2KZ7B

Solution structure of the carmil cah3a/b domain bound to capping protein (cp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kz7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kz7B02
1IZNA 5AFUK 3AA7B 1IZNB 2KZ7A 4AKRB 3AA6A 2KZ7B 3AA7A 3AAAB 3LK2B 2KXPA 5ADXK 3LK3B 3AAEA 5ADXL 3AA1A 3AAAA 3AA0B 3LK42 3AA0A 3AA1B 2KXPB 3AAEB 3LK41 3LK2A 3LK3A 3AA6B 5AFUL 4AKRA
chains in the Genus database with same CATH superfamily
2BG9A 3UU6A 3GP6A 1XMOT 1AJ3A 2UUAT 3Q2MA 3FZHB 3ZEFB 3NSGA 2IDOB 5G39A 4O4LE 3C64A 5KMGP 3KINB 1IZNB 4QKNA 5J0ZA 3AXJA 1ZEEA 3ZJ1A 3ZT6A 5KDMC 4WYVA 1BXWA 2K5BB 5AQNB 4ZXLA 1UCUA 5HCJA 1HCIA 5JR9C 1H6S1 4JEHB 3C4ZA 3ZYKA 4GF4A 3AE8A 4DV3T 4K0UA 2Y48B 2UXNB 4KI0F 1M62A 4JYAT 4QX8B 1UGOA 4QH1A 4KX6A 1XNQT 2IMLA 2E2AA 4YHHT 3UAQA 1WRDA 4KR4A 5JDNA 2ZM2A 3E08A 3AEFA 3UUXB 2WS3A 5AQVB 3UTKA 4HFBA 3SZVA 4O8SA 3N2KE 2VQFT 2WMOA 4GIWA 2YINA 5KAFO 5FVLA 2X9YA 4L0RA 2KXPA 2ODUA 4P1NA 4GCSA 3IEEA 2VWAA 4IL4A 5DABA 2R88A 5KAIO 2FJAA 2UUBT 5IUXA 2N1GA 5L3DB 3JTYA 3PGRA 5L47A 2YOEA 4MHCA 5IYUA 4KHPT 3VKGA 3ZMZB 5FXXA 1FMWA 4P0BA 4ILUA 4HWIB 3Q9DA 3R6NA 1NEKA 5EK2A 5ADXL 4H9NC 3RC8A 3T8OA 3RYIE 5LHIB 4O3XB 4E1SA 2QYWA 3N2OA 1ZV4X 5L3BB 1BR1A 4A56A 2XTQA 5CFBA 4B6XA 1GQEA 3WAJA 4XNLA 3FZFB 4I50E 5L4HA 4EV6A 1PHOA 4WZXA 5C3JA 3Q5WA 2CXFA 7PRNA 2Y8DA 3PDYA 2M06A 2L9QA 1THQA 1JNRA 3AA6B 4JLEA 4PJNA 5FXVA 1W0BA 2DWKA 2I6HA 2BS4A 4AUIA 2IAKA 4IE6A 4I4TE 4ANJA 4ZI3C 1YKEB 1MIYA 3F2EA 5FY7A 3PQSA 2UUCT 3PUVF 1E7PA 3EMNX 4X1IE 4DR4T 3AAAB 3D0TA 2AE9A 4GOUA 4UXNB 5ETWA 3PTRB 2R4NA 2XJ7A 5F5WA 4BJMA 4CTDA 1ZP0A 4DR3T 2W0GA 2JMKA 1QJ9A 3PV0F 2JJ9A 2LOPA 2KC0A 2OV9A 4HN9A 5L4EA 3U78A 3PGSA 3DWOX 3UU3A 3KBTA 5AQQB 4HEAA 2DL1A 2YEVC 3JC6C 5LG4A 3PURA 3VRBA 4AI6A 2WVPA 4K3CA 2YU2A 4QXBB 4JI2T 3F57A 4DMWA 2H7VC 2H7OA 4JV5T 4HFIA 3SY9A 4A5XA 4NPPA 1HNWT 4EEDA 3AAAA 3HWBA 4YJ2E 4AKGA 2XUEA 1GFQA 2V7LA 2K0LA 4O4IE 2C0SA 4LMJA 3IBPA 2V5DA 4KMCA 2X9WA 5LP6E 4N78D 2HN1A 4CI1B 2E9XC 4OX9T 1U4QA 2CPTA 2BG9B 4H9OC 2K24A 3ZPOA 1UX4A 5EK3A 2XAQB 3N5LA 4DIDB 3AA0B 3LK42 2CHOA 1WYCA 4TWHA 5JDFA 4B61A 3ZMVB 3I9YA 4ADZA 3DWNA 5C2TA 5LOVE 2XAJB 3AXJB 1YW0A 4I43B 3AEDA 3PORA 5L3EB 2CXDA 5HWYA 4AQFA 4L5GA 5ADXK 4HWFA 4PJJA 5LGUB 4B3ST 4FT6A 2IUBA 4PK5A 3PF1A 1ZHXA 2ACZA 2ZLYA 1HFAA 3G06A 2FUPA 3VRAA 1X9BA 4JFBA 2CBJA 2VKJA 1SA0E 1BR0A 4QX7B 3HOLA 4H9RC 2KMFA 2LHRA 5JDMA 4MALA 4TV9E 3WU2O 3NJTA 3AE2A 4NUVA 1IJ6A 5ABHA 4LF7T 4RJXA 4FRTA 3JAFA 2WP9A 2V5CA 3AAEB 4Q25A 4AKIA 3UU5A 4YSXA 3AE9A 4EYYR 1T1LA 3I1AA 4PFOA 3K3QC 4H9SE 2F1VA 2RA1A 3PUAA 4C69X 5FXZA 1NAFA 4U74A 2XQ8A 2K3WA 2B1EA 5G38A 4LFBT 3KVAA 3KV5A 5F3JA 1WFDA 1NENA 5FVKA 2C5KT 1KNRA 4UF0A 3L39A 4XNKA 1FMVA 2VB6A 4Z91A 3EUHA 1QUUA 1B7TA 1H7CA 2PTFA 5LYJE 1WR6A 1BR2A 2N2MA 1MM5A 4O4UA 1S94A 2V8SV 4U7IA 3LK2A 2LHFA 2LSGA 2VASA 3AE7A 5JDGA 5LG3A 1HG2A 1IZNA 4I0UA 3P4PA 4HWDA 4O4XA 3T20A 3ESLA 3L3PA 2ZM6T 5LGTB 4YSYA 4YHJA 2J4UP 2W63A 4PK4A 3A8YC 4KBMB 3DTOA 4IHJE 3Q5EA 5ABFB 3LSVA 4AQFC 1KEYA 2Y0KA 1OEDB 4X62T 3FZKB 4WBOA 1N32T 3ZT7A 5JR9B 2YDQA 3N9OA 3K3OA 4F6RC 3B5MA 3L09A 2BVLA 4BAYB 5L3GB 1MNDA 2NOXA 5M4YA 2BBHA 3RIUC 4IE4A 4COFA 4K0KT 4ZZBA 4YJ3E 5LA6E 2VL8A 2YDRA 4HFCA 3FBLA 3EAMA 4G2AA 2FJBA 3J7Yq 4AYMC 3F31A 5B66O 1V9DA 3DJBA 3AE1A 4JCHA 3PUXF 4DR2T 2ZM8A 2XPKA 3N9MA 3UULA 3NKZA 3ANWB 3QNUA 2E9XB 2R8AA 4O3WA 3QC9A 2CM0A 3HKEE 4DV1T 2XQ4A 2W2UA 2V7MA 3C50A 5LJNA 3HW9A 2JQYA 4NXNT 2W80C 4YT0A 3QRAA 2XQ9A 3RIFA 4UB6O 4NXMT 3HKDE 2ZLDA 2PFVA 2XQ6A 2GE4A 3LG7A 5JDPA 2BS2A 2IC9A 1MMGA 5EZYE 1HXTA 3RKOA 3ZT5A 1W9RA 3KV4A 4LMLA 5AQKB 3ZCIA 2Y7SA 2YKSA 2XE1A 4YXDA 1N36T 4UB8O 2WY2A 2CEAA 1VCTA 4UR9A 1KNZA 1XDOA 2XSAA 3O4XE 1BT9A 3CMLA 3I9WA 4AYEC 3AVRA 3FB2A 2CA5A 2WDRA 3NZQA 3SFDA 3K19A 4FRXA 2XM2A 4FJOA 1D1AA 2L3LA 1CHUA 4JEUB 2V6XA 4X64T 1J5ET 4J2CA 4B3MT 2W00A 2XQ7A 4FSOA 3E0ZA 3POQA 5FL0A 1OSMA 2XAGB 2XQAA 2LRLA 2UU9T 4IE5A 5HXHA 1IAPA 3LFMA 5FNVE 2CLYB 2IHR1 2J1DG 4FESA 3PE0A 2WCAA 3RX6A 4N75A 5AQJB 3VE1A 3OJAA 4Z3TA 2PORA 3W15B 1OEDC 3ETVA 2F4VT 1ZOYA 4DV5T 5HCMA 3OVUA 3UU2A 3HKCE 4RL9A 3GN5B 3CX6B 4H63H 3ZN1B 2IW5B 2C5IT 3LBXB 3VZUX 3SS1A 1LRZA 4CN6A 5FMNA 3RIAA 4DV4T 4LSEA 4O2BE 5JQGE 2XQ3A 4AYID 3LJCA 3DZMA 4UV9B 2OA5A 3AVSA 5AQUB 2CCQA 2LEHA 2V7JA 2BG9E 4G75A 3T0SA 3N9LA 1T98A 4ZZCA 4IE7A 5E79O 1T16A 5TISO 3TZGA 4AXPA 3LK3B 4OFZA 4N74A 3K1SA 3FZLB 4HTEA 3RIUA 4JBWF 4YSZA 2BG9C 4GK5E 3WI5A 4GCQA 2KDYA 3PUQA 4IDQA 2YPVA 4FUVA 2W61A 4U7YA 3Q5DA 5LCYA 3PJAA 2WJQA 2XTLA 3RC3A 2ACXA 2W62A 2VVNA 2ZMAA 4IREA 3AA0A 3FHNA 4B3TT 2PJQA 3O1HA 3LK41 2D9DA 1WYBA 3V5SA 2A72A 3VZTX 1GFMA 1UX5A 3PGUA 4YTPA 2IC6A 2MOZA 5DQWA 2A3DA 4CXWA 2BDEA 2UXXB 5LB7B 4ASKA 2NWBA 2ES0A 3VR9A 5A1LA 1G73A 4TWDA 5JVDE 5JTGA 2JRKA 3RI5A 4EZHA 2XE2A 2HPLA 5LBMA 2A2FX 5FKYA 3RGLA 2E8IA 1W0AA 3MJXA 3EDVA 3N9NA 5J2TE 4BA9A 3KV6A 2XG6A 1GFPA 4ISSA 4FSPA 3BK9A 3UU8A 3TLSA 1HX1B 2E5VA 3UQ7A 1OWAA 4H63V 2QVAA 4RJWA 3O1JA 2M6BA 4JI1T 4CXXA 4DO0A 3I0QA 3QB5K 2HN2A 4U3CA 2JQHA 3TLWA 3P7IA 2MAWA 3OYZA 2VL0A 2NW7A 3T1HT 2P9BA 3MKDA 2X0LB 2X9KA 2WMNA 5HEOA 3CK6A 2VKHA 3L8RA 2LM2A 1XMQT 5H2FO 4EGWA 2MPKA 1OPFA 2UXBT 2KZ7A 4AKRB 5T5FA 4QH4A 5CJ5A 1X79A 3N9PA 1YKHB 1L0VA 1VOMA 3GMIA 3RLFF 5LHHB 1Y01A 2C5JA 1HS7A 5HXEA 4DBRA 4GYRA 1O3XA 3VU7H 4C00A 2F1CX 1OEDE 5DQVA 2CHNA 4DV6T 4K3BA 1HNXT 1G90A 4O49A 2BKOA 2V7IA 2V6YA 3U3IA 2G0UA 5IHYA 4YTNA 2R4LA 4ZI2C 1HTJF 2JMHA 2EHOB 3RBHA 2FGQX 2KWIB 2XY8B 5H6QB 3UUNA 4C4VA 3B13A 3POUA 3DP7A 4RLCA 2YK0A 3LDQB 1YQ3A 2LSKA 1P4TA 2XE5A 3CQGB 2ERVA 3N9QA 4CN1A 3MA9A 1SE7A 2WU2A 3BQKA 1IBLT 1D0XA 2DNXA 3JCFA 2ODJA 2BS3A 1QJ8A 3RRCA 2FJDA 4TV8E 3OKQA 2NR4A 3UPGA 3C98B 1KK7A 1S5LO 3V8UA 4JUYA 1UUSA 5DL6A 3ABVA 4X66T 4U72A 5IYZE 5L3CB 2OLTA 3AA7B 5C8YE 1XNRT 3K8PC 1T7SA 1VCSA 4UVCB 4ZS2A 1FJGT 2N2LA 1D0ZA 4IGUA 1ZKEA 1HXUA 2R89A 5HXSA 2ZFGA 2JQQA 5AQFB 1CUNA 2D0UA 2J62A 5HWXA 4EZ4A 5LJMA 3I0OA 2NP9A 4YY3T 4ISTA 1LVFA 1MMNA 4TNWA 5HEJA 3QB5A 5AQHB 2XHEB 2K9AA 2X66A 4EXTA 1E1HB 1UK5A 3E22E 4DR7T 5GTIO 2IWVA 4X20E 4ILCA 3EABA 1KFYA 8PRNA 5FY0A 3PU3A 5AQGB 1I6ZA 5DJQC 1Q9GA 1HR0T 4E7SA 4JI7T 5LXTE 3T24A 4AKHA 3P4WA 3AE6A 5JRCB 4DV0T 2A9UA 2VK9A 5HXRA 3IF8B 2GK9A 4CQIA 4U31A 1YQ4A 4YTMA 4UF0B 4IL9A 1IJ5A 3SFEA 2XQYA 5AQSB 4KR8A 2FBWA 3PUYF 2Q9QD 3RKGA 4UIGA 4BJNA 2VKDA 3UT5E 3A2SX 3CPZA 3PJAJ 5ABEA 2K48A 5HEHA 5JH7E 1HXXA 5LMNT 1PRNA 2DWGA 5JDHA 3MZKB 4EOZB 2Y6XA 4DR6T 3ZC0A 2V7KA 4KRAA 4OHFA 4X1YE 3VZWX 1NWMX 2LOSA 2R4OA 3IHRA 4GYSA 4ZOLE 3R84B 3AE4A 1QJPA 4H9PC 4UEMA 5GTHO 4LMKA 1LVKA 4IT4A 4LFAT 1MPFA 4ZI3D 2O4VA 2KXPB 2LLYA 3CX7B 3VKHA 2IWWA 1VRBA 3TLVA 3ZJ2A 4TZ4C 4X1KE 5DL8A 3KFWX 4C90A 2BKNA 4AYNA 2WM9A 2H88A 4O4JE 3PRNA 2V1DB 2KLQA 3BRZA 2DCFA 4Z8XA 4AFKA 4UVAB 5FXWA 4IDNA 3ZN0B 1HF8A 2L8KA 2LHNA 1WLXA 4UV8B 5LNKA 2F1TA 4H9QC 2R4PA 2CXLA 4AISA 4FZLA 4LF5T 1R8IA 2X27X 4CI2B 2CWOA 3JC6D 3LK2B 3NRYA 4AQYT 2CRBA 3FZMB 4N58A 5JRCA 4A98A 4JI6T 1ZHYA 3NWIA 3A0BO 3A7MA 4CI3B 3PQUA 2J47A 2WAUA 5IWAT 3LK3A 4MFRA 2OMFA 3KVDD 4HE8A 1QSDA 2KWHA 4LF4T 4NUUA 2BBJA 2FGRA 2CMRA 3EI0A 1WCRA 2LSIA 4PR7A 5HYAA 2SPCA 3KV9A 4UVBB 2WDQA 4TUYE 3AA6A 4DR5T 2CE7A 3IA3A 4TN7B 2D5UA 4V1Av 4FMSA 2Q9QB 2JMMA 5HEUA 5GONE 2XMXA 4TX5A 2R6GF 2W81C 3FXEB 4G63A 5FVNA 2DI4A 3RQWA 3FXDB 3FBZA 5JR9A 3AEBA 1Z8UA 3NBXX 3PU8A 3O9XA 2I0MA 3OBVE 5FP3A 5LGNB 3ONXA 3BRYA 2DHRA 4CN4A 3PUGA 4D65A 3EHZA 5ABFA 4ZS3A 3CIRA 4PJLA 1MIVA 1M7KA 5AQOB 3TKLB 4EAHA 4F4BA 5DL5A 4ILBA 1YXRA 2NTXA 3AA7A 1J1JA 2W67A 4FZMA 4EYUA 3C4WA 4C91A 4PK6A 1XWMA 4QXCB 4ZEYA 2WJRA 2MBGA 4DUZT 4ZI7E 1MNEA 2NW8A 2FJEA 5AQIB 3AE5A 4AKRA 4HFVA 4LFCT 5AQRB 2Q9QC 3JAEA 2WZHA 2ZM0A 2W66A 4AZLA 3TLTA 2LKGA 3ZSSA 4QWNB 2Y2XA 3AB3B 3ZSTA 6PRNA 2KT9A 4QXHB 4O4HE 3RH3A 4PJMA 3S4UA 4OYKA 4XZCA 4WBNE 5JDLA 5DL7A 3RPUA 3RF1A 4IDOA 2V6YB 3ONJA 1YS5A 3A0HO 2JPFA 4DBQA 3VR8A 4DR1T 3M65A 2H89A 4LSIA 1MMAA 5KXJA 3P4QA 2WWUA 4U33A 3NZPA 4PJ0O 3POXA 2EHOA 4HWHA 4GK0E 2XASB 3JADA 2HPJA 4KHZF 3H3AA 3G7GA 3WI3A 3PUSA 3JCUO 3SY7A 1QLBA 5JREA 5CA0E 3CWZB 3C51A 1DU2A 4F8HA 4X5TA 5D5DA 3VY8X 3EDUA 3SYBA 3OTOT 3ETUA 2XSBA 4IE0A 2ODVA 1G8XA 5E0OA 2YDSA 1HNZT 2D0TA 3QUJA 4GCPA 2XAFB 3DA4A 2M67A 3RRWA 2XM1A 1N34T 3FYXA 3GA8A 5PRNA 3X1DA 5G3AA 2XQ5A 4JI5T 3RYHE 3BQIA 4U2YA 5FYMA 3CQCB 4D64A 4AYDC 4AKMA 4IL6O 1Y64B 2MTQA 3A5XA 1D1CA 5FL1A 5G26A 3C4XA 1E54A 3KDSE 4CZZB 5AQPB 4HKAA 1MMDA 4G76A 1XDPA 4O3ZA 2CLYC 3OPCA 4D5UA 4PFPA 1W09A 1D1BA 3BS0A 2X68A 2QGSA 2MYSA 5AQTB 2YN6A 3NVOA 1HG5A 4P0AA 2YNKA 1I94T 2B76A 4C4VB 4U2ZA 5KX5E 3OYXA 3UUMA 1EZ3A 4AIUA 2E9XA 2HH7A 4IIJE 5J2UE 3AE3A 2XTRA 3AEEA 3RQUA 4HFEA 2XAHB 5CA1E 4DNDA 1T72A 3Q5XA 3ZLIA 2BKPA 5BR8T 3SYSA 2NW9A 2KNDA 2JQKA 2BVMA 5HEGA 3N2GE 3H3MA 3P4SA 2X0YA 2WBLA 3KZIO 4LF9T 2LFUA 2X9HA 2KSRA 2Y0HA 1BH3A 1ORMA 1FEWA 3AA1A 2N9DA 1IBMT 2M07A 3KBUA 2MNHA 3GWHA 2AXDS 1HX8A 1BR4A 3ZCJA 3HOEA 1ZHCA 2KZ7B 3ZMUB 4CXYA 3QRCA 2VVSA 3ONLC 5F8PA 3GN5A 3TLUA 4QHOA 3RYFE 4B3RT 3P4RA 4QH5A 3CVRA 2PBIA 2LSJA 4NIQA 1S35A 4OYJA 4AQGA 2XE3A 5L3FB 2IIUA 4HFHA 5HAXA 4XAXB 3V5UA 2QTKA 3ZYMA 5EK4A 1YD8G 3AEGA 3AAIA 1Z0PA 4ZHQE 3PUZF 4JI4T 4KUMB 1Q9FA 2X51A 1MIWA 4Z90A 2BZBA 4WNKA 4LF6T 4EEBA 4LSHA 1OXZA 1OEDA 3J9X1 2LSYA 5ABGA 2QA7A 4JI8T 2WWVA 2WDVA 3PUWF 2PRNA 3HI2A 3C5OA 3VHLA 3QOFA 3UFGA 2Y0LA 2CWYA 3AECA 2X9XA 2J4GA 4PUXA 3VE2A 2YU1A 2RP4A 3CX8B 2QRXA 2LJLA 5AFUK 3BQLA 4MBQA 3B57A 4IDZA 2DLRA 2M6IA 1GFNA 4PW8A 5HXCA 3T1YT 5LBQB 1U5PA 4LSFA 3AA1B 3M3ZB 4FQEA 2LE8A 1ZHTA 4DV2T 3HKBE 3LBXA 2LM9A 2WQYA 3SOLA 2X0HA 1E2AA 1FIOA 3UUBA 4GHBA 3K3NA 4AKLA 2LRKA 4LF8T 2JIWA 4FI5A 4FZNA 2LT3A 4YFSA 3ZMSB 3SRZA 1KF6A 1SHZC 4JI0T 2XZEA 2RPAA 3EVYA 5AFUL 2EHOC 3ZC1A 2N2NA 5CB4E 2Z6EA 4RLBA 2KINB 1WR0A 3MACA 2JQ9A 5LMUT 4MLKA 2LKHA 4X65T 1J5WA 2W4XA 4UELA 3WI4A 4O2AE 3O1IA 4FOZA 4O3YA 2AXTO 2CBIA 1XZYA 1SUMB 1JNZA 4XBFB 2K4TA 4JI3T 4GKKT 1T8BA 1ZHZA 3HL6A 3SWHA 3CKDA 4WW0A 1UURA 2V26A 1ZHWA 2I59A 2UXCT 1MM4A 2E5LT 3RYCE 2EHOD 4L9IA 5BMVE 4TWFA 4DV7T 4HWCA 2X67A 3MK7C 3HR0A 3ZMTB 5L2LA 4YLHA 4HFDA 4HGAA 2NTYA 2WB5A 2WSSV 2UXDT 3UQ4A 5LHGB 3CQXC 4BUMX 4E1TA 4N59A 5EE2A 4EIWA 5TAOA 1IBKT 1GFOA 2Q9QA 5JDQA 3KVBA 1US7B 3ZKRA 4P09A 2HHHT 4A97A 4KP3C 5J1GA 3NRXA 5FY1A 3RHWA 3ZYLA 3P50A 5AQMB 3MXZA 1KNPA 2VURA 4DUYT 3UFEA 2VQET 1LKXA 2WU5A 3AEAA 3AAEA 4DVDA 4E7ZA 5AQLB 4IDPA 5H6RB 4PAGA 4GKJT 3O0EA 1D0YA 4PNIA 3SZDA 2PG8A 3DA3A 2VKOA 3ANWA 4ILAA 5GV0A 3P8CD 4I55E 4M1PA 3H37A 4ZI2D 2WZIA 3WAKA 4EB6E 5B5EO 4ERRA 2D2SA 4TNVA 3HA4A 4QQ1A 3VY9X 4OK0A 3QK6A 3UU4A 4U9CA 2E9XD 4DMVA 2J1NA 2H3RA 5CGMA 1N33T 2MHLA
chains in the Genus database with same CATH topology
5L3CB 4IHJE 1Y64B 2MTQA 3AA7B 5C8YE 3A5XA 1D1CA 3K8PC 5G26A 3C4XA 3GP6A 4UVCB 4ZS2A 2N2LA 4AQFC 1AJ3A 1D0ZA 2Y0KA 1E54A 4IGUA 4WBOA 1ZKEA 3KDSE 4CZZB 1HXUA 5HXSA 5JR9B 3Q2MA 3N9OA 3K3OA 2ZFGA 4F6RC 2JQQA 3ZEFB 3NSGA 4HKAA 1MMDA 1CUNA 4G76A 4O3ZA 2CLYC 2D0UA 3L09A 2BVLA 4BAYB 4D5UA 5HWXA 5L3GB 1MNDA 2NOXA 4PFPA 4EZ4A 4O4LE 5LJMA 5M4YA 3C64A 3I0OA 5KMGP 3KINB 1D1BA 2NP9A 1IZNB 4IE4A 4ISTA 1LVFA 4QKNA 1ZEEA 4C69X 2X68A 4YJ3E 2QGSA 2MYSA 5LA6E 3ZJ1A 1MMNA 4AYDC 2VL8A 5KDMC 1HG5A 4P0AA 1BXWA 2YNKA 2K5BB 2XHEB 2K9AA 5KX5E 3OYXA 2X66A 3FBLA 3UUMA 4EXTA 1E1HB 4G2AA 4AYMC 3J7Yq 1EZ3A 3E22E 3F31A 1UCUA 1HCIA 5JR9C 1H6S1 2E9XA 2HH7A 4JEHB 1V9DA 3C4ZA 4IIJE 3DJBA 5J2UE 4X20E 3ZYKA 4GF4A 4JCHA 2ZM8A 4K0UA 8PRNA 3N9MA 3UULA 2Y48B 3ANWB 2UXNB 5FY0A 3PU3A 2XTRA 2E9XB 4O3WA 3QC9A 4QX8B 5DJQC 2XAHB 1Q9GA 5CA1E 2CM0A 4DNDA 3HKEE 3Q5XA 4E7SA 3ZLIA 5LXTE 2V7MA 3C50A 3UAQA 3T24A 4AKHA 5LJNA 1WRDA 3HW9A 3SYSA 3VY8X 2NW9A 2KNDA 4KR4A 5JRCB 2W80C 5JDNA 3QRAA 2ZM2A 3E08A 2BVMA 3N2GE 3UUXB 3HKDE 3UTKA 3SZVA 2VK9A 4O8SA 3N2KE 2ZLDA 2WBLA 5HXRA 2PFVA 2GE4A 3IF8B 2WMOA 3LG7A 2GK9A 4GIWA 2YINA 4CQIA 2X9HA 2LFUA 5EZYE 2IC9A 1MMGA 5JDPA 2X9YA 4L0RA 4UF0B 1HXTA 2ODUA 2KXPA 2Y0HA 4GCSA 3RKOA 3IEEA 1IJ5A 2VWAA 2XQYA 5DABA 1BH3A 1ORMA 1FEWA 3KV4A 3AA1A 4KR8A 2N9DA 3ZCIA 2M07A 2Y7SA 3KBUA 2MNHA 3GWHA 2XE1A 2N1GA 5L3DB 3JTYA 2Q9QD 4UIGA 1HX8A 4BJNA 2VKDA 1BR4A 3ZCJA 2CEAA 3HOEA 3UT5E 1KNZA 4MHCA 3A2SX 3CPZA 1ZHCA 5IYUA 2KZ7B 3ZMUB 4CXYA 3QRCA 3VKGA 2K48A 3ZMZB 5JH7E 5F8PA 1HXXA 5FXXA 1PRNA 2DWGA 1FMWA 4P0BA 4ILUA 3O4XE 5JDHA 3GN5A 1BT9A 3Q9DA 3R6NA 4QHOA 3RYFE 5EK2A 5ADXL 4H9NC 3RC8A 3T8OA 3CMLA 3MZKB 3CVRA 2PBIA 2LSJA 4EOZB 2Y6XA 3RYIE 1S35A 4OYJA 3ZC0A 3I9WA 5LHIB 4O3XB 4AYEC 4E1SA 4AQGA 2XE3A 2V7KA 3AVRA 5L3FB 3N2OA 1ZV4X 5L3BB 3FB2A 4OHFA 1BR1A 4X1YE 4A56A 5HAXA 4XAXB 3V5UA 1NWMX 3ZYMA 2QTKA 4B6XA 3VZWX 5EK4A 2CA5A 1YD8G 2LOSA 3AAIA 1Z0PA 3NZQA 4ZHQE 3WAJA 3K19A 3IHRA 4GYSA 4ZOLE 4FJOA 3R84B 4I50E 4FRXA 4XNLA 1PHOA 1D1AA 2L3LA 1QJPA 4JEUB 4H9PC 4UEMA 4KUMB 1Q9FA 4J2CA 2X51A 2W00A 1MIWA 4KRAA 3Q5WA 1LVKA 4FSOA 1MPFA 2CXFA 3E0ZA 4ZI3D 3POQA 2BZBA 4WNKA 1OSMA 7PRNA 2XAGB 2Y8DA 3PDYA 2O4VA 2M06A 2KXPB 2L9QA 1THQA 4LSHA 1OXZA 3CX7B 3VKHA 4IE5A 3AA6B 5HXHA 4JLEA 4PJNA 1IAPA 3J9X1 2LSYA 1VRBA 3LFMA 5FNVE 5FXVA 3ZJ2A 2DWKA 2CLYB 2QA7A 2J1DG 4FESA 4TZ4C 3PE0A 4X1KE 3RX6A 2PRNA 5DL8A 3KFWX 4C90A 3OJAA 3VE1A 3HI2A 2WM9A 4AYNA 4Z3TA 3C5OA 3VHLA 2PORA 3W15B 4O4JE 4AUIA 2IAKA 3ETVA 2V1DB 4IE6A 3PRNA 2KLQA 2Y0LA 4I4TE 2CWYA 2DCFA 4ANJA 4Z8XA 3UU2A 4ZI3C 4AFKA 3HKCE 1YKEB 4UVAB 2X9XA 5FXWA 3ZN0B 4PUXA 4RL9A 2YU1A 3VE2A 1MIYA 3F2EA 1HF8A 2L8KA 5FY7A 2LHNA 3GN5B 2RP4A 3PQSA 1WLXA 3CX6B 3CX8B 4H63H 2IW5B 3ZN1B 2C5IT 3LBXB 4UV8B 3SS1A 5LNKA 2LJLA 3VZUX 1LRZA 2F1TA 4H9QC 5AFUK 2CXLA 4FZLA 3BQLA 3EMNX 4X1IE 2X27X 4MBQA 5FMNA 4CI2B 3AAAB 3D0TA 2CWOA 3B57A 3JC6D 2DLRA 3LK2B 4IDZA 1GFNA 3NRYA 4PW8A 5HXCA 4GOUA 5LBQB 4N58A 5JRCA 1U5PA 4UXNB 4LSEA 5ETWA 4O2BE 5JQGE 4LSFA 1ZHYA 3PTRB 4AYID 3LJCA 3AA1B 4CI3B 3PQUA 4UV9B 2OA5A 2LE8A 2WAUA 3AVSA 1ZHTA 4BJMA 2CCQA 3LK3A 2LEHA 4MFRA 2V7JA 3HKBE 2W0GA 2JMKA 1QJ9A 3LBXA 2JJ9A 2LOPA 2KC0A 4HN9A 3U78A 2OMFA 3KVDD 4G75A 4HE8A 3N9LA 3T0SA 3KBTA 1T98A 1QSDA 2LM9A 4HEAA 4IE7A 2KWHA 3SOLA 2YEVC 3JC6C 4NUUA 2FGRA 2CMRA 3TZGA 4AXPA 3LK3B 3PURA 4OFZA 5LG4A 4AI6A 2YU2A 4QXBB 3F57A 4DMWA 1FIOA 2H7VC 2H7OA 4GHBA 2LSIA 3SY9A 4HTEA 3K3NA 5HYAA 4AKLA 3AAAA 2SPCA 4GK5E 3HWBA 4YJ2E 3KV9A 4UVBB 4AKGA 3WI5A 2XUEA 4GCQA 1GFQA 2KDYA 4TUYE 3PUQA 3AA6A 2CE7A 2V7LA 4TN7B 2D5UA 4V1Av 4FI5A 2YPVA 4FMSA 2K0LA 2Q9QB 4O4IE 2W61A 4FUVA 2C0SA 5LCYA 2JMMA 4FZNA 2LT3A 3IBPA 5GONE 4YFSA 2XTLA 3ZMSB 3RC3A 4KMCA 2ACXA 2X9WA 2XMXA 2W62A 4TX5A 5LP6E 2ZMAA 3SRZA 3AA0A 2W81C 3FXEB 4G63A 1SHZC 4N78D 5FVNA 2DI4A 3FHNA 3FXDB 2PJQA 3O1HA 3FBZA 5JR9A 3LK41 1WYBA 3V5SA 2E9XC 4CI1B 2A72A 3EVYA 5AFUL 3NBXX 2EHOC 3ZC1A 2N2NA 5CB4E 1U4QA 3VZTX 3PU8A 1GFMA 3O9XA 1UX5A 4H9OC 2K24A 3ZPOA 2Z6EA 1UX4A 4RLBA 2IC6A 2MOZA 5DQWA 2KINB 2A3DA 3OBVE 2BDEA 5FP3A 4CXWA 2UXXB 3MACA 5LGNB 4ASKA 3ONXA 2NWBA 5EK3A 2ES0A 2XAQB 5A1LA 1G73A 2DHRA 3N5LA 5JVDE 4MLKA 3AA0B 2XTQA 3LK42 2JRKA 4EZHA 1WYCA 5JDFA 3PUGA 4UELA 4D65A 3WI4A 4B61A 4ZS3A 2XE2A 4PJLA 1MIVA 2HPLA 4O2AE 5LBMA 3ZMVB 3O1IA 3I9YA 4ADZA 4FOZA 2A2FX 3TKLB 4EAHA 4O3YA 5DL5A 4F4BA 2E8IA 2NTXA 3MJXA 5LOVE 2XAJB 3EDVA 1YW0A 4I43B 3N9NA 3AA7A 5J2TE 4XBFB 2K4TA 3PORA 5L3EB 4BA9A 3KV6A 4FZMA 2XG6A 1GFPA 2CXDA 4EYUA 4ISSA 5HWYA 4AQFA 3C4WA 4L5GA 4FSPA 5ADXK 4C91A 4PK6A 4PJJA 5LGUB 1ZHZA 3BK9A 3HL6A 3SWHA 3CKDA 4WW0A 4FT6A 4QXCB 2V26A 4PK5A 1ZHWA 2I59A 1OWAA 1ZHXA 4H63V 2ZLYA 2MBGA 1HFAA 4RJWA 3O1JA 4ZI7E 4CXXA 1MNEA 2NW8A 1MM4A 4DO0A 4JFBA 3RYCE 2EHOD 3I0QA 2VKJA 4L9IA 5BMVE 4AKRA 1SA0E 4HFVA 1BR0A 4QX7B 3HOLA 2X67A 3MK7C 2Q9QC 3HR0A 4H9RC 3ZMTB 2KMFA 3P7IA 5L2LA 2ZM0A 2LHRA 4YLHA 4AZLA 4HGAA 5JDMA 2NTYA 4MALA 4TV9E 3OYZA 2WSSV 4QWNB 2Y2XA 3AB3B 2NW7A 6PRNA 2KT9A 4QXHB 4NUVA 1IJ6A 4O4HE 3RH3A 2P9BA 4RJXA 4FRTA 4PJMA 3MKDA 3S4UA 2X0LB 4OYKA 4XZCA 2WMNA 5LHGB 3CQXC 4WBNE 4BUMX 4N59A 2VKHA 3AAEB 5EE2A 4E1TA 4AKIA 4EIWA 5JDLA 5DL7A 5TAOA 4EYYR 1OPFA 1GFOA 3RPUA 2Q9QA 2KZ7A 3I1AA 4AKRB 5JDQA 4PFOA 1YS5A 3K3QC 5T5FA 4H9SE 3KVBA 1US7B 2F1VA 2JPFA 2RA1A 3PUAA 1X79A 4P09A 5FXZA 4DBQA 1NAFA 3M65A 3N9PA 1YKHB 4U74A 1VOMA 3GMIA 4LSIA 5LHHB 1MMAA 2B1EA 2C5JA 1HS7A 5HXEA 4KP3C 5J1GA 3KVAA 3NRXA 5FY1A 4DBRA 3KV5A 2WWUA 4GYRA 3ZYLA 1O3XA 5F3JA 3VU7H 3NZPA 5DQVA 2C5KT 1G90A 3POXA 4UF0A 2EHOA 3MXZA 4O49A 4GK0E 2V7IA 2XASB 2HPJA 4XNKA 3H3AA 3U3IA 2G0UA 5IHYA 1FMVA 2VB6A 3G7GA 3EUHA 3PUSA 3WI3A 3UFEA 4ZI2C 1LKXA 1HTJF 1QUUA 5JREA 3SY7A 2JMHA 2EHOB 1B7TA 1H7CA 5CA0E 5LYJE 3CWZB 3RBHA 3C51A 2FGQX 3AAEA 4DVDA 4E7ZA 1WR6A 1BR2A 2KWIB 5H6QB 3UUNA 5D5DA 3B13A 2N2MA 3POUA 3DP7A 4RLCA 1MM5A 2YK0A 5H6RB 3EDUA 4O4UA 1S94A 2LSKA 4PAGA 1P4TA 3SYBA 3ETUA 4IE0A 3O0EA 2XE5A 2ODVA 3CQGB 2ERVA 1D0YA 3N9QA 4PNIA 3LK2A 3SZDA 2LHFA 1G8XA 2LSGA 2PG8A 3MA9A 2VASA 3DA3A 2VKOA 3BQKA 5E0OA 5JDGA 1HG2A 1IZNA 3ANWA 1D0XA 5GV0A 2DNXA 2D0TA 3P8CD 2ODJA 1QJ8A 3QUJA 3RRCA 4GCPA 4O4XA 3T20A 4TV8E 3OKQA 4I55E 4M1PA 2XAFB 3UPGA 3ESLA 3H37A 3L3PA 2M67A 3WAKA 4EB6E 4ZI2D 3RRWA 3DA4A 3C98B 4ERRA 1KK7A 2D2SA 4QQ1A 3HA4A 3VY9X 3FYXA 3GA8A 5PRNA 5LGTB 4OK0A 3QK6A 4JUYA 3V8UA 4YHJA 5DL6A 3RYHE 3BQIA 4U9CA 2E9XD 2J4UP 4DMVA 2W63A 4PK4A 2J1NA 4KBMB 5FYMA 2H3RA 3CQCB 4U72A 2MHLA 4D64A 3DTOA 5IYZE 4AKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IZN A;  5AFU K;  3AA7 B;  1IZN B;  2KZ7 A;  4AKR B;  3AA6 A;  2KZ7 B;  3AA7 A;  3AAA B;  3LK2 B;  2KXP A;  5ADX K;  3LK3 B;  3AAE A;  5ADX L;  3AA1 A;  3AAA A;  3AA0 B;  3LK4 2;  3AA0 A;  3AA1 B;  2KXP B;  3AAE B;  3LK4 1;  3LK2 A;  3LK3 A;  3AA6 B;  5AFU L;  4AKR A; 
#chains in the Genus database with same CATH topology
 2BG9 A;  3UU6 A;  3GP6 A;  1XMO T;  1AJ3 A;  2UUA T;  3Q2M A;  3FZH B;  3ZEF B;  3NSG A;  2IDO B;  5G39 A;  4O4L E;  3C64 A;  5KMG P;  3KIN B;  1IZN B;  4QKN A;  5J0Z A;  3AXJ A;  1ZEE A;  3ZJ1 A;  3ZT6 A;  5KDM C;  4WYV A;  1BXW A;  2K5B B;  5AQN B;  4ZXL A;  1UCU A;  5HCJ A;  1HCI A;  5JR9 C;  1H6S 1;  4JEH B;  3C4Z A;  3ZYK A;  4GF4 A;  3AE8 A;  4DV3 T;  4K0U A;  2Y48 B;  2UXN B;  4KI0 F;  1M62 A;  4JYA T;  4QX8 B;  1UGO A;  4QH1 A;  4KX6 A;  1XNQ T;  2IML A;  2E2A A;  4YHH T;  3UAQ A;  1WRD A;  4KR4 A;  5JDN A;  2ZM2 A;  3E08 A;  3AEF A;  3UUX B;  2WS3 A;  5AQV B;  3UTK A;  4HFB A;  3SZV A;  4O8S A;  3N2K E;  2VQF T;  2WMO A;  4GIW A;  2YIN A;  5KAF O;  5FVL A;  2X9Y A;  4L0R A;  2KXP A;  2ODU A;  4P1N A;  4GCS A;  3IEE A;  2VWA A;  4IL4 A;  5DAB A;  2R88 A;  5KAI O;  2FJA A;  2UUB T;  5IUX A;  2N1G A;  5L3D B;  3JTY A;  3PGR A;  5L47 A;  2YOE A;  4MHC A;  5IYU A;  4KHP T;  3VKG A;  3ZMZ B;  5FXX A;  1FMW A;  4P0B A;  4ILU A;  4HWI B;  3Q9D A;  3R6N A;  1NEK A;  5EK2 A;  5ADX L;  4H9N C;  3RC8 A;  3T8O A;  3RYI E;  5LHI B;  4O3X B;  4E1S A;  2QYW A;  3N2O A;  1ZV4 X;  5L3B B;  1BR1 A;  4A56 A;  2XTQ A;  5CFB A;  4B6X A;  1GQE A;  3WAJ A;  4XNL A;  3FZF B;  4I50 E;  5L4H A;  4EV6 A;  1PHO A;  4WZX A;  5C3J A;  3Q5W A;  2CXF A;  7PRN A;  2Y8D A;  3PDY A;  2M06 A;  2L9Q A;  1THQ A;  1JNR A;  3AA6 B;  4JLE A;  4PJN A;  5FXV A;  1W0B A;  2DWK A;  2I6H A;  2BS4 A;  4AUI A;  2IAK A;  4IE6 A;  4I4T E;  4ANJ A;  4ZI3 C;  1YKE B;  1MIY A;  3F2E A;  5FY7 A;  3PQS A;  2UUC T;  3PUV F;  1E7P A;  3EMN X;  4X1I E;  4DR4 T;  3AAA B;  3D0T A;  2AE9 A;  4GOU A;  4UXN B;  5ETW A;  3PTR B;  2R4N A;  2XJ7 A;  5F5W A;  4BJM A;  4CTD A;  1ZP0 A;  4DR3 T;  2W0G A;  2JMK A;  1QJ9 A;  3PV0 F;  2JJ9 A;  2LOP A;  2KC0 A;  2OV9 A;  4HN9 A;  5L4E A;  3U78 A;  3PGS A;  3DWO X;  3UU3 A;  3KBT A;  5AQQ B;  4HEA A;  2DL1 A;  2YEV C;  3JC6 C;  5LG4 A;  3PUR A;  3VRB A;  4AI6 A;  2WVP A;  4K3C A;  2YU2 A;  4QXB B;  4JI2 T;  3F57 A;  4DMW A;  2H7V C;  2H7O A;  4JV5 T;  4HFI A;  3SY9 A;  4A5X A;  4NPP A;  1HNW T;  4EED A;  3AAA A;  3HWB A;  4YJ2 E;  4AKG A;  2XUE A;  1GFQ A;  2V7L A;  2K0L A;  4O4I E;  2C0S A;  4LMJ A;  3IBP A;  2V5D A;  4KMC A;  2X9W A;  5LP6 E;  4N78 D;  2HN1 A;  4CI1 B;  2E9X C;  4OX9 T;  1U4Q A;  2CPT A;  2BG9 B;  4H9O C;  2K24 A;  3ZPO A;  1UX4 A;  5EK3 A;  2XAQ B;  3N5L A;  4DID B;  3AA0 B;  3LK4 2;  2CHO A;  1WYC A;  4TWH A;  5JDF A;  4B61 A;  3ZMV B;  3I9Y A;  4ADZ A;  3DWN A;  5C2T A;  5LOV E;  2XAJ B;  3AXJ B;  1YW0 A;  4I43 B;  3AED A;  3POR A;  5L3E B;  2CXD A;  5HWY A;  4AQF A;  4L5G A;  5ADX K;  4HWF A;  4PJJ A;  5LGU B;  4B3S T;  4FT6 A;  2IUB A;  4PK5 A;  3PF1 A;  1ZHX A;  2ACZ A;  2ZLY A;  1HFA A;  3G06 A;  2FUP A;  3VRA A;  1X9B A;  4JFB A;  2CBJ A;  2VKJ A;  1SA0 E;  1BR0 A;  4QX7 B;  3HOL A;  4H9R C;  2KMF A;  2LHR A;  5JDM A;  4MAL A;  4TV9 E;  3WU2 O;  3NJT A;  3AE2 A;  4NUV A;  1IJ6 A;  5ABH A;  4LF7 T;  4RJX A;  4FRT A;  3JAF A;  2WP9 A;  2V5C A;  3AAE B;  4Q25 A;  4AKI A;  3UU5 A;  4YSX A;  3AE9 A;  4EYY R;  1T1L A;  3I1A A;  4PFO A;  3K3Q C;  4H9S E;  2F1V A;  2RA1 A;  3PUA A;  4C69 X;  5FXZ A;  1NAF A;  4U74 A;  2XQ8 A;  2K3W A;  2B1E A;  5G38 A;  4LFB T;  3KVA A;  3KV5 A;  5F3J A;  1WFD A;  1NEN A;  5FVK A;  2C5K T;  1KNR A;  4UF0 A;  3L39 A;  4XNK A;  1FMV A;  2VB6 A;  4Z91 A;  3EUH A;  1QUU A;  1B7T A;  1H7C A;  2PTF A;  5LYJ E;  1WR6 A;  1BR2 A;  2N2M A;  1MM5 A;  4O4U A;  1S94 A;  2V8S V;  4U7I A;  3LK2 A;  2LHF A;  2LSG A;  2VAS A;  3AE7 A;  5JDG A;  5LG3 A;  1HG2 A;  1IZN A;  4I0U A;  3P4P A;  4HWD A;  4O4X A;  3T20 A;  3ESL A;  3L3P A;  2ZM6 T;  5LGT B;  4YSY A;  4YHJ A;  2J4U P;  2W63 A;  4PK4 A;  3A8Y C;  4KBM B;  3DTO A;  4IHJ E;  3Q5E A;  5ABF B;  3LSV A;  4AQF C;  1KEY A;  2Y0K A;  1OED B;  4X62 T;  3FZK B;  4WBO A;  1N32 T;  3ZT7 A;  5JR9 B;  2YDQ A;  3N9O A;  3K3O A;  4F6R C;  3B5M A;  3L09 A;  2BVL A;  4BAY B;  5L3G B;  1MND A;  2NOX A;  5M4Y A;  2BBH A;  3RIU C;  4IE4 A;  4COF A;  4K0K T;  4ZZB A;  4YJ3 E;  5LA6 E;  2VL8 A;  2YDR A;  4HFC A;  3FBL A;  3EAM A;  4G2A A;  2FJB A;  3J7Y q;  4AYM C;  3F31 A;  5B66 O;  1V9D A;  3DJB A;  3AE1 A;  4JCH A;  3PUX F;  4DR2 T;  2ZM8 A;  2XPK A;  3N9M A;  3UUL A;  3NKZ A;  3ANW B;  3QNU A;  2E9X B;  2R8A A;  4O3W A;  3QC9 A;  2CM0 A;  3HKE E;  4DV1 T;  2XQ4 A;  2W2U A;  2V7M A;  3C50 A;  5LJN A;  3HW9 A;  2JQY A;  4NXN T;  2W80 C;  4YT0 A;  3QRA A;  2XQ9 A;  3RIF A;  4UB6 O;  4NXM T;  3HKD E;  2ZLD A;  2PFV A;  2XQ6 A;  2GE4 A;  3LG7 A;  5JDP A;  2BS2 A;  2IC9 A;  1MMG A;  5EZY E;  1HXT A;  3RKO A;  3ZT5 A;  1W9R A;  3KV4 A;  4LML A;  5AQK B;  3ZCI A;  2Y7S A;  2YKS A;  2XE1 A;  4YXD A;  1N36 T;  4UB8 O;  2WY2 A;  2CEA A;  1VCT A;  4UR9 A;  1KNZ A;  1XDO A;  2XSA A;  3O4X E;  1BT9 A;  3CML A;  3I9W A;  4AYE C;  3AVR A;  3FB2 A;  2CA5 A;  2WDR A;  3NZQ A;  3SFD A;  3K19 A;  4FRX A;  2XM2 A;  4FJO A;  1D1A A;  2L3L A;  1CHU A;  4JEU B;  2V6X A;  4X64 T;  1J5E T;  4J2C A;  4B3M T;  2W00 A;  2XQ7 A;  4FSO A;  3E0Z A;  3POQ A;  5FL0 A;  1OSM A;  2XAG B;  2XQA A;  2LRL A;  2UU9 T;  4IE5 A;  5HXH A;  1IAP A;  3LFM A;  5FNV E;  2CLY B;  2IHR 1;  2J1D G;  4FES A;  3PE0 A;  2WCA A;  3RX6 A;  4N75 A;  5AQJ B;  3VE1 A;  3OJA A;  4Z3T A;  2POR A;  3W15 B;  1OED C;  3ETV A;  2F4V T;  1ZOY A;  4DV5 T;  5HCM A;  3OVU A;  3UU2 A;  3HKC E;  4RL9 A;  3GN5 B;  3CX6 B;  4H63 H;  3ZN1 B;  2IW5 B;  2C5I T;  3LBX B;  3VZU X;  3SS1 A;  1LRZ A;  4CN6 A;  5FMN A;  3RIA A;  4DV4 T;  4LSE A;  4O2B E;  5JQG E;  2XQ3 A;  4AYI D;  3LJC A;  3DZM A;  4UV9 B;  2OA5 A;  3AVS A;  5AQU B;  2CCQ A;  2LEH A;  2V7J A;  2BG9 E;  4G75 A;  3T0S A;  3N9L A;  1T98 A;  4ZZC A;  4IE7 A;  5E79 O;  1T16 A;  5TIS O;  3TZG A;  4AXP A;  3LK3 B;  4OFZ A;  4N74 A;  3K1S A;  3FZL B;  4HTE A;  3RIU A;  4JBW F;  4YSZ A;  2BG9 C;  4GK5 E;  3WI5 A;  4GCQ A;  2KDY A;  3PUQ A;  4IDQ A;  2YPV A;  4FUV A;  2W61 A;  4U7Y A;  3Q5D A;  5LCY A;  3PJA A;  2WJQ A;  2XTL A;  3RC3 A;  2ACX A;  2W62 A;  2VVN A;  2ZMA A;  4IRE A;  3AA0 A;  3FHN A;  4B3T T;  2PJQ A;  3O1H A;  3LK4 1;  2D9D A;  1WYB A;  3V5S A;  2A72 A;  3VZT X;  1GFM A;  1UX5 A;  3PGU A;  4YTP A;  2IC6 A;  2MOZ A;  5DQW A;  2A3D A;  4CXW A;  2BDE A;  2UXX B;  5LB7 B;  4ASK A;  2NWB A;  2ES0 A;  3VR9 A;  5A1L A;  1G73 A;  4TWD A;  5JVD E;  5JTG A;  2JRK A;  3RI5 A;  4EZH A;  2XE2 A;  2HPL A;  5LBM A;  2A2F X;  5FKY A;  3RGL A;  2E8I A;  1W0A A;  3MJX A;  3EDV A;  3N9N A;  5J2T E;  4BA9 A;  3KV6 A;  2XG6 A;  1GFP A;  4ISS A;  4FSP A;  3BK9 A;  3UU8 A;  3TLS A;  1HX1 B;  2E5V A;  3UQ7 A;  1OWA A;  4H63 V;  2QVA A;  4RJW A;  3O1J A;  2M6B A;  4JI1 T;  4CXX A;  4DO0 A;  3I0Q A;  3QB5 K;  2HN2 A;  4U3C A;  2JQH A;  3TLW A;  3P7I A;  2MAW A;  3OYZ A;  2VL0 A;  2NW7 A;  3T1H T;  2P9B A;  3MKD A;  2X0L B;  2X9K A;  2WMN A;  5HEO A;  3CK6 A;  2VKH A;  3L8R A;  2LM2 A;  1XMQ T;  5H2F O;  4EGW A;  2MPK A;  1OPF A;  2UXB T;  2KZ7 A;  4AKR B;  5T5F A;  4QH4 A;  5CJ5 A;  1X79 A;  3N9P A;  1YKH B;  1L0V A;  1VOM A;  3GMI A;  3RLF F;  5LHH B;  1Y01 A;  2C5J A;  1HS7 A;  5HXE A;  4DBR A;  4GYR A;  1O3X A;  3VU7 H;  4C00 A;  2F1C X;  1OED E;  5DQV A;  2CHN A;  4DV6 T;  4K3B A;  1HNX T;  1G90 A;  4O49 A;  2BKO A;  2V7I A;  2V6Y A;  3U3I A;  2G0U A;  5IHY A;  4YTN A;  2R4L A;  4ZI2 C;  1HTJ F;  2JMH A;  2EHO B;  3RBH A;  2FGQ X;  2KWI B;  2XY8 B;  5H6Q B;  3UUN A;  4C4V A;  3B13 A;  3POU A;  3DP7 A;  4RLC A;  2YK0 A;  3LDQ B;  1YQ3 A;  2LSK A;  1P4T A;  2XE5 A;  3CQG B;  2ERV A;  3N9Q A;  4CN1 A;  3MA9 A;  1SE7 A;  2WU2 A;  3BQK A;  1IBL T;  1D0X A;  2DNX A;  3JCF A;  2ODJ A;  2BS3 A;  1QJ8 A;  3RRC A;  2FJD A;  4TV8 E;  3OKQ A;  2NR4 A;  3UPG A;  3C98 B;  1KK7 A;  1S5L O;  3V8U A;  4JUY A;  1UUS A;  5DL6 A;  3ABV A;  4X66 T;  4U72 A;  5IYZ E;  5L3C B;  2OLT A;  3AA7 B;  5C8Y E;  1XNR T;  3K8P C;  1T7S A;  1VCS A;  4UVC B;  4ZS2 A;  1FJG T;  2N2L A;  1D0Z A;  4IGU A;  1ZKE A;  1HXU A;  2R89 A;  5HXS A;  2ZFG A;  2JQQ A;  5AQF B;  1CUN A;  2D0U A;  2J62 A;  5HWX A;  4EZ4 A;  5LJM A;  3I0O A;  2NP9 A;  4YY3 T;  4IST A;  1LVF A;  1MMN A;  4TNW A;  5HEJ A;  3QB5 A;  5AQH B;  2XHE B;  2K9A A;  2X66 A;  4EXT A;  1E1H B;  1UK5 A;  3E22 E;  4DR7 T;  5GTI O;  2IWV A;  4X20 E;  4ILC A;  3EAB A;  1KFY A;  8PRN A;  5FY0 A;  3PU3 A;  5AQG B;  1I6Z A;  5DJQ C;  1Q9G A;  1HR0 T;  4E7S A;  4JI7 T;  5LXT E;  3T24 A;  4AKH A;  3P4W A;  3AE6 A;  5JRC B;  4DV0 T;  2A9U A;  2VK9 A;  5HXR A;  3IF8 B;  2GK9 A;  4CQI A;  4U31 A;  1YQ4 A;  4YTM A;  4UF0 B;  4IL9 A;  1IJ5 A;  3SFE A;  2XQY A;  5AQS B;  4KR8 A;  2FBW A;  3PUY F;  2Q9Q D;  3RKG A;  4UIG A;  4BJN A;  2VKD A;  3UT5 E;  3A2S X;  3CPZ A;  3PJA J;  5ABE A;  2K48 A;  5HEH A;  5JH7 E;  1HXX A;  5LMN T;  1PRN A;  2DWG A;  5JDH A;  3MZK B;  4EOZ B;  2Y6X A;  4DR6 T;  3ZC0 A;  2V7K A;  4KRA A;  4OHF A;  4X1Y E;  3VZW X;  1NWM X;  2LOS A;  2R4O A;  3IHR A;  4GYS A;  4ZOL E;  3R84 B;  3AE4 A;  1QJP A;  4H9P C;  4UEM A;  5GTH O;  4LMK A;  1LVK A;  4IT4 A;  4LFA T;  1MPF A;  4ZI3 D;  2O4V A;  2KXP B;  2LLY A;  3CX7 B;  3VKH A;  2IWW A;  1VRB A;  3TLV A;  3ZJ2 A;  4TZ4 C;  4X1K E;  5DL8 A;  3KFW X;  4C90 A;  2BKN A;  4AYN A;  2WM9 A;  2H88 A;  4O4J E;  3PRN A;  2V1D B;  2KLQ A;  3BRZ A;  2DCF A;  4Z8X A;  4AFK A;  4UVA B;  5FXW A;  4IDN A;  3ZN0 B;  1HF8 A;  2L8K A;  2LHN A;  1WLX A;  4UV8 B;  5LNK A;  2F1T A;  4H9Q C;  2R4P A;  2CXL A;  4AIS A;  4FZL A;  4LF5 T;  1R8I A;  2X27 X;  4CI2 B;  2CWO A;  3JC6 D;  3LK2 B;  3NRY A;  4AQY T;  2CRB A;  3FZM B;  4N58 A;  5JRC A;  4A98 A;  4JI6 T;  1ZHY A;  3NWI A;  3A0B O;  3A7M A;  4CI3 B;  3PQU A;  2J47 A;  2WAU A;  5IWA T;  3LK3 A;  4MFR A;  2OMF A;  3KVD D;  4HE8 A;  1QSD A;  2KWH A;  4LF4 T;  4NUU A;  2BBJ A;  2FGR A;  2CMR A;  3EI0 A;  1WCR A;  2LSI A;  4PR7 A;  5HYA A;  2SPC A;  3KV9 A;  4UVB B;  2WDQ A;  4TUY E;  3AA6 A;  4DR5 T;  2CE7 A;  3IA3 A;  4TN7 B;  2D5U A;  4V1A v;  4FMS A;  2Q9Q B;  2JMM A;  5HEU A;  5GON E;  2XMX A;  4TX5 A;  2R6G F;  2W81 C;  3FXE B;  4G63 A;  5FVN A;  2DI4 A;  3RQW A;  3FXD B;  3FBZ A;  5JR9 A;  3AEB A;  1Z8U A;  3NBX X;  3PU8 A;  3O9X A;  2I0M A;  3OBV E;  5FP3 A;  5LGN B;  3ONX A;  3BRY A;  2DHR A;  4CN4 A;  3PUG A;  4D65 A;  3EHZ A;  5ABF A;  4ZS3 A;  3CIR A;  4PJL A;  1MIV A;  1M7K A;  5AQO B;  3TKL B;  4EAH A;  4F4B A;  5DL5 A;  4ILB A;  1YXR A;  2NTX A;  3AA7 A;  1J1J A;  2W67 A;  4FZM A;  4EYU A;  3C4W A;  4C91 A;  4PK6 A;  1XWM A;  4QXC B;  4ZEY A;  2WJR A;  2MBG A;  4DUZ T;  4ZI7 E;  1MNE A;  2NW8 A;  2FJE A;  5AQI B;  3AE5 A;  4AKR A;  4HFV A;  4LFC T;  5AQR B;  2Q9Q C;  3JAE A;  2WZH A;  2ZM0 A;  2W66 A;  4AZL A;  3TLT A;  2LKG A;  3ZSS A;  4QWN B;  2Y2X A;  3AB3 B;  3ZST A;  6PRN A;  2KT9 A;  4QXH B;  4O4H E;  3RH3 A;  4PJM A;  3S4U A;  4OYK A;  4XZC A;  4WBN E;  5JDL A;  5DL7 A;  3RPU A;  3RF1 A;  4IDO A;  2V6Y B;  3ONJ A;  1YS5 A;  3A0H O;  2JPF A;  4DBQ A;  3VR8 A;  4DR1 T;  3M65 A;  2H89 A;  4LSI A;  1MMA A;  5KXJ A;  3P4Q A;  2WWU A;  4U33 A;  3NZP A;  4PJ0 O;  3POX A;  2EHO A;  4HWH A;  4GK0 E;  2XAS B;  3JAD A;  2HPJ A;  4KHZ F;  3H3A A;  3G7G A;  3WI3 A;  3PUS A;  3JCU O;  3SY7 A;  1QLB A;  5JRE A;  5CA0 E;  3CWZ B;  3C51 A;  1DU2 A;  4F8H A;  4X5T A;  5D5D A;  3VY8 X;  3EDU A;  3SYB A;  3OTO T;  3ETU A;  2XSB A;  4IE0 A;  2ODV A;  1G8X A;  5E0O A;  2YDS A;  1HNZ T;  2D0T A;  3QUJ A;  4GCP A;  2XAF B;  3DA4 A;  2M67 A;  3RRW A;  2XM1 A;  1N34 T;  3FYX A;  3GA8 A;  5PRN A;  3X1D A;  5G3A A;  2XQ5 A;  4JI5 T;  3RYH E;  3BQI A;  4U2Y A;  5FYM A;  3CQC B;  4D64 A;  4AYD C;  4AKM A;  4IL6 O;  1Y64 B;  2MTQ A;  3A5X A;  1D1C A;  5FL1 A;  5G26 A;  3C4X A;  1E54 A;  3KDS E;  4CZZ B;  5AQP B;  4HKA A;  1MMD A;  4G76 A;  1XDP A;  4O3Z A;  2CLY C;  3OPC A;  4D5U A;  4PFP A;  1W09 A;  1D1B A;  3BS0 A;  2X68 A;  2QGS A;  2MYS A;  5AQT B;  2YN6 A;  3NVO A;  1HG5 A;  4P0A A;  2YNK A;  1I94 T;  2B76 A;  4C4V B;  4U2Z A;  5KX5 E;  3OYX A;  3UUM A;  1EZ3 A;  4AIU A;  2E9X A;  2HH7 A;  4IIJ E;  5J2U E;  3AE3 A;  2XTR A;  3AEE A;  3RQU A;  4HFE A;  2XAH B;  5CA1 E;  4DND A;  1T72 A;  3Q5X A;  3ZLI A;  2BKP A;  5BR8 T;  3SYS A;  2NW9 A;  2KND A;  2JQK A;  2BVM A;  5HEG A;  3N2G E;  3H3M A;  3P4S A;  2X0Y A;  2WBL A;  3KZI O;  4LF9 T;  2LFU A;  2X9H A;  2KSR A;  2Y0H A;  1BH3 A;  1ORM A;  1FEW A;  3AA1 A;  2N9D A;  1IBM T;  2M07 A;  3KBU A;  2MNH A;  3GWH A;  2AXD S;  1HX8 A;  1BR4 A;  3ZCJ A;  3HOE A;  1ZHC A;  2KZ7 B;  3ZMU B;  4CXY A;  3QRC A;  2VVS A;  3ONL C;  5F8P A;  3GN5 A;  3TLU A;  4QHO A;  3RYF E;  4B3R T;  3P4R A;  4QH5 A;  3CVR A;  2PBI A;  2LSJ A;  4NIQ A;  1S35 A;  4OYJ A;  4AQG A;  2XE3 A;  5L3F B;  2IIU A;  4HFH A;  5HAX A;  4XAX B;  3V5U A;  2QTK A;  3ZYM A;  5EK4 A;  1YD8 G;  3AEG A;  3AAI A;  1Z0P A;  4ZHQ E;  3PUZ F;  4JI4 T;  4KUM B;  1Q9F A;  2X51 A;  1MIW A;  4Z90 A;  2BZB A;  4WNK A;  4LF6 T;  4EEB A;  4LSH A;  1OXZ A;  1OED A;  3J9X 1;  2LSY A;  5ABG A;  2QA7 A;  4JI8 T;  2WWV A;  2WDV A;  3PUW F;  2PRN A;  3HI2 A;  3C5O A;  3VHL A;  3QOF A;  3UFG A;  2Y0L A;  2CWY A;  3AEC A;  2X9X A;  2J4G A;  4PUX A;  3VE2 A;  2YU1 A;  2RP4 A;  3CX8 B;  2QRX A;  2LJL A;  5AFU K;  3BQL A;  4MBQ A;  3B57 A;  4IDZ A;  2DLR A;  2M6I A;  1GFN A;  4PW8 A;  5HXC A;  3T1Y T;  5LBQ B;  1U5P A;  4LSF A;  3AA1 B;  3M3Z B;  4FQE A;  2LE8 A;  1ZHT A;  4DV2 T;  3HKB E;  3LBX A;  2LM9 A;  2WQY A;  3SOL A;  2X0H A;  1E2A A;  1FIO A;  3UUB A;  4GHB A;  3K3N A;  4AKL A;  2LRK A;  4LF8 T;  2JIW A;  4FI5 A;  4FZN A;  2LT3 A;  4YFS A;  3ZMS B;  3SRZ A;  1KF6 A;  1SHZ C;  4JI0 T;  2XZE A;  2RPA A;  3EVY A;  5AFU L;  2EHO C;  3ZC1 A;  2N2N A;  5CB4 E;  2Z6E A;  4RLB A;  2KIN B;  1WR0 A;  3MAC A;  2JQ9 A;  5LMU T;  4MLK A;  2LKH A;  4X65 T;  1J5W A;  2W4X A;  4UEL A;  3WI4 A;  4O2A E;  3O1I A;  4FOZ A;  4O3Y A;  2AXT O;  2CBI A;  1XZY A;  1SUM B;  1JNZ A;  4XBF B;  2K4T A;  4JI3 T;  4GKK T;  1T8B A;  1ZHZ A;  3HL6 A;  3SWH A;  3CKD A;  4WW0 A;  1UUR A;  2V26 A;  1ZHW A;  2I59 A;  2UXC T;  1MM4 A;  2E5L T;  3RYC E;  2EHO D;  4L9I A;  5BMV E;  4TWF A;  4DV7 T;  4HWC A;  2X67 A;  3MK7 C;  3HR0 A;  3ZMT B;  5L2L A;  4YLH A;  4HFD A;  4HGA A;  2NTY A;  2WB5 A;  2WSS V;  2UXD T;  3UQ4 A;  5LHG B;  3CQX C;  4BUM X;  4E1T A;  4N59 A;  5EE2 A;  4EIW A;  5TAO A;  1IBK T;  1GFO A;  2Q9Q A;  5JDQ A;  3KVB A;  1US7 B;  3ZKR A;  4P09 A;  2HHH T;  4A97 A;  4KP3 C;  5J1G A;  3NRX A;  5FY1 A;  3RHW A;  3ZYL A;  3P50 A;  5AQM B;  3MXZ A;  1KNP A;  2VUR A;  4DUY T;  3UFE A;  2VQE T;  1LKX A;  2WU5 A;  3AEA A;  3AAE A;  4DVD A;  4E7Z A;  5AQL B;  4IDP A;  5H6R B;  4PAG A;  4GKJ T;  3O0E A;  1D0Y A;  4PNI A;  3SZD A;  2PG8 A;  3DA3 A;  2VKO A;  3ANW A;  4ILA A;  5GV0 A;  3P8C D;  4I55 E;  4M1P A;  3H37 A;  4ZI2 D;  2WZI A;  3WAK A;  4EB6 E;  5B5E O;  4ERR A;  2D2S A;  4TNV A;  3HA4 A;  4QQ1 A;  3VY9 X;  4OK0 A;  3QK6 A;  3UU4 A;  4U9C A;  2E9X D;  4DMV A;  2J1N A;  2H3R A;  5CGM A;  1N33 T;  2MHL A; 
#chains in the Genus database with same CATH homology
 5L3C B;  4IHJ E;  1Y64 B;  2MTQ A;  3AA7 B;  5C8Y E;  3A5X A;  1D1C A;  3K8P C;  5G26 A;  3C4X A;  3GP6 A;  4UVC B;  4ZS2 A;  2N2L A;  4AQF C;  1AJ3 A;  1D0Z A;  2Y0K A;  1E54 A;  4IGU A;  4WBO A;  1ZKE A;  3KDS E;  4CZZ B;  1HXU A;  5HXS A;  5JR9 B;  3Q2M A;  3N9O A;  3K3O A;  2ZFG A;  4F6R C;  2JQQ A;  3ZEF B;  3NSG A;  4HKA A;  1MMD A;  1CUN A;  4G76 A;  4O3Z A;  2CLY C;  2D0U A;  3L09 A;  2BVL A;  4BAY B;  4D5U A;  5HWX A;  5L3G B;  1MND A;  2NOX A;  4PFP A;  4EZ4 A;  4O4L E;  5LJM A;  5M4Y A;  3C64 A;  3I0O A;  5KMG P;  3KIN B;  1D1B A;  2NP9 A;  1IZN B;  4IE4 A;  4IST A;  1LVF A;  4QKN A;  1ZEE A;  4C69 X;  2X68 A;  4YJ3 E;  2QGS A;  2MYS A;  5LA6 E;  3ZJ1 A;  1MMN A;  4AYD C;  2VL8 A;  5KDM C;  1HG5 A;  4P0A A;  1BXW A;  2YNK A;  2K5B B;  2XHE B;  2K9A A;  5KX5 E;  3OYX A;  2X66 A;  3FBL A;  3UUM A;  4EXT A;  1E1H B;  4G2A A;  4AYM C;  3J7Y q;  1EZ3 A;  3E22 E;  3F31 A;  1UCU A;  1HCI A;  5JR9 C;  1H6S 1;  2E9X A;  2HH7 A;  4JEH B;  1V9D A;  3C4Z A;  4IIJ E;  3DJB A;  5J2U E;  4X20 E;  3ZYK A;  4GF4 A;  4JCH A;  2ZM8 A;  4K0U A;  8PRN A;  3N9M A;  3UUL A;  2Y48 B;  3ANW B;  2UXN B;  5FY0 A;  3PU3 A;  2XTR A;  2E9X B;  4O3W A;  3QC9 A;  4QX8 B;  5DJQ C;  2XAH B;  1Q9G A;  5CA1 E;  2CM0 A;  4DND A;  3HKE E;  3Q5X A;  4E7S A;  3ZLI A;  5LXT E;  2V7M A;  3C50 A;  3UAQ A;  3T24 A;  4AKH A;  5LJN A;  1WRD A;  3HW9 A;  3SYS A;  3VY8 X;  2NW9 A;  2KND A;  4KR4 A;  5JRC B;  2W80 C;  5JDN A;  3QRA A;  2ZM2 A;  3E08 A;  2BVM A;  3N2G E;  3UUX B;  3HKD E;  3UTK A;  3SZV A;  2VK9 A;  4O8S A;  3N2K E;  2ZLD A;  2WBL A;  5HXR A;  2PFV A;  2GE4 A;  3IF8 B;  2WMO A;  3LG7 A;  2GK9 A;  4GIW A;  2YIN A;  4CQI A;  2X9H A;  2LFU A;  5EZY E;  2IC9 A;  1MMG A;  5JDP A;  2X9Y A;  4L0R A;  4UF0 B;  1HXT A;  2ODU A;  2KXP A;  2Y0H A;  4GCS A;  3RKO A;  3IEE A;  1IJ5 A;  2VWA A;  2XQY A;  5DAB A;  1BH3 A;  1ORM A;  1FEW A;  3KV4 A;  3AA1 A;  4KR8 A;  2N9D A;  3ZCI A;  2M07 A;  2Y7S A;  3KBU A;  2MNH A;  3GWH A;  2XE1 A;  2N1G A;  5L3D B;  3JTY A;  2Q9Q D;  4UIG A;  1HX8 A;  4BJN A;  2VKD A;  1BR4 A;  3ZCJ A;  2CEA A;  3HOE A;  3UT5 E;  1KNZ A;  4MHC A;  3A2S X;  3CPZ A;  1ZHC A;  5IYU A;  2KZ7 B;  3ZMU B;  4CXY A;  3QRC A;  3VKG A;  2K48 A;  3ZMZ B;  5JH7 E;  5F8P A;  1HXX A;  5FXX A;  1PRN A;  2DWG A;  1FMW A;  4P0B A;  4ILU A;  3O4X E;  5JDH A;  3GN5 A;  1BT9 A;  3Q9D A;  3R6N A;  4QHO A;  3RYF E;  5EK2 A;  5ADX L;  4H9N C;  3RC8 A;  3T8O A;  3CML A;  3MZK B;  3CVR A;  2PBI A;  2LSJ A;  4EOZ B;  2Y6X A;  3RYI E;  1S35 A;  4OYJ A;  3ZC0 A;  3I9W A;  5LHI B;  4O3X B;  4AYE C;  4E1S A;  4AQG A;  2XE3 A;  2V7K A;  3AVR A;  5L3F B;  3N2O A;  1ZV4 X;  5L3B B;  3FB2 A;  4OHF A;  1BR1 A;  4X1Y E;  4A56 A;  5HAX A;  4XAX B;  3V5U A;  1NWM X;  3ZYM A;  2QTK A;  4B6X A;  3VZW X;  5EK4 A;  2CA5 A;  1YD8 G;  2LOS A;  3AAI A;  1Z0P A;  3NZQ A;  4ZHQ E;  3WAJ A;  3K19 A;  3IHR A;  4GYS A;  4ZOL E;  4FJO A;  3R84 B;  4I50 E;  4FRX A;  4XNL A;  1PHO A;  1D1A A;  2L3L A;  1QJP A;  4JEU B;  4H9P C;  4UEM A;  4KUM B;  1Q9F A;  4J2C A;  2X51 A;  2W00 A;  1MIW A;  4KRA A;  3Q5W A;  1LVK A;  4FSO A;  1MPF A;  2CXF A;  3E0Z A;  4ZI3 D;  3POQ A;  2BZB A;  4WNK A;  1OSM A;  7PRN A;  2XAG B;  2Y8D A;  3PDY A;  2O4V A;  2M06 A;  2KXP B;  2L9Q A;  1THQ A;  4LSH A;  1OXZ A;  3CX7 B;  3VKH A;  4IE5 A;  3AA6 B;  5HXH A;  4JLE A;  4PJN A;  1IAP A;  3J9X 1;  2LSY A;  1VRB A;  3LFM A;  5FNV E;  5FXV A;  3ZJ2 A;  2DWK A;  2CLY B;  2QA7 A;  2J1D G;  4FES A;  4TZ4 C;  3PE0 A;  4X1K E;  3RX6 A;  2PRN A;  5DL8 A;  3KFW X;  4C90 A;  3OJA A;  3VE1 A;  3HI2 A;  2WM9 A;  4AYN A;  4Z3T A;  3C5O A;  3VHL A;  2POR A;  3W15 B;  4O4J E;  4AUI A;  2IAK A;  3ETV A;  2V1D B;  4IE6 A;  3PRN A;  2KLQ A;  2Y0L A;  4I4T E;  2CWY A;  2DCF A;  4ANJ A;  4Z8X A;  3UU2 A;  4ZI3 C;  4AFK A;  3HKC E;  1YKE B;  4UVA B;  2X9X A;  5FXW A;  3ZN0 B;  4PUX A;  4RL9 A;  2YU1 A;  3VE2 A;  1MIY A;  3F2E A;  1HF8 A;  2L8K A;  5FY7 A;  2LHN A;  3GN5 B;  2RP4 A;  3PQS A;  1WLX A;  3CX6 B;  3CX8 B;  4H63 H;  2IW5 B;  3ZN1 B;  2C5I T;  3LBX B;  4UV8 B;  3SS1 A;  5LNK A;  2LJL A;  3VZU X;  1LRZ A;  2F1T A;  4H9Q C;  5AFU K;  2CXL A;  4FZL A;  3BQL A;  3EMN X;  4X1I E;  2X27 X;  4MBQ A;  5FMN A;  4CI2 B;  3AAA B;  3D0T A;  2CWO A;  3B57 A;  3JC6 D;  2DLR A;  3LK2 B;  4IDZ A;  1GFN A;  3NRY A;  4PW8 A;  5HXC A;  4GOU A;  5LBQ B;  4N58 A;  5JRC A;  1U5P A;  4UXN B;  4LSE A;  5ETW A;  4O2B E;  5JQG E;  4LSF A;  1ZHY A;  3PTR B;  4AYI D;  3LJC A;  3AA1 B;  4CI3 B;  3PQU A;  4UV9 B;  2OA5 A;  2LE8 A;  2WAU A;  3AVS A;  1ZHT A;  4BJM A;  2CCQ A;  3LK3 A;  2LEH A;  4MFR A;  2V7J A;  3HKB E;  2W0G A;  2JMK A;  1QJ9 A;  3LBX A;  2JJ9 A;  2LOP A;  2KC0 A;  4HN9 A;  3U78 A;  2OMF A;  3KVD D;  4G75 A;  4HE8 A;  3N9L A;  3T0S A;  3KBT A;  1T98 A;  1QSD A;  2LM9 A;  4HEA A;  4IE7 A;  2KWH A;  3SOL A;  2YEV C;  3JC6 C;  4NUU A;  2FGR A;  2CMR A;  3TZG A;  4AXP A;  3LK3 B;  3PUR A;  4OFZ A;  5LG4 A;  4AI6 A;  2YU2 A;  4QXB B;  3F57 A;  4DMW A;  1FIO A;  2H7V C;  2H7O A;  4GHB A;  2LSI A;  3SY9 A;  4HTE A;  3K3N A;  5HYA A;  4AKL A;  3AAA A;  2SPC A;  4GK5 E;  3HWB A;  4YJ2 E;  3KV9 A;  4UVB B;  4AKG A;  3WI5 A;  2XUE A;  4GCQ A;  1GFQ A;  2KDY A;  4TUY E;  3PUQ A;  3AA6 A;  2CE7 A;  2V7L A;  4TN7 B;  2D5U A;  4V1A v;  4FI5 A;  2YPV A;  4FMS A;  2K0L A;  2Q9Q B;  4O4I E;  2W61 A;  4FUV A;  2C0S A;  5LCY A;  2JMM A;  4FZN A;  2LT3 A;  3IBP A;  5GON E;  4YFS A;  2XTL A;  3ZMS B;  3RC3 A;  4KMC A;  2ACX A;  2X9W A;  2XMX A;  2W62 A;  4TX5 A;  5LP6 E;  2ZMA A;  3SRZ A;  3AA0 A;  2W81 C;  3FXE B;  4G63 A;  1SHZ C;  4N78 D;  5FVN A;  2DI4 A;  3FHN A;  3FXD B;  2PJQ A;  3O1H A;  3FBZ A;  5JR9 A;  3LK4 1;  1WYB A;  3V5S A;  2E9X C;  4CI1 B;  2A72 A;  3EVY A;  5AFU L;  3NBX X;  2EHO C;  3ZC1 A;  2N2N A;  5CB4 E;  1U4Q A;  3VZT X;  3PU8 A;  1GFM A;  3O9X A;  1UX5 A;  4H9O C;  2K24 A;  3ZPO A;  2Z6E A;  1UX4 A;  4RLB A;  2IC6 A;  2MOZ A;  5DQW A;  2KIN B;  2A3D A;  3OBV E;  2BDE A;  5FP3 A;  4CXW A;  2UXX B;  3MAC A;  5LGN B;  4ASK A;  3ONX A;  2NWB A;  5EK3 A;  2ES0 A;  2XAQ B;  5A1L A;  1G73 A;  2DHR A;  3N5L A;  5JVD E;  4MLK A;  3AA0 B;  2XTQ A;  3LK4 2;  2JRK A;  4EZH A;  1WYC A;  5JDF A;  3PUG A;  4UEL A;  4D65 A;  3WI4 A;  4B61 A;  4ZS3 A;  2XE2 A;  4PJL A;  1MIV A;  2HPL A;  4O2A E;  5LBM A;  3ZMV B;  3O1I A;  3I9Y A;  4ADZ A;  4FOZ A;  2A2F X;  3TKL B;  4EAH A;  4O3Y A;  5DL5 A;  4F4B A;  2E8I A;  2NTX A;  3MJX A;  5LOV E;  2XAJ B;  3EDV A;  1YW0 A;  4I43 B;  3N9N A;  3AA7 A;  5J2T E;  4XBF B;  2K4T A;  3POR A;  5L3E B;  4BA9 A;  3KV6 A;  4FZM A;  2XG6 A;  1GFP A;  2CXD A;  4EYU A;  4ISS A;  5HWY A;  4AQF A;  3C4W A;  4L5G A;  4FSP A;  5ADX K;  4C91 A;  4PK6 A;  4PJJ A;  5LGU B;  1ZHZ A;  3BK9 A;  3HL6 A;  3SWH A;  3CKD A;  4WW0 A;  4FT6 A;  4QXC B;  2V26 A;  4PK5 A;  1ZHW A;  2I59 A;  1OWA A;  1ZHX A;  4H63 V;  2ZLY A;  2MBG A;  1HFA A;  4RJW A;  3O1J A;  4ZI7 E;  4CXX A;  1MNE A;  2NW8 A;  1MM4 A;  4DO0 A;  4JFB A;  3RYC E;  2EHO D;  3I0Q A;  2VKJ A;  4L9I A;  5BMV E;  4AKR A;  1SA0 E;  4HFV A;  1BR0 A;  4QX7 B;  3HOL A;  2X67 A;  3MK7 C;  2Q9Q C;  3HR0 A;  4H9R C;  3ZMT B;  2KMF A;  3P7I A;  5L2L A;  2ZM0 A;  2LHR A;  4YLH A;  4AZL A;  4HGA A;  5JDM A;  2NTY A;  4MAL A;  4TV9 E;  3OYZ A;  2WSS V;  4QWN B;  2Y2X A;  3AB3 B;  2NW7 A;  6PRN A;  2KT9 A;  4QXH B;  4NUV A;  1IJ6 A;  4O4H E;  3RH3 A;  2P9B A;  4RJX A;  4FRT A;  4PJM A;  3MKD A;  3S4U A;  2X0L B;  4OYK A;  4XZC A;  2WMN A;  5LHG B;  3CQX C;  4WBN E;  4BUM X;  4N59 A;  2VKH A;  3AAE B;  5EE2 A;  4E1T A;  4AKI A;  4EIW A;  5JDL A;  5DL7 A;  5TAO A;  4EYY R;  1OPF A;  1GFO A;  3RPU A;  2Q9Q A;  2KZ7 A;  3I1A A;  4AKR B;  5JDQ A;  4PFO A;  1YS5 A;  3K3Q C;  5T5F A;  4H9S E;  3KVB A;  1US7 B;  2F1V A;  2JPF A;  2RA1 A;  3PUA A;  1X79 A;  4P09 A;  5FXZ A;  4DBQ A;  1NAF A;  3M65 A;  3N9P A;  1YKH B;  4U74 A;  1VOM A;  3GMI A;  4LSI A;  5LHH B;  1MMA A;  2B1E A;  2C5J A;  1HS7 A;  5HXE A;  4KP3 C;  5J1G A;  3KVA A;  3NRX A;  5FY1 A;  4DBR A;  3KV5 A;  2WWU A;  4GYR A;  3ZYL A;  1O3X A;  5F3J A;  3VU7 H;  3NZP A;  5DQV A;  2C5K T;  1G90 A;  3POX A;  4UF0 A;  2EHO A;  3MXZ A;  4O49 A;  4GK0 E;  2V7I A;  2XAS B;  2HPJ A;  4XNK A;  3H3A A;  3U3I A;  2G0U A;  5IHY A;  1FMV A;  2VB6 A;  3G7G A;  3EUH A;  3PUS A;  3WI3 A;  3UFE A;  4ZI2 C;  1LKX A;  1HTJ F;  1QUU A;  5JRE A;  3SY7 A;  2JMH A;  2EHO B;  1B7T A;  1H7C A;  5CA0 E;  5LYJ E;  3CWZ B;  3RBH A;  3C51 A;  2FGQ X;  3AAE A;  4DVD A;  4E7Z A;  1WR6 A;  1BR2 A;  2KWI B;  5H6Q B;  3UUN A;  5D5D A;  3B13 A;  2N2M A;  3POU A;  3DP7 A;  4RLC A;  1MM5 A;  2YK0 A;  5H6R B;  3EDU A;  4O4U A;  1S94 A;  2LSK A;  4PAG A;  1P4T A;  3SYB A;  3ETU A;  4IE0 A;  3O0E A;  2XE5 A;  2ODV A;  3CQG B;  2ERV A;  1D0Y A;  3N9Q A;  4PNI A;  3LK2 A;  3SZD A;  2LHF A;  1G8X A;  2LSG A;  2PG8 A;  3MA9 A;  2VAS A;  3DA3 A;  2VKO A;  3BQK A;  5E0O A;  5JDG A;  1HG2 A;  1IZN A;  3ANW A;  1D0X A;  5GV0 A;  2DNX A;  2D0T A;  3P8C D;  2ODJ A;  1QJ8 A;  3QUJ A;  3RRC A;  4GCP A;  4O4X A;  3T20 A;  4TV8 E;  3OKQ A;  4I55 E;  4M1P A;  2XAF B;  3UPG A;  3ESL A;  3H37 A;  3L3P A;  2M67 A;  3WAK A;  4EB6 E;  4ZI2 D;  3RRW A;  3DA4 A;  3C98 B;  4ERR A;  1KK7 A;  2D2S A;  4QQ1 A;  3HA4 A;  3VY9 X;  3FYX A;  3GA8 A;  5PRN A;  5LGT B;  4OK0 A;  3QK6 A;  4JUY A;  3V8U A;  4YHJ A;  5DL6 A;  3RYH E;  3BQI A;  4U9C A;  2E9X D;  2J4U P;  4DMV A;  2W63 A;  4PK4 A;  2J1N A;  4KBM B;  5FYM A;  2H3R A;  3CQC B;  4U72 A;  2MHL A;  4D64 A;  3DTO A;  5IYZ E;  4AKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...