5DDMA 3QU2A 3Q8PB 3N4MB 3B0XA 4CF5A 2G5HB 1N63A 3PVXA 3M8RA 4P0QB 4DS5A 1KL9A 4IRKA 2JEIA 1D8YA 5KG5A 5ALDA 2IHNA 4I2AA 1RXWA 3M7DA 2G09A 1SV0A 1XWLA 3VC8A 4I2BA 4RQNA 1L7NA 2BCQA 5A0LA 5KAFU 5KFMA 4QZIA 4BGDA 9ICSA 4BDPA 4IRCA 1SZPA 5ALOA 4YXMA 1S0OA 1RQLA 8ICPA 5KT6A 2UVRA 2MUTB 1MN8A 3GILA 4HAIA 9ICVA 1RQNA 3H8MA 4UBBA 5JTIA 2C28A 4PHDA 4F4YA 3ONNA 4QZGA 3WK9A 2VANA 3ETRA 1JXEA 2F44A 4XA5A 2G0AA 4UATA 2OEHA 1L7MA 4JWMA 3ZD9A 2B0CA 2KICA 3GIKA 1XU4A 3GZFA 3RJEA 2HSZA 2ASJA 2AJQA 5KT2A 1ZQBA 1L3UA 3UM9A 4UAVA 1L7PA 1X9SA 3ED5A 1L3SA 2HOFA 3VCBA 4K4IA 4FS2A 4EEYA 3JPNA 3AEVA 1AROP 3RJGA 2KP7A 1SL0A 5ALZA 5ALXA 2XY6A 7ICEA 5AKXA 3C21A 5CHGA 2DGZA 4QWAA 4J9KA 2XICA 5IIIA 4XUSA 1BPBA 5ALYA 1JRPA 4UW9A 5KFEA 1ZXIA 3RRHA 2D8CA 5ALHA 1N61A 1JALA 1ZQFA 4RPXA 4PJ0U 2ASDA 5D46A 3IG5A 4DOAA 2RDJA 2LKYA 2H3IA 2H5XA 8ICXA 7ICGA 5EOZA 3KZIU 4RQ3A 4MEYA 2ZIWA 1UT5A 4NV0A 2WF9A 3PNCA 5KG6A 4NLZA 4J9SA 4ECRA 3WKDA 4IQWA 1L3TA 2LM1A 3V6KA 2ZTDA 4ICAA 1HIWA 3C2MA 2ES6A 1LKYA 3PZPA 3CRXA 2F77X 1FO4A 2CPRA 4GIBA 4DLEA 4C7ZA 2JXJA 4K4HA 1KW4A 4A8EA 2KZZA 3M8SA 7ICNA 3OGUA 1U49A 2ZIWB 4KLGA 2FLNA 2UVWA 1SV0C 2HBMA 3IM1A 1JN3A 5J2CA 2HBLA 2YTUA 4NLGA 5ALFA 4TQRA 4ED1A 2A3VA 4B6JA 4J03A 4KLOA 5IIKA 1ED1A 1LKYB 5HHHA 5KFUA 3PW0A 5KT4A 2F1JA 3N97B 4MF8A 2BCRA 2HHUA 2ALZA 5J0OA 3KHGA 2ZIUA 9ICNA 1V85A 4QW9A 4DQIA 2KOBA 1QLNA 4BJQA 2KZMA 9ICEA 1YT3A 3JPPA 2HOIA 3H0LB 4KLEA 7ICMA 4KLMA 3MBYA 4ECZA 1Z4NA 7ICKA
chains in the Genus database with same CATH topology
1UT8A 3MFIA 1X9WA 2DPIA 3G6XA 2BCVA 4ED2A 1QSSA 2FLPA 5D4BA 4JV2A 1X9MA 1NOMA 1JIHA 4O0IA 2B21A 1L3VA 4R63A 1IXRA 3QE9Y 5KFSA 4UAWA 1XC9A 1D9FA 4F2SA 1Z3EB 2FLLA 2BKEA 8ICBA 3ORYA 3BJYA 8ICJA 3ZDEA 9ICHA 4YVZA 4Q44A 4ECYA 3ISCA 4M47A 4M04A 9ICOA 2KFZA 3KHRA 4KLLA 1JMSA 2PFOA 4DSKA 2HHQA 2FPKA 1Z00B 3HX0A 3EWAA 3GFKB 2Y1JA 5J2HA 4DL2A 1TVAA 1RXVA 3RJHA 4QZFA 3AU6A 2BDPA 5J0XA 3V7KA 1XO1A 3GV7B 4ELUA 3RJFA 2XY7A 4KITB 5L1IA 2IMWP 4GXIA 3HWTA 3TAPA 1CEZA 1ZETA 5KFIA 5IIOA 3RRGA 8ICEA 4UAZA 2W9BA 3EW9A 1TFRA 1QSYA 1ZQNA 2J6UA 1NK5A 1KTQA 3UXNA 4F4ZA 3T5JA 8ICCA 5KFLA 9ICTA 1PZNA 1RPLA 3OJUA 5DBAA 4B9UA 3MR5A 3T5LA 2ZJ5A 3Q8SB 3UQ0A 2ASLA 1BPZA 2PI4A 4R66A 5BPCA 4YCXA 5KFTA 4RNNA 3PW4A 3C5GA 1S77D 3EPIA 1A77A 4Z6DA 4YXJA 3FYHA 4QZEA 2J6TA 5DDYA 5DBBA 4QZ8A 1TV9A 4KLTA 5L9XA 7ICJA 3H40A 2JEJA 4F4XA 4JV0A 3LWMA 3H8WA 3MABA 3BQ1A 2PFNA 2V9WA 2IA6A 3K75D 3GV5B 5DBCA 3OSNA 1T8EA 3V7JA 1KFSA 2ZTCA 2JZBA 3H8SA 3H7IA 4PGXA 3LWLA 3GIIA 5IINA 1NJWA 2W8LA 4O5CA 4YG2A 3GQCA 4Q43A 1XSLA 3PW7A 5DQHA 3HPOA 1SL2A 4FBUA 4EBCA 4E0DA 3GIMA 5KFJA 5J0SA 9ICAA 3ISDA 2HHXA 1ZJMA 5KFYA 4DL3A 4ECVA 1KSPA 5J2EA 1RZTA 4ECXA 4DFMA 9ICUA 2ZJ8A 3BQ2A 5J2BA 5KFXA 4YR3A 1NKBA 2PFPA 4B9VA 2W9BB 2J6SA 4EZ6A 2ISOA 2C22A 3EZ5A 9ICFA 4I27A 3RB6A 4EBDA 2W9MA 3ZDCA 1BPYA 4I2FA 3V6HA 3RB4A 2VA2A 4TURA 3PW2A 3PV8A 1NKEA 7ICRA 5DB8A 5IIJA 4PHPA 5J2AA 5KFRA 1LV5A 4KMUA 1KFDA 3AUOA 2BQUA 1NK7A 1NK0A 2PXIA 4ECSA 5CWRA 3V7LA 5L1LA 3TFRA 5KFBA 4DFJA 4KN7A 1NK8A 1XS9D 5KFPA 9ICQA 5DQIA 2ZUDA 8ICIA 5DLFA 2C2DA 1DGSA 4I2DA 7ICUA 2AGOA 1WCNA 2FPLA 2ZUBA 1U45A 4Z6CA 2AU0A 4DSFA 1ZQQA 4UB5A 4LZDA 5DQGA 3MR3A 4RQ0A 3ETLA 4HYKA 1QTMA 4C8KA 4KLSA 2HHTA 4EYIB 5HP4A 9ICWA 3C1ZA 5IILA 1U47A 1S0MA 1ZQGA 4ELVA 2NRWA 7ICLA 5KG4A 5DG8A 4QZCA 3RAQA 4B9SA 2P6RA 3PX4A 3UXPA 4P2HA 3K4GA 5KTQA 2XC9A 4F5PA 1MSWD 2ATLA 7ICVA 4I2HA 2ZJAA 4F91B 1Z00A 3TANA 5KFKA 4RQ6A 1TK8A 3KTQA 3C23A 2C2EA 8ICMA 2R8GA 4M6WA 3RR8A 3JPSA 1S0VA 2BHNA 2AQ0A 1NJZA 2BQRA 4KTQA 5EWGA 2C2RA 1KEJA 5KFNA 1ZQKA 4NLKA 4BWJA 9ICRA 3PR5B 2FMPA 4RT2A 9ICCA 1XSNA 5KFGA 2DPJA 1MQ3A 3RH5A 1IM4A 3RBDA 5BOMA 1ZYQA 4YR0A 4RQ1A 1ZQVA 4YP3A 4ED6A 8ICNA 4DFKA 2Y1IA 3RH6A 2AGPA 5DG9A 2P66A 4B9MA 5KFCA 3NGDA 3OJSA 5DGAA 4J9QA 2BPFA 1Y88A 3PR4A 2HW3A 4UQGA 4RQ7A 5CA7A 1ZQYA 4YMNA 4DL4A 2ZTEA 2AGQA 1HUOA 3PY8A 4M0AA 1H38A 4J9LA 4F4KA 1N48A 4RZRA 1C7YA 4XRHA 3SV3A 4KLUA 5J0YA 4GC7A 2FPMA 2I1QA 4DOBA 3RTVA 3RR7A 4B9NA 3KHLA 4DQRA 1SL1A 5HNKA 2V4QA 3T5HA 3IHQB 3PMLA 3PX0A 3G6YA 2BPCA 3HP6A 4M6WB 4BWMA 9ICXA 5KT3A 3ZDBA 5KFAA 2W9AA 9ICIA 2WTFA 4QW8A 7ICPA 4IR9A 3RB0A 4QZ9A 5J2KA 5KT5A 1DOQA 4DO9A 3THVA 1ZQIA 4IR1A 4MF2A 1ZQXA 5KFQA 4M9HA 5BOLA 4YFKA 4EBEA 2JEGA 1HJPA 1ZQTA 4KLJA 1X2IA 1TAUA 4F3OA 4DWIA 9ICBA 9ICLA 3SZ2A 4DSLA 4IQVA 3RH4A 5J0TA 3ISBA 2A1JB 2RDIA 1U48A 3T3FA 2MUTA 4Z6EA 3FDSA 4PGYA 3QZ8A 4QWDA 4F4WA 5DLGA 4O3PA 4QZAA 2ZUCA 5EWFA 4QZHA 5KFDA 1BGXT 5KFHA 5DDMA 3Q8PB 8ICKA 1TK0A 2NRXA 3B0XA 3N4MB 3RB3A 3PVXA 3JPQA 3M8RA 9ICPA 4YD2A 5KG3A 5J2JA 5KT7A 5TZVA 7ICOA 3RJKA 2UVUA 4DS5A 5DKWA 4IRKA 2JEIA 1D8YA 4ED3A 1KDHA 3MDCA 1ZQDA 5KG5A 1D9DA 4TUSA 5JUMA 2IHNA 4TQSA 2BGWA 4I2AA 3TFSA 3JPRA 1XSPA 1RXWA 2HHVA 8ICUA 3MDAA 2V4RA 2UVVA 1XWLA 3ZDAA 4I2BA 3LDAA 4RUAA 2BCQA 3C2LA 5KFMA 1B43A 2MAXA 4QZIA 2IBKA 4EZ9A 2HVHA 4QZBA 7ICQA 4BGDA 5KFWA 4DSJA 2NRTA 1K1SA 9ICSA 4ED7A 4O3OA 1N56A 4YN4A 4BDPA 3TQ1A 3TAQA 4IRCA 8ICLA 1SZPA 4F92B 4YXMA 4F5OA 3GIJA 1ZQOA 2Q0ZX 1S0OA 2VA3A 8ICPA 4LZGA 5KT6A 1ZQUA 2UVRA 8ICZA 2MUTB 3GILA 5CJ7A 4ECTA 8ICWA 2F1IA 1JX4A 9ICVA 9ICJA 3H4BA 4UBBA 2BCSA 2C28A 4DF4A 3E2EA 4PHDA 2XY5A 4F4YA 4F8RA 4QZGA 2HVIA 3ZD8A 4ZH4A 1U9LA 8ICOA 4I29A 2VANA 1S10A 2XCPA 2F1HA 4ED0A 3QEBZ 1JXEA 7ICTA 4XA5A 3MR6A 5DB7A 1KRPA 2HHWA 4YMMA 8ICRA 7ICHA 1S0NA 1BPEA 4YD1A 3ZD9A 4JWMA 2NRVA 4ED8A 2AQ4A 4UAYA 3C2KA 4DQQA 2LYHA 3GIKA 1NK9A 1XU4A 5DGBA 4I2GA 3RJEA 4ECWA 1CUKA 4J9RA 2ASJA 2PFQA 2HHSA 8ICVA 2AJQA 5KT2A 4PPXA 1ZQBA 4NY8A 3M9MB 3B0YA 3C5FA 1L3UA 4JWNA 4M9NA 1COOA 4DL7A 3Q8LA 1X9SA 4F50A 8ICQA 3RBEA 3RJJA 4JV1A 4P4OA 3TARA 2FMQA 3BQTA 1T3NA 2DFLA 2BR0A 1L3SA 5J2FA 4RT3A 4O3NA 4FBTA 4IQTA 4K4IA 5J0UA 3PO5A 4R8UA 4UB1A 4FS2A 4EEYA 3Q8KA 3JPNA 2BPGA 4KLQA 1V9PA 2A1JA 4RU9A 3SI8A 1AROP 4RQ4A 3QEAZ 3RJGA 1SL0A 2IHMA 3MGHA 2XY6A 7ICEA 4DFPA 2KFNA 3T5KA 4Z6FA 3UPQA 1SKSA 4I2IA 4RQ5A 4EYHB 4R64A 3C21A 5CHGA 2KTQA 3BDPA 5KG0A 4QWAA 4IRDA 4J9KA 5IIIA 4XUSA 4QZDA 1S9FA 3Q8RB 1T7PA 3KHHA 1BPBA 4PHEA 4MFAA 7ICIA 1LB2B 2I9GA 4KLIA 4O3RA 3RJIA 5KFEA 4O3QA 1WCLA 3RRHA 2OWOA 7ICFA 1NJYA 4DQPA 5DB9A 3ZDDA 1HUZA 4M2YA 9ICKA 3H4DA 3MFHA 4FO6A 1ZQZA 4RNMA 1ZQFA 3MR2A 4RPXA 4M9JA 4NLNA 3BQ0A 3MGIA 4GXKA 4UBCA 5D46A 2ASDA 4RQ8A 4DOAA 1SKRA 2RDJA 2ISPA 3UQ2A 1D8LA 2KN7A 3JPTA 3OHAA 4DQSA 9ICMA 4J9MA 5KG2A 4LVSA 2H5XA 4R8UB 5J0WA 4GXJA 1RYSA 1MC8A 4RNOA 8ICXA 7ICGA 4C8NA 5EOZA 4JK1A 2XGPA 4RQ3A 4C8LA 4MEYA 1UT5A 4ELTA 3PNCA 4O5EA 4YQWA 4NXZA 1ZQCA 1ZQEA 2P6UA 4RPYA 5KG7A 1ZQAA 4DSIA 5IIMA 8ICTA 3RAXA 5KG6A 4NLZA 4J9SA 3C1YA 4DL5A 4ECRA 4YMOA 3Q8MA 3HW8A 5KFZA 5J2GA 4KN4A 4IQUA 5DB6A 4M9LA 4BXOA 4IQWA 4J9PA 1BPDA 4DF8A 2GWSA 1T4GA 1U4BA 4PGQA 1L3TA 1ZQSA 4B9TA 4X5VA 7ICSA 3V6KA 2ZTDA 5J29A 5CB1A 1ZQHA 2W9CA 1ZQLA 3C2MA 5F9NA 4XQ8A 2R8IA 5HHIA 4CCHA 4DL6A 3AU2A 3OSPA 3OHBA 4F5QA 2M9NA 1TK5A 1NK4A 4DLEA 5F9LA 4NM2A 1ZQJA 3GDXA 4DOCA 3Q8QB 4QWEA 4K4HA 4Q45A 4NM1A 5CP2A 5J0RA 4O5KA 4F5RA 2KZZA 4RPZA 4MEXA 3M8SA 3NTUA 2BQ3A 7ICNA 3OGUA 1U49A 5D49A 4P4PA 1BPXA 3TI0A 2PI5A 4KLGA 4F2RA 2FLNA 4C8OA 1S97A 2UVWA 4I2JA 2BCUA 3GV8B 2XCAA 3PX6A 3IM1A 1NK6A 1SKWA 1JN3A 8ICYA 5J2CA 1TAQA 3PMNA 3QZ7A 5DG7A 1BVSA 3UXOA 4NLGA 3EYZA 4J9OA 4C8MA 4TQRA 4ED1A 8ICSA 4RQ2A 5CR0A 4UB4A 5J2IA 4Q8FA 4UB3A 2W8KA 4BXOB 1S76D 8ICHA 1ZQWA 4RUCA 5KG1A 4MFCA 5HMLA 4KLHA 1QSLA 5J0PA 4FS1A 3EPGA 4DS4A 4J9NA 1TKDA 4KLOA 1L5UA 1ZQMA 4MFFA 5IIKA 2W9CB 1NJXA 5J0QA 1UA1A 5HHHA 4ECUA 5KFUA 4Q8EA 4K4GA 3PW0A 4DSEA 4B9LA 8ICFA 2NRZA 2F1JA 4F93B 5C5JA 5KT4A 4GLXA 3N97B 4TUPA 4TUQA 1ZQRA 3M9NB 1ZQPA 2FMSA 2JEFA 1A76A 4MF8A 1K1QA 4ECQA 2KZ3A 1KLNA 2BCRA 1EXNA 5EWEA 4I2CA 5L1KA 2HHUA 2ALZA 3JPOA 5J0OA 1KFTA 3KHGA 4DEZA 1MQ2A 5L1JA 2R8JA 9ICNA 2JZBB 2R8KA 1B22A 8ICGA 1RYRA 2R8HA 4QW9A 1JXLA 4QWBA 1UA0A 4DQIA 1QLNA 5J2DA 2VA8A 4UB2A 3SYZA 4I28A 4R65A 4G3IA 4YR2A 2XO7A 3HT3A 3M9OB 4GC6A 1ZJNA 5KFVA 1NKCA 2XGQA 3SV4A 2KZMA 4I2EA 9ICEA 4JUZA 3JPPA 5KFFA 4KLFA 3H8JA 4DLGA 3V6JA 8ICAA 3LK9A 4F5NA 4PHAA 4O9MA 4PH5A 3G6VA 3PO4A 4QWCA 4KLEA 9ICGA 4P4MA 4M9GA 5KFOA 7ICMA 4KLMA 3PW5A 4O3SA 3V72A 3MBYA 4ECZA 4KLDA 5HMMA 7ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UT8 A;  3MFI A;  1X9W A;  2DPI A;  3G6X A;  2BCV A;  4ED2 A;  1QSS A;  2FLP A;  5D4B A;  4JV2 A;  1X9M A;  1NOM A;  1JIH A;  4O0I A;  2B21 A;  1L3V A;  4R63 A;  1IXR A;  3QE9 Y;  5KFS A;  4UAW A;  1XC9 A;  1D9F A;  4F2S A;  1Z3E B;  2FLL A;  2BKE A;  8ICB A;  3ORY A;  3BJY A;  8ICJ A;  3ZDE A;  9ICH A;  4YVZ A;  4Q44 A;  4ECY A;  3ISC A;  4M47 A;  4M04 A;  9ICO A;  2KFZ A;  3KHR A;  4KLL A;  1JMS A;  2PFO A;  4DSK A;  2HHQ A;  2FPK A;  1Z00 B;  3HX0 A;  3EWA A;  3GFK B;  2Y1J A;  5J2H A;  4DL2 A;  1TVA A;  1RXV A;  3RJH A;  4QZF A;  3AU6 A;  2BDP A;  5J0X A;  3V7K A;  1XO1 A;  3GV7 B;  4ELU A;  3RJF A;  2XY7 A;  4KIT B;  5L1I A;  2IMW P;  4GXI A;  3HWT A;  3TAP A;  1CEZ A;  1ZET A;  5KFI A;  5IIO A;  3RRG A;  8ICE A;  4UAZ A;  2W9B A;  3EW9 A;  1TFR A;  1QSY A;  1ZQN A;  2J6U A;  1NK5 A;  1KTQ A;  3UXN A;  4F4Z A;  3T5J A;  8ICC A;  5KFL A;  9ICT A;  1PZN A;  1RPL A;  3OJU A;  5DBA A;  4B9U A;  3MR5 A;  3T5L A;  2ZJ5 A;  3Q8S B;  3UQ0 A;  2ASL A;  1BPZ A;  2PI4 A;  4R66 A;  5BPC A;  4YCX A;  5KFT A;  4RNN A;  3PW4 A;  3C5G A;  1S77 D;  3EPI A;  1A77 A;  4Z6D A;  4YXJ A;  3FYH A;  4QZE A;  2J6T A;  5DDY A;  5DBB A;  4QZ8 A;  1TV9 A;  4KLT A;  5L9X A;  7ICJ A;  3H40 A;  2JEJ A;  4F4X A;  4JV0 A;  3LWM A;  3H8W A;  3MAB A;  3BQ1 A;  2PFN A;  2V9W A;  2IA6 A;  3K75 D;  3GV5 B;  5DBC A;  3OSN A;  1T8E A;  3V7J A;  1KFS A;  2ZTC A;  2JZB A;  3H8S A;  3H7I A;  4PGX A;  3LWL A;  3GII A;  5IIN A;  1NJW A;  2W8L A;  4O5C A;  4YG2 A;  3GQC A;  4Q43 A;  1XSL A;  3PW7 A;  5DQH A;  3HPO A;  1SL2 A;  4FBU A;  4EBC A;  4E0D A;  3GIM A;  5KFJ A;  5J0S A;  9ICA A;  3ISD A;  2HHX A;  1ZJM A;  5KFY A;  4DL3 A;  4ECV A;  1KSP A;  5J2E A;  1RZT A;  4ECX A;  4DFM A;  9ICU A;  2ZJ8 A;  3BQ2 A;  5J2B A;  5KFX A;  4YR3 A;  1NKB A;  2PFP A;  4B9V A;  2W9B B;  2J6S A;  4EZ6 A;  2ISO A;  2C22 A;  3EZ5 A;  9ICF A;  4I27 A;  3RB6 A;  4EBD A;  2W9M A;  3ZDC A;  1BPY A;  4I2F A;  3V6H A;  3RB4 A;  2VA2 A;  4TUR A;  3PW2 A;  3PV8 A;  1NKE A;  7ICR A;  5DB8 A;  5IIJ A;  4PHP A;  5J2A A;  5KFR A;  1LV5 A;  4KMU A;  1KFD A;  3AUO A;  2BQU A;  1NK7 A;  1NK0 A;  2PXI A;  4ECS A;  5CWR A;  3V7L A;  5L1L A;  3TFR A;  5KFB A;  4DFJ A;  4KN7 A;  1NK8 A;  1XS9 D;  5KFP A;  9ICQ A;  5DQI A;  2ZUD A;  8ICI A;  5DLF A;  2C2D A;  1DGS A;  4I2D A;  7ICU A;  2AGO A;  1WCN A;  2FPL A;  2ZUB A;  1U45 A;  4Z6C A;  2AU0 A;  4DSF A;  1ZQQ A;  4UB5 A;  4LZD A;  5DQG A;  3MR3 A;  4RQ0 A;  3ETL A;  4HYK A;  1QTM A;  4C8K A;  4KLS A;  2HHT A;  4EYI B;  5HP4 A;  9ICW A;  3C1Z A;  5IIL A;  1U47 A;  1S0M A;  1ZQG A;  4ELV A;  2NRW A;  7ICL A;  5KG4 A;  5DG8 A;  4QZC A;  3RAQ A;  4B9S A;  2P6R A;  3PX4 A;  3UXP A;  4P2H A;  3K4G A;  5KTQ A;  2XC9 A;  4F5P A;  1MSW D;  2ATL A;  7ICV A;  4I2H A;  2ZJA A;  4F91 B;  1Z00 A;  3TAN A;  5KFK A;  4RQ6 A;  1TK8 A;  3KTQ A;  3C23 A;  2C2E A;  8ICM A;  2R8G A;  4M6W A;  3RR8 A;  3JPS A;  1S0V A;  2BHN A;  2AQ0 A;  1NJZ A;  2BQR A;  4KTQ A;  5EWG A;  2C2R A;  1KEJ A;  5KFN A;  1ZQK A;  4NLK A;  4BWJ A;  9ICR A;  3PR5 B;  2FMP A;  4RT2 A;  9ICC A;  1XSN A;  5KFG A;  2DPJ A;  1MQ3 A;  3RH5 A;  1IM4 A;  3RBD A;  5BOM A;  1ZYQ A;  4YR0 A;  4RQ1 A;  1ZQV A;  4YP3 A;  4ED6 A;  8ICN A;  4DFK A;  2Y1I A;  3RH6 A;  2AGP A;  5DG9 A;  2P66 A;  4B9M A;  5KFC A;  3NGD A;  3OJS A;  5DGA A;  4J9Q A;  2BPF A;  1Y88 A;  3PR4 A;  2HW3 A;  4UQG A;  4RQ7 A;  5CA7 A;  1ZQY A;  4YMN A;  4DL4 A;  2ZTE A;  2AGQ A;  1HUO A;  3PY8 A;  4M0A A;  1H38 A;  4J9L A;  4F4K A;  1N48 A;  4RZR A;  1C7Y A;  4XRH A;  3SV3 A;  4KLU A;  5J0Y A;  4GC7 A;  2FPM A;  2I1Q A;  4DOB A;  3RTV A;  3RR7 A;  4B9N A;  3KHL A;  4DQR A;  1SL1 A;  5HNK A;  2V4Q A;  3T5H A;  3IHQ B;  3PML A;  3PX0 A;  3G6Y A;  2BPC A;  3HP6 A;  4M6W B;  4BWM A;  9ICX A;  5KT3 A;  3ZDB A;  5KFA A;  2W9A A;  9ICI A;  2WTF A;  4QW8 A;  7ICP A;  4IR9 A;  3RB0 A;  4QZ9 A;  5J2K A;  5KT5 A;  1DOQ A;  4DO9 A;  3THV A;  1ZQI A;  4IR1 A;  4MF2 A;  1ZQX A;  5KFQ A;  4M9H A;  5BOL A;  4YFK A;  4EBE A;  2JEG A;  1HJP A;  1ZQT A;  4KLJ A;  1X2I A;  1TAU A;  4F3O A;  4DWI A;  9ICB A;  9ICL A;  3SZ2 A;  4DSL A;  4IQV A;  3RH4 A;  5J0T A;  3ISB A;  2A1J B;  2RDI A;  1U48 A;  3T3F A;  2MUT A;  4Z6E A;  3FDS A;  4PGY A;  3QZ8 A;  4QWD A;  4F4W A;  5DLG A;  4O3P A;  4QZA A;  2ZUC A;  5EWF A;  4QZH A;  5KFD A;  1BGX T;  5KFH A;  5DDM A;  3Q8P B;  8ICK A;  1TK0 A;  2NRX A;  3B0X A;  3N4M B;  3RB3 A;  3PVX A;  3JPQ A;  3M8R A;  9ICP A;  4YD2 A;  5KG3 A;  5J2J A;  5KT7 A;  5TZV A;  7ICO A;  3RJK A;  2UVU A;  4DS5 A;  5DKW A;  4IRK A;  2JEI A;  1D8Y A;  4ED3 A;  1KDH A;  3MDC A;  1ZQD A;  5KG5 A;  1D9D A;  4TUS A;  5JUM A;  2IHN A;  4TQS A;  2BGW A;  4I2A A;  3TFS A;  3JPR A;  1XSP A;  1RXW A;  2HHV A;  8ICU A;  3MDA A;  2V4R A;  2UVV A;  1XWL A;  3ZDA A;  4I2B A;  3LDA A;  4RUA A;  2BCQ A;  3C2L A;  5KFM A;  1B43 A;  2MAX A;  4QZI A;  2IBK A;  4EZ9 A;  2HVH A;  4QZB A;  7ICQ A;  4BGD A;  5KFW A;  4DSJ A;  2NRT A;  1K1S A;  9ICS A;  4ED7 A;  4O3O A;  1N56 A;  4YN4 A;  4BDP A;  3TQ1 A;  3TAQ A;  4IRC A;  8ICL A;  1SZP A;  4F92 B;  4YXM A;  4F5O A;  3GIJ A;  1ZQO A;  2Q0Z X;  1S0O A;  2VA3 A;  8ICP A;  4LZG A;  5KT6 A;  1ZQU A;  2UVR A;  8ICZ A;  2MUT B;  3GIL A;  5CJ7 A;  4ECT A;  8ICW A;  2F1I A;  1JX4 A;  9ICV A;  9ICJ A;  3H4B A;  4UBB A;  2BCS A;  2C28 A;  4DF4 A;  3E2E A;  4PHD A;  2XY5 A;  4F4Y A;  4F8R A;  4QZG A;  2HVI A;  3ZD8 A;  4ZH4 A;  1U9L A;  8ICO A;  4I29 A;  2VAN A;  1S10 A;  2XCP A;  2F1H A;  4ED0 A;  3QEB Z;  1JXE A;  7ICT A;  4XA5 A;  3MR6 A;  5DB7 A;  1KRP A;  2HHW A;  4YMM A;  8ICR A;  7ICH A;  1S0N A;  1BPE A;  4YD1 A;  3ZD9 A;  4JWM A;  2NRV A;  4ED8 A;  2AQ4 A;  4UAY A;  3C2K A;  4DQQ A;  2LYH A;  3GIK A;  1NK9 A;  1XU4 A;  5DGB A;  4I2G A;  3RJE A;  4ECW A;  1CUK A;  4J9R A;  2ASJ A;  2PFQ A;  2HHS A;  8ICV A;  2AJQ A;  5KT2 A;  4PPX A;  1ZQB A;  4NY8 A;  3M9M B;  3B0Y A;  3C5F A;  1L3U A;  4JWN A;  4M9N A;  1COO A;  4DL7 A;  3Q8L A;  1X9S A;  4F50 A;  8ICQ A;  3RBE A;  3RJJ A;  4JV1 A;  4P4O A;  3TAR A;  2FMQ A;  3BQT A;  1T3N A;  2DFL A;  2BR0 A;  1L3S A;  5J2F A;  4RT3 A;  4O3N A;  4FBT A;  4IQT A;  4K4I A;  5J0U A;  3PO5 A;  4R8U A;  4UB1 A;  4FS2 A;  4EEY A;  3Q8K A;  3JPN A;  2BPG A;  4KLQ A;  1V9P A;  2A1J A;  4RU9 A;  3SI8 A;  1ARO P;  4RQ4 A;  3QEA Z;  3RJG A;  1SL0 A;  2IHM A;  3MGH A;  2XY6 A;  7ICE A;  4DFP A;  2KFN A;  3T5K A;  4Z6F A;  3UPQ A;  1SKS A;  4I2I A;  4RQ5 A;  4EYH B;  4R64 A;  3C21 A;  5CHG A;  2KTQ A;  3BDP A;  5KG0 A;  4QWA A;  4IRD A;  4J9K A;  5III A;  4XUS A;  4QZD A;  1S9F A;  3Q8R B;  1T7P A;  3KHH A;  1BPB A;  4PHE A;  4MFA A;  7ICI A;  1LB2 B;  2I9G A;  4KLI A;  4O3R A;  3RJI A;  5KFE A;  4O3Q A;  1WCL A;  3RRH A;  2OWO A;  7ICF A;  1NJY A;  4DQP A;  5DB9 A;  3ZDD A;  1HUZ A;  4M2Y A;  9ICK A;  3H4D A;  3MFH A;  4FO6 A;  1ZQZ A;  4RNM A;  1ZQF A;  3MR2 A;  4RPX A;  4M9J A;  4NLN A;  3BQ0 A;  3MGI A;  4GXK A;  4UBC A;  5D46 A;  2ASD A;  4RQ8 A;  4DOA A;  1SKR A;  2RDJ A;  2ISP A;  3UQ2 A;  1D8L A;  2KN7 A;  3JPT A;  3OHA A;  4DQS A;  9ICM A;  4J9M A;  5KG2 A;  4LVS A;  2H5X A;  4R8U B;  5J0W A;  4GXJ A;  1RYS A;  1MC8 A;  4RNO A;  8ICX A;  7ICG A;  4C8N A;  5EOZ A;  4JK1 A;  2XGP A;  4RQ3 A;  4C8L A;  4MEY A;  1UT5 A;  4ELT A;  3PNC A;  4O5E A;  4YQW A;  4NXZ A;  1ZQC A;  1ZQE A;  2P6U A;  4RPY A;  5KG7 A;  1ZQA A;  4DSI A;  5IIM A;  8ICT A;  3RAX A;  5KG6 A;  4NLZ A;  4J9S A;  3C1Y A;  4DL5 A;  4ECR A;  4YMO A;  3Q8M A;  3HW8 A;  5KFZ A;  5J2G A;  4KN4 A;  4IQU A;  5DB6 A;  4M9L A;  4BXO A;  4IQW A;  4J9P A;  1BPD A;  4DF8 A;  2GWS A;  1T4G A;  1U4B A;  4PGQ A;  1L3T A;  1ZQS A;  4B9T A;  4X5V A;  7ICS A;  3V6K A;  2ZTD A;  5J29 A;  5CB1 A;  1ZQH A;  2W9C A;  1ZQL A;  3C2M A;  5F9N A;  4XQ8 A;  2R8I A;  5HHI A;  4CCH A;  4DL6 A;  3AU2 A;  3OSP A;  3OHB A;  4F5Q A;  2M9N A;  1TK5 A;  1NK4 A;  4DLE A;  5F9L A;  4NM2 A;  1ZQJ A;  3GDX A;  4DOC A;  3Q8Q B;  4QWE A;  4K4H A;  4Q45 A;  4NM1 A;  5CP2 A;  5J0R A;  4O5K A;  4F5R A;  2KZZ A;  4RPZ A;  4MEX A;  3M8S A;  3NTU A;  2BQ3 A;  7ICN A;  3OGU A;  1U49 A;  5D49 A;  4P4P A;  1BPX A;  3TI0 A;  2PI5 A;  4KLG A;  4F2R A;  2FLN A;  4C8O A;  1S97 A;  2UVW A;  4I2J A;  2BCU A;  3GV8 B;  2XCA A;  3PX6 A;  3IM1 A;  1NK6 A;  1SKW A;  1JN3 A;  8ICY A;  5J2C A;  1TAQ A;  3PMN A;  3QZ7 A;  5DG7 A;  1BVS A;  3UXO A;  4NLG A;  3EYZ A;  4J9O A;  4C8M A;  4TQR A;  4ED1 A;  8ICS A;  4RQ2 A;  5CR0 A;  4UB4 A;  5J2I A;  4Q8F A;  4UB3 A;  2W8K A;  4BXO B;  1S76 D;  8ICH A;  1ZQW A;  4RUC A;  5KG1 A;  4MFC A;  5HML A;  4KLH A;  1QSL A;  5J0P A;  4FS1 A;  3EPG A;  4DS4 A;  4J9N A;  1TKD A;  4KLO A;  1L5U A;  1ZQM A;  4MFF A;  5IIK A;  2W9C B;  1NJX A;  5J0Q A;  1UA1 A;  5HHH A;  4ECU A;  5KFU A;  4Q8E A;  4K4G A;  3PW0 A;  4DSE A;  4B9L A;  8ICF A;  2NRZ A;  2F1J A;  4F93 B;  5C5J A;  5KT4 A;  4GLX A;  3N97 B;  4TUP A;  4TUQ A;  1ZQR A;  3M9N B;  1ZQP A;  2FMS A;  2JEF A;  1A76 A;  4MF8 A;  1K1Q A;  4ECQ A;  2KZ3 A;  1KLN A;  2BCR A;  1EXN A;  5EWE A;  4I2C A;  5L1K A;  2HHU A;  2ALZ A;  3JPO A;  5J0O A;  1KFT A;  3KHG A;  4DEZ A;  1MQ2 A;  5L1J A;  2R8J A;  9ICN A;  2JZB B;  2R8K A;  1B22 A;  8ICG A;  1RYR A;  2R8H A;  4QW9 A;  1JXL A;  4QWB A;  1UA0 A;  4DQI A;  1QLN A;  5J2D A;  2VA8 A;  4UB2 A;  3SYZ A;  4I28 A;  4R65 A;  4G3I A;  4YR2 A;  2XO7 A;  3HT3 A;  3M9O B;  4GC6 A;  1ZJN A;  5KFV A;  1NKC A;  2XGQ A;  3SV4 A;  2KZM A;  4I2E A;  9ICE A;  4JUZ A;  3JPP A;  5KFF A;  4KLF A;  3H8J A;  4DLG A;  3V6J A;  8ICA A;  3LK9 A;  4F5N A;  4PHA A;  4O9M A;  4PH5 A;  3G6V A;  3PO4 A;  4QWC A;  4KLE A;  9ICG A;  4P4M A;  4M9G A;  5KFO A;  7ICM A;  4KLM A;  3PW5 A;  4O3S A;  3V72 A;  3MBY A;  4ECZ A;  4KLD A;  5HMM A;  7ICK A; 
#chains in the Genus database with same CATH topology
 1UT8 A;  3DEE A;  3MFI A;  1X9W A;  2WHE A;  3F2D A;  2ODG A;  4C4S A;  2ZXH A;  4ED2 A;  2DKX A;  1QQ6 A;  2EAP A;  3TAD A;  3FC4 A;  4UAW A;  4F2S A;  8ICB A;  3ORY A;  3BJY A;  3NRW A;  3NVZ A;  3ZDE A;  3LVW A;  2ZIU B;  4M04 A;  2KMD A;  1L6N A;  3KHR A;  5ALJ A;  2PMZ F;  2PFO A;  2HHQ A;  2FPK A;  1B4F A;  3GFK B;  2Y1J A;  5J2H A;  2XVT A;  4QZF A;  4OJL A;  3AU6 A;  4ELU A;  5KAI U;  2EZZ A;  2XY7 A;  5L1I A;  2XID A;  4GXI A;  3HWT A;  1CEZ A;  1JRO A;  5HR6 A;  3EUB 2;  5E79 U;  4C80 A;  2EAN A;  3SMV A;  2KJ9 A;  3DV9 A;  2OYY A;  2A19 A;  3T5J A;  5C0Y A;  2RRD A;  5DBA A;  3T5L A;  3UQ0 A;  2ASL A;  5AKK A;  3C5G A;  4QZE A;  1TV9 A;  4KLT A;  4JV0 A;  3BQ1 A;  2KHV A;  2V9W A;  2IA6 A;  4MHV A;  2JZB A;  4PGX A;  3LWL A;  2OXO A;  3QX7 A;  2AHO B;  1XSL A;  3PW7 A;  1SL2 A;  2HHX A;  5KFY A;  1QQ5 A;  4ECX A;  5AM0 A;  5J2B A;  4EZ6 A;  2E1E A;  4KX5 A;  1BNP A;  1KQQ A;  1YZ6 A;  3RB6 A;  4I2F A;  3RB4 A;  1NKE A;  5IIJ A;  4PHP A;  2D3D A;  1L7O A;  4KMU A;  1KFD A;  2BQU A;  1NK8 A;  3V7L A;  1XS9 D;  5KFP A;  5DLF A;  4DFD A;  2FPL A;  3M1Y A;  1TE2 A;  5DQG A;  4C8K A;  4HYK A;  2HHT A;  4KLS A;  9ICW A;  5HP4 A;  4CF4 A;  5IIL A;  1U47 A;  2NRW A;  7ICL A;  1SXE A;  4QZC A;  3RAQ A;  4F5P A;  1MSW D;  2ATL A;  5KFK A;  2VIX A;  4US8 A;  1NJZ A;  3D6J A;  2C2R A;  4OJ6 A;  2IOF A;  1ZQK A;  9ICR A;  2FMP A;  1DK3 A;  4RT2 A;  3PSI A;  2DPJ A;  4EEL A;  1ZYQ A;  4YR0 A;  2K4I A;  3RH6 A;  4G9B A;  1RYU A;  5AI0 A;  3TKA A;  3NRZ A;  3O0F A;  4UQG A;  3PR4 A;  3PY8 A;  2ZTE A;  2YMQ A;  1N48 A;  4UB8 U;  3WK5 A;  4RZR A;  3SV3 A;  2F76 X;  4GC7 A;  2ZIX A;  2FPM A;  3R9K A;  4DQR A;  3T5H A;  3KZX A;  3TAD C;  2WTF A;  2WAQ C;  4QZ9 A;  5J2K A;  1DOQ A;  2VJ4 A;  3THV A;  5CRX A;  4EBE A;  4KLJ A;  3IDW A;  1ZQT A;  3QUB A;  1AQ6 A;  2E1F A;  3BS5 B;  2KIV A;  9ICL A;  3SZ2 A;  1A6S A;  5J0T A;  3ISB A;  4Z6E A;  4PGY A;  3QZ8 A;  4O3P A;  3TAC B;  4OJO A;  4QZH A;  5AIB A;  5B5E U;  1GO3 F;  8ICK A;  2ZIX B;  3JPQ A;  4YD2 A;  7ICO A;  3NUQ A;  2FDR A;  4UB6 U;  5B66 U;  4ED3 A;  1D9D A;  4TUS A;  2E8O A;  2BGW A;  1XSP A;  2RP5 A;  3LDA A;  4EZ9 A;  4IS7 A;  2DWQ A;  1K1S A;  1N56 A;  2YMP A;  1DK2 A;  2VA3 A;  2KKP A;  1ZQU A;  3MGV A;  8ICZ A;  5CJ7 A;  1JX4 A;  5ALL A;  2BCS A;  4DF4 A;  3SAG A;  4FZN A;  2XY5 A;  2HVI A;  4ZH4 A;  1U9L A;  2RLT A;  2QB0 B;  1S10 A;  5EE1 A;  4ED0 A;  3A0B U;  5DB7 A;  4YMM A;  7ICH A;  1S0N A;  4YD1 A;  3M6Z A;  3C2K A;  4DQQ A;  2D6F C;  2LYH A;  5DGB A;  3D2S A;  4P0P A;  4PPX A;  3UMG A;  3M9M B;  4NY8 A;  2K8B B;  4M9N A;  2QKQ A;  4DL7 A;  1COK A;  4FZL A;  8ICQ A;  3RJJ A;  3PST A;  1T3N A;  2BR0 A;  4RT3 A;  3HKZ C;  4O3N A;  2KE7 A;  2MSN A;  3Q8K A;  2BPG A;  4RU9 A;  3QEA Z;  2NO5 A;  2IHM A;  3NVY A;  2CXY A;  3MGH A;  3T5K A;  3GU3 A;  4DCC A;  2KVS A;  3BDP A;  4QZD A;  4AYB F;  3Q8R B;  5ALT A;  2DUY A;  4PHE A;  5AKG A;  3WKA A;  7ICI A;  4Y2P A;  2I9G A;  4O3R A;  4O3Q A;  1WCL A;  7ICF A;  1NJY A;  4NWI A;  5DB9 A;  1XO0 A;  4C7Y A;  3H4D A;  5ALE A;  4PL1 A;  3MFH A;  4RNM A;  3MR2 A;  4NLN A;  4RQ8 A;  2ISP A;  2NV3 A;  2KN7 A;  3OHA A;  4DQS A;  4Y2Q A;  4J9M A;  5KG2 A;  1Q3V A;  1B0X A;  2FI1 A;  2DKZ A;  4RNO A;  1KBU A;  4JK1 A;  4C8L A;  3BS7 A;  2MRL A;  5GTH U;  4O5E A;  4YQW A;  1ZQC A;  1URJ A;  1A0P A;  3Q8M A;  5KFZ A;  4KN4 A;  1T4G A;  2VKQ A;  1ZQH A;  5F9N A;  2LYB A;  4CCH A;  2W7O A;  1TK5 A;  1NK4 A;  1IIP A;  4NM2 A;  3N7P D;  1ZOL A;  5AM3 A;  5J0R A;  4Y2Y A;  4F5R A;  3NTU A;  5TIS U;  2BQ3 A;  5D49 A;  4C8O A;  1TAM A;  2G5I B;  2XCA A;  8ICY A;  1WG8 A;  3QZ7 A;  3FAH A;  4OD0 A;  4Q8F A;  4UB3 A;  1S76 D;  1ZQW A;  5KG1 A;  4KMO B;  4KLH A;  2DF4 B;  5J0P A;  3EPG A;  4DS4 A;  1ZQM A;  4MFF A;  2EAO A;  4K4G A;  4C0Z A;  3UMC A;  2NRZ A;  2JRZ A;  5AI9 A;  4TUP A;  1ZQP A;  1A76 A;  2KZ3 A;  4I2C A;  2IOF K;  5EWE A;  1UQV A;  1MQ2 A;  2R8K A;  8ICG A;  2Y0S F;  2R8H A;  1UA0 A;  4UB2 A;  3SYZ A;  4R65 A;  2H3Z A;  4YR2 A;  1ZJN A;  1P7D A;  4DLG A;  5ALK A;  8ICA A;  3LK9 A;  4F5N A;  4O9M A;  4UAR A;  4PH5 A;  1ZRM A;  4QWC A;  9ICG A;  2DBY A;  3PW5 A;  3F2C A;  3SAH A;  1SXD A;  4CDG A;  2FLP A;  2OM6 A;  5D4B A;  4JV2 A;  4C4T A;  4O0I A;  2QB1 A;  1Q3U A;  1L3V A;  4R63 A;  1IXR A;  1XC9 A;  4UAS A;  5T14 A;  2Y9U A;  4Q44 A;  4ECY A;  5ALN A;  9ICO A;  5J8Y A;  3KKA A;  5ALS A;  2K4E A;  2W7P A;  1XO1 A;  3GV7 B;  2MU2 A;  5JRT A;  3TAP A;  1ZET A;  5ALI A;  2CN1 A;  3EW9 A;  1TFR A;  1QSY A;  3ALR A;  2N1R A;  2HDO A;  3UXN A;  1SGG A;  3BZC A;  9ICT A;  1RPL A;  4B9U A;  2ZJ5 A;  5BPC A;  2WF5 A;  5KFT A;  3PW4 A;  4QIW C;  1S77 D;  3EPI A;  4RQM A;  5DBB A;  4QZ8 A;  2H3V A;  5L9X A;  2JEJ A;  3MAB A;  2KV2 A;  3GV5 B;  5H2F U;  1T8E A;  3KOO A;  3H8S A;  3GII A;  1Z19 A;  2W8L A;  3FM9 A;  2LYA A;  3SEI A;  4FBU A;  5DQH A;  3HPO A;  9ICA A;  3ISD A;  2R18 A;  4DL3 A;  1KSP A;  1RZT A;  1FEZ A;  3BQ2 A;  2J6S A;  3QNM A;  9ICF A;  4I27 A;  2KSO B;  4EBD A;  1BPY A;  2KKV A;  3CYM A;  1QCK A;  5CWR A;  4KN7 A;  2ZUD A;  2F8K A;  1DGS A;  4I2D A;  2ZUB A;  2IOH A;  1OXJ A;  3K1R B;  3MR3 A;  2KK0 A;  3PSF A;  4NL9 A;  5GTI U;  2P6R A;  3K4G A;  4I2H A;  1HEK A;  3TAN A;  4RQ6 A;  1TK8 A;  2C2E A;  3BQ7 A;  1S8O A;  3RR8 A;  3JPS A;  2BHN A;  4KTQ A;  1CI4 A;  2E5S A;  3I28 A;  4Y2U A;  3KFU F;  5KFN A;  5KFG A;  5AM1 A;  1ZQV A;  4YP3 A;  4ED6 A;  2ESE A;  4DFK A;  2Y1I A;  4B9M A;  5KFC A;  2BPF A;  2HW3 A;  4QJF B;  4RQ7 A;  5CA7 A;  1ZQY A;  3M6K A;  4YMN A;  4DL4 A;  2AGQ A;  1HUO A;  2K89 A;  1H38 A;  2G06 A;  4J9L A;  4XRH A;  4KLU A;  2I1Q A;  2RHF A;  3RTV A;  4B9N A;  1CRX A;  3KHL A;  1SL1 A;  2V4Q A;  3PML A;  3PX0 A;  5ALV A;  2BPC A;  3HP6 A;  2YQE A;  4USA A;  2EQY A;  5KT3 A;  5AIA A;  3HRD D;  1ZQI A;  1S5L U;  4C4R A;  3AN1 A;  4M9H A;  1SB3 C;  4YFK A;  5J8Y C;  2YB4 A;  2E8M A;  1J2M A;  2KJ8 A;  3KKA C;  3QYP A;  2A1J B;  3MC1 A;  3AL0 B;  1ZD4 A;  2ZUC A;  1F5S A;  2L5Y A;  1TK0 A;  3RB3 A;  9ICP A;  1N60 A;  5J2J A;  5KT7 A;  2UVU A;  4CGZ A;  1ZQD A;  5JUM A;  4TQS A;  3N7S C;  1O03 A;  2V4R A;  1F44 A;  3C2L A;  3IN5 A;  4QZB A;  4DSJ A;  4ED7 A;  4O3O A;  1NZB A;  3TQ1 A;  1VJ5 A;  8ICL A;  4F92 B;  3C29 A;  3GIJ A;  2Q0Z X;  5AKI A;  2YN4 A;  5ALQ A;  3RF9 A;  4LZG A;  4EEN A;  8ICW A;  1L8L A;  1N2X A;  3E2E A;  1IG6 A;  3L5K A;  4F8R A;  3ZD8 A;  8ICO A;  4I29 A;  2K60 A;  2FJ6 A;  2XCP A;  3QEB Z;  2E3T A;  1X40 A;  2YMM A;  7ICT A;  3MR6 A;  2W54 A;  2HHW A;  2B6G A;  2MA1 A;  5KNI A;  2AQ4 A;  4UAY A;  2W3R A;  4I2G A;  1ZD5 A;  4ECW A;  1CUK A;  4J9R A;  2PFQ A;  8ICV A;  2G08 A;  3B0Y A;  1COO A;  2JR5 A;  3Q8L A;  5ALR A;  4F50 A;  2OHF A;  3RBE A;  4JV1 A;  4P4O A;  3BQT A;  3BS5 A;  4NL9 C;  5J2F A;  1FIQ A;  4IQT A;  2QAR A;  3WKB A;  4R8U A;  4UB1 A;  1DRG A;  4KLQ A;  1UPH A;  2K4H A;  2KFN A;  1N5W A;  3WU2 U;  4Z6F A;  1SKS A;  4EYH B;  3AMZ A;  2KVC A;  5KL8 B;  1S9F A;  1RG6 A;  1N62 A;  4MFA A;  1LB2 B;  4KLI A;  2H3F A;  1LVH A;  5AKZ A;  2OWO A;  3I1Y A;  4DQP A;  5G5G A;  9ICK A;  2WF6 A;  2JGA A;  3ZI4 A;  5AKH A;  3S6J A;  1D8L A;  5G5H A;  4PL2 A;  3JPT A;  2I5H A;  9ICM A;  2HCF A;  2K8A A;  2QAR B;  4LVS A;  4R8U B;  5J0W A;  1MC8 A;  3E58 A;  2PKE A;  2P35 A;  4ELT A;  1ZQE A;  2P6U A;  5KG7 A;  3N7R C;  4DSI A;  8ICT A;  4DL5 A;  4YMO A;  3HW8 A;  2QB0 A;  5J2G A;  5DB6 A;  4M9L A;  1VDV A;  4BXO A;  4U6P A;  4J9P A;  4DF8 A;  3IG8 A;  2GWS A;  4PGQ A;  1ZQS A;  4B9T A;  4X5V A;  7ICS A;  4OCZ A;  2BZF A;  1ZD3 A;  2W9C A;  5AIC A;  5HHI A;  1ZD2 P;  3B9J A;  1T94 A;  2M9N A;  4F5Q A;  1ZQJ A;  3GDX A;  2XI9 A;  4QWE A;  4NM1 A;  2QLT A;  5CP2 A;  4RPZ A;  4P4P A;  1BPX A;  4CNQ A;  3QUT A;  2PI5 A;  3WK4 A;  1S97 A;  2BCU A;  3QXG A;  3PX6 A;  1SKW A;  1TAQ A;  1J97 A;  4CRX A;  8ICS A;  4RQ2 A;  2ZXI A;  5CR0 A;  4UB4 A;  2W8K A;  4BXO B;  4US9 A;  5HML A;  1QSL A;  1TKD A;  2W11 A;  1L5U A;  1NI3 A;  2W9C B;  1NJX A;  1UA1 A;  4ECU A;  4FZM A;  2O6K A;  4B9L A;  8ICF A;  1ZQR A;  4F93 B;  4FFD A;  4GLX A;  3F5A A;  4TUQ A;  3SQI A;  4ECQ A;  1KLN A;  5L1K A;  3JPO A;  1KFT A;  2NYV A;  4Y2V A;  4Y2X A;  3WK8 A;  4DEZ A;  1B22 A;  1RYR A;  2W03 A;  3CNH A;  2VA8 A;  4I28 A;  4G3I A;  3HT3 A;  1NKC A;  5KFV A;  3SV4 A;  4JUZ A;  3H8J A;  3V6J A;  4F71 A;  3WKE A;  4PHA A;  3G6V A;  3PO4 A;  2KNJ A;  4FE3 A;  5KFO A;  4O3S A;  3V72 A;  3SD7 A;  1DXS A;  1PVP A;  2Z7J A;  1QSS A;  1X9M A;  1NOM A;  1JIH A;  1NNL A;  5KFS A;  1D9F A;  1Z3E B;  8ICJ A;  2BKE A;  9ICH A;  1L8O A;  3ISC A;  2GO7 A;  5ALP A;  2KFZ A;  4KLL A;  1JMS A;  3QUQ A;  4DSK A;  1N5X A;  1Z00 B;  3HX0 A;  2K8C B;  3EWA A;  5L1M A;  1RXV A;  5K4L A;  4NJ8 A;  1Z4O A;  5J0X A;  3F2B A;  4KIT B;  1JUD A;  8ICE A;  4UAZ A;  2W9B A;  3QU9 A;  1ZQN A;  2AH5 A;  4F4Z A;  1MA7 A;  3MR5 A;  2Y9T A;  3CP8 A;  5AK5 A;  1BPZ A;  2PMZ C;  4YCX A;  4RNN A;  5ALM A;  1A77 A;  4Z6D A;  3I76 A;  4YXJ A;  5ALU A;  5DDY A;  4BX9 C;  3H40 A;  4F4X A;  5EE9 A;  3K75 D;  3D2N A;  1KFS A;  3V7J A;  2ZTC A;  1NJW A;  3H7I A;  1PK1 A;  4O5C A;  2KEY A;  3GQC A;  4Q43 A;  4E0D A;  4EBC A;  5J0S A;  2LBO A;  5J2E A;  4DFM A;  2ZJ8 A;  3CW2 C;  4UAU A;  5KFX A;  4YR3 A;  4B9V A;  2W9B B;  2ISO A;  1PVQ A;  1KN5 A;  2W9M A;  3PW2 A;  3PV8 A;  5DB8 A;  2H3Q A;  5J2A A;  3AUO A;  2PXI A;  4ECS A;  5KFB A;  5DQI A;  1FFV A;  2C2D A;  7ICU A;  2AGO A;  1WCN A;  3D2Q A;  4Z6C A;  2AU0 A;  4DSF A;  1ZQQ A;  4LZD A;  4RQ0 A;  3ETL A;  3C1Z A;  1S0M A;  4EX7 A;  4ELV A;  1PK1 B;  5DG8 A;  4B9S A;  3UXP A;  4P2H A;  5KTQ A;  1Z1V A;  7ICV A;  2DL0 A;  3C23 A;  2WF7 A;  8ICM A;  2R8G A;  4M6W A;  1S0V A;  2WB1 C;  2BQR A;  5EWG A;  1KEJ A;  4Y2S A;  5AM4 A;  4NLK A;  2E8P A;  3PR5 B;  9ICC A;  1XSN A;  1MQ3 A;  3RH5 A;  3E0F A;  1NZP A;  2WAQ F;  8ICN A;  5DG9 A;  2P66 A;  1V38 A;  2FE9 A;  4J9Q A;  2W55 A;  4M0A A;  2JHD A;  4F4K A;  2ZG6 A;  1C7Y A;  2K4P A;  5J0Y A;  2NO4 A;  5HNK A;  3IHQ B;  1WUD A;  5EE0 A;  3G6Y A;  3A0H U;  2YB1 A;  4M6W B;  1DGJ A;  4MF2 A;  3AQF A;  2LPE A;  5BOL A;  5AHX A;  1ZRN A;  1X9X A;  5AK6 A;  3KD3 A;  2KSO A;  4F3O A;  4DWI A;  5AKJ A;  1QH9 A;  3RH4 A;  5CEH A;  4KX3 A;  2HOQ A;  3T3F A;  3FDS A;  4NLC A;  4F4W A;  5DLG A;  5ALW A;  4QZA A;  1YZ7 A;  1BGX T;  5KL1 B;  1SWV A;  1O08 A;  3U26 A;  2NRX A;  1BNO A;  3RFA A;  5KG3 A;  4QNL A;  5TZV A;  3RJK A;  2HBJ A;  3K1Z A;  5DKW A;  3QU4 A;  3SR6 A;  1KDH A;  3MDC A;  3NVV A;  3TFS A;  3JPR A;  2HHV A;  8ICU A;  4Y2J A;  3MDA A;  4F72 A;  2UVV A;  3ZDA A;  4RUA A;  1B43 A;  1SZH A;  2MAX A;  2IBK A;  3L3F X;  2HVH A;  7ICQ A;  4ZOH C;  5KFW A;  2NRT A;  2LHT A;  4YN4 A;  3TAQ A;  2DQN B;  4F5O A;  1ZQO A;  1XNS A;  5JU5 A;  1ZQ1 C;  2HMX A;  4ECT A;  2F1I A;  9ICJ A;  2W3S A;  2GH1 A;  3H4B A;  3IP4 B;  4Y2T A;  2RQ5 A;  3HKZ F;  2F1H A;  2LI6 A;  1KRP A;  3AM9 A;  8ICR A;  3NAS A;  1BPE A;  2NRV A;  3NS1 A;  2ZIV A;  4ED8 A;  2KIW A;  1NK9 A;  3IRU A;  2HHS A;  4PZO A;  2G07 A;  2JMG A;  3C5F A;  4JWN A;  3TAR A;  2FMQ A;  2DFL A;  2VJ5 A;  1SWW A;  4FBT A;  5J0U A;  1SV4 A;  3PO5 A;  2HI0 A;  2BDU A;  1V9P A;  2A1J A;  3QU5 A;  4RQ4 A;  2EH9 A;  3SI8 A;  2KJ5 A;  4DFP A;  3UPQ A;  4I2I A;  4RQ5 A;  4R64 A;  2KTQ A;  3J81 j;  5KG0 A;  2JH1 A;  4IRD A;  1T7P A;  3KHH A;  3HJE A;  2ZIV B;  3RJI A;  3SEN A;  1X66 A;  3ZDD A;  1HUZ A;  2A1A A;  4M2Y A;  1C20 A;  4FO6 A;  1ZQZ A;  5AKY A;  2EZY A;  1X6I A;  4M9J A;  3BQ0 A;  3MGI A;  4GXK A;  4UBC A;  1SKR A;  1QQ7 A;  3UQ2 A;  1J2N A;  1VLB A;  3F5E A;  4GXJ A;  2JH7 A;  1RYS A;  2YML A;  2XGP A;  4C8N A;  4AYB C;  5AM5 A;  4WJ3 B;  1RM6 C;  2F3N A;  4NXZ A;  1KKX A;  4RPY A;  1ZQA A;  5IIM A;  3WKC A;  3RAX A;  3C1Y A;  5AI6 A;  4IQU A;  3WK7 A;  3KBB A;  1BPD A;  1U4B A;  4OJP A;  5J29 A;  5CB1 A;  2WFA A;  1UCV A;  1ZQL A;  4XQ8 A;  2R8I A;  2CRX A;  2EAM A;  3HIL A;  4DL6 A;  3AU2 A;  3OSP A;  3OHB A;  5AI5 A;  5F9L A;  1T3Q A;  4DOC A;  4CE6 A;  3Q8Q B;  1Z1B A;  4JB3 A;  4Q45 A;  4O5K A;  2W43 A;  4MEX A;  5HR7 A;  3TI0 A;  1M6Y A;  4F2R A;  3UMB A;  4U7C A;  4I2J A;  3GV8 B;  1NK6 A;  2YY6 A;  3PMN A;  5DG7 A;  2WF8 A;  1BVS A;  3OPX A;  3UXO A;  3EYZ A;  4J9O A;  5FP0 A;  4C8M A;  5J2I A;  3T79 A;  5ALG A;  3L4P A;  8ICH A;  4RUC A;  4MFC A;  1JI7 A;  4FS1 A;  2WB1 F;  4J9N A;  5J0Q A;  4Q8E A;  4DSE A;  2BDP A;  5C5J A;  5AI4 A;  2JEF A;  2FMS A;  3M9N B;  1K1Q A;  1EXN A;  5L1J A;  1UHU A;  2R8J A;  2JZB B;  1JXL A;  4QWB A;  5J2D A;  4Y2R A;  4ACO A;  3N28 A;  2XO7 A;  3M9O B;  4GC6 A;  2XGQ A;  4OJ5 A;  4I2E A;  5KFF A;  4KLF A;  1OW5 A;  2YX8 A;  5AK3 A;  4EEK A;  1Q8K A;  4P4M A;  4M9G A;  1D8B A;  4KLD A;  5HMM A;  2OCE A;  2M0N A;  5AKL A;  4AP9 A;  1FFU A;  1IV8 A;  1OUQ A;  2DPI A;  3G6X A;  1X42 A;  2BCV A;  2Y0S C;  2B21 A;  1F0M A;  3QE9 Y;  3QUC A;  2FLL A;  4YVZ A;  2LMR A;  4M47 A;  3NVW A;  3QU7 A;  2LM4 A;  4QIW F;  1PVR A;  4DL2 A;  1TVA A;  1PK3 A;  3RJH A;  1WYG A;  3ICX A;  3V7K A;  2AXT U;  3RJF A;  2IMW P;  5KFI A;  2GOL A;  5IIO A;  3RRG A;  5F3X B;  1RDF A;  3H0M B;  3C28 A;  2J6U A;  4BUG A;  1NK5 A;  1KTQ A;  3PSP A;  8ICC A;  1WWU A;  5KFL A;  1PZN A;  3OJU A;  3Q8S B;  2PI4 A;  4R66 A;  3LVV A;  1K5O A;  2OH2 A;  3FYH A;  2J6T A;  3AQE A;  3WK6 A;  7ICJ A;  3LWM A;  4GFJ A;  3H8W A;  2PFN A;  5DBC A;  3OSN A;  5IIN A;  4YG2 A;  3SAF A;  2F8L A;  3GIM A;  5KFJ A;  1ZJM A;  2E8N A;  4ECV A;  9ICU A;  1SIJ A;  1NKB A;  3F53 A;  2PFP A;  2C22 A;  3OTQ A;  3EZ5 A;  2F2A B;  2KHQ A;  3ZDC A;  3V6H A;  2KG5 A;  2VA2 A;  4TUR A;  1V97 A;  7ICR A;  2HBK A;  5KFR A;  1LV5 A;  4EX6 A;  1NK0 A;  1NK7 A;  9ICQ A;  5L1L A;  3TFR A;  4DFJ A;  4OO1 J;  1X6J A;  8ICI A;  5AI8 A;  4O3M A;  1U45 A;  5AKE A;  4UB5 A;  1QTM A;  4EYI B;  1WWV A;  1ZQG A;  5KG4 A;  2I6X A;  3PX4 A;  2XC9 A;  2ZJA A;  4F91 B;  1Z00 A;  3KTQ A;  2AQ0 A;  1PUZ A;  3LYS A;  1ECW A;  4LJX A;  3BZK A;  4BWJ A;  2W04 A;  4NLB A;  2KD1 A;  1IM4 A;  3RBD A;  5BOM A;  4RQ1 A;  2AGP A;  2EZX A;  3NGD A;  3OJS A;  4IC9 A;  5DGA A;  5AK4 A;  1Y88 A;  2Q4T A;  3IV6 A;  4PZN A;  4JMU A;  4DOB A;  3RR7 A;  4P0Q A;  4IL6 U;  1Q46 A;  3H0R B;  2GLE A;  4BWM A;  4P0P B;  9ICX A;  3ZDB A;  5KFA A;  2W9A A;  9ICI A;  4QW8 A;  7ICP A;  4IR9 A;  3RB0 A;  4IR1 A;  3DDH A;  5KT5 A;  4DO9 A;  1ZQX A;  2EDU A;  5KFQ A;  2JEG A;  1HJP A;  1X2I A;  1TAU A;  9ICB A;  4DSL A;  4IQV A;  4CF3 A;  2JV3 A;  2RDI A;  1U48 A;  2MUT A;  4QWD A;  5EE3 A;  5EWF A;  5AM2 A;  5KFD A;  5KFH A;  5DDM A;  3QU2 A;  3Q8P B;  3N4M B;  3B0X A;  4CF5 A;  2G5H B;  1N63 A;  3PVX A;  3M8R A;  4P0Q B;  4DS5 A;  1KL9 A;  4IRK A;  2JEI A;  1D8Y A;  5KG5 A;  5ALD A;  2IHN A;  4I2A A;  1RXW A;  3M7D A;  2G09 A;  1SV0 A;  1XWL A;  3VC8 A;  4I2B A;  4RQN A;  1L7N A;  2BCQ A;  5A0L A;  5KAF U;  5KFM A;  4QZI A;  4BGD A;  9ICS A;  4BDP A;  4IRC A;  1SZP A;  5ALO A;  4YXM A;  1S0O A;  1RQL A;  8ICP A;  5KT6 A;  2UVR A;  2MUT B;  1MN8 A;  3GIL A;  4HAI A;  9ICV A;  1RQN A;  3H8M A;  4UBB A;  5JTI A;  2C28 A;  4PHD A;  4F4Y A;  3ONN A;  4QZG A;  3WK9 A;  2VAN A;  3ETR A;  1JXE A;  2F44 A;  4XA5 A;  2G0A A;  4UAT A;  2OEH A;  1L7M A;  4JWM A;  3ZD9 A;  2B0C A;  2KIC A;  3GIK A;  1XU4 A;  3GZF A;  3RJE A;  2HSZ A;  2ASJ A;  2AJQ A;  5KT2 A;  1ZQB A;  1L3U A;  3UM9 A;  4UAV A;  1L7P A;  1X9S A;  3ED5 A;  1L3S A;  2HOF A;  3VCB A;  4K4I A;  4FS2 A;  4EEY A;  3JPN A;  3AEV A;  1ARO P;  3RJG A;  2KP7 A;  1SL0 A;  5ALZ A;  5ALX A;  2XY6 A;  7ICE A;  5AKX A;  3C21 A;  5CHG A;  2DGZ A;  4QWA A;  4J9K A;  2XIC A;  5III A;  4XUS A;  1BPB A;  5ALY A;  1JRP A;  4UW9 A;  5KFE A;  1ZXI A;  3RRH A;  2D8C A;  5ALH A;  1N61 A;  1JAL A;  1ZQF A;  4RPX A;  4PJ0 U;  2ASD A;  5D46 A;  3IG5 A;  4DOA A;  2RDJ A;  2LKY A;  2H3I A;  2H5X A;  8ICX A;  7ICG A;  5EOZ A;  3KZI U;  4RQ3 A;  4MEY A;  2ZIW A;  1UT5 A;  4NV0 A;  2WF9 A;  3PNC A;  5KG6 A;  4NLZ A;  4J9S A;  4ECR A;  3WKD A;  4IQW A;  1L3T A;  2LM1 A;  3V6K A;  2ZTD A;  4ICA A;  1HIW A;  3C2M A;  2ES6 A;  1LKY A;  3PZP A;  3CRX A;  2F77 X;  1FO4 A;  2CPR A;  4GIB A;  4DLE A;  4C7Z A;  2JXJ A;  4K4H A;  1KW4 A;  4A8E A;  2KZZ A;  3M8S A;  7ICN A;  3OGU A;  1U49 A;  2ZIW B;  4KLG A;  2FLN A;  2UVW A;  1SV0 C;  2HBM A;  3IM1 A;  1JN3 A;  5J2C A;  2HBL A;  2YTU A;  4NLG A;  5ALF A;  4TQR A;  4ED1 A;  2A3V A;  4B6J A;  4J03 A;  4KLO A;  5IIK A;  1ED1 A;  1LKY B;  5HHH A;  5KFU A;  3PW0 A;  5KT4 A;  2F1J A;  3N97 B;  4MF8 A;  2BCR A;  2HHU A;  2ALZ A;  5J0O A;  3KHG A;  2ZIU A;  9ICN A;  1V85 A;  4QW9 A;  4DQI A;  2KOB A;  1QLN A;  4BJQ A;  2KZM A;  9ICE A;  1YT3 A;  3JPP A;  2HOI A;  3H0L B;  4KLE A;  7ICM A;  4KLM A;  3MBY A;  4ECZ A;  1Z4N A;  7ICK A; 
#chains in the Genus database with same CATH homology
 1UT8 A;  3MFI A;  1X9W A;  2DPI A;  3G6X A;  2BCV A;  4ED2 A;  1QSS A;  2FLP A;  5D4B A;  4JV2 A;  1X9M A;  1NOM A;  1JIH A;  4O0I A;  2B21 A;  1L3V A;  4R63 A;  1IXR A;  3QE9 Y;  5KFS A;  4UAW A;  1XC9 A;  1D9F A;  4F2S A;  1Z3E B;  2FLL A;  2BKE A;  8ICB A;  3ORY A;  3BJY A;  8ICJ A;  3ZDE A;  9ICH A;  4YVZ A;  4Q44 A;  4ECY A;  3ISC A;  4M47 A;  4M04 A;  9ICO A;  2KFZ A;  3KHR A;  4KLL A;  1JMS A;  2PFO A;  4DSK A;  2HHQ A;  2FPK A;  1Z00 B;  3HX0 A;  3EWA A;  3GFK B;  2Y1J A;  5J2H A;  4DL2 A;  1TVA A;  1RXV A;  3RJH A;  4QZF A;  3AU6 A;  2BDP A;  5J0X A;  3V7K A;  1XO1 A;  3GV7 B;  4ELU A;  3RJF A;  2XY7 A;  4KIT B;  5L1I A;  2IMW P;  4GXI A;  3HWT A;  3TAP A;  1CEZ A;  1ZET A;  5KFI A;  5IIO A;  3RRG A;  8ICE A;  4UAZ A;  2W9B A;  3EW9 A;  1TFR A;  1QSY A;  1ZQN A;  2J6U A;  1NK5 A;  1KTQ A;  3UXN A;  4F4Z A;  3T5J A;  8ICC A;  5KFL A;  9ICT A;  1PZN A;  1RPL A;  3OJU A;  5DBA A;  4B9U A;  3MR5 A;  3T5L A;  2ZJ5 A;  3Q8S B;  3UQ0 A;  2ASL A;  1BPZ A;  2PI4 A;  4R66 A;  5BPC A;  4YCX A;  5KFT A;  4RNN A;  3PW4 A;  3C5G A;  1S77 D;  3EPI A;  1A77 A;  4Z6D A;  4YXJ A;  3FYH A;  4QZE A;  2J6T A;  5DDY A;  5DBB A;  4QZ8 A;  1TV9 A;  4KLT A;  5L9X A;  7ICJ A;  3H40 A;  2JEJ A;  4F4X A;  4JV0 A;  3LWM A;  3H8W A;  3MAB A;  3BQ1 A;  2PFN A;  2V9W A;  2IA6 A;  3K75 D;  3GV5 B;  5DBC A;  3OSN A;  1T8E A;  3V7J A;  1KFS A;  2ZTC A;  2JZB A;  3H8S A;  3H7I A;  4PGX A;  3LWL A;  3GII A;  5IIN A;  1NJW A;  2W8L A;  4O5C A;  4YG2 A;  3GQC A;  4Q43 A;  1XSL A;  3PW7 A;  5DQH A;  3HPO A;  1SL2 A;  4FBU A;  4EBC A;  4E0D A;  3GIM A;  5KFJ A;  5J0S A;  9ICA A;  3ISD A;  2HHX A;  1ZJM A;  5KFY A;  4DL3 A;  4ECV A;  1KSP A;  5J2E A;  1RZT A;  4ECX A;  4DFM A;  9ICU A;  2ZJ8 A;  3BQ2 A;  5J2B A;  5KFX A;  4YR3 A;  1NKB A;  2PFP A;  4B9V A;  2W9B B;  2J6S A;  4EZ6 A;  2ISO A;  2C22 A;  3EZ5 A;  9ICF A;  4I27 A;  3RB6 A;  4EBD A;  2W9M A;  3ZDC A;  1BPY A;  4I2F A;  3V6H A;  3RB4 A;  2VA2 A;  4TUR A;  3PW2 A;  3PV8 A;  1NKE A;  7ICR A;  5DB8 A;  5IIJ A;  4PHP A;  5J2A A;  5KFR A;  1LV5 A;  4KMU A;  1KFD A;  3AUO A;  2BQU A;  1NK7 A;  1NK0 A;  2PXI A;  4ECS A;  5CWR A;  3V7L A;  5L1L A;  3TFR A;  5KFB A;  4DFJ A;  4KN7 A;  1NK8 A;  1XS9 D;  5KFP A;  9ICQ A;  5DQI A;  2ZUD A;  8ICI A;  5DLF A;  2C2D A;  1DGS A;  4I2D A;  7ICU A;  2AGO A;  1WCN A;  2FPL A;  2ZUB A;  1U45 A;  4Z6C A;  2AU0 A;  4DSF A;  1ZQQ A;  4UB5 A;  4LZD A;  5DQG A;  3MR3 A;  4RQ0 A;  3ETL A;  4HYK A;  1QTM A;  4C8K A;  4KLS A;  2HHT A;  4EYI B;  5HP4 A;  9ICW A;  3C1Z A;  5IIL A;  1U47 A;  1S0M A;  1ZQG A;  4ELV A;  2NRW A;  7ICL A;  5KG4 A;  5DG8 A;  4QZC A;  3RAQ A;  4B9S A;  2P6R A;  3PX4 A;  3UXP A;  4P2H A;  3K4G A;  5KTQ A;  2XC9 A;  4F5P A;  1MSW D;  2ATL A;  7ICV A;  4I2H A;  2ZJA A;  4F91 B;  1Z00 A;  3TAN A;  5KFK A;  4RQ6 A;  1TK8 A;  3KTQ A;  3C23 A;  2C2E A;  8ICM A;  2R8G A;  4M6W A;  3RR8 A;  3JPS A;  1S0V A;  2BHN A;  2AQ0 A;  1NJZ A;  2BQR A;  4KTQ A;  5EWG A;  2C2R A;  1KEJ A;  5KFN A;  1ZQK A;  4NLK A;  4BWJ A;  9ICR A;  3PR5 B;  2FMP A;  4RT2 A;  9ICC A;  1XSN A;  5KFG A;  2DPJ A;  1MQ3 A;  3RH5 A;  1IM4 A;  3RBD A;  5BOM A;  1ZYQ A;  4YR0 A;  4RQ1 A;  1ZQV A;  4YP3 A;  4ED6 A;  8ICN A;  4DFK A;  2Y1I A;  3RH6 A;  2AGP A;  5DG9 A;  2P66 A;  4B9M A;  5KFC A;  3NGD A;  3OJS A;  5DGA A;  4J9Q A;  2BPF A;  1Y88 A;  3PR4 A;  2HW3 A;  4UQG A;  4RQ7 A;  5CA7 A;  1ZQY A;  4YMN A;  4DL4 A;  2ZTE A;  2AGQ A;  1HUO A;  3PY8 A;  4M0A A;  1H38 A;  4J9L A;  4F4K A;  1N48 A;  4RZR A;  1C7Y A;  4XRH A;  3SV3 A;  4KLU A;  5J0Y A;  4GC7 A;  2FPM A;  2I1Q A;  4DOB A;  3RTV A;  3RR7 A;  4B9N A;  3KHL A;  4DQR A;  1SL1 A;  5HNK A;  2V4Q A;  3T5H A;  3IHQ B;  3PML A;  3PX0 A;  3G6Y A;  2BPC A;  3HP6 A;  4M6W B;  4BWM A;  9ICX A;  5KT3 A;  3ZDB A;  5KFA A;  2W9A A;  9ICI A;  2WTF A;  4QW8 A;  7ICP A;  4IR9 A;  3RB0 A;  4QZ9 A;  5J2K A;  5KT5 A;  1DOQ A;  4DO9 A;  3THV A;  1ZQI A;  4IR1 A;  4MF2 A;  1ZQX A;  5KFQ A;  4M9H A;  5BOL A;  4YFK A;  4EBE A;  2JEG A;  1HJP A;  1ZQT A;  4KLJ A;  1X2I A;  1TAU A;  4F3O A;  4DWI A;  9ICB A;  9ICL A;  3SZ2 A;  4DSL A;  4IQV A;  3RH4 A;  5J0T A;  3ISB A;  2A1J B;  2RDI A;  1U48 A;  3T3F A;  2MUT A;  4Z6E A;  3FDS A;  4PGY A;  3QZ8 A;  4QWD A;  4F4W A;  5DLG A;  4O3P A;  4QZA A;  2ZUC A;  5EWF A;  4QZH A;  5KFD A;  1BGX T;  5KFH A;  5DDM A;  3Q8P B;  8ICK A;  1TK0 A;  2NRX A;  3B0X A;  3N4M B;  3RB3 A;  3PVX A;  3JPQ A;  3M8R A;  9ICP A;  4YD2 A;  5KG3 A;  5J2J A;  5KT7 A;  5TZV A;  7ICO A;  3RJK A;  2UVU A;  4DS5 A;  5DKW A;  4IRK A;  2JEI A;  1D8Y A;  4ED3 A;  1KDH A;  3MDC A;  1ZQD A;  5KG5 A;  1D9D A;  4TUS A;  5JUM A;  2IHN A;  4TQS A;  2BGW A;  4I2A A;  3TFS A;  3JPR A;  1XSP A;  1RXW A;  2HHV A;  8ICU A;  3MDA A;  2V4R A;  2UVV A;  1XWL A;  3ZDA A;  4I2B A;  3LDA A;  4RUA A;  2BCQ A;  3C2L A;  5KFM A;  1B43 A;  2MAX A;  4QZI A;  2IBK A;  4EZ9 A;  2HVH A;  4QZB A;  7ICQ A;  4BGD A;  5KFW A;  4DSJ A;  2NRT A;  1K1S A;  9ICS A;  4ED7 A;  4O3O A;  1N56 A;  4YN4 A;  4BDP A;  3TQ1 A;  3TAQ A;  4IRC A;  8ICL A;  1SZP A;  4F92 B;  4YXM A;  4F5O A;  3GIJ A;  1ZQO A;  2Q0Z X;  1S0O A;  2VA3 A;  8ICP A;  4LZG A;  5KT6 A;  1ZQU A;  2UVR A;  8ICZ A;  2MUT B;  3GIL A;  5CJ7 A;  4ECT A;  8ICW A;  2F1I A;  1JX4 A;  9ICV A;  9ICJ A;  3H4B A;  4UBB A;  2BCS A;  2C28 A;  4DF4 A;  3E2E A;  4PHD A;  2XY5 A;  4F4Y A;  4F8R A;  4QZG A;  2HVI A;  3ZD8 A;  4ZH4 A;  1U9L A;  8ICO A;  4I29 A;  2VAN A;  1S10 A;  2XCP A;  2F1H A;  4ED0 A;  3QEB Z;  1JXE A;  7ICT A;  4XA5 A;  3MR6 A;  5DB7 A;  1KRP A;  2HHW A;  4YMM A;  8ICR A;  7ICH A;  1S0N A;  1BPE A;  4YD1 A;  3ZD9 A;  4JWM A;  2NRV A;  4ED8 A;  2AQ4 A;  4UAY A;  3C2K A;  4DQQ A;  2LYH A;  3GIK A;  1NK9 A;  1XU4 A;  5DGB A;  4I2G A;  3RJE A;  4ECW A;  1CUK A;  4J9R A;  2ASJ A;  2PFQ A;  2HHS A;  8ICV A;  2AJQ A;  5KT2 A;  4PPX A;  1ZQB A;  4NY8 A;  3M9M B;  3B0Y A;  3C5F A;  1L3U A;  4JWN A;  4M9N A;  1COO A;  4DL7 A;  3Q8L A;  1X9S A;  4F50 A;  8ICQ A;  3RBE A;  3RJJ A;  4JV1 A;  4P4O A;  3TAR A;  2FMQ A;  3BQT A;  1T3N A;  2DFL A;  2BR0 A;  1L3S A;  5J2F A;  4RT3 A;  4O3N A;  4FBT A;  4IQT A;  4K4I A;  5J0U A;  3PO5 A;  4R8U A;  4UB1 A;  4FS2 A;  4EEY A;  3Q8K A;  3JPN A;  2BPG A;  4KLQ A;  1V9P A;  2A1J A;  4RU9 A;  3SI8 A;  1ARO P;  4RQ4 A;  3QEA Z;  3RJG A;  1SL0 A;  2IHM A;  3MGH A;  2XY6 A;  7ICE A;  4DFP A;  2KFN A;  3T5K A;  4Z6F A;  3UPQ A;  1SKS A;  4I2I A;  4RQ5 A;  4EYH B;  4R64 A;  3C21 A;  5CHG A;  2KTQ A;  3BDP A;  5KG0 A;  4QWA A;  4IRD A;  4J9K A;  5III A;  4XUS A;  4QZD A;  1S9F A;  3Q8R B;  1T7P A;  3KHH A;  1BPB A;  4PHE A;  4MFA A;  7ICI A;  1LB2 B;  2I9G A;  4KLI A;  4O3R A;  3RJI A;  5KFE A;  4O3Q A;  1WCL A;  3RRH A;  2OWO A;  7ICF A;  1NJY A;  4DQP A;  5DB9 A;  3ZDD A;  1HUZ A;  4M2Y A;  9ICK A;  3H4D A;  3MFH A;  4FO6 A;  1ZQZ A;  4RNM A;  1ZQF A;  3MR2 A;  4RPX A;  4M9J A;  4NLN A;  3BQ0 A;  3MGI A;  4GXK A;  4UBC A;  5D46 A;  2ASD A;  4RQ8 A;  4DOA A;  1SKR A;  2RDJ A;  2ISP A;  3UQ2 A;  1D8L A;  2KN7 A;  3JPT A;  3OHA A;  4DQS A;  9ICM A;  4J9M A;  5KG2 A;  4LVS A;  2H5X A;  4R8U B;  5J0W A;  4GXJ A;  1RYS A;  1MC8 A;  4RNO A;  8ICX A;  7ICG A;  4C8N A;  5EOZ A;  4JK1 A;  2XGP A;  4RQ3 A;  4C8L A;  4MEY A;  1UT5 A;  4ELT A;  3PNC A;  4O5E A;  4YQW A;  4NXZ A;  1ZQC A;  1ZQE A;  2P6U A;  4RPY A;  5KG7 A;  1ZQA A;  4DSI A;  5IIM A;  8ICT A;  3RAX A;  5KG6 A;  4NLZ A;  4J9S A;  3C1Y A;  4DL5 A;  4ECR A;  4YMO A;  3Q8M A;  3HW8 A;  5KFZ A;  5J2G A;  4KN4 A;  4IQU A;  5DB6 A;  4M9L A;  4BXO A;  4IQW A;  4J9P A;  1BPD A;  4DF8 A;  2GWS A;  1T4G A;  1U4B A;  4PGQ A;  1L3T A;  1ZQS A;  4B9T A;  4X5V A;  7ICS A;  3V6K A;  2ZTD A;  5J29 A;  5CB1 A;  1ZQH A;  2W9C A;  1ZQL A;  3C2M A;  5F9N A;  4XQ8 A;  2R8I A;  5HHI A;  4CCH A;  4DL6 A;  3AU2 A;  3OSP A;  3OHB A;  4F5Q A;  2M9N A;  1TK5 A;  1NK4 A;  4DLE A;  5F9L A;  4NM2 A;  1ZQJ A;  3GDX A;  4DOC A;  3Q8Q B;  4QWE A;  4K4H A;  4Q45 A;  4NM1 A;  5CP2 A;  5J0R A;  4O5K A;  4F5R A;  2KZZ A;  4RPZ A;  4MEX A;  3M8S A;  3NTU A;  2BQ3 A;  7ICN A;  3OGU A;  1U49 A;  5D49 A;  4P4P A;  1BPX A;  3TI0 A;  2PI5 A;  4KLG A;  4F2R A;  2FLN A;  4C8O A;  1S97 A;  2UVW A;  4I2J A;  2BCU A;  3GV8 B;  2XCA A;  3PX6 A;  3IM1 A;  1NK6 A;  1SKW A;  1JN3 A;  8ICY A;  5J2C A;  1TAQ A;  3PMN A;  3QZ7 A;  5DG7 A;  1BVS A;  3UXO A;  4NLG A;  3EYZ A;  4J9O A;  4C8M A;  4TQR A;  4ED1 A;  8ICS A;  4RQ2 A;  5CR0 A;  4UB4 A;  5J2I A;  4Q8F A;  4UB3 A;  2W8K A;  4BXO B;  1S76 D;  8ICH A;  1ZQW A;  4RUC A;  5KG1 A;  4MFC A;  5HML A;  4KLH A;  1QSL A;  5J0P A;  4FS1 A;  3EPG A;  4DS4 A;  4J9N A;  1TKD A;  4KLO A;  1L5U A;  1ZQM A;  4MFF A;  5IIK A;  2W9C B;  1NJX A;  5J0Q A;  1UA1 A;  5HHH A;  4ECU A;  5KFU A;  4Q8E A;  4K4G A;  3PW0 A;  4DSE A;  4B9L A;  8ICF A;  2NRZ A;  2F1J A;  4F93 B;  5C5J A;  5KT4 A;  4GLX A;  3N97 B;  4TUP A;  4TUQ A;  1ZQR A;  3M9N B;  1ZQP A;  2FMS A;  2JEF A;  1A76 A;  4MF8 A;  1K1Q A;  4ECQ A;  2KZ3 A;  1KLN A;  2BCR A;  1EXN A;  5EWE A;  4I2C A;  5L1K A;  2HHU A;  2ALZ A;  3JPO A;  5J0O A;  1KFT A;  3KHG A;  4DEZ A;  1MQ2 A;  5L1J A;  2R8J A;  9ICN A;  2JZB B;  2R8K A;  1B22 A;  8ICG A;  1RYR A;  2R8H A;  4QW9 A;  1JXL A;  4QWB A;  1UA0 A;  4DQI A;  1QLN A;  5J2D A;  2VA8 A;  4UB2 A;  3SYZ A;  4I28 A;  4R65 A;  4G3I A;  4YR2 A;  2XO7 A;  3HT3 A;  3M9O B;  4GC6 A;  1ZJN A;  5KFV A;  1NKC A;  2XGQ A;  3SV4 A;  2KZM A;  4I2E A;  9ICE A;  4JUZ A;  3JPP A;  5KFF A;  4KLF A;  3H8J A;  4DLG A;  3V6J A;  8ICA A;  3LK9 A;  4F5N A;  4PHA A;  4O9M A;  4PH5 A;  3G6V A;  3PO4 A;  4QWC A;  4KLE A;  9ICG A;  4P4M A;  4M9G A;  5KFO A;  7ICM A;  4KLM A;  3PW5 A;  4O3S A;  3V72 A;  3MBY A;  4ECZ A;  4KLD A;  5HMM A;  7ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...