2KZ7B

Solution structure of the carmil cah3a/b domain bound to capping protein (cp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
publication title Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
total genus 80
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kz7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kz7B02
3LK41 5ADXK 3LK3A 3AAAA 3LK2B 3AA0A 1IZNB 3AAEA 3AA1A 3AA7B 2KZ7A 4AKRA 5AFUK 5ADXL 3AA6A 3LK3B 2KXPA 3AAAB 3AA0B 3AAEB 3AA1B 5AFUL 2KZ7B 3LK42 4AKRB 3AA6B 3LK2A 1IZNA 3AA7A 2KXPB
chains in the Genus database with same CATH superfamily
5LP6E 2W2UA 3Q2MA 2LHFA 3IF8B 1B7TA 3VR9A 3K3NA 4DR1T 4UB6O 4K0KT 2D2SA 2JJ9A 2KLQA 3GP6A 1ZV4X 3ZN1B 2FJDA 3E08A 1I94T 2BS2A 2VL0A 1IZNA 4FSPA 1D1AA 1UK5A 2D9DA 4GCPA 4RJXA 1HFAA 2XHEB 1ZEEA 3POUA 4RLCA 4EIWA 5JR9C 4FOZA 2X27X 3AAEA 3KVAA 4U3CA 1KNPA 2MYSA 4XNKA 2VKHA 4EV6A 3DWOX 4O3WA 3AEBA 4DR5T 1S94A 1J5ET 1GFNA 1QJPA 4U72A 3UU5A 4CN4A 2XAHB 5GTIO 1HXXA 1MM5A 2UUAT 3RYIE 2FGRA 2AXDS 2LEHA 4AXPA 1OWAA 2E5LT 4LF6T 1OPFA 4HWIB 5HEUA 2ZFGA 2L9QA 4O4JE 4UVCB 5L3GB 4HN9A 3CWZB 2NW9A 2LE8A 2W66A 3IBPA 2BBJA 3BQLA 3M65A 2QVAA 2BS4A 2E5VA 5LG3A 2CBIA 1N34T 4TWHA 1XNQT 2RPAA 2H7OA 1MM4A 4XZCA 5JDGA 4KUMB 4H63H 2FJAA 3AEFA 2LSGA 2BKPA 5DJQC 1HTJF 5ADXK 2X66A 1E1HB 2KINB 2NOXA 4LMLA 2XAJB 1KNZA 3UUBA 4QHOA 1US7B 4OX9T 2NR4A 4IL9A 4NPPA 1KF6A 1XMOT 2A3DA 1Q9GA 2E9XC 1EZ3A 3U78A 3LSVA 4LMKA 2K3WA 3EMNX 2WP9A 3K19A 2K4TA 1XDPA 4TNWA 4OHFA 4DV5T 1I6ZA 4O4LE 3KVDD 4L0RA 2M67A 3E0ZA 3BRZA 2K0LA 4IIJE 4RLBA 3RIUA 1VRBA 4NXNT 3LFMA 3NRXA 4TV9E 4IGUA 2LM2A 2WU2A 4DV1T 4WBOA 3CQXC 5LBMA 3N2KE 3ZN0B 4GKJT 3KINB 2A2FX 5DQVA 2DWGA 3UFGA 4UIGA 4GK0E 2Y7SA 2MAWA 4O4UA 4O4XA 2JMHA 2LLYA 4TWFA 3ZCJA 3PRNA 3PU3A 3UULA 1BR1A 1NEKA 1BR0A 4IL4A 2AXTO 4U33A 1Z0PA 2G0UA 4QH1A 2LSJA 1M62A 2CHNA 2IW5B 4PJ0O 1SUMB 2XQ3A 2XPKA 4PFPA 2MHLA 5KXJA 1W9RA 2R88A 4LF5T 2YOEA 4JI6T 4CXYA 2ZM8A 3AAIA 4YTPA 2XM1A 4A56A 4IHJE 3UPGA 2O4VA 3FXEB 3RC3A 2QA7A 2ODUA 2XQ9A 4YLHA 1ORMA 5JQGE 3CK6A 4EYUA 3CMLA 4CN1A 2KWIB 2N2LA 4DV2T 4IL6O 3AE6A 4LSIA 1G8XA 5B5EO 4I43B 3ZCIA 4O3XB 1CUNA 1VOMA 2X9XA 3ANWB 4X1IE 1HNXT 2XE1A 1OEDE 5FXWA 7PRNA 2K9AA 5AQTB 1IBKT 2PTFA 2L8KA 2IMLA 4O8SA 2UU9T 2C0SA 3WAKA 2IUBA 4JEHB 4U31A 1ZHCA 2D5UA 4AKIA 5KX5E 2NTXA 1AJ3A 4DUYT 1WRDA 3C50A 3VRAA 3TLVA 3FB2A 2WJRA 1BT9A 4IE0A 4A97A 2N1GA 4IE4A 1GFPA 2X68A 2MBGA 1MMDA 4WW0A 3HKDE 4O4HE 5HCMA 3ANWA 4F4BA 1OEDB 3HOLA 4I4TE 5PRNA 3T24A 2KZ7B 3DTOA 4LF9T 5AQJB 3D0TA 5LGUB 5HXHA 4X1KE 1KK7A 2ES0A 2XTQA 1GFQA 4FZLA 3B57A 3LK3B 2YU2A 3IHRA 3K1SA 3OJAA 1Z8UA 5HAXA 2Y2XA 5AQLB 3VHLA 3SOLA 5FP3A 2W00A 2R6GF 5H6QB 3CQCB 5ABFB 3RH3A 4UVBB 4TNVA 1OEDA 2LSIA 3LK2B 3AA7B 4IDNA 2KZ7A 4FSOA 3AAAB 2KT9A 2WS3A 3FYXA 5FVLA 3PGSA 3JAEA 3PUYF 3MA9A 3OTOT 4L9IA 3CIRA 4NXMT 2W62A 2Z6EA 3PUQA 2YDRA 4AQFA 3LK3A 2DL1A 5JRCB 3HKCE 2LKGA 5JTGA 2C5KT 2IWVA 5JH7E 1HS7A 5ABFA 1ZHWA 3LK2A 5DL5A 3AA7A 3SS1A 2KXPB 2XQ7A 3ZT6A 4X5TA 5LGTB 4U7YA 2VWAA 3X1DA 3KDSE 3AAAA 5H2FO 4YFSA 3PORA 5H6RB 4ZHQE 2JMKA 4DIDB 4UV9B 2WDQA 3VY8X 1HXTA 2PG8A 5JRCA 4L5GA 3R84B 3DA3A 4BUMX 1E7PA 4Q25A 3AEDA 5ETWA 1H7CA 1SA0E 2NW7A 2CWOA 5EK3A 2XQYA 4TX5A 2JQHA 2V6XA 1H6S1 3ABVA 4B61A 2N9DA 3PQUA 4FMSA 4G76A 4P09A 5KMGP 4A5XA 2ODVA 2KXPA 3HA4A 3M3ZB 5FXXA 2LT3A 4ZI2D 3LK42 1S5LO 4JYAT 2WDVA 4IDPA 3WU2O 4OYKA 5LCYA 1WCRA 4FI5A 3FBLA 3AVSA 3PDYA 2ZM0A 5FY0A 2IAKA 4P1NA 3BQKA 4PJLA 4PJMA 3JC6D 5ABHA 5F8PA 4QX7B 3T8OA 3PQSA 4QWNB 3UTKA 1BR2A 2V5CA 5HXEA 3POXA 5FKYA 3RPUA 2M6BA 3N2OA 4V1Av 3PGRA 2WU5A 3FHNA 2JQ9A 3Q5EA 2WSSV 5AFUK 3T1HT 3TLTA 3AE8A 1Y64B 3EVYA 2H89A 3WI3A 3O9XA 1GFMA 1G90A 2B1EA 4GOUA 4JEUB 5HEOA 1S35A 4DBRA 1N36T 5D5DA 1R8IA 3PUVF 3N9OA 2FGQX 5HXRA 3RI5A 3FZHB 4JUYA 2HH7A 3KFWX 4ZI3D 5LYJE 3LJCA 4PJNA 4B3RT 2BG9C 3J9X1 4JI5T 2AE9A 4CTDA 1XWMA 4N59A 3RYFE 5JVDE 3UU2A 2Q9QB 2X9YA 3P4RA 4UB8O 3VY9X 3V8UA 5FVNA 1LVKA 3SWHA 4OFZA 4UR9A 3UU8A 4X1YE 5LB7B 3ZLIA 3IEEA 4ZEYA 3AEAA 4C91A 2Y6XA 2HHHT 3WI4A 1QUUA 2D0TA 2V7KA 2JQKA 2XQ5A 4N75A 5LXTE 2PJQA 3ONJA 4LF8T 3O4XE 4ZZBA 3PUGA 2V7MA 4PR7A 3A0BO 4QX8B 2CCQA 3P7IA 2WZIA 2OMFA 4F8HA 1HNZT 1D1BA 1VCSA 2Q9QA 5IYUA 1OXZA 1L0VA 4DUZT 4LF7T 2UXBT 3VZTX 5HWYA 4AQGA 2BBHA 3QK6A 2MOZA 2V7LA 4BA9A 3ZJ1A 4GIWA 1IBMT 4TV8E 3VR8A 5LBQB 4ISSA 4A98A 2WJQA 3SFEA 3W15B 4H9SE 3RIUC 2ODJA 4CI1B 2F1TA 2XM2A 2BVMA 4O2AE 3ZSSA 4YT0A 3JAFA 2X67A 5AQKB 5DABA 3V5SA 4TZ4C 1HXUA 3CVRA 2QRXA 4O2BE 2PORA 2DCFA 4LF4T 1V9DA 4AYNA 2V7JA 2CLYB 3C4XA 4G2AA 4RL9A 3OVUA 1ZHYA 3PJAA 5CJ5A 1J1JA 4X64T 5L3FB 5LHHB 1UUSA 5G38A 4C4VB 2EHOC 4CZZB 4KP3C 3PUXF 4ZS2A 2LHRA 5ABGA 1W09A 3RIFA 4IT4A 4B6XA 4JI2T 3KV9A 4RJWA 4LSEA 2WAUA 4AISA 4COFA 1D1CA 5JDFA 2R4NA 2UXXB 1YXRA 1MMGA 4PK6A 2GK9A 2F1CX 4JFBA 1W0AA 1X9BA 3ZPOA 3EDVA 4B3TT 4C4VA 5HXSA 5JR9B 3I9WA 5FY1A 1LRZA 4DR7T 3FZKB 4PK5A 2YINA 5F5WA 5HEHA 2R89A 3O1JA 2KC0A 3FZFB 3C51A 5LA6E 1LVFA 3SYSA 2LOPA 2KDYA 1NAFA 4EAHA 5G26A 5M4YA 1KNRA 5AQPB 1PHOA 4KR8A 3PUSA 3ZC0A 5IHYA 2LKHA 4WZXA 2BKNA 1WFDA 4AZLA 2I59A 1WYBA 4YSYA 4CXWA 4HFHA 5IUXA 2IHR1 3DWNA 2Y48B 5JR9A 2ZM6T 2YKSA 4QKNA 5CFBA 4I0UA 3UU6A 4I55E 2NP9A 2LM9A 2BDEA 1X79A 2W67A 4HFVA 4K3BA 3KBTA 4B3MT 3SY7A 2W81C 1YS5A 1BXWA 2BS3A 4X20E 5AQGB 4Z90A 5J1GA 4AI6A 2OA5A 3KV5A 4IDQA 2VKDA 4UELA 5FL0A 4WYVA 2K24A 2RA1A 2HPJA 5EZYE 4JI0T 2F4VT 2XAQB 4U2ZA 2LSYA 4EZHA 4K0UA 2YDSA 2Y0LA 5DL8A 5E0OA 4AKLA 4UXNB 2R4OA 4F6RC 2VQET 3A0HO 4LMJA 2H88A 2E9XB 2XQ6A 2CXFA 3HW9A 4YSZA 4MBQA 2NTYA 5EE2A 2W80C 4KHPT 3I9YA 4AYDC 1Q9FA 2XASB 1E2AA 3AE3A 2XMXA 1ZHXA 2DHRA 2X0LB 2HN1A 2VVNA 3CX8B 2JQYA 3ZJ2A 2Y0KA 5BMVE 4LFAT 1T16A 3TLWA 4HFIA 4JV5T 3GN5B 3RRWA 2E9XA 2KNDA 4ILBA 3UT5E 4GF4A 3VE1A 4H9PC 4Z3TA 3Q9DA 1YD8G 3UUXB 4DNDA 2I0MA 5LMUT 2XQ8A 1KFYA 5BR8T 4QQ1A 4DR6T 5JDQA 1SE7A 4KR4A 4IREA 2C5IT 1MIVA 2IC9A 4UF0B 4FESA 1M7KA 3GN5A 3P8CD 3AVRA 2Q9QD 2XG6A 5GV0A 5AQMB 4DR3T 2LFUA 3FZLB 3AA6B 5AQUB 1QJ9A 2DWKA 2CM0A 2R4PA 4C00A 2VURA 2UXCT 4P0AA 4D65A 2CHOA 3QB5A 3O0EA 1YQ4A 3NWIA 4U7IA 2X9KA 5HCJA 3VU7H 2L3LA 2IDOB 2I6HA 3MZKB 2V7IA 1MIWA 5FY7A 4UF0A 4YSXA 3AB3B 3KBUA 4JCHA 4FQEA 4ZI7E 4GYSA 4ILAA 4UV8B 3CKDA 2CEAA 2WMNA 3AA6A 3PUAA 3B5MA 2MPKA 5HXCA 4E1TA 1HG5A 3N5LA 2MTQA 4GHBA 4AQYT 5GTHO 5C3JA 3VE2A 2C5JA 1UX5A 1UX4A 4DR2T 3A7MA 2JMMA 3T0SA 5E79O 3C5OA 4PAGA 1WR6A 4G63A 4YHHT 3NJTA 2R4LA 4TWDA 5J0ZA 1T7SA 3QB5K 3ZT7A 2F1VA 5GONE 3H3MA 2WDRA 4GKKT 2LHNA 5CB4E 1GFOA 4MALA 3C4ZA 4C90A 3HI2A 5JDHA 1D0XA 1LKXA 4ERRA 5DL6A 3OBVE 2VASA 2XTLA 2WB5A 3K3OA 5G3AA 3LBXB 3ESLA 5HYAA 2X0HA 2IWWA 5HEGA 5L47A 3BS0A 3LG7A 4PUXA 4DBQA 2XE3A 2W0GA 2A72A 4BJMA 1ZKEA 1N33T 3LDQB 1UGOA 3VRBA 1MIYA 4J2CA 3H37A 4M1PA 4DV4T 1MMNA 4MLKA 5EK4A 3HWBA 4H9OC 2Y0HA 2XSAA 2XZEA 3C64A 4D5UA 5AQIB 3A2SX 4QH4A 5CGMA 4NUUA 3EHZA 4EOZB 1NENA 3LBXA 4YJ2E 1KEYA 2KSRA 2UXDT 2J1NA 3NKZA 3POQA 5FYMA 3AXJB 1ZP0A 5J2TE 1MNEA 2LRKA 3K3QC 5CA1E 3I0OA 1XMQT 4KRAA 4CI3B 1GQEA 1FEWA 5CA0E 2VB6A 3OYZA 3TKLB 3ZMVB 4DR4T 2HPLA 3VZWX 3NVOA 3OPCA 3N9NA 2X9HA 5FL1A 3I1AA 2MNHA 3Q5XA 8PRNA 2FUPA 5LHGB 4AYEC 3NZQA 1XZYA 5EK2A 2YEVC 5LOVE 3AEEA 4E1SA 5F3JA 3AEGA 3AXJA 2R8AA 5LJMA 3QUJA 5L4EA 3P4QA 1IAPA 1XNRT 4FUVA 3C4WA 3RHWA 3RF1A 1YKHB 5HEJA 3ONLC 3E22E 2WWUA 2PFVA 2V1DB 5FMNA 4DV7T 5L3EB 3PUWF 1NWMX 1J5WA 3EABA 3HKEE 4EZ4A 2DNXA 2XAGB 3O1HA 4FZNA 3UFEA 2WM9A 4MFRA 2QYWA 3CX7B 5DQWA 2M6IA 3A8YC 4QXHB 3JTYA 3ZMSB 2E9XD 4AUIA 3BQIA 4AIUA 1IJ5A 1BH3A 1D0ZA 4TUYE 2OV9A 4AYID 5AQRB 2XE2A 1T98A 2D0UA 4YTMA 2BG9E 2LOSA 4AKRB 4GCQA 4ILUA 4KHZF 1UURA 5L4HA 3P4PA 4PFOA 5L3CB 3LK41 5FXZA 3RQWA 4IDZA 4GK5E 3BRYA 1FJGT 2KWHA 3T1YT 2W61A 3IA3A 3EDUA 4LSFA 4HWHA 4ZI2C 4EB6E 2J62A 2YU1A 5JDLA 1CHUA 4ANJA 4FRTA 5TISO 1JNZA 4NIQA 2BG9B 3KV4A 5AQVB 3P4SA 2A9UA 4KI0F 4EGWA 4K3CA 1HCIA 1D0YA 4AKRA 3UQ7A 4TN7B 3ETUA 2VKJA 1MNDA 5KDMC 4E7ZA 3JC6C 3PF1A 4CQIA 4ZZCA 4Z91A 4HWFA 3N2GE 3MJXA 4N74A 2X51A 4HFBA 2J1DG 4U2YA 3EUHA 2V5DA 2B76A 3FBZA 3TZGA 3CPZA 4IE6A 3AE9A 4FZMA 4ISTA 3WI5A 4XNLA 2BG9A 4UVAB 1FMVA 4EEBA 2H7VC 6PRNA 4HWCA 1O3XA 3RLFF 3G7GA 3RBHA 2WWVA 4H9QC 3UUMA 3VKHA 5L2LA 4HFEA 4E7SA 5B66O 4ZI3C 2XSBA 4X62T 5AQFB 4XBFB 3T20A 3DP7A 4HEAA 3PU8A 3EAMA 2VVSA 1Y01A 4FJOA 2CMRA 5TAOA 4KX6A 1YQ3A 1IJ6A 2JIWA 2M07A 2XTRA 1HX8A 3G06A 3F31A 4FT6A 1HX1B 1HF8A 4EEDA 1ZHZA 2EHOB 3F2EA 4DV0T 2J47A 4YY3T 3S4UA 2FJBA 4YHJA 4JLEA 1WYCA 2WQYA 2BKOA 2VL8A 3HR0A 2WMOA 3ZT5A 3A5XA 3AECA 5LGNB 4JI3T 4QXCB 1T8BA 2ACXA 3CX6B 3ZYKA 1U5PA 4H9RC 4PK4A 2M06A 3RGLA 1W0BA 2WY2A 5AQNB 5JDNA 3PGUA 1T1LA 3WAJA 2EHOA 4EYYR 3KV6A 2XQ4A 3DA4A 5DL7A 4HFDA 4ZXLA 3P50A 3V5UA 3FXDB 2XE5A 4AKGA 4JI1T 1VCTA 4O4IE 3PUZF 5HWXA 2VKOA 3OYXA 1OSMA 4LFBT 3J7Yq 4ADZA 2H3RA 2LSKA 4DO0A 2RP4A 4DV6T 5G39A 1U4QA 1OEDC 1PRNA 4U9CA 3PV0F 3RKOA 5KAIO 4OYJA 3QOFA 4N78D 1FIOA 4KMCA 2BZBA 4X65T 2UXNB 4JI4T 2ZMAA 4AQFC 5A1LA 4DVDA 3CQGB 1JNRA 3NBXX 4DMVA 3UAQA 2FJEA 3AA0B 5AFUL 2CXDA 1E54A 2HN2A 3EI0A 3P4WA 2CWYA 5IYZE 2GE4A 4CN6A 2VQFT 3KZIO 2CE7A 3OKQA 3NSGA 3DZMA 2ZM2A 2WVPA 4B3ST 1N32T 2CA5A 2LJLA 5FNVE 3AE7A 1HG2A 1DU2A 4PNIA 3QRCA 4ASKA 3NZPA 4WNKA 1WLXA 2UUCT 5JDMA 2W63A 4IDOA 1QLBA 2NWBA 3SZDA 4WBNE 3MK7C 1HR0T 3AA0A 4HGAA 5LHIB 2V8SV 5AQOB 4NUVA 4CXXA 1BR4A 3N9LA 2JPFA 3H3AA 2E8IA 3JADA 2V6YB 2QTKA 2KMFA 2JRKA 4QXBB 3UUNA 2SPCA 1QSDA 5LG4A 4FRXA 2CPTA 4DMWA 4LSHA 4O49A 3ETVA 3KVBA 4KBMB 2DLRA 3PTRB 3TLSA 3ZMZB 3N9QA 3QRAA 3N9MA 3RC8A 3ZMUB 4AYMC 4EXTA 5ABEA 3ZKRA 2V6YA 3F57A 3PURA 4LFCT 2NW8A 3I0QA 3O1IA 2N2MA 1WR0A 2WZHA 4X66T 2LRLA 5LJNA 5JDPA 2JQQA 2CBJA 4DV3T 3GA8A 1SHZC 5FXVA 2DI4A 3Q5WA 3UU3A 3PJAJ 3QNUA 5FVKA 3SYBA 3RQUA 1MPFA 3GWHA 3HOEA 4AFKA 4HWDA 2WCAA 4ZS3A 3RIAA 2E2AA 4PJJA 4HTEA 4ZOLE 2J4UP 2K5BB 2YN6A 3ZMTB 2YDQA 4OK0A 3UU4A 3RYCE 5C8YE 3HKBE 2PBIA 3RYHE 2XJ7A 3RRCA 3L8RA 4UEMA 2XQAA 4CI2B 1ZOYA 3AA1B 4U74A 4H9NC 3L3PA 4JI8T 2V26A 3K8PC 5LMNT 3L39A 3Q5DA 4AKMA 3AE4A 4Z8XA 3RX6A 3AE2A 5L3BB 4AKHA 2ZLDA 3N9PA 1P4TA 3UQ4A 2IC6A 1T72A 4O3ZA 3SRZA 5LNKA 5ADXL 3GMIA 1THQA 2Q9QC 3PE0A 3NRYA 4C69X 2YPVA 4IE5A 1FMWA 3BK9A 2ZLYA 4HKAA 4GYRA 1QJ8A 5KAFO 2UUBT 1HNWT 2N2NA 2ACZA 5AQQB 2OLTA 3B13A 2XAFB 4HFCA 3R6NA 3AA1A 4HE8A 2P9BA 3SY9A 3AE1A 3DJBA 4BAYB 4BJNA 4JBWF 4PW8A 4QH5A 2FBWA 2IIUA 3MXZA 2Y8DA 3TLUA 2EHOD 1UCUA 4N58A 3QC9A 3JCUO 1XDOA 4D64A 3FZMB 3ONXA 2J4GA 5JREA 2ERVA 3MKDA 2YK0A 5C2TA 2CXLA 4MHCA 5L3DB 3VZUX 1MMAA 3U3IA 2W4XA 3JCFA 2CRBA 4YXDA 3ZYMA 3L09A 4O3YA 2XY8B 4YTNA 1IBLT 2XUEA 1ZHTA 2X0YA 4H63V 3RKGA 1G73A 5AQHB 2BVLA 3ZSTA 3SFDA 3ZC1A 2K48A 4I50E 2VK9A 4P0BA 5IWAT 3SZVA 2QGSA 3HL6A 3AE5A 1YKEB 3VKGA 4G75A 3ZEFB 4JI7T 2CLYC 2WBLA 4GCSA 1IZNB 1YW0A 4YJ3E 5T5FA 4ILCA 5AQSB 4IE7A 2X9WA 3AAEB 3MACA 3ZYLA 2YNKA 3C98B 4XAXB 2PRNA 5J2UE
chains in the Genus database with same CATH topology
1HX8A 5JDQA 5ETWA 1H7CA 3F31A 4FT6A 5LP6E 1HF8A 1SA0E 4KR4A 2NW7A 2C5IT 1MIVA 2CWOA 1ZHZA 2IC9A 5EK3A 2XQYA 2EHOB 3Q2MA 4TX5A 4UF0B 2LHFA 1H6S1 4FESA 3GN5A 3F2EA 4B61A 2N9DA 1B7TA 3IF8B 3K3NA 3P8CD 3S4UA 3PQUA 4FMSA 4G76A 3AVRA 4P09A 5KMGP 2Q9QD 2ODVA 2KXPA 2XG6A 2D2SA 4YHJA 2JJ9A 2KLQA 3GP6A 3HA4A 4ZI2D 5FXXA 2LT3A 5GV0A 4JLEA 1ZV4X 3ZN1B 1WYCA 2LFUA 3LK42 3E08A 2VL8A 3HR0A 3AA6B 1QJ9A 2DWKA 1IZNA 4FSPA 2WMOA 1D1AA 3A5XA 4GCPA 4RJXA 1HFAA 5LGNB 2CM0A 2XHEB 4QXCB 1ZEEA 3POUA 4RLCA 4OYKA 5LCYA 2ACXA 4EIWA 5JR9C 4FOZA 4FI5A 2X27X 3AAEA 3FBLA 3AVSA 3KVAA 3CX6B 3PDYA 3ZYKA 2MYSA 4P0AA 4XNKA 1U5PA 2ZM0A 4H9RC 4D65A 5FY0A 3O0EA 2IAKA 2VKHA 4PK4A 3BQKA 2M06A 4PJLA 4PJMA 3JC6D 4O3WA 3VU7H 5F8PA 4QX7B 3T8OA 1S94A 2L3LA 5JDNA 3PQSA 3MZKB 4QWNB 1GFNA 1QJPA 2V7IA 3UTKA 1MIWA 1BR2A 4U72A 5FY7A 3WAJA 2EHOA 2XAHB 4EYYR 3KV6A 5HXEA 1HXXA 4UF0A 1MM5A 3DA4A 3POXA 3RYIE 3AB3B 3RPUA 2LEHA 3KBUA 3N2OA 4AXPA 2FGRA 4JCHA 4ZI7E 4GYSA 4V1Av 3V5UA 1OWAA 3FXDB 3FHNA 2XE5A 4UV8B 3CKDA 1OPFA 2WSSV 2CEAA 4AKGA 2WMNA 5AFUK 3AA6A 3PUAA 4O4IE 2ZFGA 2L9QA 1Y64B 3EVYA 4O4JE 4UVCB 3WI3A 5HXCA 5L3GB 3O9XA 4E1TA 5HWXA 1GFMA 1HG5A 2B1EA 2VKOA 1G90A 3OYXA 3N5LA 4HN9A 1OSMA 4GOUA 3CWZB 4JEUB 3J7Yq 4ADZA 2NW9A 2MTQA 2H3RA 4GHBA 2LSKA 2LE8A 4DO0A 1S35A 2RP4A 4DBRA 3IBPA 3VE2A 2C5JA 3BQLA 3M65A 5D5DA 1UX5A 1UX4A 3N9OA 5HXRA 2FGQX 2XTRA 1U4QA 2JMMA 3T0SA 1PRNA 4JUYA 4U9CA 3C5OA 4PAGA 2HH7A 1WR6A 3KFWX 3RKOA 4OYJA 4G63A 4ZI3D 5LYJE 2H7OA 3LJCA 4PJNA 1MM4A 4XZCA 4N78D 5JDGA 1FIOA 4KUMB 4H63H 3J9X1 4KMCA 2BZBA 2F1VA 5GONE 2LSGA 4N59A 5DJQC 2UXNB 1HTJF 5JVDE 2Q9QB 3RYFE 3UU2A 2LHNA 5CB4E 1GFOA 4MALA 2X9YA 2ZMAA 4AQFC 3C4ZA 4C90A 5A1LA 3VY9X 2X66A 5ADXK 4DVDA 3CQGB 1E1HB 3HI2A 2KINB 1D0XA 5JDHA 3V8UA 1LKXA 5FVNA 1LVKA 3NBXX 4ERRA 3OBVE 2VASA 5DL6A 2XTLA 4DMVA 3SWHA 4OFZA 3K3OA 2NOXA 3ESLA 3LBXB 4X1YE 5HYAA 3ZLIA 3UAQA 2XAJB 1KNZA 3IEEA 4QHOA 3AA0B 1US7B 4C91A 2Y6XA 3WI4A 5AFUL 2CXDA 1E54A 1QUUA 2D0TA 2V7KA 5LXTE 2A3DA 1Q9GA 2E9XC 2PJQA 1EZ3A 3U78A 2CWYA 5IYZE 3LG7A 4PUXA 2GE4A 3O4XE 4DBQA 2XE3A 2W0GA 2A72A 2CE7A 1ZKEA 2V7MA 3PUGA 4BJMA 3OKQA 3EMNX 3K19A 1MIYA 3NSGA 4J2CA 2K4TA 4QX8B 3H37A 2CCQA 4M1PA 3P7IA 2OMFA 1MMNA 4MLKA 2ZM2A 5EK4A 3HWBA 4H9OC 4OHFA 2Y0HA 1D1BA 2CA5A 2LJLA 3C64A 4O4LE 5FNVE 2Q9QA 1HG2A 4D5UA 3KVDD 1OXZA 5IYUA 4PNIA 3QRCA 4L0RA 4ASKA 2M67A 3E0ZA 2K0LA 4IIJE 3A2SX 3NZPA 4WNKA 4RLBA 1WLXA 1VRBA 3VZTX 5HWYA 4AQGA 3LFMA 4NUUA 5JDMA 2W63A 4EOZB 3LBXA 3QK6A 2MOZA 2NWBA 3SZDA 2V7LA 4YJ2E 4WBNE 4BA9A 3NRXA 3MK7C 3ZJ1A 4GIWA 3AA0A 4HGAA 4TV9E 4TV8E 5LHIB 2J1NA 4IGUA 3POQA 5FYMA 4WBOA 3CQXC 5LBMA 3N2KE 3ZN0B 5LBQB 4NUVA 4ISSA 3KINB 2A2FX 5DQVA 5J2TE 4CXXA 2DWGA 1BR4A 1MNEA 3K3QC 4UIGA 4GK0E 3N9LA 3W15B 5CA1E 2JPFA 4H9SE 3H3AA 2E8IA 3I0OA 4KRAA 2QTKA 2Y7SA 4O4UA 2ODJA 4CI3B 4CI1B 2F1TA 2JMHA 3ZCJA 2KMFA 4O4XA 2BVMA 2JRKA 1FEWA 3PRNA 3PU3A 4QXBB 4O2AE 3UULA 5CA0E 3UUNA 1BR1A 2VB6A 2SPCA 2X67A 3OYZA 1QSDA 3TKLB 3ZMVB 3V5SA 5DABA 5LG4A 4TZ4C 1HXUA 3CVRA 4FRXA 4O2BE 4DMWA 1BR0A 2HPLA 2PORA 4LSHA 4O49A 3VZWX 2DCFA 3ETVA 3N9NA 1V9DA 1Z0PA 2G0UA 2X9HA 4AYNA 2LSJA 2V7JA 3I1AA 2MNHA 2CLYB 3Q5XA 8PRNA 3C4XA 3KVBA 4G2AA 4RL9A 2IW5B 5LHGB 1ZHYA 4AYEC 3NZQA 4KBMB 2DLRA 5EK2A 5L3FB 5LHHB 2YEVC 5LOVE 3PTRB 3ZMZB 2EHOC 3N9QA 4CZZB 4KP3C 4PFPA 4E1SA 5F3JA 4ZS2A 2MHLA 3QRAA 2LHRA 3N9MA 3RC8A 5LJMA 3ZMUB 4AYMC 3QUJA 4EXTA 1IAPA 4B6XA 4FUVA 3F57A 3C4WA 3PURA 3KV9A 4RJWA 4CXYA 2ZM8A 4LSEA 2NW8A 2WAUA 3I0QA 3O1IA 1YKHB 3AAIA 2N2MA 1D1CA 3E22E 4A56A 2WWUA 2PFVA 2V1DB 4IHJE 5JDFA 5FMNA 2UXXB 5LJNA 3UPGA 5JDPA 1MMGA 2JQQA 4PK6A 5L3EB 2O4VA 1NWMX 2GK9A 3GA8A 1SHZC 3FXEB 5FXVA 2QA7A 3RC3A 4JFBA 2DI4A 2ODUA 3HKEE 4EZ4A 3Q5WA 4YLHA 3ZPOA 1ORMA 2DNXA 3EDVA 2XAGB 3O1HA 5JQGE 4FZNA 3SYBA 3UFEA 1MPFA 3GWHA 3HOEA 4EYUA 5HXSA 2WM9A 4MFRA 4AFKA 3CMLA 5JR9B 3CX7B 3I9WA 2KWIB 5DQWA 4ZS3A 5FY1A 1LRZA 2N2LA 4PK5A 4LSIA 2YINA 1G8XA 4QXHB 4I43B 3O1JA 2KC0A 3ZCIA 3JTYA 4PJJA 3ZMSB 4O3XB 1CUNA 1VOMA 2E9XD 3C51A 4HTEA 2X9XA 3ANWB 4AUIA 4X1IE 3BQIA 1LVFA 4ZOLE 5LA6E 2XE1A 3SYSA 1IJ5A 2LOPA 1BH3A 2KDYA 2K5BB 1D0ZA 1NAFA 5FXWA 4TUYE 3ZMTB 7PRNA 2K9AA 4EAHA 4AYID 5G26A 4OK0A 5M4YA 2L8KA 2XE2A 3RYCE 1PHOA 4O8SA 4KR8A 2C0SA 3WAKA 5C8YE 3PUSA 3HKBE 2PBIA 3RYHE 1T98A 3ZC0A 2D0UA 4JEHB 3RRCA 1ZHCA 5IHYA 4UEMA 2D5UA 4CI2B 4AKIA 2LOSA 5KX5E 3AA1B 2NTXA 4U74A 4AZLA 4H9NC 2I59A 3L3PA 4AKRB 2V26A 1AJ3A 4GCQA 3K8PC 1WYBA 4ILUA 1WRDA 3C50A 4AKMA 3FB2A 4CXWA 1BT9A 4PFOA 4Z8XA 3RX6A 5L3CB 3LK41 2Y48B 5FXZA 4IE0A 5L3BB 4AKHA 2ZLDA 5JR9A 4IDZA 3N9PA 2N1GA 4GK5E 4IE4A 1GFPA 1P4TA 2X68A 2MBGA 2IC6A 1MMDA 4QKNA 4WW0A 4O3ZA 4I55E 2NP9A 2KWHA 2LM9A 2W61A 2BDEA 3HKDE 1X79A 4O4HE 3SRZA 5ADXL 5LNKA 4HFVA 3GMIA 3ANWA 1THQA 2J4UP 3EDUA 4F4BA 3KBTA 2Q9QC 3HOLA 4I4TE 5PRNA 4LSFA 3PE0A 2KZ7B 3SY7A 3DTOA 3NRYA 4ZI2C 2YPVA 4IE5A 4EB6E 4C69X 1FMWA 3BK9A 2ZLYA 2W81C 1YS5A 1BXWA 4HKAA 4GYRA 1QJ8A 3D0TA 4X20E 2YU1A 5JDLA 2N2NA 4ANJA 5J1GA 4FRTA 4AI6A 2OA5A 3KV5A 4UELA 2VKDA 3KV4A 5LGUB 5HXHA 4X1KE 2K24A 1KK7A 3B13A 2XAFB 2RA1A 3R6NA 3AA1A 1HCIA 4HE8A 1D0YA 2HPJA 2P9BA 3SY9A 4AKRA 5EZYE 2ES0A 3DJBA 4TN7B 1GFQA 3ETUA 2XTQA 3B57A 4FZLA 2VKJA 3LK3B 2YU2A 4BAYB 3IHRA 1MNDA 4BJNA 5KDMC 4E7ZA 3JC6C 4PW8A 3OJAA 5HAXA 2Y2XA 2XAQB 2Y8DA 3MXZA 3VHLA 3T24A 2EHOD 1UCUA 4CQIA 2LSYA 4N58A 3QC9A 4EZHA 3SOLA 5FP3A 4K0UA 2W00A 5H6QB 3N2GE 2Y0LA 5DL8A 5E0OA 3CQCB 3MJXA 4D64A 2X51A 3RH3A 4AKLA 4UXNB 2J1DG 4UVBB 3ONXA 4F6RC 2LSIA 3EUHA 3LK2B 5JREA 2ERVA 2E9XB 5DL7A 3AA7B 3FBZA 3MKDA 2KZ7A 3HW9A 2CXFA 3TZGA 2YK0A 3CPZA 2CXLA 4IE6A 4MHCA 5L3DB 4FSOA 3VZUX 1MMAA 3U3IA 3AAAB 4MBQA 4FZMA 4ISTA 2NTYA 2KT9A 3L09A 3ZYMA 4XNLA 4O3YA 5EE2A 3WI5A 4UVAB 1FMVA 3FYXA 2W80C 2XUEA 1ZHTA 3MA9A 3I9YA 2H7VC 4L9IA 4AYDC 1Q9FA 2W62A 6PRNA 2Z6EA 3PUQA 2XASB 4AQFA 1O3XA 4H63V 3G7GA 3LK3A 1G73A 5JRCB 2XMXA 1ZHXA 2DHRA 2X0LB 3HKCE 3RBHA 2C5KT 4H9QC 3UUMA 2BVLA 3CX8B 3ZJ2A 2Y0KA 3ZC1A 3VKHA 5BMVE 5L2LA 4E7SA 2K48A 5JH7E 4ZI3C 4I50E 2VK9A 4P0BA 1HS7A 3SZVA 2QGSA 3GN5B 3HL6A 1ZHWA 1YKEB 3VKGA 3RRWA 3LK2A 2E9XA 4G75A 2KNDA 3ZEFB 3AA7A 3SS1A 3UT5E 2KXPB 4GF4A 4XBFB 5DL5A 3T20A 5LGTB 3VE1A 4H9PC 3DP7A 4HEAA 3PU8A 2VWAA 4FJOA 3KDSE 2CLYC 4Z3TA 2WBLA 3AAAA 4GCSA 3Q9DA 1YD8G 4YFSA 1IZNB 3UUXB 1YW0A 2CMRA 3PORA 4YJ3E 4DNDA 5H6RB 5T5FA 5TAOA 4IE7A 4ZHQE 2X9WA 2JMKA 3AAEB 4UV9B 1IJ6A 3VY8X 3MACA 3ZYLA 2M07A 1HXTA 2PG8A 2YNKA 5JRCA 3C98B 4L5GA 4XAXB 4QQ1A 2PRNA 3R84B 5J2UE 3DA3A 4BUMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 1;  5ADX K;  3LK3 A;  3AAA A;  3LK2 B;  3AA0 A;  1IZN B;  3AAE A;  3AA1 A;  3AA7 B;  2KZ7 A;  4AKR A;  5AFU K;  5ADX L;  3AA6 A;  3LK3 B;  2KXP A;  3AAA B;  3AA0 B;  3AAE B;  3AA1 B;  5AFU L;  2KZ7 B;  3LK4 2;  4AKR B;  3AA6 B;  3LK2 A;  1IZN A;  3AA7 A;  2KXP B; 
#chains in the Genus database with same CATH topology
 5LP6 E;  2W2U A;  3Q2M A;  2LHF A;  3IF8 B;  1B7T A;  3VR9 A;  3K3N A;  4DR1 T;  4UB6 O;  4K0K T;  2D2S A;  2JJ9 A;  2KLQ A;  3GP6 A;  1ZV4 X;  3ZN1 B;  2FJD A;  3E08 A;  1I94 T;  2BS2 A;  2VL0 A;  1IZN A;  4FSP A;  1D1A A;  1UK5 A;  2D9D A;  4GCP A;  4RJX A;  1HFA A;  2XHE B;  1ZEE A;  3POU A;  4RLC A;  4EIW A;  5JR9 C;  4FOZ A;  2X27 X;  3AAE A;  3KVA A;  4U3C A;  1KNP A;  2MYS A;  4XNK A;  2VKH A;  4EV6 A;  3DWO X;  4O3W A;  3AEB A;  4DR5 T;  1S94 A;  1J5E T;  1GFN A;  1QJP A;  4U72 A;  3UU5 A;  4CN4 A;  2XAH B;  5GTI O;  1HXX A;  1MM5 A;  2UUA T;  3RYI E;  2FGR A;  2AXD S;  2LEH A;  4AXP A;  1OWA A;  2E5L T;  4LF6 T;  1OPF A;  4HWI B;  5HEU A;  2ZFG A;  2L9Q A;  4O4J E;  4UVC B;  5L3G B;  4HN9 A;  3CWZ B;  2NW9 A;  2LE8 A;  2W66 A;  3IBP A;  2BBJ A;  3BQL A;  3M65 A;  2QVA A;  2BS4 A;  2E5V A;  5LG3 A;  2CBI A;  1N34 T;  4TWH A;  1XNQ T;  2RPA A;  2H7O A;  1MM4 A;  4XZC A;  5JDG A;  4KUM B;  4H63 H;  2FJA A;  3AEF A;  2LSG A;  2BKP A;  5DJQ C;  1HTJ F;  5ADX K;  2X66 A;  1E1H B;  2KIN B;  2NOX A;  4LML A;  2XAJ B;  1KNZ A;  3UUB A;  4QHO A;  1US7 B;  4OX9 T;  2NR4 A;  4IL9 A;  4NPP A;  1KF6 A;  1XMO T;  2A3D A;  1Q9G A;  2E9X C;  1EZ3 A;  3U78 A;  3LSV A;  4LMK A;  2K3W A;  3EMN X;  2WP9 A;  3K19 A;  2K4T A;  1XDP A;  4TNW A;  4OHF A;  4DV5 T;  1I6Z A;  4O4L E;  3KVD D;  4L0R A;  2M67 A;  3E0Z A;  3BRZ A;  2K0L A;  4IIJ E;  4RLB A;  3RIU A;  1VRB A;  4NXN T;  3LFM A;  3NRX A;  4TV9 E;  4IGU A;  2LM2 A;  2WU2 A;  4DV1 T;  4WBO A;  3CQX C;  5LBM A;  3N2K E;  3ZN0 B;  4GKJ T;  3KIN B;  2A2F X;  5DQV A;  2DWG A;  3UFG A;  4UIG A;  4GK0 E;  2Y7S A;  2MAW A;  4O4U A;  4O4X A;  2JMH A;  2LLY A;  4TWF A;  3ZCJ A;  3PRN A;  3PU3 A;  3UUL A;  1BR1 A;  1NEK A;  1BR0 A;  4IL4 A;  2AXT O;  4U33 A;  1Z0P A;  2G0U A;  4QH1 A;  2LSJ A;  1M62 A;  2CHN A;  2IW5 B;  4PJ0 O;  1SUM B;  2XQ3 A;  2XPK A;  4PFP A;  2MHL A;  5KXJ A;  1W9R A;  2R88 A;  4LF5 T;  2YOE A;  4JI6 T;  4CXY A;  2ZM8 A;  3AAI A;  4YTP A;  2XM1 A;  4A56 A;  4IHJ E;  3UPG A;  2O4V A;  3FXE B;  3RC3 A;  2QA7 A;  2ODU A;  2XQ9 A;  4YLH A;  1ORM A;  5JQG E;  3CK6 A;  4EYU A;  3CML A;  4CN1 A;  2KWI B;  2N2L A;  4DV2 T;  4IL6 O;  3AE6 A;  4LSI A;  1G8X A;  5B5E O;  4I43 B;  3ZCI A;  4O3X B;  1CUN A;  1VOM A;  2X9X A;  3ANW B;  4X1I E;  1HNX T;  2XE1 A;  1OED E;  5FXW A;  7PRN A;  2K9A A;  5AQT B;  1IBK T;  2PTF A;  2L8K A;  2IML A;  4O8S A;  2UU9 T;  2C0S A;  3WAK A;  2IUB A;  4JEH B;  4U31 A;  1ZHC A;  2D5U A;  4AKI A;  5KX5 E;  2NTX A;  1AJ3 A;  4DUY T;  1WRD A;  3C50 A;  3VRA A;  3TLV A;  3FB2 A;  2WJR A;  1BT9 A;  4IE0 A;  4A97 A;  2N1G A;  4IE4 A;  1GFP A;  2X68 A;  2MBG A;  1MMD A;  4WW0 A;  3HKD E;  4O4H E;  5HCM A;  3ANW A;  4F4B A;  1OED B;  3HOL A;  4I4T E;  5PRN A;  3T24 A;  2KZ7 B;  3DTO A;  4LF9 T;  5AQJ B;  3D0T A;  5LGU B;  5HXH A;  4X1K E;  1KK7 A;  2ES0 A;  2XTQ A;  1GFQ A;  4FZL A;  3B57 A;  3LK3 B;  2YU2 A;  3IHR A;  3K1S A;  3OJA A;  1Z8U A;  5HAX A;  2Y2X A;  5AQL B;  3VHL A;  3SOL A;  5FP3 A;  2W00 A;  2R6G F;  5H6Q B;  3CQC B;  5ABF B;  3RH3 A;  4UVB B;  4TNV A;  1OED A;  2LSI A;  3LK2 B;  3AA7 B;  4IDN A;  2KZ7 A;  4FSO A;  3AAA B;  2KT9 A;  2WS3 A;  3FYX A;  5FVL A;  3PGS A;  3JAE A;  3PUY F;  3MA9 A;  3OTO T;  4L9I A;  3CIR A;  4NXM T;  2W62 A;  2Z6E A;  3PUQ A;  2YDR A;  4AQF A;  3LK3 A;  2DL1 A;  5JRC B;  3HKC E;  2LKG A;  5JTG A;  2C5K T;  2IWV A;  5JH7 E;  1HS7 A;  5ABF A;  1ZHW A;  3LK2 A;  5DL5 A;  3AA7 A;  3SS1 A;  2KXP B;  2XQ7 A;  3ZT6 A;  4X5T A;  5LGT B;  4U7Y A;  2VWA A;  3X1D A;  3KDS E;  3AAA A;  5H2F O;  4YFS A;  3POR A;  5H6R B;  4ZHQ E;  2JMK A;  4DID B;  4UV9 B;  2WDQ A;  3VY8 X;  1HXT A;  2PG8 A;  5JRC A;  4L5G A;  3R84 B;  3DA3 A;  4BUM X;  1E7P A;  4Q25 A;  3AED A;  5ETW A;  1H7C A;  1SA0 E;  2NW7 A;  2CWO A;  5EK3 A;  2XQY A;  4TX5 A;  2JQH A;  2V6X A;  1H6S 1;  3ABV A;  4B61 A;  2N9D A;  3PQU A;  4FMS A;  4G76 A;  4P09 A;  5KMG P;  4A5X A;  2ODV A;  2KXP A;  3HA4 A;  3M3Z B;  5FXX A;  2LT3 A;  4ZI2 D;  3LK4 2;  1S5L O;  4JYA T;  2WDV A;  4IDP A;  3WU2 O;  4OYK A;  5LCY A;  1WCR A;  4FI5 A;  3FBL A;  3AVS A;  3PDY A;  2ZM0 A;  5FY0 A;  2IAK A;  4P1N A;  3BQK A;  4PJL A;  4PJM A;  3JC6 D;  5ABH A;  5F8P A;  4QX7 B;  3T8O A;  3PQS A;  4QWN B;  3UTK A;  1BR2 A;  2V5C A;  5HXE A;  3POX A;  5FKY A;  3RPU A;  2M6B A;  3N2O A;  4V1A v;  3PGR A;  2WU5 A;  3FHN A;  2JQ9 A;  3Q5E A;  2WSS V;  5AFU K;  3T1H T;  3TLT A;  3AE8 A;  1Y64 B;  3EVY A;  2H89 A;  3WI3 A;  3O9X A;  1GFM A;  1G90 A;  2B1E A;  4GOU A;  4JEU B;  5HEO A;  1S35 A;  4DBR A;  1N36 T;  5D5D A;  1R8I A;  3PUV F;  3N9O A;  2FGQ X;  5HXR A;  3RI5 A;  3FZH B;  4JUY A;  2HH7 A;  3KFW X;  4ZI3 D;  5LYJ E;  3LJC A;  4PJN A;  4B3R T;  2BG9 C;  3J9X 1;  4JI5 T;  2AE9 A;  4CTD A;  1XWM A;  4N59 A;  3RYF E;  5JVD E;  3UU2 A;  2Q9Q B;  2X9Y A;  3P4R A;  4UB8 O;  3VY9 X;  3V8U A;  5FVN A;  1LVK A;  3SWH A;  4OFZ A;  4UR9 A;  3UU8 A;  4X1Y E;  5LB7 B;  3ZLI A;  3IEE A;  4ZEY A;  3AEA A;  4C91 A;  2Y6X A;  2HHH T;  3WI4 A;  1QUU A;  2D0T A;  2V7K A;  2JQK A;  2XQ5 A;  4N75 A;  5LXT E;  2PJQ A;  3ONJ A;  4LF8 T;  3O4X E;  4ZZB A;  3PUG A;  2V7M A;  4PR7 A;  3A0B O;  4QX8 B;  2CCQ A;  3P7I A;  2WZI A;  2OMF A;  4F8H A;  1HNZ T;  1D1B A;  1VCS A;  2Q9Q A;  5IYU A;  1OXZ A;  1L0V A;  4DUZ T;  4LF7 T;  2UXB T;  3VZT X;  5HWY A;  4AQG A;  2BBH A;  3QK6 A;  2MOZ A;  2V7L A;  4BA9 A;  3ZJ1 A;  4GIW A;  1IBM T;  4TV8 E;  3VR8 A;  5LBQ B;  4ISS A;  4A98 A;  2WJQ A;  3SFE A;  3W15 B;  4H9S E;  3RIU C;  2ODJ A;  4CI1 B;  2F1T A;  2XM2 A;  2BVM A;  4O2A E;  3ZSS A;  4YT0 A;  3JAF A;  2X67 A;  5AQK B;  5DAB A;  3V5S A;  4TZ4 C;  1HXU A;  3CVR A;  2QRX A;  4O2B E;  2POR A;  2DCF A;  4LF4 T;  1V9D A;  4AYN A;  2V7J A;  2CLY B;  3C4X A;  4G2A A;  4RL9 A;  3OVU A;  1ZHY A;  3PJA A;  5CJ5 A;  1J1J A;  4X64 T;  5L3F B;  5LHH B;  1UUS A;  5G38 A;  4C4V B;  2EHO C;  4CZZ B;  4KP3 C;  3PUX F;  4ZS2 A;  2LHR A;  5ABG A;  1W09 A;  3RIF A;  4IT4 A;  4B6X A;  4JI2 T;  3KV9 A;  4RJW A;  4LSE A;  2WAU A;  4AIS A;  4COF A;  1D1C A;  5JDF A;  2R4N A;  2UXX B;  1YXR A;  1MMG A;  4PK6 A;  2GK9 A;  2F1C X;  4JFB A;  1W0A A;  1X9B A;  3ZPO A;  3EDV A;  4B3T T;  4C4V A;  5HXS A;  5JR9 B;  3I9W A;  5FY1 A;  1LRZ A;  4DR7 T;  3FZK B;  4PK5 A;  2YIN A;  5F5W A;  5HEH A;  2R89 A;  3O1J A;  2KC0 A;  3FZF B;  3C51 A;  5LA6 E;  1LVF A;  3SYS A;  2LOP A;  2KDY A;  1NAF A;  4EAH A;  5G26 A;  5M4Y A;  1KNR A;  5AQP B;  1PHO A;  4KR8 A;  3PUS A;  3ZC0 A;  5IHY A;  2LKH A;  4WZX A;  2BKN A;  1WFD A;  4AZL A;  2I59 A;  1WYB A;  4YSY A;  4CXW A;  4HFH A;  5IUX A;  2IHR 1;  3DWN A;  2Y48 B;  5JR9 A;  2ZM6 T;  2YKS A;  4QKN A;  5CFB A;  4I0U A;  3UU6 A;  4I55 E;  2NP9 A;  2LM9 A;  2BDE A;  1X79 A;  2W67 A;  4HFV A;  4K3B A;  3KBT A;  4B3M T;  3SY7 A;  2W81 C;  1YS5 A;  1BXW A;  2BS3 A;  4X20 E;  5AQG B;  4Z90 A;  5J1G A;  4AI6 A;  2OA5 A;  3KV5 A;  4IDQ A;  2VKD A;  4UEL A;  5FL0 A;  4WYV A;  2K24 A;  2RA1 A;  2HPJ A;  5EZY E;  4JI0 T;  2F4V T;  2XAQ B;  4U2Z A;  2LSY A;  4EZH A;  4K0U A;  2YDS A;  2Y0L A;  5DL8 A;  5E0O A;  4AKL A;  4UXN B;  2R4O A;  4F6R C;  2VQE T;  3A0H O;  4LMJ A;  2H88 A;  2E9X B;  2XQ6 A;  2CXF A;  3HW9 A;  4YSZ A;  4MBQ A;  2NTY A;  5EE2 A;  2W80 C;  4KHP T;  3I9Y A;  4AYD C;  1Q9F A;  2XAS B;  1E2A A;  3AE3 A;  2XMX A;  1ZHX A;  2DHR A;  2X0L B;  2HN1 A;  2VVN A;  3CX8 B;  2JQY A;  3ZJ2 A;  2Y0K A;  5BMV E;  4LFA T;  1T16 A;  3TLW A;  4HFI A;  4JV5 T;  3GN5 B;  3RRW A;  2E9X A;  2KND A;  4ILB A;  3UT5 E;  4GF4 A;  3VE1 A;  4H9P C;  4Z3T A;  3Q9D A;  1YD8 G;  3UUX B;  4DND A;  2I0M A;  5LMU T;  2XQ8 A;  1KFY A;  5BR8 T;  4QQ1 A;  4DR6 T;  5JDQ A;  1SE7 A;  4KR4 A;  4IRE A;  2C5I T;  1MIV A;  2IC9 A;  4UF0 B;  4FES A;  1M7K A;  3GN5 A;  3P8C D;  3AVR A;  2Q9Q D;  2XG6 A;  5GV0 A;  5AQM B;  4DR3 T;  2LFU A;  3FZL B;  3AA6 B;  5AQU B;  1QJ9 A;  2DWK A;  2CM0 A;  2R4P A;  4C00 A;  2VUR A;  2UXC T;  4P0A A;  4D65 A;  2CHO A;  3QB5 A;  3O0E A;  1YQ4 A;  3NWI A;  4U7I A;  2X9K A;  5HCJ A;  3VU7 H;  2L3L A;  2IDO B;  2I6H A;  3MZK B;  2V7I A;  1MIW A;  5FY7 A;  4UF0 A;  4YSX A;  3AB3 B;  3KBU A;  4JCH A;  4FQE A;  4ZI7 E;  4GYS A;  4ILA A;  4UV8 B;  3CKD A;  2CEA A;  2WMN A;  3AA6 A;  3PUA A;  3B5M A;  2MPK A;  5HXC A;  4E1T A;  1HG5 A;  3N5L A;  2MTQ A;  4GHB A;  4AQY T;  5GTH O;  5C3J A;  3VE2 A;  2C5J A;  1UX5 A;  1UX4 A;  4DR2 T;  3A7M A;  2JMM A;  3T0S A;  5E79 O;  3C5O A;  4PAG A;  1WR6 A;  4G63 A;  4YHH T;  3NJT A;  2R4L A;  4TWD A;  5J0Z A;  1T7S A;  3QB5 K;  3ZT7 A;  2F1V A;  5GON E;  3H3M A;  2WDR A;  4GKK T;  2LHN A;  5CB4 E;  1GFO A;  4MAL A;  3C4Z A;  4C90 A;  3HI2 A;  5JDH A;  1D0X A;  1LKX A;  4ERR A;  5DL6 A;  3OBV E;  2VAS A;  2XTL A;  2WB5 A;  3K3O A;  5G3A A;  3LBX B;  3ESL A;  5HYA A;  2X0H A;  2IWW A;  5HEG A;  5L47 A;  3BS0 A;  3LG7 A;  4PUX A;  4DBQ A;  2XE3 A;  2W0G A;  2A72 A;  4BJM A;  1ZKE A;  1N33 T;  3LDQ B;  1UGO A;  3VRB A;  1MIY A;  4J2C A;  3H37 A;  4M1P A;  4DV4 T;  1MMN A;  4MLK A;  5EK4 A;  3HWB A;  4H9O C;  2Y0H A;  2XSA A;  2XZE A;  3C64 A;  4D5U A;  5AQI B;  3A2S X;  4QH4 A;  5CGM A;  4NUU A;  3EHZ A;  4EOZ B;  1NEN A;  3LBX A;  4YJ2 E;  1KEY A;  2KSR A;  2UXD T;  2J1N A;  3NKZ A;  3POQ A;  5FYM A;  3AXJ B;  1ZP0 A;  5J2T E;  1MNE A;  2LRK A;  3K3Q C;  5CA1 E;  3I0O A;  1XMQ T;  4KRA A;  4CI3 B;  1GQE A;  1FEW A;  5CA0 E;  2VB6 A;  3OYZ A;  3TKL B;  3ZMV B;  4DR4 T;  2HPL A;  3VZW X;  3NVO A;  3OPC A;  3N9N A;  2X9H A;  5FL1 A;  3I1A A;  2MNH A;  3Q5X A;  8PRN A;  2FUP A;  5LHG B;  4AYE C;  3NZQ A;  1XZY A;  5EK2 A;  2YEV C;  5LOV E;  3AEE A;  4E1S A;  5F3J A;  3AEG A;  3AXJ A;  2R8A A;  5LJM A;  3QUJ A;  5L4E A;  3P4Q A;  1IAP A;  1XNR T;  4FUV A;  3C4W A;  3RHW A;  3RF1 A;  1YKH B;  5HEJ A;  3ONL C;  3E22 E;  2WWU A;  2PFV A;  2V1D B;  5FMN A;  4DV7 T;  5L3E B;  3PUW F;  1NWM X;  1J5W A;  3EAB A;  3HKE E;  4EZ4 A;  2DNX A;  2XAG B;  3O1H A;  4FZN A;  3UFE A;  2WM9 A;  4MFR A;  2QYW A;  3CX7 B;  5DQW A;  2M6I A;  3A8Y C;  4QXH B;  3JTY A;  3ZMS B;  2E9X D;  4AUI A;  3BQI A;  4AIU A;  1IJ5 A;  1BH3 A;  1D0Z A;  4TUY E;  2OV9 A;  4AYI D;  5AQR B;  2XE2 A;  1T98 A;  2D0U A;  4YTM A;  2BG9 E;  2LOS A;  4AKR B;  4GCQ A;  4ILU A;  4KHZ F;  1UUR A;  5L4H A;  3P4P A;  4PFO A;  5L3C B;  3LK4 1;  5FXZ A;  3RQW A;  4IDZ A;  4GK5 E;  3BRY A;  1FJG T;  2KWH A;  3T1Y T;  2W61 A;  3IA3 A;  3EDU A;  4LSF A;  4HWH A;  4ZI2 C;  4EB6 E;  2J62 A;  2YU1 A;  5JDL A;  1CHU A;  4ANJ A;  4FRT A;  5TIS O;  1JNZ A;  4NIQ A;  2BG9 B;  3KV4 A;  5AQV B;  3P4S A;  2A9U A;  4KI0 F;  4EGW A;  4K3C A;  1HCI A;  1D0Y A;  4AKR A;  3UQ7 A;  4TN7 B;  3ETU A;  2VKJ A;  1MND A;  5KDM C;  4E7Z A;  3JC6 C;  3PF1 A;  4CQI A;  4ZZC A;  4Z91 A;  4HWF A;  3N2G E;  3MJX A;  4N74 A;  2X51 A;  4HFB A;  2J1D G;  4U2Y A;  3EUH A;  2V5D A;  2B76 A;  3FBZ A;  3TZG A;  3CPZ A;  4IE6 A;  3AE9 A;  4FZM A;  4IST A;  3WI5 A;  4XNL A;  2BG9 A;  4UVA B;  1FMV A;  4EEB A;  2H7V C;  6PRN A;  4HWC A;  1O3X A;  3RLF F;  3G7G A;  3RBH A;  2WWV A;  4H9Q C;  3UUM A;  3VKH A;  5L2L A;  4HFE A;  4E7S A;  5B66 O;  4ZI3 C;  2XSB A;  4X62 T;  5AQF B;  4XBF B;  3T20 A;  3DP7 A;  4HEA A;  3PU8 A;  3EAM A;  2VVS A;  1Y01 A;  4FJO A;  2CMR A;  5TAO A;  4KX6 A;  1YQ3 A;  1IJ6 A;  2JIW A;  2M07 A;  2XTR A;  1HX8 A;  3G06 A;  3F31 A;  4FT6 A;  1HX1 B;  1HF8 A;  4EED A;  1ZHZ A;  2EHO B;  3F2E A;  4DV0 T;  2J47 A;  4YY3 T;  3S4U A;  2FJB A;  4YHJ A;  4JLE A;  1WYC A;  2WQY A;  2BKO A;  2VL8 A;  3HR0 A;  2WMO A;  3ZT5 A;  3A5X A;  3AEC A;  5LGN B;  4JI3 T;  4QXC B;  1T8B A;  2ACX A;  3CX6 B;  3ZYK A;  1U5P A;  4H9R C;  4PK4 A;  2M06 A;  3RGL A;  1W0B A;  2WY2 A;  5AQN B;  5JDN A;  3PGU A;  1T1L A;  3WAJ A;  2EHO A;  4EYY R;  3KV6 A;  2XQ4 A;  3DA4 A;  5DL7 A;  4HFD A;  4ZXL A;  3P50 A;  3V5U A;  3FXD B;  2XE5 A;  4AKG A;  4JI1 T;  1VCT A;  4O4I E;  3PUZ F;  5HWX A;  2VKO A;  3OYX A;  1OSM A;  4LFB T;  3J7Y q;  4ADZ A;  2H3R A;  2LSK A;  4DO0 A;  2RP4 A;  4DV6 T;  5G39 A;  1U4Q A;  1OED C;  1PRN A;  4U9C A;  3PV0 F;  3RKO A;  5KAI O;  4OYJ A;  3QOF A;  4N78 D;  1FIO A;  4KMC A;  2BZB A;  4X65 T;  2UXN B;  4JI4 T;  2ZMA A;  4AQF C;  5A1L A;  4DVD A;  3CQG B;  1JNR A;  3NBX X;  4DMV A;  3UAQ A;  2FJE A;  3AA0 B;  5AFU L;  2CXD A;  1E54 A;  2HN2 A;  3EI0 A;  3P4W A;  2CWY A;  5IYZ E;  2GE4 A;  4CN6 A;  2VQF T;  3KZI O;  2CE7 A;  3OKQ A;  3NSG A;  3DZM A;  2ZM2 A;  2WVP A;  4B3S T;  1N32 T;  2CA5 A;  2LJL A;  5FNV E;  3AE7 A;  1HG2 A;  1DU2 A;  4PNI A;  3QRC A;  4ASK A;  3NZP A;  4WNK A;  1WLX A;  2UUC T;  5JDM A;  2W63 A;  4IDO A;  1QLB A;  2NWB A;  3SZD A;  4WBN E;  3MK7 C;  1HR0 T;  3AA0 A;  4HGA A;  5LHI B;  2V8S V;  5AQO B;  4NUV A;  4CXX A;  1BR4 A;  3N9L A;  2JPF A;  3H3A A;  2E8I A;  3JAD A;  2V6Y B;  2QTK A;  2KMF A;  2JRK A;  4QXB B;  3UUN A;  2SPC A;  1QSD A;  5LG4 A;  4FRX A;  2CPT A;  4DMW A;  4LSH A;  4O49 A;  3ETV A;  3KVB A;  4KBM B;  2DLR A;  3PTR B;  3TLS A;  3ZMZ B;  3N9Q A;  3QRA A;  3N9M A;  3RC8 A;  3ZMU B;  4AYM C;  4EXT A;  5ABE A;  3ZKR A;  2V6Y A;  3F57 A;  3PUR A;  4LFC T;  2NW8 A;  3I0Q A;  3O1I A;  2N2M A;  1WR0 A;  2WZH A;  4X66 T;  2LRL A;  5LJN A;  5JDP A;  2JQQ A;  2CBJ A;  4DV3 T;  3GA8 A;  1SHZ C;  5FXV A;  2DI4 A;  3Q5W A;  3UU3 A;  3PJA J;  3QNU A;  5FVK A;  3SYB A;  3RQU A;  1MPF A;  3GWH A;  3HOE A;  4AFK A;  4HWD A;  2WCA A;  4ZS3 A;  3RIA A;  2E2A A;  4PJJ A;  4HTE A;  4ZOL E;  2J4U P;  2K5B B;  2YN6 A;  3ZMT B;  2YDQ A;  4OK0 A;  3UU4 A;  3RYC E;  5C8Y E;  3HKB E;  2PBI A;  3RYH E;  2XJ7 A;  3RRC A;  3L8R A;  4UEM A;  2XQA A;  4CI2 B;  1ZOY A;  3AA1 B;  4U74 A;  4H9N C;  3L3P A;  4JI8 T;  2V26 A;  3K8P C;  5LMN T;  3L39 A;  3Q5D A;  4AKM A;  3AE4 A;  4Z8X A;  3RX6 A;  3AE2 A;  5L3B B;  4AKH A;  2ZLD A;  3N9P A;  1P4T A;  3UQ4 A;  2IC6 A;  1T72 A;  4O3Z A;  3SRZ A;  5LNK A;  5ADX L;  3GMI A;  1THQ A;  2Q9Q C;  3PE0 A;  3NRY A;  4C69 X;  2YPV A;  4IE5 A;  1FMW A;  3BK9 A;  2ZLY A;  4HKA A;  4GYR A;  1QJ8 A;  5KAF O;  2UUB T;  1HNW T;  2N2N A;  2ACZ A;  5AQQ B;  2OLT A;  3B13 A;  2XAF B;  4HFC A;  3R6N A;  3AA1 A;  4HE8 A;  2P9B A;  3SY9 A;  3AE1 A;  3DJB A;  4BAY B;  4BJN A;  4JBW F;  4PW8 A;  4QH5 A;  2FBW A;  2IIU A;  3MXZ A;  2Y8D A;  3TLU A;  2EHO D;  1UCU A;  4N58 A;  3QC9 A;  3JCU O;  1XDO A;  4D64 A;  3FZM B;  3ONX A;  2J4G A;  5JRE A;  2ERV A;  3MKD A;  2YK0 A;  5C2T A;  2CXL A;  4MHC A;  5L3D B;  3VZU X;  1MMA A;  3U3I A;  2W4X A;  3JCF A;  2CRB A;  4YXD A;  3ZYM A;  3L09 A;  4O3Y A;  2XY8 B;  4YTN A;  1IBL T;  2XUE A;  1ZHT A;  2X0Y A;  4H63 V;  3RKG A;  1G73 A;  5AQH B;  2BVL A;  3ZST A;  3SFD A;  3ZC1 A;  2K48 A;  4I50 E;  2VK9 A;  4P0B A;  5IWA T;  3SZV A;  2QGS A;  3HL6 A;  3AE5 A;  1YKE B;  3VKG A;  4G75 A;  3ZEF B;  4JI7 T;  2CLY C;  2WBL A;  4GCS A;  1IZN B;  1YW0 A;  4YJ3 E;  5T5F A;  4ILC A;  5AQS B;  4IE7 A;  2X9W A;  3AAE B;  3MAC A;  3ZYL A;  2YNK A;  3C98 B;  4XAX B;  2PRN A;  5J2U E; 
#chains in the Genus database with same CATH homology
 1HX8 A;  5JDQ A;  5ETW A;  1H7C A;  3F31 A;  4FT6 A;  5LP6 E;  1HF8 A;  1SA0 E;  4KR4 A;  2NW7 A;  2C5I T;  1MIV A;  2CWO A;  1ZHZ A;  2IC9 A;  5EK3 A;  2XQY A;  2EHO B;  3Q2M A;  4TX5 A;  4UF0 B;  2LHF A;  1H6S 1;  4FES A;  3GN5 A;  3F2E A;  4B61 A;  2N9D A;  1B7T A;  3IF8 B;  3K3N A;  3P8C D;  3S4U A;  3PQU A;  4FMS A;  4G76 A;  3AVR A;  4P09 A;  5KMG P;  2Q9Q D;  2ODV A;  2KXP A;  2XG6 A;  2D2S A;  4YHJ A;  2JJ9 A;  2KLQ A;  3GP6 A;  3HA4 A;  4ZI2 D;  5FXX A;  2LT3 A;  5GV0 A;  4JLE A;  1ZV4 X;  3ZN1 B;  1WYC A;  2LFU A;  3LK4 2;  3E08 A;  2VL8 A;  3HR0 A;  3AA6 B;  1QJ9 A;  2DWK A;  1IZN A;  4FSP A;  2WMO A;  1D1A A;  3A5X A;  4GCP A;  4RJX A;  1HFA A;  5LGN B;  2CM0 A;  2XHE B;  4QXC B;  1ZEE A;  3POU A;  4RLC A;  4OYK A;  5LCY A;  2ACX A;  4EIW A;  5JR9 C;  4FOZ A;  4FI5 A;  2X27 X;  3AAE A;  3FBL A;  3AVS A;  3KVA A;  3CX6 B;  3PDY A;  3ZYK A;  2MYS A;  4P0A A;  4XNK A;  1U5P A;  2ZM0 A;  4H9R C;  4D65 A;  5FY0 A;  3O0E A;  2IAK A;  2VKH A;  4PK4 A;  3BQK A;  2M06 A;  4PJL A;  4PJM A;  3JC6 D;  4O3W A;  3VU7 H;  5F8P A;  4QX7 B;  3T8O A;  1S94 A;  2L3L A;  5JDN A;  3PQS A;  3MZK B;  4QWN B;  1GFN A;  1QJP A;  2V7I A;  3UTK A;  1MIW A;  1BR2 A;  4U72 A;  5FY7 A;  3WAJ A;  2EHO A;  2XAH B;  4EYY R;  3KV6 A;  5HXE A;  1HXX A;  4UF0 A;  1MM5 A;  3DA4 A;  3POX A;  3RYI E;  3AB3 B;  3RPU A;  2LEH A;  3KBU A;  3N2O A;  4AXP A;  2FGR A;  4JCH A;  4ZI7 E;  4GYS A;  4V1A v;  3V5U A;  1OWA A;  3FXD B;  3FHN A;  2XE5 A;  4UV8 B;  3CKD A;  1OPF A;  2WSS V;  2CEA A;  4AKG A;  2WMN A;  5AFU K;  3AA6 A;  3PUA A;  4O4I E;  2ZFG A;  2L9Q A;  1Y64 B;  3EVY A;  4O4J E;  4UVC B;  3WI3 A;  5HXC A;  5L3G B;  3O9X A;  4E1T A;  5HWX A;  1GFM A;  1HG5 A;  2B1E A;  2VKO A;  1G90 A;  3OYX A;  3N5L A;  4HN9 A;  1OSM A;  4GOU A;  3CWZ B;  4JEU B;  3J7Y q;  4ADZ A;  2NW9 A;  2MTQ A;  2H3R A;  4GHB A;  2LSK A;  2LE8 A;  4DO0 A;  1S35 A;  2RP4 A;  4DBR A;  3IBP A;  3VE2 A;  2C5J A;  3BQL A;  3M65 A;  5D5D A;  1UX5 A;  1UX4 A;  3N9O A;  5HXR A;  2FGQ X;  2XTR A;  1U4Q A;  2JMM A;  3T0S A;  1PRN A;  4JUY A;  4U9C A;  3C5O A;  4PAG A;  2HH7 A;  1WR6 A;  3KFW X;  3RKO A;  4OYJ A;  4G63 A;  4ZI3 D;  5LYJ E;  2H7O A;  3LJC A;  4PJN A;  1MM4 A;  4XZC A;  4N78 D;  5JDG A;  1FIO A;  4KUM B;  4H63 H;  3J9X 1;  4KMC A;  2BZB A;  2F1V A;  5GON E;  2LSG A;  4N59 A;  5DJQ C;  2UXN B;  1HTJ F;  5JVD E;  2Q9Q B;  3RYF E;  3UU2 A;  2LHN A;  5CB4 E;  1GFO A;  4MAL A;  2X9Y A;  2ZMA A;  4AQF C;  3C4Z A;  4C90 A;  5A1L A;  3VY9 X;  2X66 A;  5ADX K;  4DVD A;  3CQG B;  1E1H B;  3HI2 A;  2KIN B;  1D0X A;  5JDH A;  3V8U A;  1LKX A;  5FVN A;  1LVK A;  3NBX X;  4ERR A;  3OBV E;  2VAS A;  5DL6 A;  2XTL A;  4DMV A;  3SWH A;  4OFZ A;  3K3O A;  2NOX A;  3ESL A;  3LBX B;  4X1Y E;  5HYA A;  3ZLI A;  3UAQ A;  2XAJ B;  1KNZ A;  3IEE A;  4QHO A;  3AA0 B;  1US7 B;  4C91 A;  2Y6X A;  3WI4 A;  5AFU L;  2CXD A;  1E54 A;  1QUU A;  2D0T A;  2V7K A;  5LXT E;  2A3D A;  1Q9G A;  2E9X C;  2PJQ A;  1EZ3 A;  3U78 A;  2CWY A;  5IYZ E;  3LG7 A;  4PUX A;  2GE4 A;  3O4X E;  4DBQ A;  2XE3 A;  2W0G A;  2A72 A;  2CE7 A;  1ZKE A;  2V7M A;  3PUG A;  4BJM A;  3OKQ A;  3EMN X;  3K19 A;  1MIY A;  3NSG A;  4J2C A;  2K4T A;  4QX8 B;  3H37 A;  2CCQ A;  4M1P A;  3P7I A;  2OMF A;  1MMN A;  4MLK A;  2ZM2 A;  5EK4 A;  3HWB A;  4H9O C;  4OHF A;  2Y0H A;  1D1B A;  2CA5 A;  2LJL A;  3C64 A;  4O4L E;  5FNV E;  2Q9Q A;  1HG2 A;  4D5U A;  3KVD D;  1OXZ A;  5IYU A;  4PNI A;  3QRC A;  4L0R A;  4ASK A;  2M67 A;  3E0Z A;  2K0L A;  4IIJ E;  3A2S X;  3NZP A;  4WNK A;  4RLB A;  1WLX A;  1VRB A;  3VZT X;  5HWY A;  4AQG A;  3LFM A;  4NUU A;  5JDM A;  2W63 A;  4EOZ B;  3LBX A;  3QK6 A;  2MOZ A;  2NWB A;  3SZD A;  2V7L A;  4YJ2 E;  4WBN E;  4BA9 A;  3NRX A;  3MK7 C;  3ZJ1 A;  4GIW A;  3AA0 A;  4HGA A;  4TV9 E;  4TV8 E;  5LHI B;  2J1N A;  4IGU A;  3POQ A;  5FYM A;  4WBO A;  3CQX C;  5LBM A;  3N2K E;  3ZN0 B;  5LBQ B;  4NUV A;  4ISS A;  3KIN B;  2A2F X;  5DQV A;  5J2T E;  4CXX A;  2DWG A;  1BR4 A;  1MNE A;  3K3Q C;  4UIG A;  4GK0 E;  3N9L A;  3W15 B;  5CA1 E;  2JPF A;  4H9S E;  3H3A A;  2E8I A;  3I0O A;  4KRA A;  2QTK A;  2Y7S A;  4O4U A;  2ODJ A;  4CI3 B;  4CI1 B;  2F1T A;  2JMH A;  3ZCJ A;  2KMF A;  4O4X A;  2BVM A;  2JRK A;  1FEW A;  3PRN A;  3PU3 A;  4QXB B;  4O2A E;  3UUL A;  5CA0 E;  3UUN A;  1BR1 A;  2VB6 A;  2SPC A;  2X67 A;  3OYZ A;  1QSD A;  3TKL B;  3ZMV B;  3V5S A;  5DAB A;  5LG4 A;  4TZ4 C;  1HXU A;  3CVR A;  4FRX A;  4O2B E;  4DMW A;  1BR0 A;  2HPL A;  2POR A;  4LSH A;  4O49 A;  3VZW X;  2DCF A;  3ETV A;  3N9N A;  1V9D A;  1Z0P A;  2G0U A;  2X9H A;  4AYN A;  2LSJ A;  2V7J A;  3I1A A;  2MNH A;  2CLY B;  3Q5X A;  8PRN A;  3C4X A;  3KVB A;  4G2A A;  4RL9 A;  2IW5 B;  5LHG B;  1ZHY A;  4AYE C;  3NZQ A;  4KBM B;  2DLR A;  5EK2 A;  5L3F B;  5LHH B;  2YEV C;  5LOV E;  3PTR B;  3ZMZ B;  2EHO C;  3N9Q A;  4CZZ B;  4KP3 C;  4PFP A;  4E1S A;  5F3J A;  4ZS2 A;  2MHL A;  3QRA A;  2LHR A;  3N9M A;  3RC8 A;  5LJM A;  3ZMU B;  4AYM C;  3QUJ A;  4EXT A;  1IAP A;  4B6X A;  4FUV A;  3F57 A;  3C4W A;  3PUR A;  3KV9 A;  4RJW A;  4CXY A;  2ZM8 A;  4LSE A;  2NW8 A;  2WAU A;  3I0Q A;  3O1I A;  1YKH B;  3AAI A;  2N2M A;  1D1C A;  3E22 E;  4A56 A;  2WWU A;  2PFV A;  2V1D B;  4IHJ E;  5JDF A;  5FMN A;  2UXX B;  5LJN A;  3UPG A;  5JDP A;  1MMG A;  2JQQ A;  4PK6 A;  5L3E B;  2O4V A;  1NWM X;  2GK9 A;  3GA8 A;  1SHZ C;  3FXE B;  5FXV A;  2QA7 A;  3RC3 A;  4JFB A;  2DI4 A;  2ODU A;  3HKE E;  4EZ4 A;  3Q5W A;  4YLH A;  3ZPO A;  1ORM A;  2DNX A;  3EDV A;  2XAG B;  3O1H A;  5JQG E;  4FZN A;  3SYB A;  3UFE A;  1MPF A;  3GWH A;  3HOE A;  4EYU A;  5HXS A;  2WM9 A;  4MFR A;  4AFK A;  3CML A;  5JR9 B;  3CX7 B;  3I9W A;  2KWI B;  5DQW A;  4ZS3 A;  5FY1 A;  1LRZ A;  2N2L A;  4PK5 A;  4LSI A;  2YIN A;  1G8X A;  4QXH B;  4I43 B;  3O1J A;  2KC0 A;  3ZCI A;  3JTY A;  4PJJ A;  3ZMS B;  4O3X B;  1CUN A;  1VOM A;  2E9X D;  3C51 A;  4HTE A;  2X9X A;  3ANW B;  4AUI A;  4X1I E;  3BQI A;  1LVF A;  4ZOL E;  5LA6 E;  2XE1 A;  3SYS A;  1IJ5 A;  2LOP A;  1BH3 A;  2KDY A;  2K5B B;  1D0Z A;  1NAF A;  5FXW A;  4TUY E;  3ZMT B;  7PRN A;  2K9A A;  4EAH A;  4AYI D;  5G26 A;  4OK0 A;  5M4Y A;  2L8K A;  2XE2 A;  3RYC E;  1PHO A;  4O8S A;  4KR8 A;  2C0S A;  3WAK A;  5C8Y E;  3PUS A;  3HKB E;  2PBI A;  3RYH E;  1T98 A;  3ZC0 A;  2D0U A;  4JEH B;  3RRC A;  1ZHC A;  5IHY A;  4UEM A;  2D5U A;  4CI2 B;  4AKI A;  2LOS A;  5KX5 E;  3AA1 B;  2NTX A;  4U74 A;  4AZL A;  4H9N C;  2I59 A;  3L3P A;  4AKR B;  2V26 A;  1AJ3 A;  4GCQ A;  3K8P C;  1WYB A;  4ILU A;  1WRD A;  3C50 A;  4AKM A;  3FB2 A;  4CXW A;  1BT9 A;  4PFO A;  4Z8X A;  3RX6 A;  5L3C B;  3LK4 1;  2Y48 B;  5FXZ A;  4IE0 A;  5L3B B;  4AKH A;  2ZLD A;  5JR9 A;  4IDZ A;  3N9P A;  2N1G A;  4GK5 E;  4IE4 A;  1GFP A;  1P4T A;  2X68 A;  2MBG A;  2IC6 A;  1MMD A;  4QKN A;  4WW0 A;  4O3Z A;  4I55 E;  2NP9 A;  2KWH A;  2LM9 A;  2W61 A;  2BDE A;  3HKD E;  1X79 A;  4O4H E;  3SRZ A;  5ADX L;  5LNK A;  4HFV A;  3GMI A;  3ANW A;  1THQ A;  2J4U P;  3EDU A;  4F4B A;  3KBT A;  2Q9Q C;  3HOL A;  4I4T E;  5PRN A;  4LSF A;  3PE0 A;  2KZ7 B;  3SY7 A;  3DTO A;  3NRY A;  4ZI2 C;  2YPV A;  4IE5 A;  4EB6 E;  4C69 X;  1FMW A;  3BK9 A;  2ZLY A;  2W81 C;  1YS5 A;  1BXW A;  4HKA A;  4GYR A;  1QJ8 A;  3D0T A;  4X20 E;  2YU1 A;  5JDL A;  2N2N A;  4ANJ A;  5J1G A;  4FRT A;  4AI6 A;  2OA5 A;  3KV5 A;  4UEL A;  2VKD A;  3KV4 A;  5LGU B;  5HXH A;  4X1K E;  2K24 A;  1KK7 A;  3B13 A;  2XAF B;  2RA1 A;  3R6N A;  3AA1 A;  1HCI A;  4HE8 A;  1D0Y A;  2HPJ A;  2P9B A;  3SY9 A;  4AKR A;  5EZY E;  2ES0 A;  3DJB A;  4TN7 B;  1GFQ A;  3ETU A;  2XTQ A;  3B57 A;  4FZL A;  2VKJ A;  3LK3 B;  2YU2 A;  4BAY B;  3IHR A;  1MND A;  4BJN A;  5KDM C;  4E7Z A;  3JC6 C;  4PW8 A;  3OJA A;  5HAX A;  2Y2X A;  2XAQ B;  2Y8D A;  3MXZ A;  3VHL A;  3T24 A;  2EHO D;  1UCU A;  4CQI A;  2LSY A;  4N58 A;  3QC9 A;  4EZH A;  3SOL A;  5FP3 A;  4K0U A;  2W00 A;  5H6Q B;  3N2G E;  2Y0L A;  5DL8 A;  5E0O A;  3CQC B;  3MJX A;  4D64 A;  2X51 A;  3RH3 A;  4AKL A;  4UXN B;  2J1D G;  4UVB B;  3ONX A;  4F6R C;  2LSI A;  3EUH A;  3LK2 B;  5JRE A;  2ERV A;  2E9X B;  5DL7 A;  3AA7 B;  3FBZ A;  3MKD A;  2KZ7 A;  3HW9 A;  2CXF A;  3TZG A;  2YK0 A;  3CPZ A;  2CXL A;  4IE6 A;  4MHC A;  5L3D B;  4FSO A;  3VZU X;  1MMA A;  3U3I A;  3AAA B;  4MBQ A;  4FZM A;  4IST A;  2NTY A;  2KT9 A;  3L09 A;  3ZYM A;  4XNL A;  4O3Y A;  5EE2 A;  3WI5 A;  4UVA B;  1FMV A;  3FYX A;  2W80 C;  2XUE A;  1ZHT A;  3MA9 A;  3I9Y A;  2H7V C;  4L9I A;  4AYD C;  1Q9F A;  2W62 A;  6PRN A;  2Z6E A;  3PUQ A;  2XAS B;  4AQF A;  1O3X A;  4H63 V;  3G7G A;  3LK3 A;  1G73 A;  5JRC B;  2XMX A;  1ZHX A;  2DHR A;  2X0L B;  3HKC E;  3RBH A;  2C5K T;  4H9Q C;  3UUM A;  2BVL A;  3CX8 B;  3ZJ2 A;  2Y0K A;  3ZC1 A;  3VKH A;  5BMV E;  5L2L A;  4E7S A;  2K48 A;  5JH7 E;  4ZI3 C;  4I50 E;  2VK9 A;  4P0B A;  1HS7 A;  3SZV A;  2QGS A;  3GN5 B;  3HL6 A;  1ZHW A;  1YKE B;  3VKG A;  3RRW A;  3LK2 A;  2E9X A;  4G75 A;  2KND A;  3ZEF B;  3AA7 A;  3SS1 A;  3UT5 E;  2KXP B;  4GF4 A;  4XBF B;  5DL5 A;  3T20 A;  5LGT B;  3VE1 A;  4H9P C;  3DP7 A;  4HEA A;  3PU8 A;  2VWA A;  4FJO A;  3KDS E;  2CLY C;  4Z3T A;  2WBL A;  3AAA A;  4GCS A;  3Q9D A;  1YD8 G;  4YFS A;  1IZN B;  3UUX B;  1YW0 A;  2CMR A;  3POR A;  4YJ3 E;  4DND A;  5H6R B;  5T5F A;  5TAO A;  4IE7 A;  4ZHQ E;  2X9W A;  2JMK A;  3AAE B;  4UV9 B;  1IJ6 A;  3VY8 X;  3MAC A;  3ZYL A;  2M07 A;  1HXT A;  2PG8 A;  2YNK A;  5JRC A;  3C98 B;  4L5G A;  4XAX B;  4QQ1 A;  2PRN A;  3R84 B;  5J2U E;  3DA3 A;  4BUM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...