2KZ7B

Solution structure of the carmil cah3a/b domain bound to capping protein (cp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kz7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kz7B02
3LK41 3AA7A 2KZ7A 3LK3B 3AA1B 3LK42 3AA6B 3AA0A 2KXPA 3LK2A 3AAEA 1IZNA 3AAAA 5ADXK 2KZ7B 3AA7B 5ADXL 3AA0B 3LK2B 3AAEB 2KXPB 4AKRA 1IZNB 3AAAB 3LK3A 3AA1A 5AFUK 5AFUL 3AA6A 4AKRB
chains in the Genus database with same CATH superfamily
5GTHO 2YDRA 4P09A 4NXMT 3LSVA 1T8BA 1QSDA 2EHOB 2KINB 3UQ4A 4CI1B 3CMLA 3FBZA 2X0YA 2ZMAA 4UVCB 4PFPA 1S5LO 1PRNA 3FXEB 2A3DA 4N78D 5GTIO 4KMCA 3P4QA 2LEHA 4CN4A 3Q5XA 3VRAA 4JV5T 2E2AA 1UX4A 2PTFA 4HWDA 4IDPA 4J2CA 4NPPA 1JNZA 2LSJA 4B6XA 4C4VA 4HKAA 3CX8B 2YPVA 2BS3A 3CQGB 3UFGA 3ZCJA 2ODVA 4ZHQE 2XQ9A 3PF1A 1B7TA 3RYIE 3RRCA 2VASA 2CE7A 4ZS2A 4QH5A 4AYEC 3ZT7A 3TLSA 4QH1A 4LFCT 4O4LE 2YKSA 3LK2A 4X62T 2UU9T 2YK0A 2X27X 2E9XC 4F4BA 5LJNA 3PU8A 3PGUA 2V26A 4DNDA 2XMXA 4PAGA 5L3EB 1BR1A 2XQ5A 1WR6A 2HPJA 2WJRA 4GKKT 4EXTA 1Z0PA 4G76A 1BT9A 2BS4A 3GA8A 5JVDE 1KEYA 2X0LB 3V5SA 3KBUA 3B13A 3ZKRA 5CA1E 2VL8A 4AKRA 3I9WA 5FXVA 4LFBT 2EHOC 5JQGE 2Y0HA 4B3RT 2R8AA 2WMNA 4K3BA 2NWBA 5FVLA 4DR3T 3RC8A 3E22E 2OA5A 2WCAA 3MACA 5LHGB 4PJ0O 5J2TE 4HN9A 2FGQX 1FMVA 1YKHB 2N9DA 4YTPA 3W15B 3FXDB 4EZHA 2KXPB 3ABVA 4Z3TA 1YQ4A 3S4UA 2IWWA 1WR0A 3O1IA 2P9BA 5HXSA 5LOVE 4X65T 4LMLA 5B66O 3AEDA 3AEGA 3SZDA 1YQ3A 4X5TA 3C5OA 2BG9E 2KSRA 3PUAA 4DO0A 2V7IA 5HEGA 4I43B 1X9BA 4GCQA 1OPFA 3UU2A 5GONE 3ZMVB 4ANJA 4TX5A 1HTJF 4FT6A 4XAXB 1MIVA 1WFDA 2VB6A 5G39A 1HFAA 4JI3T 2MBGA 4QXBB 4EEDA 3MKDA 1SUMB 3H3AA 1HR0T 4UV9B 2XZEA 5LXTE 4DV7T 2E9XD 4Z90A 4FSOA 2GE4A 1YS5A 3KVAA 3PURA 1D1BA 4LFAT 4PK5A 1US7B 4O8SA 1HG2A 3RI5A 3TZGA 3HKDE 1HCIA 3QRCA 3C4WA 2RP4A 5LBMA 5L4HA 1H6S1 1U4QA 3RIUC 2QA7A 2R4OA 5JRCA 5FL0A 3PUSA 4HFHA 3N9MA 5F3JA 2JMMA 8PRNA 4CQIA 3X1DA 4DV4T 3GN5B 4X66T 4U33A 5DL7A 2BS2A 2IDOB 2XE2A 3T1YT 1ORMA 4E7SA 2X51A 3CWZB 4O3XB 4PJJA 1KF6A 4O2BE 4YSZA 3BS0A 3AAEB 2XQ4A 2VQFT 1HXXA 5HCJA 5JR9B 3EABA 2R6GF 1S35A 4I0UA 5FVKA 4U7IA 1NAFA 3F2EA 2AXTO 2W63A 5JH7E 2WVPA 3C50A 1OEDE 5H2FO 3I1AA 4AI6A 5ADXK 5JREA 3ANWA 2JIWA 2R4PA 5HXCA 3KFWX 3OPCA 2CM0A 4NUUA 5AQPB 2HH7A 3RC3A 5ABHA 2J1NA 3PQUA 3DZMA 4E1TA 5DL5A 5G3AA 3T24A 4DV2T 1VCTA 2LT3A 1XWMA 3ZC0A 4MLKA 2YOEA 5L47A 5AQFB 5J0ZA 2CBJA 1G73A 5L3BB 2LSGA 1QJ8A 2LHNA 6PRNA 4YFSA 2WWUA 1M62A 5B5EO 2CLYB 3SFDA 1GFMA 2BG9A 3T0SA 2YEVC 4XBFB 3MZKB 4DR5T 3N9PA 4EAHA 4G63A 7PRNA 2BKNA 3C4XA 2V5DA 4ILBA 1G90A 4PR7A 4ZS3A 2HHHT 2KZ7B 3LBXB 2X68A 1UURA 2OMFA 3RPUA 3T8OA 2NW8A 2X67A 4KI0F 2JMKA 4H9QC 4X64T 2Z6EA 2ZLYA 3DJBA 3FYXA 1UGOA 4ZI7E 1WYCA 4O4XA 3MA9A 4GIWA 4CN6A 3EVYA 4KR8A 2WU5A 4AQFC 1KK7A 1IBKT 5C2TA 3FZLB 3OKQA 3POXA 2L8KA 3AXJB 3DA4A 4GKJT 3ZSSA 3HKCE 1SHZC 4UF0A 1KNPA 2BBJA 2I0MA 1SA0E 4B3ST 1E2AA 4PJNA 2CLYC 3U3IA 2NP9A 3CVRA 2F1VA 1KFYA 2XASB 3AEFA 1VRBA 2W2UA 4JI0T 4UVAB 2VKDA 4UV8B 4YTMA 1OEDA 2JQQA 3B57A 3N9NA 1MPFA 2PJQA 4H63H 4HTEA 4UB6O 3A8YC 3MXZA 3EMNX 4HWFA 4HGAA 2M67A 4TN7B 5IYUA 2CBIA 5CA0E 3UQ7A 3UAQA 2KXPA 4I4TE 3F57A 1MMDA 4OK0A 1ZEEA 1HS7A 3NJTA 3VZTX 2K3WA 2V1DB 3N9OA 2BVLA 3JAEA 1KNZA 3E0ZA 1T16A 1BR2A 4ZI2C 4FZNA 4FI5A 4IE7A 4TZ4C 1DU2A 1BR0A 5DABA 1ZHWA 2VWAA 2LRLA 3KV5A 4KP3C 4EGWA 3O4XE 4C90A 2XAJB 3P50A 2CHOA 1Y01A 4RJXA 3WAKA 4QWNB 5KAIO 2XAQB 3A7MA 3VRBA 2WDQA 5BR8T 5M4YA 2XQ7A 1QJPA 4O3WA 3JCFA 3AE5A 3LFMA 2IUBA 4DR1T 4DMVA 4N74A 3CQCB 3ZPOA 5LGUB 4HFVA 4ZXLA 1UUSA 4AYDC 4YT0A 4HEAA 5AQLB 5IUXA 3JTYA 4U31A 5F8PA 3I0QA 3PUYF 4LMJA 2LKHA 4H9RC 4DV0T 5E0OA 4AFKA 3KVBA 4ZOLE 3UU4A 3V5UA 3GMIA 2FUPA 4L9IA 3VHLA 2Y0KA 4FUVA 4N59A 4JUYA 5JDLA 2E9XB 4I50E 5LHIB 4B61A 5HWYA 3AA1B 2XM1A 3DWNA 4C00A 4QQ1A 3AE2A 2CXFA 3DP7A 1D0YA 2LSYA 3EUHA 2MNHA 1XZYA 4MFRA 3VZWX 2XTLA 3KV4A 1D1CA 3ZYMA 4ZI2D 2IC6A 4UELA 2WDRA 2JQHA 3G7GA 3OYZA 3NSGA 2CHNA 3FBLA 5EK4A 4AKLA 3RBHA 3DWOX 4H9OC 5LNKA 4JLEA 2DWKA 4KUMB 2UXNB 4HFDA 3HA4A 1J1JA 2X9KA 2LSIA 3N2KE 3PU3A 1FIOA 1ZHYA 3AVSA 2PFVA 3ZC1A 3QOFA 4O2AE 4TNVA 4HFBA 2X9HA 2V6YB 3TLTA 4QXHB 3MK7C 1N34T 2NTYA 5AQNB 1UX5A 3NRYA 2Y7SA 2V7KA 3N9QA 3SZVA 4JI6T 2IW5B 5LG4A 2K0LA 4JYAT 2LM9A 3JADA 5LYJE 2HN1A 2UUBT 4FESA 2K48A 2XG6A 1ZP0A 4X1IE 2CRBA 1WRDA 3NWIA 3UUNA 2D9DA 1IBLT 2YINA 2X9YA 5JDNA 2XSBA 3U78A 3M3ZB 2DWGA 2N1GA 3I0OA 2UXXB 2V7LA 4K0KT 1HG5A 3H3MA 1S94A 2LFUA 4DR2T 2VK9A 3AE7A 3RH3A 1J5WA 3AE9A 4HE8A 2LE8A 2MYSA 2C0SA 4UR9A 2J1DG 2B1EA 4JBWF 5AQQB 2QVAA 5HAXA 3CQXC 5TAOA 2ZM8A 3AA0A 2IC9A 2FJAA 2A72A 5JDGA 5KAFO 2XAGB 3R84B 5CFBA 4U3CA 2W81C 3PUXF 2ACZA 4LSIA 2WQYA 1W0BA 4TV9E 3AXJA 4FMSA 3AVRA 2JMHA 4JI4T 2N2LA 3QRAA 5FXWA 3RHWA 3LG7A 1P4TA 3O0EA 2X9XA 4BJNA 3PGRA 1CHUA 2HN2A 5LG3A 2KDYA 3ONJA 4LSFA 3AAAB 3RF1A 4ILCA 2XQYA 3HOEA 3LK41 3NKZA 3VKGA 2QYWA 2VQET 3JCUO 5HXHA 3CKDA 2UXBT 3UUXB 3LJCA 2WJQA 5AQUB 2XUEA 1T72A 3NVOA 3PTRB 3RLFF 4DR4T 2IWVA 3ZMUB 1THQA 4NUVA 1BXWA 2VL0A 2BDEA 2LLYA 4P0BA 3LK3B 2O4VA 4FJOA 4KHPT 1WYBA 4IREA 4N58A 4EYUA 4JEUB 5LGTB 5FXZA 2G0UA 3RQUA 2I6HA 4IIJE 4IDQA 4DV5T 2CXLA 5HEOA 5LHHB 4KX6A 5FMNA 3JC6C 5ABFB 2YDQA 4LMKA 2RA1A 3K19A 4LF9T 5TISO 3NBXX 1MM4A 3CX7B 3A2SX 4PFOA 3UTKA 3HR0A 3N2GE 5FY0A 5AQKB 3N9LA 5ADXL 3TLUA 2LHRA 1WCRA 4GHBA 2V7JA 1LVKA 2W66A 5L3CB 4QH4A 5FY7A 3SOLA 3E08A 2WU2A 1MM5A 4RLBA 4BJMA 3KDSE 3P4SA 1G8XA 5JTGA 2AE9A 5HWXA 2Y48B 1GFQA 4IDOA 3SY9A 1IJ6A 5LCYA 3C51A 5EK2A 2BVMA 4COFA 3FZHB 2UUAT 4PK4A 4IE6A 3ZMZB 5LGNB 2H7OA 4X20E 1IZNB 2BKPA 3C4ZA 3AA1A 1QUUA 2MAWA 3KBTA 3B5MA 2W80C 4U7YA 3D0TA 2Q9QC 3GWHA 3MJXA 4U2ZA 3UT5E 2YNKA 3QC9A 4C4VB 1T98A 2C5KT 2B76A 2W67A 5AQSB 2J4UP 3OTOT 5CJ5A 3UFEA 2EHOA 3JC6D 1HNWT 2H88A 1X79A 3NZQA 1UCUA 1IBMT 2ES0A 2KT9A 3AE4A 5JDPA 3H37A 2V5CA 3LK2B 2H3RA 3O1HA 3TLVA 3RYHE 4LSHA 4QHOA 3VZUX 4AQYT 2ODJA 2K9AA 5HCMA 1NENA 4QX7B 4A97A 2QGSA 5AQRB 2V6YA 2XE5A 4QX8B 4XNLA 4DBRA 3UULA 1Y64B 4O4UA 2DI4A 3P4RA 2CA5A 4ISSA 3ZYKA 4JI8T 4AKRB 1LKXA 1FEWA 1VCSA 2KNDA 3CPZA 3EI0A 3R6NA 4TUYE 3LK42 4YJ2E 2ZFGA 3AA7B 3QNUA 3ZMTB 2FJEA 5ETWA 2WBLA 4YHHT 4H9NC 2DNXA 4QKNA 2DLRA 2XE3A 3WI5A 5AQJB 2VVSA 2VURA 4JEHB 3J7Yq 4ILUA 2N2NA 2Y6XA 2LSKA 4RJWA 2UUCT 2Q9QD 2JQKA 2CWYA 4ZZCA 2XQAA 4L0RA 2PG8A 2YU1A 3QB5A 5LBQB 3RIUA 4L5GA 4TWDA 2WSSV 4N75A 3BK9A 4DR6T 3PRNA 3SRZA 1VOMA 4Z91A 4UB8O 3AEAA 2ZLDA 2V7MA 4X1YE 3RKGA 2KWIB 3VU7H 4OYKA 2D2SA 1XNRT 5L3GB 4KHZF 3IHRA 4YLHA 2Y0LA 5JDMA 3FZFB 1UK5A 2MOZA 2SPCA 5DL8A 1CUNA 4AYMC 2IIUA 3AAIA 4YJ3E 3FZMB 5G38A 1LVFA 3FB2A 5C8YE 5LMUT 4DVDA 5JDFA 3KINB 3P8CD 4ZEYA 3BQLA 3ZJ1A 3VY9X 3HKBE 5DL6A 2MTQA 1AJ3A 4TNWA 3K3OA 3UPGA 2WAUA 2J47A 5L2LA 2XTQA 1R8IA 1YW0A 5LJMA 2CPTA 1BH3A 3VE1A 1KNRA 2XM2A 3POQA 5HEUA 2F4VT 3FZKB 5FNVE 5LA6E 2PRNA 4U9CA 4MALA 3VR8A 4UIGA 2XQ6A 2A2FX 3AEEA 5JDHA 4AYID 3UUMA 1FMWA 4GYRA 2CCQA 4TWHA 3P7IA 4FSPA 4GK0E 3LK3A 5HEJA 3KV9A 5AFUL 3RIAA 4CTDA 1JNRA 2YU2A 1YXRA 3KV6A 2X66A 1IAPA 4DV6T 5LB7B 1XMQT 3IA3A 3OBVE 4LSEA 3ZT5A 4IT4A 2M6IA 4CI3B 2JPFA 3AECA 5KXJA 2ZM2A 3GN5A 3RX6A 2M07A 3Q9DA 2I59A 2UXDT 3ANWB 5AFUK 3GP6A 4WBNE 3PUQA 2JRKA 1HNXT 3F31A 2VKHA 3AAEA 1GFNA 1NWMX 2D0UA 1ZHTA 4XZCA 4AUIA 4AXPA 5JR9A 3ZLIA 1Q9FA 5F5WA 2WDVA 2V6XA 1HX8A 3K3QC 3HW9A 3EDVA 2IMLA 3ZYLA 2VKJA 4O49A 3ZSTA 4ASKA 4DV1T 4H9SE 2M06A 1FJGT 4NXNT 4A56A 4HFCA 2XHEB 3NRXA 2YDSA 4QXCB 4PNIA 2HPLA 4AQFA 2ERVA 2DHRA 2WMOA 2PORA 1ZKEA 3EHZA 4AYNA 5HYAA 2X9WA 2KC0A 3RRWA 4DMWA 2KWHA 1IZNA 4LF6T 2MHLA 3K1SA 2YN6A 2J62A 4WBOA 4FOZA 4CZZB 4ILAA 5J2UE 2K24A 2JQ9A 1N36T 3OVUA 1ZHZA 2E5VA 2XAFB 4M1PA 4BAYB 3FHNA 2QRXA 4TWFA 4I55E 4OYJA 3CIRA 2FJDA 4U72A 3QK6A 4H63V 5LMNT 1XDOA 2C5JA 3EAMA 3T1HT 4MBQA 4B3TT 4EEBA 3IF8B 2PBIA 1HF8A 2KZ7A 3LBXA 2K4TA 2ODUA 5AQOB 1HNZT 3NZPA 4EB6E 4G75A 4IE4A 4PJLA 5EZYE 3L3PA 2H7VC 5AQTB 4RLCA 1E7PA 5A1LA 3O1JA 4UF0B 5FL1A 4U2YA 3CK6A 5DQVA 3TKLB 3L8RA 2BG9C 2C5IT 4AKGA 2OV9A 1LRZA 5HXEA 4OFZA 5AQVB 2N2MA 4O3YA 5KDMC 2L3LA 1W9RA 3ZN0B 1OEDB 4YXDA 2D5UA 1Q9GA 3HI2A 3PV0F 3ONXA 2W4XA 4WZXA 3AA7A 5T5FA 1MIYA 1MMNA 3POUA 2MPKA 4EYYR 2XAHB 4EV6A 2Y8DA 4TV8E 5AQGB 1QJ9A 3UU8A 2FBWA 2LM2A 3HOLA 4C69X 5G26A 4P0AA 4E1SA 3KVDD 3BRZA 3HWBA 4AIUA 5L4EA 1Z8UA 4WYVA 3BRYA 2E8IA 4LF5T 1OXZA 4GYSA 1GQEA 4YSYA 2R4LA 3SYBA 4IL4A 2R88A 4KRAA 5FY1A 3HKEE 1N32T 3C98B 4HFEA 1ZV4X 3ZN1B 3A5XA 4F8HA 5L3FB 5H6RB 2ZM6T 4CN1A 4YSXA 2L9QA 1XNQT 1W09A 4HWIB 3RKOA 3ZMSB 1HX1B 1ZHXA 2LOPA 1U5PA 1BR4A 4FZMA 3AE6A 4LF8T 2OLTA 3K8PC 2CWOA 3WAJA 4PJMA 2GK9A 2LHFA 2Q9QB 3LDQB 3VE2A 3HL6A 1N33T 4ADZA 4WNKA 4IL6O 4C91A 1OEDC 2BKOA 4V1Av 1MNEA 3A0BO 1OSMA 2DCFA 2XQ3A 3Q5DA 1WLXA 4ZZBA 3UU6A 5HEHA 5IWAT 2EHOD 2E5LT 1E1HB 2AXDS 5LP6E 2X0HA 4KR4A 2LOSA 3DA3A 4DUZT 4JI1T 3AA6B 4ERRA 3Q5EA 4LF7T 3WU2O 5CB4E 4A5XA 1NEKA 4IE5A 2M6BA 2FGRA 1T7SA 3AE8A 3BQKA 2VKOA 2XY8B 5AQMB 3WI4A 1D0XA 2LKGA 3J9X1 3PGSA 5GV0A 2NR4A 4HFIA 4K3CA 3IEEA 3VR9A 3QB5K 5ABGA 1T1LA 2BBHA 3DTOA 2R89A 1MMAA 2E9XA 3O9XA 5EK3A 4CI2B 4H9PC 1HXTA 3BQIA 4NIQA 4PW8A 1D1AA 2NW9A 3EDUA 3A0HO 2DL1A 3OYXA 3PJAJ 5JDQA 4IDZA 3I9YA 3PUZF 4Z8XA 5E79O 3P4PA 2FJBA 2JQYA 2WZHA 1J5ET 5KX5E 4BA9A 3M65A 4HWHA 5PRNA 4IE0A 1W0AA 1ZOYA 4X1KE 5AQHB 3ETUA 2K5BB 3ZT6A 3SY7A 4GOUA 3SS1A 3N2OA 2WP9A 1V9DA 3QUJA 4JI7T 4O4HE 2CMRA 3Q2MA 4ZI3C 2WM9A 4U74A 4DUYT 3PQSA 4O3ZA 5DJQC 1SE7A 4YHJA 2H89A 3L39A 5EE2A 2F1CX 3Q5WA 5JR9C 3G06A 4K0UA 5HXRA 2NOXA 3VY8X 2WZIA 3PUGA 2XE1A 4CXXA 2D0TA 3K3NA 3TLWA 1I6ZA 4IHJE 2V8SV 2LRKA 3IBPA 4RL9A 3T20A 3SFEA 3ZJ2A 4A98A 5D5DA 3AEBA 3P4WA 5J1GA 3RYFE 3AA0B 1H7CA 3UUBA 3ESLA 3AE3A 3UU5A 4D65A 2W62A 5FKYA 4KBMB 4XNKA 2LJLA 4JCHA 2W0GA 2IHR1 2JJ9A 3ETVA 4DBQA 4AISA 1YD8G 2NW7A 4D5UA 4EZ4A 2BZBA 2RPAA 2WS3A 2W00A 3PUVF 5H6QB 4CXYA 2XTRA 4AQGA 4PK6A 4G2AA 5AQIB 2IAKA 3PE0A 2XQ8A 2CEAA 1I94T 2QTKA 3AE1A 1O3XA 4PUXA 5IHYA 2XPKA 2XSAA 4IDNA 4Q25A 4D64A 4DV3T 1GFPA 4MHCA 3V8UA 4FRXA 1YKEB 2Y2XA 1GFOA 2XJ7A 1PHOA 1IJ5A 4ZI3D 3PUWF 4FRTA 4YY3T 3RIFA 4JI5T 2WY2A 4E7ZA 5FXXA 3AAAA 2CXDA 4ISTA 1M7KA 3C64A 4AKMA 5C3JA 3AB3B 4JI2T 4FQEA 5JRCB 5KMGP 3KZIO 4B3MT 4P1NA 4HWCA 1MIWA 2WWVA 2KLQA 4WW0A 2W61A 5CGMA 4EIWA 3JAFA 5DQWA 4UVBB 5ABEA 2UXCT 2VVNA 4F6RC 1D0ZA 4BUMX 3L09A 3RQWA 4IL9A 1XMOT 4YTNA 4EOZB 3VKHA 5FP3A 2Q9QA 3ZCIA 4FZLA 4OX9T 4UEMA 2NTXA 5ABFA 1HXUA 2ZM0A 4DR7T 1MMGA 1E54A 2F1TA 3RYCE 4GF4A 4IGUA 3WI3A 4DIDB 5BMVE 4JFBA 3CX6B 3N5LA 4CXWA 4UXNB 3ONLC 3PDYA 1QLBA 3PORA 1MNDA 4O4JE 2KMFA 4O4IE 3SWHA 3AA6A 3RGLA 3UU3A 3PJAA 5FVNA 1XDPA 2A9UA 5FYMA 4AZLA 4OHFA 4GCPA 2R4NA 1OWAA 1L0VA 2J4GA 5IYZE 5L3DB 4LF4T 4GK5E 4AKHA 4GCSA 2WB5A 3ZEFB 1EZ3A 3SYSA 2ACXA 2BG9B 4AKIA 3OJAA 1ZHCA
chains in the Genus database with same CATH topology
3HWBA 3D0TA 2E8IA 3UAQA 2Q9QC 4P09A 2KXPA 1OXZA 4I4TE 3F57A 1QSDA 2EHOB 2KINB 3GWHA 3MJXA 4GYSA 1MMDA 4OK0A 1ZEEA 4CI1B 3SYBA 1HS7A 4KRAA 3VZTX 3UT5E 2YNKA 3CMLA 3FBZA 3QC9A 5FY1A 2ZMAA 3HKEE 1T98A 2C5KT 4UVCB 2V1DB 3C98B 3N9OA 2BVLA 4PFPA 1KNZA 1ZV4X 1PRNA 3FXEB 2J4UP 3ZN1B 3A5XA 2A3DA 3E0ZA 4N78D 3UFEA 1BR2A 5L3FB 2EHOA 4KMCA 3JC6D 5H6RB 2LEHA 4ZI2C 4FZNA 4FI5A 4IE7A 3Q5XA 2L9QA 4TZ4C 1UX4A 1X79A 3NZQA 1UCUA 4J2CA 2ES0A 5DABA 1BR0A 1ZHWA 3RKOA 3ZMSB 2LSJA 4B6XA 2KT9A 4HKAA 3CX8B 2YPVA 3CQGB 2VWAA 1ZHXA 2LOPA 1U5PA 1BR4A 4FZMA 3ZCJA 3KV5A 2XE1A 4KP3C 5JDPA 2ODVA 3H37A 4ZHQE 3LK2B 2H3RA 3O1HA 3K8PC 2CWOA 3WAJA 3RYHE 3O4XE 4LSHA 4PJMA 4QHOA 2GK9A 1B7TA 2Q9QB 2XAJB 4C90A 2LHFA 3VE2A 3RYIE 4RJXA 3WAKA 3RRCA 3VZUX 2VASA 3HL6A 4QWNB 2XAQB 2CE7A 4ZS2A 2ODJA 2K9AA 4AYEC 4ADZA 4WNKA 5M4YA 1QJPA 4O3WA 4C91A 4O4LE 4QX7B 2QGSA 4V1Av 3LK2A 1MNEA 2YK0A 2X27X 2E9XC 4F4BA 5LJNA 3LFMA 1OSMA 2XE5A 4QX8B 4DMVA 4XNLA 2DCFA 4DBRA 3CQCB 3PU8A 3UULA 2V26A 4DNDA 1Y64B 1WLXA 3ZPOA 5LGUB 2XMXA 4O4UA 2DI4A 4HFVA 4PAGA 5L3EB 2EHOD 1BR1A 2CA5A 4ISSA 3ZYKA 4AYDC 1WR6A 2HPJA 4AKRB 4HEAA 1E1HB 5LP6E 1LKXA 1FEWA 1Z0PA 4EXTA 2KNDA 5F8PA 3JTYA 2LOSA 3I0QA 3DA3A 4G76A 3CPZA 4KR4A 4H9RC 3R6NA 4TUYE 3LK42 3AA6B 1BT9A 5E0OA 4ERRA 4AFKA 3KVBA 4YJ2E 3GA8A 4ZOLE 3V5UA 5JVDE 2ZFGA 3GMIA 2X0LB 3AA7B 3V5SA 3KBUA 5CB4E 4IE5A 3B13A 3ZMTB 5CA1E 2FGRA 4L9IA 2VL8A 3BQKA 5ETWA 4AKRA 2WBLA 2VKOA 3VHLA 3I9WA 5FXVA 2EHOC 2Y0KA 4FUVA 4N59A 5JQGE 2Y0HA 4H9NC 3WI4A 1D0XA 4JUYA 5JDLA 2DNXA 4QKNA 3J9X1 2E9XB 2DLRA 2XE3A 5GV0A 2WMNA 4I50E 2NWBA 5LHIB 4B61A 3WI5A 3RC8A 3E22E 5HWYA 2OA5A 3AA1B 3IEEA 4JEHB 3MACA 3J7Yq 4QQ1A 5LHGB 4ILUA 2N2NA 2CXFA 2LSKA 2Y6XA 5J2TE 4RJWA 5IYUA 4HN9A 2Q9QD 3DP7A 2CWYA 2FGQX 1FMVA 1D0YA 1YKHB 2LSYA 2N9DA 3DTOA 4L0RA 2PG8A 1MMAA 2E9XA 2YU1A 5EK3A 3FXDB 5LBQB 3W15B 4EZHA 3O9XA 4CI2B 2KXPB 3EUHA 4Z3TA 2MNHA 4L5GA 4H9PC 3S4UA 2WSSV 1HXTA 4MFRA 3BQIA 3O1IA 2P9BA 3VZWX 4PW8A 5HXSA 2XTLA 3KV4A 1D1AA 1D1CA 3BK9A 5LOVE 2NW9A 3ZYMA 3EDUA 3PRNA 3SRZA 4ZI2D 3OYXA 1VOMA 2IC6A 4UELA 3SZDA 5JDQA 4IDZA 3I9YA 2ZLDA 3C5OA 3OYZA 4Z8XA 3G7GA 3PUAA 2V7MA 3NSGA 4DO0A 3FBLA 5EK4A 4X1YE 4AKLA 2V7IA 2KWIB 4I43B 3VU7H 4OYKA 2D2SA 5KX5E 5L3GB 4BA9A 3IHRA 4GCQA 4YLHA 3M65A 1OPFA 2Y0LA 3UU2A 3RBHA 5GONE 3ZMVB 4ANJA 5JDMA 4TX5A 4H9OC 5PRNA 4IE0A 1HTJF 2MOZA 4FT6A 2SPCA 4XAXB 1MIVA 5LNKA 4JLEA 2DWKA 5DL8A 1CUNA 2VB6A 4AYMC 1HFAA 4KUMB 2UXNB 3AAIA 4X1KE 2MBGA 3ETUA 4YJ3E 2K5BB 4QXBB 1LVFA 3FB2A 3SY7A 3MKDA 3H3AA 4GOUA 3HA4A 3SS1A 5C8YE 4DVDA 3N2OA 5JDFA 3KINB 4UV9B 1V9DA 3QUJA 3P8CD 2LSIA 3BQLA 3ZJ1A 3N2KE 4O4HE 5LXTE 2E9XD 3VY9X 3PU3A 3HKBE 1FIOA 2MTQA 5DL6A 1ZHYA 1AJ3A 2CMRA 3AVSA 2PFVA 4FSOA 2GE4A 3K3OA 3ZC1A 1YS5A 3UPGA 4O2AE 2WAUA 3KVAA 2X9HA 3PURA 5L2LA 1D1BA 3Q2MA 2XTQA 4ZI3C 2WM9A 4U74A 4PK5A 3PQSA 4O3ZA 4QXHB 1US7B 3MK7C 5DJQC 4O8SA 1YW0A 5LJMA 1HG2A 3TZGA 2NTYA 3HKDE 4YHJA 1HCIA 1BH3A 3QRCA 3VE1A 3C4WA 1UX5A 5EE2A 3NRYA 2Y7SA 2RP4A 3POQA 3Q5WA 2V7KA 3N9QA 5LBMA 5JR9C 3SZVA 4K0UA 5FNVE 2IW5B 5LG4A 2K0LA 5LA6E 2PRNA 4U9CA 5HXRA 4MALA 1H6S1 1U4QA 2NOXA 4UIGA 2LM9A 3KVDD 2QA7A 5LYJE 2A2FX 5JDHA 4FESA 5JRCA 3VY8X 4AYID 2K48A 1FMWA 3PUGA 2CCQA 3PUSA 4GYRA 2D0TA 3UUMA 4CXXA 3P7IA 4FSPA 3K3NA 3N9MA 4GK0E 2XG6A 3LK3A 5F3JA 4X1IE 3KV9A 1WRDA 5AFUL 2JMMA 8PRNA 3UUNA 4CQIA 4IHJE 3GN5B 2YU2A 2YINA 2X9YA 3KV6A 2X66A 1IAPA 3IBPA 5JDNA 4RL9A 5DL7A 3U78A 3T20A 3ZJ2A 2DWGA 2N1GA 3I0OA 3OBVE 2UXXB 5D5DA 2V7LA 2XE2A 4LSEA 1ORMA 4E7SA 2X51A 3CWZB 1HG5A 4PJJA 4O3XB 5J1GA 3RYFE 5CA0E 1S94A 2JPFA 4O2BE 4CI3B 2ZM2A 3AA0B 2LFUA 1H7CA 3AAEB 3GN5A 3RX6A 1HXXA 2M07A 3Q9DA 2I59A 3ESLA 3ANWB 5AFUK 5JR9B 2VK9A 3GP6A 4D65A 4WBNE 1S35A 3RH3A 4HE8A 2W62A 2LE8A 3PUQA 2JRKA 2MYSA 2C0SA 4KBMB 1NAFA 4XNKA 2J1DG 2LJLA 2B1EA 3F2EA 2W63A 3F31A 4JCHA 2W0GA 5HAXA 5JH7E 2JJ9A 3CQXC 5TAOA 2ZM8A 3C50A 2VKHA 3ETVA 2IC9A 3AA0A 3AAEA 4DBQA 1NWMX 3I1AA 1YD8G 4AI6A 2NW7A 2D0UA 1GFNA 1ZHTA 5ADXK 2A72A 4XZCA 5JDGA 2XAGB 5JREA 3ANWA 3R84B 5JR9A 4AXPA 3ZLIA 1Q9FA 4AUIA 4D5UA 4EZ4A 2W81C 2BZBA 5HXCA 1HX8A 3K3QC 3KFWX 3HW9A 2W00A 3EDVA 4LSIA 5H6QB 2CM0A 4TV9E 4CXYA 3ZYLA 4FMSA 2XTRA 3AVRA 4AQGA 2JMHA 4PK6A 4G2AA 4NUUA 2HH7A 3RC3A 2N2LA 2IAKA 2VKJA 4O49A 3PE0A 4ASKA 2CEAA 4H9SE 2M06A 3QRAA 2J1NA 3PQUA 2QTKA 5FXWA 4E1TA 1O3XA 5DL5A 3T24A 4PUXA 4A56A 3LG7A 1P4TA 2XHEB 3NRXA 5IHYA 3O0EA 2X9XA 4BJNA 4QXCB 4PNIA 4D64A 2LT3A 2HPLA 1GFPA 4MHCA 4AQFA 2ERVA 3ZC0A 4MLKA 2KDYA 4FRXA 3V8UA 4LSFA 3AAAB 1YKEB 2DHRA 2WMOA 1ZKEA 2PORA 2Y2XA 1GFOA 2XQYA 1PHOA 1IJ5A 3HOEA 4ZI3D 4AYNA 5HYAA 1G73A 5L3BB 2LSGA 3LK41 2X9WA 2KC0A 1QJ8A 4FRTA 2LHNA 3VKGA 3RRWA 4YFSA 4DMWA 6PRNA 2KWHA 2WWUA 4E7ZA 5HXHA 3CKDA 1IZNA 5FXXA 3UUXB 3AAAA 3LJCA 2CLYB 2CXDA 2XUEA 1GFMA 4ISTA 3PTRB 2MHLA 3T0SA 3ZMUB 3C64A 2YEVC 4XBFB 3MZKB 3N9PA 4AKMA 4EAHA 3AB3B 1THQA 4G63A 7PRNA 4NUVA 4WBOA 1BXWA 4FOZA 4CZZB 5JRCB 3C4XA 2BDEA 5J2UE 2K24A 5KMGP 4P0BA 3LK3B 2O4VA 4FJOA 1WYBA 1G90A 4N58A 4ZS3A 4EYUA 4JEUB 5LGTB 1MIWA 1ZHZA 5FXZA 2KLQA 4WW0A 2KZ7B 2W61A 2XAFB 2G0UA 3LBXB 3FHNA 4M1PA 4BAYB 2X68A 2OMFA 4EIWA 4I55E 4OYJA 4IIJE 3RPUA 3T8OA 5DQWA 2CXLA 2NW8A 4U72A 2X67A 3QK6A 4H63V 4UVBB 2JMKA 4H9QC 5LHHB 4F6RC 1D0ZA 5FMNA 3JC6C 2C5JA 4BUMX 2Z6EA 2ZLYA 3DJBA 3FYXA 4MBQA 2RA1A 3IF8B 3K19A 2PBIA 1HF8A 2KZ7A 3LBXA 3L09A 4ZI7E 1WYCA 2K4TA 4O4XA 3NBXX 1MM4A 3CX7B 3MA9A 2ODUA 4GIWA 3A2SX 4PFOA 3UTKA 3NZPA 4EB6E 3EVYA 3HR0A 4IE4A 4G75A 4EOZB 3N2GE 3VKHA 4PJLA 5EZYE 5FP3A 5FY0A 2Q9QA 3ZCIA 4KR8A 3L3PA 3N9LA 4AQFC 5ADXL 2H7VC 2LHRA 1KK7A 4FZLA 4RLCA 4GHBA 4UEMA 2NTXA 5A1LA 2V7JA 1LVKA 1HXUA 2ZM0A 3O1JA 1MMGA 4UF0B 1E54A 3OKQA 5L3CB 3POXA 2F1TA 3RYCE 5FY7A 3SOLA 3E08A 4IGUA 4GF4A 1MM5A 4RLBA 5DQVA 3WI3A 2L8KA 3TKLB 5BMVE 3DA4A 4BJMA 3KDSE 4JFBA 3CX6B 3HKCE 1SHZC 2C5IT 3N5LA 4AKGA 4CXWA 1LRZA 1G8XA 4UF0A 4UXNB 3PDYA 5HXEA 4OFZA 2Y48B 5HWXA 1GFQA 2N2MA 3PORA 4O3YA 1SA0E 5KDMC 3SY9A 2L3LA 1MNDA 1IJ6A 3ZN0B 4O4JE 3C51A 5LCYA 2KMFA 4PJNA 4O4IE 5EK2A 2BVMA 3SWHA 2D5UA 1Q9GA 3AA6A 2CLYC 3HI2A 3U3IA 2NP9A 5FVNA 3CVRA 3ONXA 4PK4A 2F1VA 3AA7A 5T5FA 5FYMA 2XASB 4AZLA 1MIYA 1MMNA 4IE6A 1VRBA 3POUA 4OHFA 3ZMZB 4EYYR 4GCPA 2XAHB 1OWAA 2Y8DA 4TV8E 4UVAB 2VKDA 4UV8B 1QJ9A 5LGNB 2JQQA 5IYZE 3B57A 3N9NA 5L3DB 2H7OA 4GK5E 4X20E 3HOLA 4AKHA 1IZNB 3C4ZA 1MPFA 4C69X 3AA1A 4GCSA 2PJQA 4H63H 3ZEFB 5G26A 1EZ3A 1QUUA 4HTEA 3MXZA 2ACXA 3EMNX 3KBTA 3SYSA 4HGAA 2M67A 4AKIA 4TN7B 4P0AA 4E1SA 2W80C 3OJAA 1ZHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 1;  3AA7 A;  2KZ7 A;  3LK3 B;  3AA1 B;  3LK4 2;  3AA6 B;  3AA0 A;  2KXP A;  3LK2 A;  3AAE A;  1IZN A;  3AAA A;  5ADX K;  2KZ7 B;  3AA7 B;  5ADX L;  3AA0 B;  3LK2 B;  3AAE B;  2KXP B;  4AKR A;  1IZN B;  3AAA B;  3LK3 A;  3AA1 A;  5AFU K;  5AFU L;  3AA6 A;  4AKR B; 
#chains in the Genus database with same CATH topology
 5GTH O;  2YDR A;  4P09 A;  4NXM T;  3LSV A;  1T8B A;  1QSD A;  2EHO B;  2KIN B;  3UQ4 A;  4CI1 B;  3CML A;  3FBZ A;  2X0Y A;  2ZMA A;  4UVC B;  4PFP A;  1S5L O;  1PRN A;  3FXE B;  2A3D A;  4N78 D;  5GTI O;  4KMC A;  3P4Q A;  2LEH A;  4CN4 A;  3Q5X A;  3VRA A;  4JV5 T;  2E2A A;  1UX4 A;  2PTF A;  4HWD A;  4IDP A;  4J2C A;  4NPP A;  1JNZ A;  2LSJ A;  4B6X A;  4C4V A;  4HKA A;  3CX8 B;  2YPV A;  2BS3 A;  3CQG B;  3UFG A;  3ZCJ A;  2ODV A;  4ZHQ E;  2XQ9 A;  3PF1 A;  1B7T A;  3RYI E;  3RRC A;  2VAS A;  2CE7 A;  4ZS2 A;  4QH5 A;  4AYE C;  3ZT7 A;  3TLS A;  4QH1 A;  4LFC T;  4O4L E;  2YKS A;  3LK2 A;  4X62 T;  2UU9 T;  2YK0 A;  2X27 X;  2E9X C;  4F4B A;  5LJN A;  3PU8 A;  3PGU A;  2V26 A;  4DND A;  2XMX A;  4PAG A;  5L3E B;  1BR1 A;  2XQ5 A;  1WR6 A;  2HPJ A;  2WJR A;  4GKK T;  4EXT A;  1Z0P A;  4G76 A;  1BT9 A;  2BS4 A;  3GA8 A;  5JVD E;  1KEY A;  2X0L B;  3V5S A;  3KBU A;  3B13 A;  3ZKR A;  5CA1 E;  2VL8 A;  4AKR A;  3I9W A;  5FXV A;  4LFB T;  2EHO C;  5JQG E;  2Y0H A;  4B3R T;  2R8A A;  2WMN A;  4K3B A;  2NWB A;  5FVL A;  4DR3 T;  3RC8 A;  3E22 E;  2OA5 A;  2WCA A;  3MAC A;  5LHG B;  4PJ0 O;  5J2T E;  4HN9 A;  2FGQ X;  1FMV A;  1YKH B;  2N9D A;  4YTP A;  3W15 B;  3FXD B;  4EZH A;  2KXP B;  3ABV A;  4Z3T A;  1YQ4 A;  3S4U A;  2IWW A;  1WR0 A;  3O1I A;  2P9B A;  5HXS A;  5LOV E;  4X65 T;  4LML A;  5B66 O;  3AED A;  3AEG A;  3SZD A;  1YQ3 A;  4X5T A;  3C5O A;  2BG9 E;  2KSR A;  3PUA A;  4DO0 A;  2V7I A;  5HEG A;  4I43 B;  1X9B A;  4GCQ A;  1OPF A;  3UU2 A;  5GON E;  3ZMV B;  4ANJ A;  4TX5 A;  1HTJ F;  4FT6 A;  4XAX B;  1MIV A;  1WFD A;  2VB6 A;  5G39 A;  1HFA A;  4JI3 T;  2MBG A;  4QXB B;  4EED A;  3MKD A;  1SUM B;  3H3A A;  1HR0 T;  4UV9 B;  2XZE A;  5LXT E;  4DV7 T;  2E9X D;  4Z90 A;  4FSO A;  2GE4 A;  1YS5 A;  3KVA A;  3PUR A;  1D1B A;  4LFA T;  4PK5 A;  1US7 B;  4O8S A;  1HG2 A;  3RI5 A;  3TZG A;  3HKD E;  1HCI A;  3QRC A;  3C4W A;  2RP4 A;  5LBM A;  5L4H A;  1H6S 1;  1U4Q A;  3RIU C;  2QA7 A;  2R4O A;  5JRC A;  5FL0 A;  3PUS A;  4HFH A;  3N9M A;  5F3J A;  2JMM A;  8PRN A;  4CQI A;  3X1D A;  4DV4 T;  3GN5 B;  4X66 T;  4U33 A;  5DL7 A;  2BS2 A;  2IDO B;  2XE2 A;  3T1Y T;  1ORM A;  4E7S A;  2X51 A;  3CWZ B;  4O3X B;  4PJJ A;  1KF6 A;  4O2B E;  4YSZ A;  3BS0 A;  3AAE B;  2XQ4 A;  2VQF T;  1HXX A;  5HCJ A;  5JR9 B;  3EAB A;  2R6G F;  1S35 A;  4I0U A;  5FVK A;  4U7I A;  1NAF A;  3F2E A;  2AXT O;  2W63 A;  5JH7 E;  2WVP A;  3C50 A;  1OED E;  5H2F O;  3I1A A;  4AI6 A;  5ADX K;  5JRE A;  3ANW A;  2JIW A;  2R4P A;  5HXC A;  3KFW X;  3OPC A;  2CM0 A;  4NUU A;  5AQP B;  2HH7 A;  3RC3 A;  5ABH A;  2J1N A;  3PQU A;  3DZM A;  4E1T A;  5DL5 A;  5G3A A;  3T24 A;  4DV2 T;  1VCT A;  2LT3 A;  1XWM A;  3ZC0 A;  4MLK A;  2YOE A;  5L47 A;  5AQF B;  5J0Z A;  2CBJ A;  1G73 A;  5L3B B;  2LSG A;  1QJ8 A;  2LHN A;  6PRN A;  4YFS A;  2WWU A;  1M62 A;  5B5E O;  2CLY B;  3SFD A;  1GFM A;  2BG9 A;  3T0S A;  2YEV C;  4XBF B;  3MZK B;  4DR5 T;  3N9P A;  4EAH A;  4G63 A;  7PRN A;  2BKN A;  3C4X A;  2V5D A;  4ILB A;  1G90 A;  4PR7 A;  4ZS3 A;  2HHH T;  2KZ7 B;  3LBX B;  2X68 A;  1UUR A;  2OMF A;  3RPU A;  3T8O A;  2NW8 A;  2X67 A;  4KI0 F;  2JMK A;  4H9Q C;  4X64 T;  2Z6E A;  2ZLY A;  3DJB A;  3FYX A;  1UGO A;  4ZI7 E;  1WYC A;  4O4X A;  3MA9 A;  4GIW A;  4CN6 A;  3EVY A;  4KR8 A;  2WU5 A;  4AQF C;  1KK7 A;  1IBK T;  5C2T A;  3FZL B;  3OKQ A;  3POX A;  2L8K A;  3AXJ B;  3DA4 A;  4GKJ T;  3ZSS A;  3HKC E;  1SHZ C;  4UF0 A;  1KNP A;  2BBJ A;  2I0M A;  1SA0 E;  4B3S T;  1E2A A;  4PJN A;  2CLY C;  3U3I A;  2NP9 A;  3CVR A;  2F1V A;  1KFY A;  2XAS B;  3AEF A;  1VRB A;  2W2U A;  4JI0 T;  4UVA B;  2VKD A;  4UV8 B;  4YTM A;  1OED A;  2JQQ A;  3B57 A;  3N9N A;  1MPF A;  2PJQ A;  4H63 H;  4HTE A;  4UB6 O;  3A8Y C;  3MXZ A;  3EMN X;  4HWF A;  4HGA A;  2M67 A;  4TN7 B;  5IYU A;  2CBI A;  5CA0 E;  3UQ7 A;  3UAQ A;  2KXP A;  4I4T E;  3F57 A;  1MMD A;  4OK0 A;  1ZEE A;  1HS7 A;  3NJT A;  3VZT X;  2K3W A;  2V1D B;  3N9O A;  2BVL A;  3JAE A;  1KNZ A;  3E0Z A;  1T16 A;  1BR2 A;  4ZI2 C;  4FZN A;  4FI5 A;  4IE7 A;  4TZ4 C;  1DU2 A;  1BR0 A;  5DAB A;  1ZHW A;  2VWA A;  2LRL A;  3KV5 A;  4KP3 C;  4EGW A;  3O4X E;  4C90 A;  2XAJ B;  3P50 A;  2CHO A;  1Y01 A;  4RJX A;  3WAK A;  4QWN B;  5KAI O;  2XAQ B;  3A7M A;  3VRB A;  2WDQ A;  5BR8 T;  5M4Y A;  2XQ7 A;  1QJP A;  4O3W A;  3JCF A;  3AE5 A;  3LFM A;  2IUB A;  4DR1 T;  4DMV A;  4N74 A;  3CQC B;  3ZPO A;  5LGU B;  4HFV A;  4ZXL A;  1UUS A;  4AYD C;  4YT0 A;  4HEA A;  5AQL B;  5IUX A;  3JTY A;  4U31 A;  5F8P A;  3I0Q A;  3PUY F;  4LMJ A;  2LKH A;  4H9R C;  4DV0 T;  5E0O A;  4AFK A;  3KVB A;  4ZOL E;  3UU4 A;  3V5U A;  3GMI A;  2FUP A;  4L9I A;  3VHL A;  2Y0K A;  4FUV A;  4N59 A;  4JUY A;  5JDL A;  2E9X B;  4I50 E;  5LHI B;  4B61 A;  5HWY A;  3AA1 B;  2XM1 A;  3DWN A;  4C00 A;  4QQ1 A;  3AE2 A;  2CXF A;  3DP7 A;  1D0Y A;  2LSY A;  3EUH A;  2MNH A;  1XZY A;  4MFR A;  3VZW X;  2XTL A;  3KV4 A;  1D1C A;  3ZYM A;  4ZI2 D;  2IC6 A;  4UEL A;  2WDR A;  2JQH A;  3G7G A;  3OYZ A;  3NSG A;  2CHN A;  3FBL A;  5EK4 A;  4AKL A;  3RBH A;  3DWO X;  4H9O C;  5LNK A;  4JLE A;  2DWK A;  4KUM B;  2UXN B;  4HFD A;  3HA4 A;  1J1J A;  2X9K A;  2LSI A;  3N2K E;  3PU3 A;  1FIO A;  1ZHY A;  3AVS A;  2PFV A;  3ZC1 A;  3QOF A;  4O2A E;  4TNV A;  4HFB A;  2X9H A;  2V6Y B;  3TLT A;  4QXH B;  3MK7 C;  1N34 T;  2NTY A;  5AQN B;  1UX5 A;  3NRY A;  2Y7S A;  2V7K A;  3N9Q A;  3SZV A;  4JI6 T;  2IW5 B;  5LG4 A;  2K0L A;  4JYA T;  2LM9 A;  3JAD A;  5LYJ E;  2HN1 A;  2UUB T;  4FES A;  2K48 A;  2XG6 A;  1ZP0 A;  4X1I E;  2CRB A;  1WRD A;  3NWI A;  3UUN A;  2D9D A;  1IBL T;  2YIN A;  2X9Y A;  5JDN A;  2XSB A;  3U78 A;  3M3Z B;  2DWG A;  2N1G A;  3I0O A;  2UXX B;  2V7L A;  4K0K T;  1HG5 A;  3H3M A;  1S94 A;  2LFU A;  4DR2 T;  2VK9 A;  3AE7 A;  3RH3 A;  1J5W A;  3AE9 A;  4HE8 A;  2LE8 A;  2MYS A;  2C0S A;  4UR9 A;  2J1D G;  2B1E A;  4JBW F;  5AQQ B;  2QVA A;  5HAX A;  3CQX C;  5TAO A;  2ZM8 A;  3AA0 A;  2IC9 A;  2FJA A;  2A72 A;  5JDG A;  5KAF O;  2XAG B;  3R84 B;  5CFB A;  4U3C A;  2W81 C;  3PUX F;  2ACZ A;  4LSI A;  2WQY A;  1W0B A;  4TV9 E;  3AXJ A;  4FMS A;  3AVR A;  2JMH A;  4JI4 T;  2N2L A;  3QRA A;  5FXW A;  3RHW A;  3LG7 A;  1P4T A;  3O0E A;  2X9X A;  4BJN A;  3PGR A;  1CHU A;  2HN2 A;  5LG3 A;  2KDY A;  3ONJ A;  4LSF A;  3AAA B;  3RF1 A;  4ILC A;  2XQY A;  3HOE A;  3LK4 1;  3NKZ A;  3VKG A;  2QYW A;  2VQE T;  3JCU O;  5HXH A;  3CKD A;  2UXB T;  3UUX B;  3LJC A;  2WJQ A;  5AQU B;  2XUE A;  1T72 A;  3NVO A;  3PTR B;  3RLF F;  4DR4 T;  2IWV A;  3ZMU B;  1THQ A;  4NUV A;  1BXW A;  2VL0 A;  2BDE A;  2LLY A;  4P0B A;  3LK3 B;  2O4V A;  4FJO A;  4KHP T;  1WYB A;  4IRE A;  4N58 A;  4EYU A;  4JEU B;  5LGT B;  5FXZ A;  2G0U A;  3RQU A;  2I6H A;  4IIJ E;  4IDQ A;  4DV5 T;  2CXL A;  5HEO A;  5LHH B;  4KX6 A;  5FMN A;  3JC6 C;  5ABF B;  2YDQ A;  4LMK A;  2RA1 A;  3K19 A;  4LF9 T;  5TIS O;  3NBX X;  1MM4 A;  3CX7 B;  3A2S X;  4PFO A;  3UTK A;  3HR0 A;  3N2G E;  5FY0 A;  5AQK B;  3N9L A;  5ADX L;  3TLU A;  2LHR A;  1WCR A;  4GHB A;  2V7J A;  1LVK A;  2W66 A;  5L3C B;  4QH4 A;  5FY7 A;  3SOL A;  3E08 A;  2WU2 A;  1MM5 A;  4RLB A;  4BJM A;  3KDS E;  3P4S A;  1G8X A;  5JTG A;  2AE9 A;  5HWX A;  2Y48 B;  1GFQ A;  4IDO A;  3SY9 A;  1IJ6 A;  5LCY A;  3C51 A;  5EK2 A;  2BVM A;  4COF A;  3FZH B;  2UUA T;  4PK4 A;  4IE6 A;  3ZMZ B;  5LGN B;  2H7O A;  4X20 E;  1IZN B;  2BKP A;  3C4Z A;  3AA1 A;  1QUU A;  2MAW A;  3KBT A;  3B5M A;  2W80 C;  4U7Y A;  3D0T A;  2Q9Q C;  3GWH A;  3MJX A;  4U2Z A;  3UT5 E;  2YNK A;  3QC9 A;  4C4V B;  1T98 A;  2C5K T;  2B76 A;  2W67 A;  5AQS B;  2J4U P;  3OTO T;  5CJ5 A;  3UFE A;  2EHO A;  3JC6 D;  1HNW T;  2H88 A;  1X79 A;  3NZQ A;  1UCU A;  1IBM T;  2ES0 A;  2KT9 A;  3AE4 A;  5JDP A;  3H37 A;  2V5C A;  3LK2 B;  2H3R A;  3O1H A;  3TLV A;  3RYH E;  4LSH A;  4QHO A;  3VZU X;  4AQY T;  2ODJ A;  2K9A A;  5HCM A;  1NEN A;  4QX7 B;  4A97 A;  2QGS A;  5AQR B;  2V6Y A;  2XE5 A;  4QX8 B;  4XNL A;  4DBR A;  3UUL A;  1Y64 B;  4O4U A;  2DI4 A;  3P4R A;  2CA5 A;  4ISS A;  3ZYK A;  4JI8 T;  4AKR B;  1LKX A;  1FEW A;  1VCS A;  2KND A;  3CPZ A;  3EI0 A;  3R6N A;  4TUY E;  3LK4 2;  4YJ2 E;  2ZFG A;  3AA7 B;  3QNU A;  3ZMT B;  2FJE A;  5ETW A;  2WBL A;  4YHH T;  4H9N C;  2DNX A;  4QKN A;  2DLR A;  2XE3 A;  3WI5 A;  5AQJ B;  2VVS A;  2VUR A;  4JEH B;  3J7Y q;  4ILU A;  2N2N A;  2Y6X A;  2LSK A;  4RJW A;  2UUC T;  2Q9Q D;  2JQK A;  2CWY A;  4ZZC A;  2XQA A;  4L0R A;  2PG8 A;  2YU1 A;  3QB5 A;  5LBQ B;  3RIU A;  4L5G A;  4TWD A;  2WSS V;  4N75 A;  3BK9 A;  4DR6 T;  3PRN A;  3SRZ A;  1VOM A;  4Z91 A;  4UB8 O;  3AEA A;  2ZLD A;  2V7M A;  4X1Y E;  3RKG A;  2KWI B;  3VU7 H;  4OYK A;  2D2S A;  1XNR T;  5L3G B;  4KHZ F;  3IHR A;  4YLH A;  2Y0L A;  5JDM A;  3FZF B;  1UK5 A;  2MOZ A;  2SPC A;  5DL8 A;  1CUN A;  4AYM C;  2IIU A;  3AAI A;  4YJ3 E;  3FZM B;  5G38 A;  1LVF A;  3FB2 A;  5C8Y E;  5LMU T;  4DVD A;  5JDF A;  3KIN B;  3P8C D;  4ZEY A;  3BQL A;  3ZJ1 A;  3VY9 X;  3HKB E;  5DL6 A;  2MTQ A;  1AJ3 A;  4TNW A;  3K3O A;  3UPG A;  2WAU A;  2J47 A;  5L2L A;  2XTQ A;  1R8I A;  1YW0 A;  5LJM A;  2CPT A;  1BH3 A;  3VE1 A;  1KNR A;  2XM2 A;  3POQ A;  5HEU A;  2F4V T;  3FZK B;  5FNV E;  5LA6 E;  2PRN A;  4U9C A;  4MAL A;  3VR8 A;  4UIG A;  2XQ6 A;  2A2F X;  3AEE A;  5JDH A;  4AYI D;  3UUM A;  1FMW A;  4GYR A;  2CCQ A;  4TWH A;  3P7I A;  4FSP A;  4GK0 E;  3LK3 A;  5HEJ A;  3KV9 A;  5AFU L;  3RIA A;  4CTD A;  1JNR A;  2YU2 A;  1YXR A;  3KV6 A;  2X66 A;  1IAP A;  4DV6 T;  5LB7 B;  1XMQ T;  3IA3 A;  3OBV E;  4LSE A;  3ZT5 A;  4IT4 A;  2M6I A;  4CI3 B;  2JPF A;  3AEC A;  5KXJ A;  2ZM2 A;  3GN5 A;  3RX6 A;  2M07 A;  3Q9D A;  2I59 A;  2UXD T;  3ANW B;  5AFU K;  3GP6 A;  4WBN E;  3PUQ A;  2JRK A;  1HNX T;  3F31 A;  2VKH A;  3AAE A;  1GFN A;  1NWM X;  2D0U A;  1ZHT A;  4XZC A;  4AUI A;  4AXP A;  5JR9 A;  3ZLI A;  1Q9F A;  5F5W A;  2WDV A;  2V6X A;  1HX8 A;  3K3Q C;  3HW9 A;  3EDV A;  2IML A;  3ZYL A;  2VKJ A;  4O49 A;  3ZST A;  4ASK A;  4DV1 T;  4H9S E;  2M06 A;  1FJG T;  4NXN T;  4A56 A;  4HFC A;  2XHE B;  3NRX A;  2YDS A;  4QXC B;  4PNI A;  2HPL A;  4AQF A;  2ERV A;  2DHR A;  2WMO A;  2POR A;  1ZKE A;  3EHZ A;  4AYN A;  5HYA A;  2X9W A;  2KC0 A;  3RRW A;  4DMW A;  2KWH A;  1IZN A;  4LF6 T;  2MHL A;  3K1S A;  2YN6 A;  2J62 A;  4WBO A;  4FOZ A;  4CZZ B;  4ILA A;  5J2U E;  2K24 A;  2JQ9 A;  1N36 T;  3OVU A;  1ZHZ A;  2E5V A;  2XAF B;  4M1P A;  4BAY B;  3FHN A;  2QRX A;  4TWF A;  4I55 E;  4OYJ A;  3CIR A;  2FJD A;  4U72 A;  3QK6 A;  4H63 V;  5LMN T;  1XDO A;  2C5J A;  3EAM A;  3T1H T;  4MBQ A;  4B3T T;  4EEB A;  3IF8 B;  2PBI A;  1HF8 A;  2KZ7 A;  3LBX A;  2K4T A;  2ODU A;  5AQO B;  1HNZ T;  3NZP A;  4EB6 E;  4G75 A;  4IE4 A;  4PJL A;  5EZY E;  3L3P A;  2H7V C;  5AQT B;  4RLC A;  1E7P A;  5A1L A;  3O1J A;  4UF0 B;  5FL1 A;  4U2Y A;  3CK6 A;  5DQV A;  3TKL B;  3L8R A;  2BG9 C;  2C5I T;  4AKG A;  2OV9 A;  1LRZ A;  5HXE A;  4OFZ A;  5AQV B;  2N2M A;  4O3Y A;  5KDM C;  2L3L A;  1W9R A;  3ZN0 B;  1OED B;  4YXD A;  2D5U A;  1Q9G A;  3HI2 A;  3PV0 F;  3ONX A;  2W4X A;  4WZX A;  3AA7 A;  5T5F A;  1MIY A;  1MMN A;  3POU A;  2MPK A;  4EYY R;  2XAH B;  4EV6 A;  2Y8D A;  4TV8 E;  5AQG B;  1QJ9 A;  3UU8 A;  2FBW A;  2LM2 A;  3HOL A;  4C69 X;  5G26 A;  4P0A A;  4E1S A;  3KVD D;  3BRZ A;  3HWB A;  4AIU A;  5L4E A;  1Z8U A;  4WYV A;  3BRY A;  2E8I A;  4LF5 T;  1OXZ A;  4GYS A;  1GQE A;  4YSY A;  2R4L A;  3SYB A;  4IL4 A;  2R88 A;  4KRA A;  5FY1 A;  3HKE E;  1N32 T;  3C98 B;  4HFE A;  1ZV4 X;  3ZN1 B;  3A5X A;  4F8H A;  5L3F B;  5H6R B;  2ZM6 T;  4CN1 A;  4YSX A;  2L9Q A;  1XNQ T;  1W09 A;  4HWI B;  3RKO A;  3ZMS B;  1HX1 B;  1ZHX A;  2LOP A;  1U5P A;  1BR4 A;  4FZM A;  3AE6 A;  4LF8 T;  2OLT A;  3K8P C;  2CWO A;  3WAJ A;  4PJM A;  2GK9 A;  2LHF A;  2Q9Q B;  3LDQ B;  3VE2 A;  3HL6 A;  1N33 T;  4ADZ A;  4WNK A;  4IL6 O;  4C91 A;  1OED C;  2BKO A;  4V1A v;  1MNE A;  3A0B O;  1OSM A;  2DCF A;  2XQ3 A;  3Q5D A;  1WLX A;  4ZZB A;  3UU6 A;  5HEH A;  5IWA T;  2EHO D;  2E5L T;  1E1H B;  2AXD S;  5LP6 E;  2X0H A;  4KR4 A;  2LOS A;  3DA3 A;  4DUZ T;  4JI1 T;  3AA6 B;  4ERR A;  3Q5E A;  4LF7 T;  3WU2 O;  5CB4 E;  4A5X A;  1NEK A;  4IE5 A;  2M6B A;  2FGR A;  1T7S A;  3AE8 A;  3BQK A;  2VKO A;  2XY8 B;  5AQM B;  3WI4 A;  1D0X A;  2LKG A;  3J9X 1;  3PGS A;  5GV0 A;  2NR4 A;  4HFI A;  4K3C A;  3IEE A;  3VR9 A;  3QB5 K;  5ABG A;  1T1L A;  2BBH A;  3DTO A;  2R89 A;  1MMA A;  2E9X A;  3O9X A;  5EK3 A;  4CI2 B;  4H9P C;  1HXT A;  3BQI A;  4NIQ A;  4PW8 A;  1D1A A;  2NW9 A;  3EDU A;  3A0H O;  2DL1 A;  3OYX A;  3PJA J;  5JDQ A;  4IDZ A;  3I9Y A;  3PUZ F;  4Z8X A;  5E79 O;  3P4P A;  2FJB A;  2JQY A;  2WZH A;  1J5E T;  5KX5 E;  4BA9 A;  3M65 A;  4HWH A;  5PRN A;  4IE0 A;  1W0A A;  1ZOY A;  4X1K E;  5AQH B;  3ETU A;  2K5B B;  3ZT6 A;  3SY7 A;  4GOU A;  3SS1 A;  3N2O A;  2WP9 A;  1V9D A;  3QUJ A;  4JI7 T;  4O4H E;  2CMR A;  3Q2M A;  4ZI3 C;  2WM9 A;  4U74 A;  4DUY T;  3PQS A;  4O3Z A;  5DJQ C;  1SE7 A;  4YHJ A;  2H89 A;  3L39 A;  5EE2 A;  2F1C X;  3Q5W A;  5JR9 C;  3G06 A;  4K0U A;  5HXR A;  2NOX A;  3VY8 X;  2WZI A;  3PUG A;  2XE1 A;  4CXX A;  2D0T A;  3K3N A;  3TLW A;  1I6Z A;  4IHJ E;  2V8S V;  2LRK A;  3IBP A;  4RL9 A;  3T20 A;  3SFE A;  3ZJ2 A;  4A98 A;  5D5D A;  3AEB A;  3P4W A;  5J1G A;  3RYF E;  3AA0 B;  1H7C A;  3UUB A;  3ESL A;  3AE3 A;  3UU5 A;  4D65 A;  2W62 A;  5FKY A;  4KBM B;  4XNK A;  2LJL A;  4JCH A;  2W0G A;  2IHR 1;  2JJ9 A;  3ETV A;  4DBQ A;  4AIS A;  1YD8 G;  2NW7 A;  4D5U A;  4EZ4 A;  2BZB A;  2RPA A;  2WS3 A;  2W00 A;  3PUV F;  5H6Q B;  4CXY A;  2XTR A;  4AQG A;  4PK6 A;  4G2A A;  5AQI B;  2IAK A;  3PE0 A;  2XQ8 A;  2CEA A;  1I94 T;  2QTK A;  3AE1 A;  1O3X A;  4PUX A;  5IHY A;  2XPK A;  2XSA A;  4IDN A;  4Q25 A;  4D64 A;  4DV3 T;  1GFP A;  4MHC A;  3V8U A;  4FRX A;  1YKE B;  2Y2X A;  1GFO A;  2XJ7 A;  1PHO A;  1IJ5 A;  4ZI3 D;  3PUW F;  4FRT A;  4YY3 T;  3RIF A;  4JI5 T;  2WY2 A;  4E7Z A;  5FXX A;  3AAA A;  2CXD A;  4IST A;  1M7K A;  3C64 A;  4AKM A;  5C3J A;  3AB3 B;  4JI2 T;  4FQE A;  5JRC B;  5KMG P;  3KZI O;  4B3M T;  4P1N A;  4HWC A;  1MIW A;  2WWV A;  2KLQ A;  4WW0 A;  2W61 A;  5CGM A;  4EIW A;  3JAF A;  5DQW A;  4UVB B;  5ABE A;  2UXC T;  2VVN A;  4F6R C;  1D0Z A;  4BUM X;  3L09 A;  3RQW A;  4IL9 A;  1XMO T;  4YTN A;  4EOZ B;  3VKH A;  5FP3 A;  2Q9Q A;  3ZCI A;  4FZL A;  4OX9 T;  4UEM A;  2NTX A;  5ABF A;  1HXU A;  2ZM0 A;  4DR7 T;  1MMG A;  1E54 A;  2F1T A;  3RYC E;  4GF4 A;  4IGU A;  3WI3 A;  4DID B;  5BMV E;  4JFB A;  3CX6 B;  3N5L A;  4CXW A;  4UXN B;  3ONL C;  3PDY A;  1QLB A;  3POR A;  1MND A;  4O4J E;  2KMF A;  4O4I E;  3SWH A;  3AA6 A;  3RGL A;  3UU3 A;  3PJA A;  5FVN A;  1XDP A;  2A9U A;  5FYM A;  4AZL A;  4OHF A;  4GCP A;  2R4N A;  1OWA A;  1L0V A;  2J4G A;  5IYZ E;  5L3D B;  4LF4 T;  4GK5 E;  4AKH A;  4GCS A;  2WB5 A;  3ZEF B;  1EZ3 A;  3SYS A;  2ACX A;  2BG9 B;  4AKI A;  3OJA A;  1ZHC A; 
#chains in the Genus database with same CATH homology
 3HWB A;  3D0T A;  2E8I A;  3UAQ A;  2Q9Q C;  4P09 A;  2KXP A;  1OXZ A;  4I4T E;  3F57 A;  1QSD A;  2EHO B;  2KIN B;  3GWH A;  3MJX A;  4GYS A;  1MMD A;  4OK0 A;  1ZEE A;  4CI1 B;  3SYB A;  1HS7 A;  4KRA A;  3VZT X;  3UT5 E;  2YNK A;  3CML A;  3FBZ A;  3QC9 A;  5FY1 A;  2ZMA A;  3HKE E;  1T98 A;  2C5K T;  4UVC B;  2V1D B;  3C98 B;  3N9O A;  2BVL A;  4PFP A;  1KNZ A;  1ZV4 X;  1PRN A;  3FXE B;  2J4U P;  3ZN1 B;  3A5X A;  2A3D A;  3E0Z A;  4N78 D;  3UFE A;  1BR2 A;  5L3F B;  2EHO A;  4KMC A;  3JC6 D;  5H6R B;  2LEH A;  4ZI2 C;  4FZN A;  4FI5 A;  4IE7 A;  3Q5X A;  2L9Q A;  4TZ4 C;  1UX4 A;  1X79 A;  3NZQ A;  1UCU A;  4J2C A;  2ES0 A;  5DAB A;  1BR0 A;  1ZHW A;  3RKO A;  3ZMS B;  2LSJ A;  4B6X A;  2KT9 A;  4HKA A;  3CX8 B;  2YPV A;  3CQG B;  2VWA A;  1ZHX A;  2LOP A;  1U5P A;  1BR4 A;  4FZM A;  3ZCJ A;  3KV5 A;  2XE1 A;  4KP3 C;  5JDP A;  2ODV A;  3H37 A;  4ZHQ E;  3LK2 B;  2H3R A;  3O1H A;  3K8P C;  2CWO A;  3WAJ A;  3RYH E;  3O4X E;  4LSH A;  4PJM A;  4QHO A;  2GK9 A;  1B7T A;  2Q9Q B;  2XAJ B;  4C90 A;  2LHF A;  3VE2 A;  3RYI E;  4RJX A;  3WAK A;  3RRC A;  3VZU X;  2VAS A;  3HL6 A;  4QWN B;  2XAQ B;  2CE7 A;  4ZS2 A;  2ODJ A;  2K9A A;  4AYE C;  4ADZ A;  4WNK A;  5M4Y A;  1QJP A;  4O3W A;  4C91 A;  4O4L E;  4QX7 B;  2QGS A;  4V1A v;  3LK2 A;  1MNE A;  2YK0 A;  2X27 X;  2E9X C;  4F4B A;  5LJN A;  3LFM A;  1OSM A;  2XE5 A;  4QX8 B;  4DMV A;  4XNL A;  2DCF A;  4DBR A;  3CQC B;  3PU8 A;  3UUL A;  2V26 A;  4DND A;  1Y64 B;  1WLX A;  3ZPO A;  5LGU B;  2XMX A;  4O4U A;  2DI4 A;  4HFV A;  4PAG A;  5L3E B;  2EHO D;  1BR1 A;  2CA5 A;  4ISS A;  3ZYK A;  4AYD C;  1WR6 A;  2HPJ A;  4AKR B;  4HEA A;  1E1H B;  5LP6 E;  1LKX A;  1FEW A;  1Z0P A;  4EXT A;  2KND A;  5F8P A;  3JTY A;  2LOS A;  3I0Q A;  3DA3 A;  4G76 A;  3CPZ A;  4KR4 A;  4H9R C;  3R6N A;  4TUY E;  3LK4 2;  3AA6 B;  1BT9 A;  5E0O A;  4ERR A;  4AFK A;  3KVB A;  4YJ2 E;  3GA8 A;  4ZOL E;  3V5U A;  5JVD E;  2ZFG A;  3GMI A;  2X0L B;  3AA7 B;  3V5S A;  3KBU A;  5CB4 E;  4IE5 A;  3B13 A;  3ZMT B;  5CA1 E;  2FGR A;  4L9I A;  2VL8 A;  3BQK A;  5ETW A;  4AKR A;  2WBL A;  2VKO A;  3VHL A;  3I9W A;  5FXV A;  2EHO C;  2Y0K A;  4FUV A;  4N59 A;  5JQG E;  2Y0H A;  4H9N C;  3WI4 A;  1D0X A;  4JUY A;  5JDL A;  2DNX A;  4QKN A;  3J9X 1;  2E9X B;  2DLR A;  2XE3 A;  5GV0 A;  2WMN A;  4I50 E;  2NWB A;  5LHI B;  4B61 A;  3WI5 A;  3RC8 A;  3E22 E;  5HWY A;  2OA5 A;  3AA1 B;  3IEE A;  4JEH B;  3MAC A;  3J7Y q;  4QQ1 A;  5LHG B;  4ILU A;  2N2N A;  2CXF A;  2LSK A;  2Y6X A;  5J2T E;  4RJW A;  5IYU A;  4HN9 A;  2Q9Q D;  3DP7 A;  2CWY A;  2FGQ X;  1FMV A;  1D0Y A;  1YKH B;  2LSY A;  2N9D A;  3DTO A;  4L0R A;  2PG8 A;  1MMA A;  2E9X A;  2YU1 A;  5EK3 A;  3FXD B;  5LBQ B;  3W15 B;  4EZH A;  3O9X A;  4CI2 B;  2KXP B;  3EUH A;  4Z3T A;  2MNH A;  4L5G A;  4H9P C;  3S4U A;  2WSS V;  1HXT A;  4MFR A;  3BQI A;  3O1I A;  2P9B A;  3VZW X;  4PW8 A;  5HXS A;  2XTL A;  3KV4 A;  1D1A A;  1D1C A;  3BK9 A;  5LOV E;  2NW9 A;  3ZYM A;  3EDU A;  3PRN A;  3SRZ A;  4ZI2 D;  3OYX A;  1VOM A;  2IC6 A;  4UEL A;  3SZD A;  5JDQ A;  4IDZ A;  3I9Y A;  2ZLD A;  3C5O A;  3OYZ A;  4Z8X A;  3G7G A;  3PUA A;  2V7M A;  3NSG A;  4DO0 A;  3FBL A;  5EK4 A;  4X1Y E;  4AKL A;  2V7I A;  2KWI B;  4I43 B;  3VU7 H;  4OYK A;  2D2S A;  5KX5 E;  5L3G B;  4BA9 A;  3IHR A;  4GCQ A;  4YLH A;  3M65 A;  1OPF A;  2Y0L A;  3UU2 A;  3RBH A;  5GON E;  3ZMV B;  4ANJ A;  5JDM A;  4TX5 A;  4H9O C;  5PRN A;  4IE0 A;  1HTJ F;  2MOZ A;  4FT6 A;  2SPC A;  4XAX B;  1MIV A;  5LNK A;  4JLE A;  2DWK A;  5DL8 A;  1CUN A;  2VB6 A;  4AYM C;  1HFA A;  4KUM B;  2UXN B;  3AAI A;  4X1K E;  2MBG A;  3ETU A;  4YJ3 E;  2K5B B;  4QXB B;  1LVF A;  3FB2 A;  3SY7 A;  3MKD A;  3H3A A;  4GOU A;  3HA4 A;  3SS1 A;  5C8Y E;  4DVD A;  3N2O A;  5JDF A;  3KIN B;  4UV9 B;  1V9D A;  3QUJ A;  3P8C D;  2LSI A;  3BQL A;  3ZJ1 A;  3N2K E;  4O4H E;  5LXT E;  2E9X D;  3VY9 X;  3PU3 A;  3HKB E;  1FIO A;  2MTQ A;  5DL6 A;  1ZHY A;  1AJ3 A;  2CMR A;  3AVS A;  2PFV A;  4FSO A;  2GE4 A;  3K3O A;  3ZC1 A;  1YS5 A;  3UPG A;  4O2A E;  2WAU A;  3KVA A;  2X9H A;  3PUR A;  5L2L A;  1D1B A;  3Q2M A;  2XTQ A;  4ZI3 C;  2WM9 A;  4U74 A;  4PK5 A;  3PQS A;  4O3Z A;  4QXH B;  1US7 B;  3MK7 C;  5DJQ C;  4O8S A;  1YW0 A;  5LJM A;  1HG2 A;  3TZG A;  2NTY A;  3HKD E;  4YHJ A;  1HCI A;  1BH3 A;  3QRC A;  3VE1 A;  3C4W A;  1UX5 A;  5EE2 A;  3NRY A;  2Y7S A;  2RP4 A;  3POQ A;  3Q5W A;  2V7K A;  3N9Q A;  5LBM A;  5JR9 C;  3SZV A;  4K0U A;  5FNV E;  2IW5 B;  5LG4 A;  2K0L A;  5LA6 E;  2PRN A;  4U9C A;  5HXR A;  4MAL A;  1H6S 1;  1U4Q A;  2NOX A;  4UIG A;  2LM9 A;  3KVD D;  2QA7 A;  5LYJ E;  2A2F X;  5JDH A;  4FES A;  5JRC A;  3VY8 X;  4AYI D;  2K48 A;  1FMW A;  3PUG A;  2CCQ A;  3PUS A;  4GYR A;  2D0T A;  3UUM A;  4CXX A;  3P7I A;  4FSP A;  3K3N A;  3N9M A;  4GK0 E;  2XG6 A;  3LK3 A;  5F3J A;  4X1I E;  3KV9 A;  1WRD A;  5AFU L;  2JMM A;  8PRN A;  3UUN A;  4CQI A;  4IHJ E;  3GN5 B;  2YU2 A;  2YIN A;  2X9Y A;  3KV6 A;  2X66 A;  1IAP A;  3IBP A;  5JDN A;  4RL9 A;  5DL7 A;  3U78 A;  3T20 A;  3ZJ2 A;  2DWG A;  2N1G A;  3I0O A;  3OBV E;  2UXX B;  5D5D A;  2V7L A;  2XE2 A;  4LSE A;  1ORM A;  4E7S A;  2X51 A;  3CWZ B;  1HG5 A;  4PJJ A;  4O3X B;  5J1G A;  3RYF E;  5CA0 E;  1S94 A;  2JPF A;  4O2B E;  4CI3 B;  2ZM2 A;  3AA0 B;  2LFU A;  1H7C A;  3AAE B;  3GN5 A;  3RX6 A;  1HXX A;  2M07 A;  3Q9D A;  2I59 A;  3ESL A;  3ANW B;  5AFU K;  5JR9 B;  2VK9 A;  3GP6 A;  4D65 A;  4WBN E;  1S35 A;  3RH3 A;  4HE8 A;  2W62 A;  2LE8 A;  3PUQ A;  2JRK A;  2MYS A;  2C0S A;  4KBM B;  1NAF A;  4XNK A;  2J1D G;  2LJL A;  2B1E A;  3F2E A;  2W63 A;  3F31 A;  4JCH A;  2W0G A;  5HAX A;  5JH7 E;  2JJ9 A;  3CQX C;  5TAO A;  2ZM8 A;  3C50 A;  2VKH A;  3ETV A;  2IC9 A;  3AA0 A;  3AAE A;  4DBQ A;  1NWM X;  3I1A A;  1YD8 G;  4AI6 A;  2NW7 A;  2D0U A;  1GFN A;  1ZHT A;  5ADX K;  2A72 A;  4XZC A;  5JDG A;  2XAG B;  5JRE A;  3ANW A;  3R84 B;  5JR9 A;  4AXP A;  3ZLI A;  1Q9F A;  4AUI A;  4D5U A;  4EZ4 A;  2W81 C;  2BZB A;  5HXC A;  1HX8 A;  3K3Q C;  3KFW X;  3HW9 A;  2W00 A;  3EDV A;  4LSI A;  5H6Q B;  2CM0 A;  4TV9 E;  4CXY A;  3ZYL A;  4FMS A;  2XTR A;  3AVR A;  4AQG A;  2JMH A;  4PK6 A;  4G2A A;  4NUU A;  2HH7 A;  3RC3 A;  2N2L A;  2IAK A;  2VKJ A;  4O49 A;  3PE0 A;  4ASK A;  2CEA A;  4H9S E;  2M06 A;  3QRA A;  2J1N A;  3PQU A;  2QTK A;  5FXW A;  4E1T A;  1O3X A;  5DL5 A;  3T24 A;  4PUX A;  4A56 A;  3LG7 A;  1P4T A;  2XHE B;  3NRX A;  5IHY A;  3O0E A;  2X9X A;  4BJN A;  4QXC B;  4PNI A;  4D64 A;  2LT3 A;  2HPL A;  1GFP A;  4MHC A;  4AQF A;  2ERV A;  3ZC0 A;  4MLK A;  2KDY A;  4FRX A;  3V8U A;  4LSF A;  3AAA B;  1YKE B;  2DHR A;  2WMO A;  1ZKE A;  2POR A;  2Y2X A;  1GFO A;  2XQY A;  1PHO A;  1IJ5 A;  3HOE A;  4ZI3 D;  4AYN A;  5HYA A;  1G73 A;  5L3B B;  2LSG A;  3LK4 1;  2X9W A;  2KC0 A;  1QJ8 A;  4FRT A;  2LHN A;  3VKG A;  3RRW A;  4YFS A;  4DMW A;  6PRN A;  2KWH A;  2WWU A;  4E7Z A;  5HXH A;  3CKD A;  1IZN A;  5FXX A;  3UUX B;  3AAA A;  3LJC A;  2CLY B;  2CXD A;  2XUE A;  1GFM A;  4IST A;  3PTR B;  2MHL A;  3T0S A;  3ZMU B;  3C64 A;  2YEV C;  4XBF B;  3MZK B;  3N9P A;  4AKM A;  4EAH A;  3AB3 B;  1THQ A;  4G63 A;  7PRN A;  4NUV A;  4WBO A;  1BXW A;  4FOZ A;  4CZZ B;  5JRC B;  3C4X A;  2BDE A;  5J2U E;  2K24 A;  5KMG P;  4P0B A;  3LK3 B;  2O4V A;  4FJO A;  1WYB A;  1G90 A;  4N58 A;  4ZS3 A;  4EYU A;  4JEU B;  5LGT B;  1MIW A;  1ZHZ A;  5FXZ A;  2KLQ A;  4WW0 A;  2KZ7 B;  2W61 A;  2XAF B;  2G0U A;  3LBX B;  3FHN A;  4M1P A;  4BAY B;  2X68 A;  2OMF A;  4EIW A;  4I55 E;  4OYJ A;  4IIJ E;  3RPU A;  3T8O A;  5DQW A;  2CXL A;  2NW8 A;  4U72 A;  2X67 A;  3QK6 A;  4H63 V;  4UVB B;  2JMK A;  4H9Q C;  5LHH B;  4F6R C;  1D0Z A;  5FMN A;  3JC6 C;  2C5J A;  4BUM X;  2Z6E A;  2ZLY A;  3DJB A;  3FYX A;  4MBQ A;  2RA1 A;  3IF8 B;  3K19 A;  2PBI A;  1HF8 A;  2KZ7 A;  3LBX A;  3L09 A;  4ZI7 E;  1WYC A;  2K4T A;  4O4X A;  3NBX X;  1MM4 A;  3CX7 B;  3MA9 A;  2ODU A;  4GIW A;  3A2S X;  4PFO A;  3UTK A;  3NZP A;  4EB6 E;  3EVY A;  3HR0 A;  4IE4 A;  4G75 A;  4EOZ B;  3N2G E;  3VKH A;  4PJL A;  5EZY E;  5FP3 A;  5FY0 A;  2Q9Q A;  3ZCI A;  4KR8 A;  3L3P A;  3N9L A;  4AQF C;  5ADX L;  2H7V C;  2LHR A;  1KK7 A;  4FZL A;  4RLC A;  4GHB A;  4UEM A;  2NTX A;  5A1L A;  2V7J A;  1LVK A;  1HXU A;  2ZM0 A;  3O1J A;  1MMG A;  4UF0 B;  1E54 A;  3OKQ A;  5L3C B;  3POX A;  2F1T A;  3RYC E;  5FY7 A;  3SOL A;  3E08 A;  4IGU A;  4GF4 A;  1MM5 A;  4RLB A;  5DQV A;  3WI3 A;  2L8K A;  3TKL B;  5BMV E;  3DA4 A;  4BJM A;  3KDS E;  4JFB A;  3CX6 B;  3HKC E;  1SHZ C;  2C5I T;  3N5L A;  4AKG A;  4CXW A;  1LRZ A;  1G8X A;  4UF0 A;  4UXN B;  3PDY A;  5HXE A;  4OFZ A;  2Y48 B;  5HWX A;  1GFQ A;  2N2M A;  3POR A;  4O3Y A;  1SA0 E;  5KDM C;  3SY9 A;  2L3L A;  1MND A;  1IJ6 A;  3ZN0 B;  4O4J E;  3C51 A;  5LCY A;  2KMF A;  4PJN A;  4O4I E;  5EK2 A;  2BVM A;  3SWH A;  2D5U A;  1Q9G A;  3AA6 A;  2CLY C;  3HI2 A;  3U3I A;  2NP9 A;  5FVN A;  3CVR A;  3ONX A;  4PK4 A;  2F1V A;  3AA7 A;  5T5F A;  5FYM A;  2XAS B;  4AZL A;  1MIY A;  1MMN A;  4IE6 A;  1VRB A;  3POU A;  4OHF A;  3ZMZ B;  4EYY R;  4GCP A;  2XAH B;  1OWA A;  2Y8D A;  4TV8 E;  4UVA B;  2VKD A;  4UV8 B;  1QJ9 A;  5LGN B;  2JQQ A;  5IYZ E;  3B57 A;  3N9N A;  5L3D B;  2H7O A;  4GK5 E;  4X20 E;  3HOL A;  4AKH A;  1IZN B;  3C4Z A;  1MPF A;  4C69 X;  3AA1 A;  4GCS A;  2PJQ A;  4H63 H;  3ZEF B;  5G26 A;  1EZ3 A;  1QUU A;  4HTE A;  3MXZ A;  2ACX A;  3EMN X;  3KBT A;  3SYS A;  4HGA A;  2M67 A;  4AKI A;  4TN7 B;  4P0A A;  4E1S A;  2W80 C;  3OJA A;  1ZHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...