2KZ7B

Solution structure of the carmil cah3a/b domain bound to capping protein (cp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
b'SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords F-actin-capping protein subunit alpha-1
molecule tags Protein binding
source organism Gallus gallus
publication title Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP)
rcsb
total genus 80
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kz7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kz7B02
3LK42 3AA7A 2KXPB 3LK41 5ADXK 3AAAB 1IZNB 2KXPA 3AAEB 3AA0B 4AKRA 5AFUK 1IZNA 3AA0A 3AA6A 2KZ7B 4AKRB 3LK2A 3AA1B 3AAEA 3LK3A 3AA6B 3AA1A 3AA7B 3LK2B 2KZ7A 5ADXL 5AFUL 3AAAA 3LK3B
chains in the Genus database with same CATH superfamily
3VKGA 2WWVA 4ZI7E 1XMOT 4JI7T 4CI2B 4Z3TA 3WI4A 1FJGT 1HXXA 3AVSA 4PK6A 2DI4A 3EABA 5G26A 5AQLB 4KI0F 2Y2XA 4PFPA 4U74A 4X1YE 3RLFF 2MYSA 4NUVA 4IDPA 5A1LA 2BVLA 2KC0A 2YDRA 2XAGB 2V7IA 1KNRA 2JQHA 5LXTE 5JVDE 3O9XA 2ODVA 3UU4A 4ZI3D 3C50A 2CLYC 2LFUA 4RLBA 5HEGA 3TLUA 4C4VA 3A7MA 2A3DA 4HFIA 3CIRA 3JCUO 3KV9A 3PUGA 2KZ7A 2WCAA 1ZHCA 5FXZA 5D5DA 5JDFA 2N9DA 4JFBA 4O4LE 2IW5B 2W2UA 3ZCIA 3KV6A 2L3LA 2MOZA 1Q9FA 5LB7B 4FZNA 3AA0A 4CXXA 1FMWA 2YPVA 3T24A 3AE6A 4DUYT 3A2SX 4D5UA 4OHFA 1WYBA 3Q5WA 2W63A 5TAOA 4C69X 3N2OA 3FXDB 1XDOA 2W00A 2K0LA 4JBWF 5AQFB 3AAIA 2YDSA 3ZYLA 4EYYR 3U78A 2UUAT 3FXEB 4GYSA 1HXTA 4ZHQE 5AQQB 3KFWX 4D64A 4O4UA 3ZN1B 5DL6A 2PRNA 2C5JA 1DU2A 3AB3B 3RIAA 5LA6E 3ZSSA 2XQ7A 4DR6T 3ZMVB 2CBJA 5HXEA 5GTIO 2BVMA 3UUBA 2KINB 5HEJA 5C3JA 1HG5A 4U72A 4A97A 5BMVE 3AA6A 4I0UA 1HX8A 2UU9T 1E54A 5J1GA 3RYCE 5E79O 3AE5A 1M62A 2DWKA 3UU2A 2E9XD 3HKDE 3Q9DA 3NKZA 5JTGA 4HWIB 1VOMA 2VURA 4O2BE 1VCSA 3P50A 2RPAA 4UEMA 3KBUA 4JV5T 4AKLA 4X65T 3QRCA 3VZWX 1KF6A 4PUXA 4TUYE 1VCTA 1QLBA 3FZMB 4IIJE 2IC6A 4V1Av 3KVAA 2FJEA 2V8SV 4OFZA 5KAIO 3A5XA 5BR8T 3CKDA 1OPFA 2JMMA 2X9KA 2V5CA 4ILAA 3PDYA 5AQUB 4DV2T 2R89A 4UF0B 1L0VA 4H63H 3BQKA 3J7Yq 2Q9QA 3OBVE 4ZXLA 5F3JA 2K3WA 2B1EA 1BR1A 1HF8A 2BKOA 4O4IE 4KHPT 5B66O 3T1YT 1BR0A 1OXZA 1HX1B 1T7SA 3VRBA 3AA1A 4CI1B 3F57A 3LK2B 3FBLA 2XZEA 1OEDB 4EEDA 1MIVA 2VKHA 3I9YA 2HHHT 2VKDA 5JRCA 3AVRA 3CWZB 1GFOA 5LMUT 4ADZA 2IWVA 2QGSA 5LGTB 4FMSA 4KR4A 1D0YA 4FSPA 4HWDA 1ZKEA 2WZIA 3CPZA 4QX8B 3GWHA 4O2AE 4TWFA 4FESA 2XHEB 3QK6A 1N36T 2IHR1 3N9QA 4LF6T 5LCYA 3RHWA 3LK3B 4UVBB 4JI2T 4U2YA 4H9OC 1IBLT 2FGRA 3MKDA 2DHRA 4BA9A 2HN1A 3NRXA 1WR0A 1WRDA 4LF5T 4D65A 2CPTA 2KMFA 5LNKA 4XNKA 1LKXA 2VKOA 4O4HE 3UQ7A 4UR9A 4LFAT 3RC3A 2N2LA 1CUNA 3L8RA 2XE1A 4GYRA 2C5KT 5EK3A 4QKNA 1KFYA 1HNXT 1D1AA 3K3NA 1M7KA 3PGUA 2KDYA 1HS7A 4DBRA 4QXBB 4I55E 4O49A 3C64A 4ILUA 5L4HA 4UELA 2XQ9A 5C8YE 5FNVE 2R4PA 2LT3A 5L3GB 1D1BA 2EHOD 3ZLIA 3NWIA 3L3PA 2Q9QD 2Y48B 3E08A 3FYXA 3RIUC 2WDVA 2BBJA 2BKNA 4GHBA 2RA1A 2WSSV 4M1PA 3PUQA 2X9WA 3UU8A 4EXTA 2WU2A 3Q5EA 4FSOA 2ZLYA 5H6QB 4WBNE 2N1GA 2IIUA 1Z8UA 3AXJA 3LDQB 4F8HA 3ZC1A 2WAUA 2JJ9A 4EGWA 3VY8X 3AAAB 3ONLC 5AQHB 2X0YA 3QC9A 1X79A 3C98B 3VKHA 2K24A 4DV4T 4LF7T 2XASB 3WAKA 4PW8A 4HWHA 2KWIB 1IJ5A 4A98A 2X0HA 4UVCB 3ZSTA 2JQKA 4B6XA 4QX7B 5FYMA 1N33T 2ZM8A 3RIUA 2ACZA 3UULA 4RJXA 3NZQA 1IJ6A 3N9MA 5ABFB 4QWNB 1QUUA 4RL9A 3WI3A 3VE1A 4FQEA 2EHOB 2VB6A 4YJ3E 2ACXA 2V6YA 5IUXA 5FY0A 1ORMA 4RJWA 3HW9A 4MALA 3S4UA 5LYJE 2D0UA 3QOFA 1J1JA 2LJLA 2YU2A 1KNPA 4ILCA 3TLTA 4TWDA 2H7VC 3N2KE 1BH3A 4DUZT 3SZVA 4O8SA 2UXCT 4U31A 2E2AA 1IBMT 4UIGA 2IAKA 2NTXA 4TV8E 2WJRA 2AXDS 3F2EA 4JI8T 4O4JE 4UVAB 3VE2A 3WU2O 4E7ZA 4TN7B 1YKHB 3FBZA 4C4VB 3C51A 3K3QC 2J47A 3WI5A 1J5WA 3Q5DA 2XQ8A 3VY9X 4OK0A 4AKIA 4IT4A 3K19A 3BRYA 1KEYA 1MMDA 4ZS3A 5HEOA 3LBXB 4DMWA 3PGRA 3ETUA 2IMLA 2WB5A 1I6ZA 4YHJA 4LF8T 3UFGA 5ADXK 4TNWA 3AAEB 2WP9A 5H6RB 2JMKA 4Z8XA 2V5DA 3NRYA 4A56A 4U7YA 2LKHA 4FZMA 5ABGA 3AA1B 4CN1A 5LGUB 2Y0KA 3AEAA 4ERRA 4ZZCA 4IREA 3HA4A 4IGUA 5FVNA 4JI0T 1OEDE 2KXPB 2H3RA 2EHOC 1US7B 2CRBA 3PUVF 4IHJE 4K0UA 1SHZC 5HWYA 3P4QA 5AQSB 2OA5A 3C4XA 3CVRA 3MZKB 5AQIB 5J0ZA 4DR7T 3ZC0A 1SE7A 3IEEA 4UV8B 2MNHA 3HKEE 3C5OA 2Y8DA 1ZEEA 4IE7A 1ZV4X 3EUHA 4AI6A 1YQ3A 2XQ4A 5L3DB 4KP3C 2L9QA 5ADXL 4GF4A 2V1DB 1Q9GA 3RBHA 4WNKA 4FOZA 3UUMA 3E22E 4DNDA 4JUYA 1R8IA 4QH4A 2C5IT 1T8BA 3H37A 4UXNB 2N2NA 2WDRA 4BUMX 2R4OA 1ZHWA 5FXXA 3DA3A 2NOXA 4L0RA 1XDPA 1MNEA 3RQWA 2R88A 2K9AA 3MA9A 2LSKA 4JEUB 4AIUA 3M3ZB 3AEEA 4YHHT 2CA5A 2UXDT 1WCRA 2ZM6T 4N74A 1WFDA 3L09A 4GCSA 3DTOA 5EZYE 2FJDA 1FIOA 2ZMAA 4OYKA 3P4RA 4N58A 2BG9C 3O0EA 2RP4A 4PJJA 2XE3A 4DO0A 4YTNA 2KT9A 4WBOA 2X0LB 3RIFA 2XQAA 3BK9A 3P4SA 4E7SA 4U9CA 2NR4A 4QXHB 3ZEFB 3RH3A 4YSXA 4UB6O 3AEGA 3R6NA 3LK41 4DBQA 4P09A 3PURA 2UUCT 2MHLA 4GIWA 4TZ4C 2J62A 2V7JA 2WY2A 4DR5T 2XE2A 3X1DA 2MPKA 3K8PC 2WBLA 4CI3B 3RQUA 3EMNX 3PUSA 4X1KE 4Z91A 1AJ3A 3CQGB 1THQA 3T8OA 2LSIA 4ISSA 5AQVB 3FZLB 2NW9A 2UUBT 2LSJA 3UFEA 4AYDC 2V6XA 3V5UA 1IBKT 1SA0E 2SPCA 2OLTA 4FI5A 2W4XA 3KV5A 4JYAT 2CEAA 3SY7A 2C0SA 5AQMB 2WDQA 2XQ3A 4HN9A 4MHCA 3DJBA 3WAJA 5EK2A 2XY8B 3GN5A 4LSEA 2XTRA 5F8PA 1MMAA 1KNZA 3BQIA 1N32T 1S35A 3G06A 5TISO 3Q2MA 2WJQA 3EDVA 4NXMT 4YJ2E 2JQ9A 5AQGB 5L3FB 1U4QA 5IHYA 1YD8G 3UTKA 3NZPA 3KDSE 4HGAA 5ETWA 5HXRA 2QRXA 1G8XA 3T1HT 2PBIA 1UGOA 2PJQA 4XNLA 2XUEA 2VQET 2W61A 3JC6D 2XQ5A 2CBIA 2R4LA 4EYUA 3AXJB 3DWNA 5DQVA 5AQPB 4ZOLE 2Z6EA 1X9BA 2CE7A 4LMJA 5LG4A 2BDEA 2LEHA 3UAQA 1WYCA 3PORA 2AE9A 4CN6A 4IL9A 2IUBA 3VR8A 4PJNA 4PAGA 3DWOX 3KVDD 4NPPA 2VVNA 3TLWA 4B3ST 4L5GA 3RGLA 2XSBA 3P7IA 2HH7A 2PG8A 2F1CX 4IE5A 4OYJA 3FZKB 3JC6C 4CTDA 4DVDA 4HFBA 4AQFA 1QJ9A 2VKJA 3O1HA 5KAFO 2CXDA 3VU7H 5T5FA 3B57A 2LM9A 2E9XB 3N9PA 2JQYA 1ZHYA 4JI3T 1OEDA 5DABA 3K3OA 1W0BA 4GKKT 3GA8A 3SOLA 3JADA 4E1SA 2ES0A 2WMNA 1Y64B 3A8YC 3RKGA 2X66A 4JLEA 2ZM2A 4H9RC 4XZCA 5EE2A 3C4ZA 4PK5A 2E5VA 3VR9A 4FRXA 2WWUA 4TNVA 5KMGP 2J1DG 2AXTO 4KUMB 2B76A 2ZM0A 3ZMUB 4LMLA 4AFKA 4I50E 1YW0A 2PFVA 2CXFA 2KXPA 4AKRA 4TWHA 3FHNA 5JR9C 4DR2T 4HFDA 3HI2A 4LMKA 2VVSA 3ZT5A 2CMRA 2VK9A 3UU5A 3OKQA 5JDPA 3ZCJA 1O3XA 2KLQA 3PTRB 3PQUA 4YSYA 1E7PA 2CHOA 2DCFA 1IZNB 4AYMC 3SYBA 4B61A 4AXPA 4DR1T 3N2GE 3B13A 5JDQA 5L3BB 1KK7A 4LSFA 3RI5A 1H7CA 2XG6A 5FY7A 2XM2A 4GCPA 4IE4A 3PU3A 3PE0A 4AZLA 5HXCA 3OTOT 1XWMA 5E0OA 2A2FX 2PTFA 2D2SA 1MMNA 1UCUA 2E9XA 1PHOA 2CM0A 4DR4T 4O3YA 5DL5A 5GV0A 1FEWA 3OJAA 4YLHA 4MLKA 2K48A 2XMXA 2WMOA 3D0TA 5DJQC 1YKEB 4YSZA 4P0BA 4JI5T 2BG9B 2KNDA 1BT9A 3LK42 3LG7A 4CQIA 4FJOA 1T16A 5B5EO 3JCFA 3DZMA 1FMVA 5ABHA 5JQGE 1BR2A 3ZJ1A 2J4UP 4N59A 4HFVA 4UV9B 5KXJA 4BJNA 2BKPA 1HNZT 2EHOA 4HE8A 5J2UE 3E0ZA 5LJMA 3PGSA 3PJAA 5HXHA 5C2TA 2L8KA 1VRBA 2F1VA 5AFUK 3ETVA 1E2AA 3PV0F 2IDOB 4JI4T 4PJLA 1I94T 2JIWA 4LF9T 3SRZA 3POQA 3AA7A 3HOLA 3TKLB 2E9XC 2M6BA 4NXNT 5JDGA 3AEDA 3PUXF 1MIWA 2LOSA 5CA1E 1YXRA 3O4XE 4IDZA 4X5TA 3ZYMA 2JPFA 3ONXA 1ZHTA 4EEBA 4B3MT 3AE3A 1HXUA 2LHFA 5DL7A 3RC8A 2Q9QB 5FXVA 3UQ4A 3SFEA 4WW0A 4QH5A 4Z90A 2Y0HA 4CZZB 4ZI3C 4X20E 2V7MA 1E1HB 4CN4A 4DV1T 3LBXA 1WLXA 4BJMA 2XM1A 5GTHO 4FT6A 5HCJA 2MAWA 4EIWA 3VRAA 2XSAA 2YOEA 5JREA 2ODJA 4AKMA 4U7IA 4JI6T 2BG9A 2WQYA 2FJBA 4ZI2D 2F4VT 2VL8A 5LHGB 1UURA 4PR7A 2XJ7A 4EAHA 3VZTX 4Q25A 2XPKA 4MFRA 1UX5A 2UXXB 3I9WA 5CFBA 4C90A 3OYXA 3SWHA 3P4WA 3P4PA 2KSRA 4HWCA 1XMQT 4F6RC 1G73A 2BG9E 4FRTA 3BQLA 3ZPOA 5HEHA 4DMVA 5M4YA 3T0SA 3H3AA 2WZHA 4LSIA 4DV5T 4ZI2C 5FXWA 5AFUL 3HOEA 2X9XA 1UX4A 3POXA 4U2ZA 2YK0A 2YNKA 3ESLA 2V7LA 2XAFB 3QNUA 2W80C 5G3AA 1S94A 2H88A 1IZNA 4QH1A 4YT0A 1OWAA 3EVYA 2KWHA 3U3IA 4K3CA 3LJCA 2E5LT 1U5PA 5LBQB 3MXZA 1HFAA 2DWGA 3NBXX 4G76A 4X1IE 3BS0A 4QHOA 1Y01A 2UXBT 3SYSA 1LVKA 4I4TE 1ZOYA 4YY3T 3QB5K 3IBPA 3PUAA 2I0MA 1NEKA 3PF1A 3B5MA 3HKBE 4KBMB 2E8IA 5FL0A 5FKYA 4XAXB 4IDQA 5DL8A 5HXSA 2J1NA 3O1IA 1XZYA 2WS3A 4EZHA 5HYAA 3EAMA 3LK2A 5FP3A 2W0GA 4DR3T 2W81C 3ABVA 5LOVE 4AYNA 2I6HA 4PJMA 5LHIB 4I43B 2V7KA 2XAQB 3JTYA 5KDMC 3NVOA 3AA0B 4GK5E 4WYVA 2R4NA 4HWFA 3KVBA 3GMIA 1BXWA 3PRNA 2H89A 1H6S1 2R8AA 2Y6XA 4O3WA 2YDQA 3HR0A 4HFEA 5LHHB 3OPCA 4ZS2A 3N9OA 3IF8B 3ZMTB 3RYHE 4CXWA 3CQXC 3PU8A 1D0XA 4P0AA 4AKRB 4X64T 3UU3A 1G90A 3RYIE 4GCQA 3ONJA 2CHNA 3CX8B 5CGMA 3AE7A 5H2FO 3ZMZB 4IL4A 5J2TE 2X9YA 3AE2A 4JEHB 3VHLA 3KZIO 3AEFA 5FL1A 4ISTA 3AAEA 5ABEA 1WR6A 2WU5A 2PORA 3W15B 5F5WA 4AYEC 3SS1A 4IDOA 2OV9A 2XQYA 1ZP0A 5LJNA 3PUWF 2LLYA 5JDLA 3ANWA 3PJAJ 4DV6T 2XTLA 2VWAA 4H9QC 2HPLA 3I0OA 1N34T 2CWYA 3HL6A 4AYID 2CXLA 3G7GA 3J9X1 3TLVA 2D0TA 5L47A 5HWXA 4IE0A 2D9DA 4LFBT 4NUUA 4OX9T 2WM9A 2X51A 4UF0A 3TZGA 2M6IA 3RKOA 5LBMA 3SZDA 5HEUA 2LHRA 5FVLA 3ANWB 1MIYA 2LSYA 3ZN0B 4HFHA 2W66A 1XNRT 4YTPA 1GFQA 2JRKA 4X62T 4KX6A 2VASA 3UT5E 3RF1A 4ASKA 2VL0A 2FBWA 2JQQA 4RLCA 2LHNA 5JH7E 1LVFA 2JMHA 4PJ0O 5JDNA 2LOPA 4C91A 4AQGA 3MACA 2A72A 3N5LA 2YN6A 2ZLDA 2ODUA 3KBTA 4E1TA 2A9UA 1W09A 2MBGA 4KMCA 2QTKA 1MM4A 3RYFE 4TX5A 3PQSA 2W62A 1HTJF 2NP9A 5LG3A 4C00A 2YKSA 4JI1T 3AE9A 4COFA 1PRNA 4B3RT 3N9NA 2BS3A 3VZUX 3OVUA 3CK6A 5JR9B 1T98A 3R84B 1NWMX 2DNXA 2LKGA 4MBQA 2X68A 4O3ZA 3UPGA 5L3CB 3CMLA 2H7OA 4B3TT 4PFOA 3POUA 4P1NA 3V5SA 1MMGA 3KINB 3DA4A 1J5ET 2DLRA 4N78D 2R6GF 3ZT7A 2D5UA 4X66T 2QYWA 2GE4A 2NW8A 2P9BA 4HFCA 4ZZBA 4ZEYA 2VQFT 4EOZB 4FUVA 1OEDC 8PRNA 2BZBA 3AE1A 4KRAA 2X67A 3RPUA 4AISA 2XAJB 2W67A 5IYZE 5LMNT 2XTQA 1S5LO 3FB2A 3OYZA 4GK0E 1T72A 5IYUA 4ANJA 5HAXA 1SUMB 5CJ5A 1GFMA 3QB5A 1GFPA 2Y7SA 3C4WA 4UB8O 3EHZA 5JRCB 5FY1A 1UUSA 4HTEA 4G75A 4K0KT 4HKAA 4LSHA 2IWWA 3H3MA 2ERVA 4PNIA 2V26A 2FJAA 2LM2A 4IE6A 1JNZA 2I59A 3N9LA 1ZHZA 1UK5A 4WZXA 3RRWA 2NTYA 4AUIA 4A5XA 5LP6E 3NSGA 4NIQA 5CB4E 2FUPA 1MNDA 1QSDA 3I1AA 5L2LA 1LRZA 5AQJB 3DP7A 4EB6E 4K3BA 5JR9A 1YS5A 5JDHA 2HN2A 5ABFA 4U33A 3UU6A 1QJ8A 3FZHB 3AEBA 5PRNA 5DQWA 5GONE 2G0UA 4HEAA 4AKHA 1Z0PA 2M67A 5FVKA 3V8UA 2LSGA 4DIDB 4FZLA 4H9SE 4DV0T 2CCQA 5FMNA 3MJXA 3ZKRA 3CQCB 5KX5E 1QJPA 4O4XA 4TV9E 3AA7B 4CXYA 3JAFA 3MK7C 2Q9QC 2UXNB 1JNRA 4L9IA 2XAHB 5LGNB 1GFNA 4AQYT 3A0HO 3RX6A 2OMFA 3LK3A 3IHRA 1D1CA 3RRCA 4IL6O 3ZJ2A 2N2MA 1OSMA 3CX7B 3M65A 3FZFB 2Y0LA 2CLYB 2M07A 3F31A 4DV7T 3SY9A 4H9NC 3LSVA 2NWBA 2LE8A 3A0BO 3UUNA 3SFDA 4LFCT 1GQEA 2XQ6A 1XNQT 3AA6B 1CHUA 1B7TA 4PK4A 2FGQX 5L4EA 4QQ1A 2J4GA 3AECA 3PUYF 1HCIA 5AQTB 3BRZA 3K1SA 1NENA 2YU1A 4H9PC 4EV6A 2M06A 2QVAA 3ZMSB 3UUXB 3AE4A 3TLSA 1W0AA 4YFSA 3O1JA 5AQOB 1BR4A 1HG2A 3L39A 2GK9A 3ZT6A 3ZYKA 4G2AA 5AQNB 4AKGA 2K4TA 3QUJA 4JCHA 1EZ3A 3T20A 2X9HA 2LRLA 3HKCE 5AQKB 7PRNA 4H63V 2K5BB 2O4VA 2QA7A 1NAFA 4U3CA 5JDMA 2NW7A 4AQFC 1HNWT 2BBHA 4F4BA 1IAPA 4GKJT 1T1LA 2V6YB 4XBFB 5G39A 2F1TA 2XE5A 2BS2A 4O3XB 2KZ7B 5G38A 3Q5XA 2MTQA 4J2CA 3P8CD 5L3EB 5EK4A 3AAAA 2X27X 1MM5A 4KR8A 6PRNA 4N75A 1MPFA 2ZFGA 3IA3A 3GP6A 4YTMA 4EZ4A 3HWBA 3KV4A 4LF4T 2YINA 5AQRB 3NJTA 4GOUA 2CWOA 5CA0E 4IDNA 2BS4A 4G63A 4YXDA 3QRAA 3EI0A 4QXCB 4BAYB 3CX6B 3I0QA 2YEVC 2DL1A 1HR0T 1YQ4A 5IWAT 4DV3T 2HPJA 1ZHXA 1V9DA 1W9RA 1P4TA 5HCMA 3LFMA 4ILBA 1D0ZA 4KHZF 2LRKA 3JAEA 2WVPA 3GN5B 3EDUA 2IC9A 3PUZF 3AE8A
chains in the Genus database with same CATH topology
2ACXA 3VKGA 5LJNA 5FY0A 1ORMA 4RJWA 4ZI7E 3SOLA 3HW9A 4MALA 3S4UA 5LYJE 4CI2B 5JDLA 4Z3TA 3ANWA 2ES0A 4E1SA 3WI4A 2WMNA 2D0UA 1HXXA 1Y64B 2LJLA 2VWAA 2XTLA 2HPLA 2X66A 3AVSA 3I0OA 2ZM2A 2CWYA 2YU2A 3HL6A 4JLEA 4H9RC 4AYID 2CXLA 4PK6A 4XZCA 5EE2A 2DI4A 3C4ZA 3G7GA 3J9X1 4RLCA 5G26A 4PK5A 2Y2XA 2D0TA 4FRXA 4PFPA 4U74A 4X1YE 2WWUA 5HWXA 2H7VC 5KMGP 2J1DG 3N2KE 1BH3A 4IE0A 2MYSA 4KUMB 3SZVA 4NUVA 4O8SA 4NUUA 5A1LA 2ZM0A 2BVLA 2WM9A 3ZMUB 2KC0A 4UIGA 2IAKA 4I50E 4AFKA 2NTXA 2X51A 4TV8E 4UF0A 3RKOA 2XAGB 2V7IA 1YW0A 5LXTE 2PFVA 5JVDE 5LBMA 2ODVA 2CXFA 3O9XA 3SZDA 4ZI3D 2LHRA 3C50A 2CLYC 3F2EA 2KXPA 2LFUA 4RLBA 4AKRA 4O4JE 4UVAB 3VE2A 2A3DA 3ANWB 1MIYA 2LSYA 3ZN0B 4E7ZA 3FHNA 5JR9C 4TN7B 1YKHB 3KV9A 3HI2A 3PUGA 3FBZA 3C51A 2CMRA 2VK9A 3K3QC 3OKQA 1GFQA 2JRKA 3WI5A 5JDPA 3ZCJA 2KZ7A 1ZHCA 1O3XA 5FXZA 5D5DA 2KLQA 2VASA 3UT5E 3PTRB 3PQUA 4ASKA 3VY9X 4OK0A 2JQQA 5JDFA 2DCFA 4AKIA 2LHNA 1IZNB 2N9DA 1LVFA 4O4LE 5JH7E 4JFBA 4AYMC 3K19A 2JMHA 2IW5B 3SYBA 4B61A 4AXPA 5JDNA 2LOPA 3ZCIA 3KV6A 2L3LA 3N2GE 2MOZA 1Q9FA 3B13A 4C91A 5JDQA 5L3BB 4FZNA 1MMDA 1KK7A 4ZS3A 3MACA 2A72A 4AQGA 3LBXB 3N5LA 3AA0A 4LSFA 2ZLDA 4DMWA 1H7CA 2ODUA 4CXXA 2XG6A 1FMWA 3KBTA 4E1TA 5FY7A 3ETUA 2YPVA 3T24A 2MBGA 4GCPA 4KMCA 4IE4A 3PU3A 2QTKA 3PE0A 4AZLA 3A2SX 1MM4A 3RYFE 4OHFA 4TX5A 3PQSA 4D5UA 1WYBA 5HXCA 2W62A 4YHJA 5E0OA 1HTJF 2A2FX 2NP9A 3POXA 3Q5WA 2W63A 2D2SA 1MMNA 1UCUA 5TAOA 2E9XA 5ADXK 1PHOA 1PRNA 2CM0A 4C69X 3N2OA 3N9NA 3FXDB 4O3YA 3AAEB 3VZUX 5H6RB 5DL5A 2W00A 5GV0A 5JR9B 2JMKA 1FEWA 3OJAA 4Z8XA 3NRYA 4YLHA 4A56A 1T98A 3R84B 4FZMA 2K0LA 4MLKA 2K48A 3AA1B 1NWMX 2XMXA 3AAIA 5LGUB 2WMOA 2Y0KA 3D0TA 5DJQC 3ZYLA 2DNXA 4MBQA 4EYYR 3U78A 1YKEB 2X68A 4O3ZA 3UPGA 4ERRA 5L3CB 3CMLA 3FXEB 3HA4A 4IGUA 4P0BA 2H7OA 5FVNA 2KNDA 1BT9A 3LK42 3LG7A 2KXPB 4GYSA 4PFOA 4CQIA 2H3RA 4ZHQE 1HXTA 3POUA 4FJOA 2EHOC 1US7B 3KFWX 1MMGA 3V5SA 3KINB 3DA4A 4D64A 4O4UA 2DLRA 4IHJE 3ZN1B 5DL6A 2PRNA 1FMVA 4K0UA 4N78D 2C5JA 1SHZC 5HWYA 2D5UA 5JQGE 1BR2A 3ZJ1A 2J4UP 3AB3B 4N59A 2OA5A 3C4XA 3CVRA 4HFVA 5LA6E 4UV9B 3MZKB 4BJNA 3ZC0A 2GE4A 2NW8A 3IEEA 4UV8B 2P9BA 2MNHA 3HKEE 3ZMVB 3C5OA 2EHOA 2Y8DA 1ZEEA 4HE8A 4IE7A 4EOZB 4FUVA 5HXEA 5J2UE 8PRNA 2BZBA 3E0ZA 2BVMA 5LJMA 1ZV4X 5HXHA 3EUHA 4AI6A 2KINB 2L8KA 1VRBA 4KRAA 2X67A 3RPUA 2F1VA 5AFUK 1HG5A 2XAJB 3ETVA 4U72A 5BMVE 3AA6A 5IYZE 2XTQA 5L3DB 4KP3C 1HX8A 3FB2A 3OYZA 4PJLA 5J1GA 3RYCE 1E54A 4GK0E 2L9QA 5IYUA 5ADXL 4ANJA 5HAXA 2DWKA 4GF4A 2E9XD 3UU2A 3SRZA 3HKDE 3Q9DA 3POQA 2V1DB 1Q9GA 1GFMA 3AA7A 3HOLA 3TKLB 2E9XC 3RBHA 1GFPA 2Y7SA 3C4WA 5JDGA 4WNKA 4FOZA 1VOMA 3UUMA 1MIWA 2LOSA 3E22E 4O2BE 4DNDA 4JUYA 5CA1E 5JRCB 5FY1A 4UEMA 4HTEA 2C5IT 3KBUA 3O4XE 3H37A 4IDZA 4UXNB 2N2NA 4G75A 4AKLA 3QRCA 3ZYMA 2JPFA 3ONXA 1ZHTA 4BUMX 1ZHWA 5FXXA 3DA3A 4HKAA 4LSHA 2NOXA 2ERVA 4PNIA 4L0RA 1MNEA 2V26A 3VZWX 2K9AA 3MA9A 2LSKA 4JEUB 4PUXA 4IE6A 4TUYE 1HXUA 2LHFA 2I59A 3N9LA 5DL7A 2CA5A 2Q9QB 5FXVA 3RC8A 1ZHZA 4IIJE 3RRWA 2NTYA 2IC6A 4AUIA 4V1Av 3KVAA 4WW0A 5LP6E 3NSGA 5CB4E 2Y0HA 1MNDA 4CZZB 4ZI3C 1QSDA 3I1AA 4OFZA 4X20E 5L2LA 2V7MA 1LRZA 1E1HB 3A5XA 3DP7A 3CKDA 3L09A 1OPFA 2JMMA 2Y0LA 4GCSA 4EB6E 5JR9A 1YS5A 3PDYA 3DTOA 5JDHA 3LBXA 1WLXA 5EZYE 4BJMA 4O4XA 1FIOA 1QJ8A 2ZMAA 4UF0B 4FT6A 4OYKA 4N58A 5PRNA 5DQWA 5GONE 2G0UA 4EIWA 4HEAA 5JREA 4H63H 3O0EA 4AKHA 2ODJA 2RP4A 1Z0PA 3BQKA 4AKMA 3J7Yq 4PJJA 2M67A 2Q9QA 3OBVE 2XE3A 4DO0A 2KT9A 4WBOA 4ZI2D 2X0LB 5F3JA 2VL8A 2B1EA 3V8UA 1BR1A 5LHGB 1HF8A 2LSGA 4O4IE 1BR0A 4FZLA 4H9SE 1OXZA 2CCQA 3BK9A 4EAHA 4E7SA 5FMNA 3MJXA 4U9CA 3CQCB 5KX5E 1QJPA 3VZTX 3AA1A 4CI1B 4TV9E 3AA7B 4CXYA 3F57A 3LK2B 3FBLA 1UX5A 3MK7C 2UXXB 3I9WA 4MFRA 2Q9QC 4QXHB 3ZEFB 3RH3A 1MIVA 2UXNB 2VKHA 3I9YA 2VKDA 4L9IA 2XAHB 4C90A 3R6NA 5JRCA 3OYXA 3LK41 3SWHA 3AVRA 5LGNB 1GFNA 4DBQA 4P09A 3PURA 3CWZB 4F6RC 4GIWA 4TZ4C 2MHLA 1G73A 4H9QC 1GFOA 3RX6A 4FRTA 4ADZA 2V7JA 3BQLA 3ZPOA 2OMFA 2QGSA 4DMVA 5LGTB 5M4YA 4FMSA 4KR4A 1D0YA 3H3AA 2XE2A 3T0SA 4FSPA 3LK3A 3IHRA 1D1CA 3RRCA 4LSIA 1ZKEA 3CPZA 4QX8B 3ZJ2A 3K8PC 3GWHA 4O2AE 2WBLA 4CI3B 4ZI2C 2N2MA 3PUSA 1OSMA 3EMNX 2XHEB 3CX7B 3M65A 4X1KE 3QK6A 5FXWA 5AFUL 1AJ3A 2X9XA 1UX4A 3N9QA 3CQGB 2CLYB 5LCYA 3F31A 3LK3B 3T8OA 2LSIA 1THQA 4UVBB 2M07A 2YK0A 4ISSA 2YNKA 3ESLA 4H9OC 2NW9A 2FGRA 3SY9A 4H9NC 3MKDA 2LSJA 2V7LA 3UFEA 4AYDC 2NWBA 2DHRA 4YJ3E 4BA9A 3V5UA 3NRXA 2XAFB 1SA0E 2SPCA 1WRDA 2LE8A 2W80C 4FI5A 1S94A 3UUNA 3KV5A 4D65A 1IZNA 2KMFA 5LNKA 4XNKA 1OWAA 1LKXA 2VKOA 4O4HE 2CEAA 3SY7A 3EVYA 2KWHA 3U3IA 2N2LA 3AA6B 3RC3A 2C0SA 3LJCA 1B7TA 1U5PA 1CUNA 3HOEA 4HN9A 2XE1A 4PK4A 4GYRA 4MHCA 5LBQB 3MXZA 2FGQX 1HFAA 3DJBA 2DWGA 3NBXX 5EK2A 3WAJA 2C5KT 4QQ1A 5EK3A 4QKNA 4X1IE 4G76A 4QHOA 1HCIA 3SYSA 1D1AA 1LVKA 3GN5A 3K3NA 4LSEA 2YU1A 4H9PC 4I4TE 3TZGA 2KDYA 2M06A 1HS7A 4DBRA 2XTRA 4QXBB 4I55E 3IBPA 3PUAA 4O49A 3ZMSB 3C64A 5F8PA 3UUXB 4ILUA 1MMAA 1KNZA 3HKBE 4KBMB 4UELA 3BQIA 2E8IA 1S35A 4YFSA 3Q2MA 3O1JA 4XAXB 5C8YE 1BR4A 1HG2A 5DL8A 2GK9A 5FNVE 5HXSA 3ZYKA 2LT3A 3EDVA 4G2AA 2J1NA 3O1IA 4AKGA 2K4TA 4YJ2E 3QUJA 4JCHA 1EZ3A 4EZHA 5L3GB 1D1BA 5HYAA 2EHOD 5L3FB 3T20A 3ZLIA 3LK2A 2X9HA 1U4QA 3HKCE 5IHYA 1YD8G 3UTKA 7PRNA 3NZPA 4H63V 3KDSE 4HGAA 5ETWA 2K5BB 2W0GA 5FP3A 5HXRA 1G8XA 3L3PA 2W81C 2O4VA 2QA7A 2Q9QD 2Y48B 3E08A 3FYXA 5LOVE 1NAFA 4AYNA 5JDMA 2PBIA 2NW7A 4PJMA 5LHIB 2PJQA 4AQFC 4I43B 2V7KA 4F4BA 2XAQB 4GHBA 1IAPA 3JTYA 5KDMC 4XBFB 2F1TA 2XE5A 3AA0B 2RA1A 4XNLA 4GK5E 2WSSV 2XUEA 4M1PA 2W61A 3PUQA 2X9WA 3JC6D 4O3XB 4FESA 3KVBA 3GMIA 1BXWA 3PRNA 2KZ7B 4EXTA 4EYUA 3Q5XA 2MTQA 4FSOA 4J2CA 5DQVA 2ZLYA 3P8CD 1H6S1 5H6QB 2Y6XA 4WBNE 4ZOLE 2Z6EA 4O3WA 2N1GA 5L3EB 5EK4A 2CE7A 3HR0A 2X27X 3AAAA 5LHHB 4ZS2A 3N9OA 1MM5A 5LG4A 2BDEA 2LEHA 3IF8B 4KR8A 3UAQA 6PRNA 3ZC1A 1WYCA 2WAUA 2JJ9A 3ZMTB 3PORA 3RYHE 3VY8X 3AAAB 1MPFA 4CXWA 2ZFGA 3CQXC 3PU8A 4PJNA 4PAGA 1D0XA 3GP6A 4EZ4A 3HWBA 3KV4A 3KVDD 2YINA 3QC9A 4P0AA 1X79A 3C98B 4L5GA 4AKRB 3VKHA 2K24A 4GOUA 1G90A 2CWOA 3P7IA 2XASB 3WAKA 5CA0E 2HH7A 2PG8A 4G63A 4PW8A 3RYIE 4IE5A 2KWIB 4GCQA 1IJ5A 4OYJA 3CX8B 3JC6C 3QRAA 4DVDA 4QXCB 4BAYB 4UVCB 4AQFA 4B6XA 1QJ9A 4QX7B 3CX6B 5FYMA 2VKJA 3I0QA 2YEVC 3ZMZB 5J2TE 2X9YA 2ZM8A 3O1HA 2CXDA 4JEHB 2HPJA 3UULA 3VHLA 3VU7H 1V9DA 3B57A 1ZHXA 5T5FA 1P4TA 3NZQA 2LM9A 4RJXA 1IJ6A 2E9XB 3N9MA 3N9PA 4ISTA 1ZHYA 3LFMA 1D0ZA 4QWNB 1QUUA 3AAEA 1WR6A 3GN5B 3EDUA 3W15B 2PORA 4RL9A 2IC9A 3WI3A 5DABA 4AYEC 3VE1A 3K3OA 3SS1A 2EHOB 2VB6A 2XQYA 3GA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LK4 2;  3AA7 A;  2KXP B;  3LK4 1;  5ADX K;  3AAA B;  1IZN B;  2KXP A;  3AAE B;  3AA0 B;  4AKR A;  5AFU K;  1IZN A;  3AA0 A;  3AA6 A;  2KZ7 B;  4AKR B;  3LK2 A;  3AA1 B;  3AAE A;  3LK3 A;  3AA6 B;  3AA1 A;  3AA7 B;  3LK2 B;  2KZ7 A;  5ADX L;  5AFU L;  3AAA A;  3LK3 B; 
#chains in the Genus database with same CATH topology
 3VKG A;  2WWV A;  4ZI7 E;  1XMO T;  4JI7 T;  4CI2 B;  4Z3T A;  3WI4 A;  1FJG T;  1HXX A;  3AVS A;  4PK6 A;  2DI4 A;  3EAB A;  5G26 A;  5AQL B;  4KI0 F;  2Y2X A;  4PFP A;  4U74 A;  4X1Y E;  3RLF F;  2MYS A;  4NUV A;  4IDP A;  5A1L A;  2BVL A;  2KC0 A;  2YDR A;  2XAG B;  2V7I A;  1KNR A;  2JQH A;  5LXT E;  5JVD E;  3O9X A;  2ODV A;  3UU4 A;  4ZI3 D;  3C50 A;  2CLY C;  2LFU A;  4RLB A;  5HEG A;  3TLU A;  4C4V A;  3A7M A;  2A3D A;  4HFI A;  3CIR A;  3JCU O;  3KV9 A;  3PUG A;  2KZ7 A;  2WCA A;  1ZHC A;  5FXZ A;  5D5D A;  5JDF A;  2N9D A;  4JFB A;  4O4L E;  2IW5 B;  2W2U A;  3ZCI A;  3KV6 A;  2L3L A;  2MOZ A;  1Q9F A;  5LB7 B;  4FZN A;  3AA0 A;  4CXX A;  1FMW A;  2YPV A;  3T24 A;  3AE6 A;  4DUY T;  3A2S X;  4D5U A;  4OHF A;  1WYB A;  3Q5W A;  2W63 A;  5TAO A;  4C69 X;  3N2O A;  3FXD B;  1XDO A;  2W00 A;  2K0L A;  4JBW F;  5AQF B;  3AAI A;  2YDS A;  3ZYL A;  4EYY R;  3U78 A;  2UUA T;  3FXE B;  4GYS A;  1HXT A;  4ZHQ E;  5AQQ B;  3KFW X;  4D64 A;  4O4U A;  3ZN1 B;  5DL6 A;  2PRN A;  2C5J A;  1DU2 A;  3AB3 B;  3RIA A;  5LA6 E;  3ZSS A;  2XQ7 A;  4DR6 T;  3ZMV B;  2CBJ A;  5HXE A;  5GTI O;  2BVM A;  3UUB A;  2KIN B;  5HEJ A;  5C3J A;  1HG5 A;  4U72 A;  4A97 A;  5BMV E;  3AA6 A;  4I0U A;  1HX8 A;  2UU9 T;  1E54 A;  5J1G A;  3RYC E;  5E79 O;  3AE5 A;  1M62 A;  2DWK A;  3UU2 A;  2E9X D;  3HKD E;  3Q9D A;  3NKZ A;  5JTG A;  4HWI B;  1VOM A;  2VUR A;  4O2B E;  1VCS A;  3P50 A;  2RPA A;  4UEM A;  3KBU A;  4JV5 T;  4AKL A;  4X65 T;  3QRC A;  3VZW X;  1KF6 A;  4PUX A;  4TUY E;  1VCT A;  1QLB A;  3FZM B;  4IIJ E;  2IC6 A;  4V1A v;  3KVA A;  2FJE A;  2V8S V;  4OFZ A;  5KAI O;  3A5X A;  5BR8 T;  3CKD A;  1OPF A;  2JMM A;  2X9K A;  2V5C A;  4ILA A;  3PDY A;  5AQU B;  4DV2 T;  2R89 A;  4UF0 B;  1L0V A;  4H63 H;  3BQK A;  3J7Y q;  2Q9Q A;  3OBV E;  4ZXL A;  5F3J A;  2K3W A;  2B1E A;  1BR1 A;  1HF8 A;  2BKO A;  4O4I E;  4KHP T;  5B66 O;  3T1Y T;  1BR0 A;  1OXZ A;  1HX1 B;  1T7S A;  3VRB A;  3AA1 A;  4CI1 B;  3F57 A;  3LK2 B;  3FBL A;  2XZE A;  1OED B;  4EED A;  1MIV A;  2VKH A;  3I9Y A;  2HHH T;  2VKD A;  5JRC A;  3AVR A;  3CWZ B;  1GFO A;  5LMU T;  4ADZ A;  2IWV A;  2QGS A;  5LGT B;  4FMS A;  4KR4 A;  1D0Y A;  4FSP A;  4HWD A;  1ZKE A;  2WZI A;  3CPZ A;  4QX8 B;  3GWH A;  4O2A E;  4TWF A;  4FES A;  2XHE B;  3QK6 A;  1N36 T;  2IHR 1;  3N9Q A;  4LF6 T;  5LCY A;  3RHW A;  3LK3 B;  4UVB B;  4JI2 T;  4U2Y A;  4H9O C;  1IBL T;  2FGR A;  3MKD A;  2DHR A;  4BA9 A;  2HN1 A;  3NRX A;  1WR0 A;  1WRD A;  4LF5 T;  4D65 A;  2CPT A;  2KMF A;  5LNK A;  4XNK A;  1LKX A;  2VKO A;  4O4H E;  3UQ7 A;  4UR9 A;  4LFA T;  3RC3 A;  2N2L A;  1CUN A;  3L8R A;  2XE1 A;  4GYR A;  2C5K T;  5EK3 A;  4QKN A;  1KFY A;  1HNX T;  1D1A A;  3K3N A;  1M7K A;  3PGU A;  2KDY A;  1HS7 A;  4DBR A;  4QXB B;  4I55 E;  4O49 A;  3C64 A;  4ILU A;  5L4H A;  4UEL A;  2XQ9 A;  5C8Y E;  5FNV E;  2R4P A;  2LT3 A;  5L3G B;  1D1B A;  2EHO D;  3ZLI A;  3NWI A;  3L3P A;  2Q9Q D;  2Y48 B;  3E08 A;  3FYX A;  3RIU C;  2WDV A;  2BBJ A;  2BKN A;  4GHB A;  2RA1 A;  2WSS V;  4M1P A;  3PUQ A;  2X9W A;  3UU8 A;  4EXT A;  2WU2 A;  3Q5E A;  4FSO A;  2ZLY A;  5H6Q B;  4WBN E;  2N1G A;  2IIU A;  1Z8U A;  3AXJ A;  3LDQ B;  4F8H A;  3ZC1 A;  2WAU A;  2JJ9 A;  4EGW A;  3VY8 X;  3AAA B;  3ONL C;  5AQH B;  2X0Y A;  3QC9 A;  1X79 A;  3C98 B;  3VKH A;  2K24 A;  4DV4 T;  4LF7 T;  2XAS B;  3WAK A;  4PW8 A;  4HWH A;  2KWI B;  1IJ5 A;  4A98 A;  2X0H A;  4UVC B;  3ZST A;  2JQK A;  4B6X A;  4QX7 B;  5FYM A;  1N33 T;  2ZM8 A;  3RIU A;  2ACZ A;  3UUL A;  4RJX A;  3NZQ A;  1IJ6 A;  3N9M A;  5ABF B;  4QWN B;  1QUU A;  4RL9 A;  3WI3 A;  3VE1 A;  4FQE A;  2EHO B;  2VB6 A;  4YJ3 E;  2ACX A;  2V6Y A;  5IUX A;  5FY0 A;  1ORM A;  4RJW A;  3HW9 A;  4MAL A;  3S4U A;  5LYJ E;  2D0U A;  3QOF A;  1J1J A;  2LJL A;  2YU2 A;  1KNP A;  4ILC A;  3TLT A;  4TWD A;  2H7V C;  3N2K E;  1BH3 A;  4DUZ T;  3SZV A;  4O8S A;  2UXC T;  4U31 A;  2E2A A;  1IBM T;  4UIG A;  2IAK A;  2NTX A;  4TV8 E;  2WJR A;  2AXD S;  3F2E A;  4JI8 T;  4O4J E;  4UVA B;  3VE2 A;  3WU2 O;  4E7Z A;  4TN7 B;  1YKH B;  3FBZ A;  4C4V B;  3C51 A;  3K3Q C;  2J47 A;  3WI5 A;  1J5W A;  3Q5D A;  2XQ8 A;  3VY9 X;  4OK0 A;  4AKI A;  4IT4 A;  3K19 A;  3BRY A;  1KEY A;  1MMD A;  4ZS3 A;  5HEO A;  3LBX B;  4DMW A;  3PGR A;  3ETU A;  2IML A;  2WB5 A;  1I6Z A;  4YHJ A;  4LF8 T;  3UFG A;  5ADX K;  4TNW A;  3AAE B;  2WP9 A;  5H6R B;  2JMK A;  4Z8X A;  2V5D A;  3NRY A;  4A56 A;  4U7Y A;  2LKH A;  4FZM A;  5ABG A;  3AA1 B;  4CN1 A;  5LGU B;  2Y0K A;  3AEA A;  4ERR A;  4ZZC A;  4IRE A;  3HA4 A;  4IGU A;  5FVN A;  4JI0 T;  1OED E;  2KXP B;  2H3R A;  2EHO C;  1US7 B;  2CRB A;  3PUV F;  4IHJ E;  4K0U A;  1SHZ C;  5HWY A;  3P4Q A;  5AQS B;  2OA5 A;  3C4X A;  3CVR A;  3MZK B;  5AQI B;  5J0Z A;  4DR7 T;  3ZC0 A;  1SE7 A;  3IEE A;  4UV8 B;  2MNH A;  3HKE E;  3C5O A;  2Y8D A;  1ZEE A;  4IE7 A;  1ZV4 X;  3EUH A;  4AI6 A;  1YQ3 A;  2XQ4 A;  5L3D B;  4KP3 C;  2L9Q A;  5ADX L;  4GF4 A;  2V1D B;  1Q9G A;  3RBH A;  4WNK A;  4FOZ A;  3UUM A;  3E22 E;  4DND A;  4JUY A;  1R8I A;  4QH4 A;  2C5I T;  1T8B A;  3H37 A;  4UXN B;  2N2N A;  2WDR A;  4BUM X;  2R4O A;  1ZHW A;  5FXX A;  3DA3 A;  2NOX A;  4L0R A;  1XDP A;  1MNE A;  3RQW A;  2R88 A;  2K9A A;  3MA9 A;  2LSK A;  4JEU B;  4AIU A;  3M3Z B;  3AEE A;  4YHH T;  2CA5 A;  2UXD T;  1WCR A;  2ZM6 T;  4N74 A;  1WFD A;  3L09 A;  4GCS A;  3DTO A;  5EZY E;  2FJD A;  1FIO A;  2ZMA A;  4OYK A;  3P4R A;  4N58 A;  2BG9 C;  3O0E A;  2RP4 A;  4PJJ A;  2XE3 A;  4DO0 A;  4YTN A;  2KT9 A;  4WBO A;  2X0L B;  3RIF A;  2XQA A;  3BK9 A;  3P4S A;  4E7S A;  4U9C A;  2NR4 A;  4QXH B;  3ZEF B;  3RH3 A;  4YSX A;  4UB6 O;  3AEG A;  3R6N A;  3LK4 1;  4DBQ A;  4P09 A;  3PUR A;  2UUC T;  2MHL A;  4GIW A;  4TZ4 C;  2J62 A;  2V7J A;  2WY2 A;  4DR5 T;  2XE2 A;  3X1D A;  2MPK A;  3K8P C;  2WBL A;  4CI3 B;  3RQU A;  3EMN X;  3PUS A;  4X1K E;  4Z91 A;  1AJ3 A;  3CQG B;  1THQ A;  3T8O A;  2LSI A;  4ISS A;  5AQV B;  3FZL B;  2NW9 A;  2UUB T;  2LSJ A;  3UFE A;  4AYD C;  2V6X A;  3V5U A;  1IBK T;  1SA0 E;  2SPC A;  2OLT A;  4FI5 A;  2W4X A;  3KV5 A;  4JYA T;  2CEA A;  3SY7 A;  2C0S A;  5AQM B;  2WDQ A;  2XQ3 A;  4HN9 A;  4MHC A;  3DJB A;  3WAJ A;  5EK2 A;  2XY8 B;  3GN5 A;  4LSE A;  2XTR A;  5F8P A;  1MMA A;  1KNZ A;  3BQI A;  1N32 T;  1S35 A;  3G06 A;  5TIS O;  3Q2M A;  2WJQ A;  3EDV A;  4NXM T;  4YJ2 E;  2JQ9 A;  5AQG B;  5L3F B;  1U4Q A;  5IHY A;  1YD8 G;  3UTK A;  3NZP A;  3KDS E;  4HGA A;  5ETW A;  5HXR A;  2QRX A;  1G8X A;  3T1H T;  2PBI A;  1UGO A;  2PJQ A;  4XNL A;  2XUE A;  2VQE T;  2W61 A;  3JC6 D;  2XQ5 A;  2CBI A;  2R4L A;  4EYU A;  3AXJ B;  3DWN A;  5DQV A;  5AQP B;  4ZOL E;  2Z6E A;  1X9B A;  2CE7 A;  4LMJ A;  5LG4 A;  2BDE A;  2LEH A;  3UAQ A;  1WYC A;  3POR A;  2AE9 A;  4CN6 A;  4IL9 A;  2IUB A;  3VR8 A;  4PJN A;  4PAG A;  3DWO X;  3KVD D;  4NPP A;  2VVN A;  3TLW A;  4B3S T;  4L5G A;  3RGL A;  2XSB A;  3P7I A;  2HH7 A;  2PG8 A;  2F1C X;  4IE5 A;  4OYJ A;  3FZK B;  3JC6 C;  4CTD A;  4DVD A;  4HFB A;  4AQF A;  1QJ9 A;  2VKJ A;  3O1H A;  5KAF O;  2CXD A;  3VU7 H;  5T5F A;  3B57 A;  2LM9 A;  2E9X B;  3N9P A;  2JQY A;  1ZHY A;  4JI3 T;  1OED A;  5DAB A;  3K3O A;  1W0B A;  4GKK T;  3GA8 A;  3SOL A;  3JAD A;  4E1S A;  2ES0 A;  2WMN A;  1Y64 B;  3A8Y C;  3RKG A;  2X66 A;  4JLE A;  2ZM2 A;  4H9R C;  4XZC A;  5EE2 A;  3C4Z A;  4PK5 A;  2E5V A;  3VR9 A;  4FRX A;  2WWU A;  4TNV A;  5KMG P;  2J1D G;  2AXT O;  4KUM B;  2B76 A;  2ZM0 A;  3ZMU B;  4LML A;  4AFK A;  4I50 E;  1YW0 A;  2PFV A;  2CXF A;  2KXP A;  4AKR A;  4TWH A;  3FHN A;  5JR9 C;  4DR2 T;  4HFD A;  3HI2 A;  4LMK A;  2VVS A;  3ZT5 A;  2CMR A;  2VK9 A;  3UU5 A;  3OKQ A;  5JDP A;  3ZCJ A;  1O3X A;  2KLQ A;  3PTR B;  3PQU A;  4YSY A;  1E7P A;  2CHO A;  2DCF A;  1IZN B;  4AYM C;  3SYB A;  4B61 A;  4AXP A;  4DR1 T;  3N2G E;  3B13 A;  5JDQ A;  5L3B B;  1KK7 A;  4LSF A;  3RI5 A;  1H7C A;  2XG6 A;  5FY7 A;  2XM2 A;  4GCP A;  4IE4 A;  3PU3 A;  3PE0 A;  4AZL A;  5HXC A;  3OTO T;  1XWM A;  5E0O A;  2A2F X;  2PTF A;  2D2S A;  1MMN A;  1UCU A;  2E9X A;  1PHO A;  2CM0 A;  4DR4 T;  4O3Y A;  5DL5 A;  5GV0 A;  1FEW A;  3OJA A;  4YLH A;  4MLK A;  2K48 A;  2XMX A;  2WMO A;  3D0T A;  5DJQ C;  1YKE B;  4YSZ A;  4P0B A;  4JI5 T;  2BG9 B;  2KND A;  1BT9 A;  3LK4 2;  3LG7 A;  4CQI A;  4FJO A;  1T16 A;  5B5E O;  3JCF A;  3DZM A;  1FMV A;  5ABH A;  5JQG E;  1BR2 A;  3ZJ1 A;  2J4U P;  4N59 A;  4HFV A;  4UV9 B;  5KXJ A;  4BJN A;  2BKP A;  1HNZ T;  2EHO A;  4HE8 A;  5J2U E;  3E0Z A;  5LJM A;  3PGS A;  3PJA A;  5HXH A;  5C2T A;  2L8K A;  1VRB A;  2F1V A;  5AFU K;  3ETV A;  1E2A A;  3PV0 F;  2IDO B;  4JI4 T;  4PJL A;  1I94 T;  2JIW A;  4LF9 T;  3SRZ A;  3POQ A;  3AA7 A;  3HOL A;  3TKL B;  2E9X C;  2M6B A;  4NXN T;  5JDG A;  3AED A;  3PUX F;  1MIW A;  2LOS A;  5CA1 E;  1YXR A;  3O4X E;  4IDZ A;  4X5T A;  3ZYM A;  2JPF A;  3ONX A;  1ZHT A;  4EEB A;  4B3M T;  3AE3 A;  1HXU A;  2LHF A;  5DL7 A;  3RC8 A;  2Q9Q B;  5FXV A;  3UQ4 A;  3SFE A;  4WW0 A;  4QH5 A;  4Z90 A;  2Y0H A;  4CZZ B;  4ZI3 C;  4X20 E;  2V7M A;  1E1H B;  4CN4 A;  4DV1 T;  3LBX A;  1WLX A;  4BJM A;  2XM1 A;  5GTH O;  4FT6 A;  5HCJ A;  2MAW A;  4EIW A;  3VRA A;  2XSA A;  2YOE A;  5JRE A;  2ODJ A;  4AKM A;  4U7I A;  4JI6 T;  2BG9 A;  2WQY A;  2FJB A;  4ZI2 D;  2F4V T;  2VL8 A;  5LHG B;  1UUR A;  4PR7 A;  2XJ7 A;  4EAH A;  3VZT X;  4Q25 A;  2XPK A;  4MFR A;  1UX5 A;  2UXX B;  3I9W A;  5CFB A;  4C90 A;  3OYX A;  3SWH A;  3P4W A;  3P4P A;  2KSR A;  4HWC A;  1XMQ T;  4F6R C;  1G73 A;  2BG9 E;  4FRT A;  3BQL A;  3ZPO A;  5HEH A;  4DMV A;  5M4Y A;  3T0S A;  3H3A A;  2WZH A;  4LSI A;  4DV5 T;  4ZI2 C;  5FXW A;  5AFU L;  3HOE A;  2X9X A;  1UX4 A;  3POX A;  4U2Z A;  2YK0 A;  2YNK A;  3ESL A;  2V7L A;  2XAF B;  3QNU A;  2W80 C;  5G3A A;  1S94 A;  2H88 A;  1IZN A;  4QH1 A;  4YT0 A;  1OWA A;  3EVY A;  2KWH A;  3U3I A;  4K3C A;  3LJC A;  2E5L T;  1U5P A;  5LBQ B;  3MXZ A;  1HFA A;  2DWG A;  3NBX X;  4G76 A;  4X1I E;  3BS0 A;  4QHO A;  1Y01 A;  2UXB T;  3SYS A;  1LVK A;  4I4T E;  1ZOY A;  4YY3 T;  3QB5 K;  3IBP A;  3PUA A;  2I0M A;  1NEK A;  3PF1 A;  3B5M A;  3HKB E;  4KBM B;  2E8I A;  5FL0 A;  5FKY A;  4XAX B;  4IDQ A;  5DL8 A;  5HXS A;  2J1N A;  3O1I A;  1XZY A;  2WS3 A;  4EZH A;  5HYA A;  3EAM A;  3LK2 A;  5FP3 A;  2W0G A;  4DR3 T;  2W81 C;  3ABV A;  5LOV E;  4AYN A;  2I6H A;  4PJM A;  5LHI B;  4I43 B;  2V7K A;  2XAQ B;  3JTY A;  5KDM C;  3NVO A;  3AA0 B;  4GK5 E;  4WYV A;  2R4N A;  4HWF A;  3KVB A;  3GMI A;  1BXW A;  3PRN A;  2H89 A;  1H6S 1;  2R8A A;  2Y6X A;  4O3W A;  2YDQ A;  3HR0 A;  4HFE A;  5LHH B;  3OPC A;  4ZS2 A;  3N9O A;  3IF8 B;  3ZMT B;  3RYH E;  4CXW A;  3CQX C;  3PU8 A;  1D0X A;  4P0A A;  4AKR B;  4X64 T;  3UU3 A;  1G90 A;  3RYI E;  4GCQ A;  3ONJ A;  2CHN A;  3CX8 B;  5CGM A;  3AE7 A;  5H2F O;  3ZMZ B;  4IL4 A;  5J2T E;  2X9Y A;  3AE2 A;  4JEH B;  3VHL A;  3KZI O;  3AEF A;  5FL1 A;  4IST A;  3AAE A;  5ABE A;  1WR6 A;  2WU5 A;  2POR A;  3W15 B;  5F5W A;  4AYE C;  3SS1 A;  4IDO A;  2OV9 A;  2XQY A;  1ZP0 A;  5LJN A;  3PUW F;  2LLY A;  5JDL A;  3ANW A;  3PJA J;  4DV6 T;  2XTL A;  2VWA A;  4H9Q C;  2HPL A;  3I0O A;  1N34 T;  2CWY A;  3HL6 A;  4AYI D;  2CXL A;  3G7G A;  3J9X 1;  3TLV A;  2D0T A;  5L47 A;  5HWX A;  4IE0 A;  2D9D A;  4LFB T;  4NUU A;  4OX9 T;  2WM9 A;  2X51 A;  4UF0 A;  3TZG A;  2M6I A;  3RKO A;  5LBM A;  3SZD A;  5HEU A;  2LHR A;  5FVL A;  3ANW B;  1MIY A;  2LSY A;  3ZN0 B;  4HFH A;  2W66 A;  1XNR T;  4YTP A;  1GFQ A;  2JRK A;  4X62 T;  4KX6 A;  2VAS A;  3UT5 E;  3RF1 A;  4ASK A;  2VL0 A;  2FBW A;  2JQQ A;  4RLC A;  2LHN A;  5JH7 E;  1LVF A;  2JMH A;  4PJ0 O;  5JDN A;  2LOP A;  4C91 A;  4AQG A;  3MAC A;  2A72 A;  3N5L A;  2YN6 A;  2ZLD A;  2ODU A;  3KBT A;  4E1T A;  2A9U A;  1W09 A;  2MBG A;  4KMC A;  2QTK A;  1MM4 A;  3RYF E;  4TX5 A;  3PQS A;  2W62 A;  1HTJ F;  2NP9 A;  5LG3 A;  4C00 A;  2YKS A;  4JI1 T;  3AE9 A;  4COF A;  1PRN A;  4B3R T;  3N9N A;  2BS3 A;  3VZU X;  3OVU A;  3CK6 A;  5JR9 B;  1T98 A;  3R84 B;  1NWM X;  2DNX A;  2LKG A;  4MBQ A;  2X68 A;  4O3Z A;  3UPG A;  5L3C B;  3CML A;  2H7O A;  4B3T T;  4PFO A;  3POU A;  4P1N A;  3V5S A;  1MMG A;  3KIN B;  3DA4 A;  1J5E T;  2DLR A;  4N78 D;  2R6G F;  3ZT7 A;  2D5U A;  4X66 T;  2QYW A;  2GE4 A;  2NW8 A;  2P9B A;  4HFC A;  4ZZB A;  4ZEY A;  2VQF T;  4EOZ B;  4FUV A;  1OED C;  8PRN A;  2BZB A;  3AE1 A;  4KRA A;  2X67 A;  3RPU A;  4AIS A;  2XAJ B;  2W67 A;  5IYZ E;  5LMN T;  2XTQ A;  1S5L O;  3FB2 A;  3OYZ A;  4GK0 E;  1T72 A;  5IYU A;  4ANJ A;  5HAX A;  1SUM B;  5CJ5 A;  1GFM A;  3QB5 A;  1GFP A;  2Y7S A;  3C4W A;  4UB8 O;  3EHZ A;  5JRC B;  5FY1 A;  1UUS A;  4HTE A;  4G75 A;  4K0K T;  4HKA A;  4LSH A;  2IWW A;  3H3M A;  2ERV A;  4PNI A;  2V26 A;  2FJA A;  2LM2 A;  4IE6 A;  1JNZ A;  2I59 A;  3N9L A;  1ZHZ A;  1UK5 A;  4WZX A;  3RRW A;  2NTY A;  4AUI A;  4A5X A;  5LP6 E;  3NSG A;  4NIQ A;  5CB4 E;  2FUP A;  1MND A;  1QSD A;  3I1A A;  5L2L A;  1LRZ A;  5AQJ B;  3DP7 A;  4EB6 E;  4K3B A;  5JR9 A;  1YS5 A;  5JDH A;  2HN2 A;  5ABF A;  4U33 A;  3UU6 A;  1QJ8 A;  3FZH B;  3AEB A;  5PRN A;  5DQW A;  5GON E;  2G0U A;  4HEA A;  4AKH A;  1Z0P A;  2M67 A;  5FVK A;  3V8U A;  2LSG A;  4DID B;  4FZL A;  4H9S E;  4DV0 T;  2CCQ A;  5FMN A;  3MJX A;  3ZKR A;  3CQC B;  5KX5 E;  1QJP A;  4O4X A;  4TV9 E;  3AA7 B;  4CXY A;  3JAF A;  3MK7 C;  2Q9Q C;  2UXN B;  1JNR A;  4L9I A;  2XAH B;  5LGN B;  1GFN A;  4AQY T;  3A0H O;  3RX6 A;  2OMF A;  3LK3 A;  3IHR A;  1D1C A;  3RRC A;  4IL6 O;  3ZJ2 A;  2N2M A;  1OSM A;  3CX7 B;  3M65 A;  3FZF B;  2Y0L A;  2CLY B;  2M07 A;  3F31 A;  4DV7 T;  3SY9 A;  4H9N C;  3LSV A;  2NWB A;  2LE8 A;  3A0B O;  3UUN A;  3SFD A;  4LFC T;  1GQE A;  2XQ6 A;  1XNQ T;  3AA6 B;  1CHU A;  1B7T A;  4PK4 A;  2FGQ X;  5L4E A;  4QQ1 A;  2J4G A;  3AEC A;  3PUY F;  1HCI A;  5AQT B;  3BRZ A;  3K1S A;  1NEN A;  2YU1 A;  4H9P C;  4EV6 A;  2M06 A;  2QVA A;  3ZMS B;  3UUX B;  3AE4 A;  3TLS A;  1W0A A;  4YFS A;  3O1J A;  5AQO B;  1BR4 A;  1HG2 A;  3L39 A;  2GK9 A;  3ZT6 A;  3ZYK A;  4G2A A;  5AQN B;  4AKG A;  2K4T A;  3QUJ A;  4JCH A;  1EZ3 A;  3T20 A;  2X9H A;  2LRL A;  3HKC E;  5AQK B;  7PRN A;  4H63 V;  2K5B B;  2O4V A;  2QA7 A;  1NAF A;  4U3C A;  5JDM A;  2NW7 A;  4AQF C;  1HNW T;  2BBH A;  4F4B A;  1IAP A;  4GKJ T;  1T1L A;  2V6Y B;  4XBF B;  5G39 A;  2F1T A;  2XE5 A;  2BS2 A;  4O3X B;  2KZ7 B;  5G38 A;  3Q5X A;  2MTQ A;  4J2C A;  3P8C D;  5L3E B;  5EK4 A;  3AAA A;  2X27 X;  1MM5 A;  4KR8 A;  6PRN A;  4N75 A;  1MPF A;  2ZFG A;  3IA3 A;  3GP6 A;  4YTM A;  4EZ4 A;  3HWB A;  3KV4 A;  4LF4 T;  2YIN A;  5AQR B;  3NJT A;  4GOU A;  2CWO A;  5CA0 E;  4IDN A;  2BS4 A;  4G63 A;  4YXD A;  3QRA A;  3EI0 A;  4QXC B;  4BAY B;  3CX6 B;  3I0Q A;  2YEV C;  2DL1 A;  1HR0 T;  1YQ4 A;  5IWA T;  4DV3 T;  2HPJ A;  1ZHX A;  1V9D A;  1W9R A;  1P4T A;  5HCM A;  3LFM A;  4ILB A;  1D0Z A;  4KHZ F;  2LRK A;  3JAE A;  2WVP A;  3GN5 B;  3EDU A;  2IC9 A;  3PUZ F;  3AE8 A; 
#chains in the Genus database with same CATH homology
 2ACX A;  3VKG A;  5LJN A;  5FY0 A;  1ORM A;  4RJW A;  4ZI7 E;  3SOL A;  3HW9 A;  4MAL A;  3S4U A;  5LYJ E;  4CI2 B;  5JDL A;  4Z3T A;  3ANW A;  2ES0 A;  4E1S A;  3WI4 A;  2WMN A;  2D0U A;  1HXX A;  1Y64 B;  2LJL A;  2VWA A;  2XTL A;  2HPL A;  2X66 A;  3AVS A;  3I0O A;  2ZM2 A;  2CWY A;  2YU2 A;  3HL6 A;  4JLE A;  4H9R C;  4AYI D;  2CXL A;  4PK6 A;  4XZC A;  5EE2 A;  2DI4 A;  3C4Z A;  3G7G A;  3J9X 1;  4RLC A;  5G26 A;  4PK5 A;  2Y2X A;  2D0T A;  4FRX A;  4PFP A;  4U74 A;  4X1Y E;  2WWU A;  5HWX A;  2H7V C;  5KMG P;  2J1D G;  3N2K E;  1BH3 A;  4IE0 A;  2MYS A;  4KUM B;  3SZV A;  4NUV A;  4O8S A;  4NUU A;  5A1L A;  2ZM0 A;  2BVL A;  2WM9 A;  3ZMU B;  2KC0 A;  4UIG A;  2IAK A;  4I50 E;  4AFK A;  2NTX A;  2X51 A;  4TV8 E;  4UF0 A;  3RKO A;  2XAG B;  2V7I A;  1YW0 A;  5LXT E;  2PFV A;  5JVD E;  5LBM A;  2ODV A;  2CXF A;  3O9X A;  3SZD A;  4ZI3 D;  2LHR A;  3C50 A;  2CLY C;  3F2E A;  2KXP A;  2LFU A;  4RLB A;  4AKR A;  4O4J E;  4UVA B;  3VE2 A;  2A3D A;  3ANW B;  1MIY A;  2LSY A;  3ZN0 B;  4E7Z A;  3FHN A;  5JR9 C;  4TN7 B;  1YKH B;  3KV9 A;  3HI2 A;  3PUG A;  3FBZ A;  3C51 A;  2CMR A;  2VK9 A;  3K3Q C;  3OKQ A;  1GFQ A;  2JRK A;  3WI5 A;  5JDP A;  3ZCJ A;  2KZ7 A;  1ZHC A;  1O3X A;  5FXZ A;  5D5D A;  2KLQ A;  2VAS A;  3UT5 E;  3PTR B;  3PQU A;  4ASK A;  3VY9 X;  4OK0 A;  2JQQ A;  5JDF A;  2DCF A;  4AKI A;  2LHN A;  1IZN B;  2N9D A;  1LVF A;  4O4L E;  5JH7 E;  4JFB A;  4AYM C;  3K19 A;  2JMH A;  2IW5 B;  3SYB A;  4B61 A;  4AXP A;  5JDN A;  2LOP A;  3ZCI A;  3KV6 A;  2L3L A;  3N2G E;  2MOZ A;  1Q9F A;  3B13 A;  4C91 A;  5JDQ A;  5L3B B;  4FZN A;  1MMD A;  1KK7 A;  4ZS3 A;  3MAC A;  2A72 A;  4AQG A;  3LBX B;  3N5L A;  3AA0 A;  4LSF A;  2ZLD A;  4DMW A;  1H7C A;  2ODU A;  4CXX A;  2XG6 A;  1FMW A;  3KBT A;  4E1T A;  5FY7 A;  3ETU A;  2YPV A;  3T24 A;  2MBG A;  4GCP A;  4KMC A;  4IE4 A;  3PU3 A;  2QTK A;  3PE0 A;  4AZL A;  3A2S X;  1MM4 A;  3RYF E;  4OHF A;  4TX5 A;  3PQS A;  4D5U A;  1WYB A;  5HXC A;  2W62 A;  4YHJ A;  5E0O A;  1HTJ F;  2A2F X;  2NP9 A;  3POX A;  3Q5W A;  2W63 A;  2D2S A;  1MMN A;  1UCU A;  5TAO A;  2E9X A;  5ADX K;  1PHO A;  1PRN A;  2CM0 A;  4C69 X;  3N2O A;  3N9N A;  3FXD B;  4O3Y A;  3AAE B;  3VZU X;  5H6R B;  5DL5 A;  2W00 A;  5GV0 A;  5JR9 B;  2JMK A;  1FEW A;  3OJA A;  4Z8X A;  3NRY A;  4YLH A;  4A56 A;  1T98 A;  3R84 B;  4FZM A;  2K0L A;  4MLK A;  2K48 A;  3AA1 B;  1NWM X;  2XMX A;  3AAI A;  5LGU B;  2WMO A;  2Y0K A;  3D0T A;  5DJQ C;  3ZYL A;  2DNX A;  4MBQ A;  4EYY R;  3U78 A;  1YKE B;  2X68 A;  4O3Z A;  3UPG A;  4ERR A;  5L3C B;  3CML A;  3FXE B;  3HA4 A;  4IGU A;  4P0B A;  2H7O A;  5FVN A;  2KND A;  1BT9 A;  3LK4 2;  3LG7 A;  2KXP B;  4GYS A;  4PFO A;  4CQI A;  2H3R A;  4ZHQ E;  1HXT A;  3POU A;  4FJO A;  2EHO C;  1US7 B;  3KFW X;  1MMG A;  3V5S A;  3KIN B;  3DA4 A;  4D64 A;  4O4U A;  2DLR A;  4IHJ E;  3ZN1 B;  5DL6 A;  2PRN A;  1FMV A;  4K0U A;  4N78 D;  2C5J A;  1SHZ C;  5HWY A;  2D5U A;  5JQG E;  1BR2 A;  3ZJ1 A;  2J4U P;  3AB3 B;  4N59 A;  2OA5 A;  3C4X A;  3CVR A;  4HFV A;  5LA6 E;  4UV9 B;  3MZK B;  4BJN A;  3ZC0 A;  2GE4 A;  2NW8 A;  3IEE A;  4UV8 B;  2P9B A;  2MNH A;  3HKE E;  3ZMV B;  3C5O A;  2EHO A;  2Y8D A;  1ZEE A;  4HE8 A;  4IE7 A;  4EOZ B;  4FUV A;  5HXE A;  5J2U E;  8PRN A;  2BZB A;  3E0Z A;  2BVM A;  5LJM A;  1ZV4 X;  5HXH A;  3EUH A;  4AI6 A;  2KIN B;  2L8K A;  1VRB A;  4KRA A;  2X67 A;  3RPU A;  2F1V A;  5AFU K;  1HG5 A;  2XAJ B;  3ETV A;  4U72 A;  5BMV E;  3AA6 A;  5IYZ E;  2XTQ A;  5L3D B;  4KP3 C;  1HX8 A;  3FB2 A;  3OYZ A;  4PJL A;  5J1G A;  3RYC E;  1E54 A;  4GK0 E;  2L9Q A;  5IYU A;  5ADX L;  4ANJ A;  5HAX A;  2DWK A;  4GF4 A;  2E9X D;  3UU2 A;  3SRZ A;  3HKD E;  3Q9D A;  3POQ A;  2V1D B;  1Q9G A;  1GFM A;  3AA7 A;  3HOL A;  3TKL B;  2E9X C;  3RBH A;  1GFP A;  2Y7S A;  3C4W A;  5JDG A;  4WNK A;  4FOZ A;  1VOM A;  3UUM A;  1MIW A;  2LOS A;  3E22 E;  4O2B E;  4DND A;  4JUY A;  5CA1 E;  5JRC B;  5FY1 A;  4UEM A;  4HTE A;  2C5I T;  3KBU A;  3O4X E;  3H37 A;  4IDZ A;  4UXN B;  2N2N A;  4G75 A;  4AKL A;  3QRC A;  3ZYM A;  2JPF A;  3ONX A;  1ZHT A;  4BUM X;  1ZHW A;  5FXX A;  3DA3 A;  4HKA A;  4LSH A;  2NOX A;  2ERV A;  4PNI A;  4L0R A;  1MNE A;  2V26 A;  3VZW X;  2K9A A;  3MA9 A;  2LSK A;  4JEU B;  4PUX A;  4IE6 A;  4TUY E;  1HXU A;  2LHF A;  2I59 A;  3N9L A;  5DL7 A;  2CA5 A;  2Q9Q B;  5FXV A;  3RC8 A;  1ZHZ A;  4IIJ E;  3RRW A;  2NTY A;  2IC6 A;  4AUI A;  4V1A v;  3KVA A;  4WW0 A;  5LP6 E;  3NSG A;  5CB4 E;  2Y0H A;  1MND A;  4CZZ B;  4ZI3 C;  1QSD A;  3I1A A;  4OFZ A;  4X20 E;  5L2L A;  2V7M A;  1LRZ A;  1E1H B;  3A5X A;  3DP7 A;  3CKD A;  3L09 A;  1OPF A;  2JMM A;  2Y0L A;  4GCS A;  4EB6 E;  5JR9 A;  1YS5 A;  3PDY A;  3DTO A;  5JDH A;  3LBX A;  1WLX A;  5EZY E;  4BJM A;  4O4X A;  1FIO A;  1QJ8 A;  2ZMA A;  4UF0 B;  4FT6 A;  4OYK A;  4N58 A;  5PRN A;  5DQW A;  5GON E;  2G0U A;  4EIW A;  4HEA A;  5JRE A;  4H63 H;  3O0E A;  4AKH A;  2ODJ A;  2RP4 A;  1Z0P A;  3BQK A;  4AKM A;  3J7Y q;  4PJJ A;  2M67 A;  2Q9Q A;  3OBV E;  2XE3 A;  4DO0 A;  2KT9 A;  4WBO A;  4ZI2 D;  2X0L B;  5F3J A;  2VL8 A;  2B1E A;  3V8U A;  1BR1 A;  5LHG B;  1HF8 A;  2LSG A;  4O4I E;  1BR0 A;  4FZL A;  4H9S E;  1OXZ A;  2CCQ A;  3BK9 A;  4EAH A;  4E7S A;  5FMN A;  3MJX A;  4U9C A;  3CQC B;  5KX5 E;  1QJP A;  3VZT X;  3AA1 A;  4CI1 B;  4TV9 E;  3AA7 B;  4CXY A;  3F57 A;  3LK2 B;  3FBL A;  1UX5 A;  3MK7 C;  2UXX B;  3I9W A;  4MFR A;  2Q9Q C;  4QXH B;  3ZEF B;  3RH3 A;  1MIV A;  2UXN B;  2VKH A;  3I9Y A;  2VKD A;  4L9I A;  2XAH B;  4C90 A;  3R6N A;  5JRC A;  3OYX A;  3LK4 1;  3SWH A;  3AVR A;  5LGN B;  1GFN A;  4DBQ A;  4P09 A;  3PUR A;  3CWZ B;  4F6R C;  4GIW A;  4TZ4 C;  2MHL A;  1G73 A;  4H9Q C;  1GFO A;  3RX6 A;  4FRT A;  4ADZ A;  2V7J A;  3BQL A;  3ZPO A;  2OMF A;  2QGS A;  4DMV A;  5LGT B;  5M4Y A;  4FMS A;  4KR4 A;  1D0Y A;  3H3A A;  2XE2 A;  3T0S A;  4FSP A;  3LK3 A;  3IHR A;  1D1C A;  3RRC A;  4LSI A;  1ZKE A;  3CPZ A;  4QX8 B;  3ZJ2 A;  3K8P C;  3GWH A;  4O2A E;  2WBL A;  4CI3 B;  4ZI2 C;  2N2M A;  3PUS A;  1OSM A;  3EMN X;  2XHE B;  3CX7 B;  3M65 A;  4X1K E;  3QK6 A;  5FXW A;  5AFU L;  1AJ3 A;  2X9X A;  1UX4 A;  3N9Q A;  3CQG B;  2CLY B;  5LCY A;  3F31 A;  3LK3 B;  3T8O A;  2LSI A;  1THQ A;  4UVB B;  2M07 A;  2YK0 A;  4ISS A;  2YNK A;  3ESL A;  4H9O C;  2NW9 A;  2FGR A;  3SY9 A;  4H9N C;  3MKD A;  2LSJ A;  2V7L A;  3UFE A;  4AYD C;  2NWB A;  2DHR A;  4YJ3 E;  4BA9 A;  3V5U A;  3NRX A;  2XAF B;  1SA0 E;  2SPC A;  1WRD A;  2LE8 A;  2W80 C;  4FI5 A;  1S94 A;  3UUN A;  3KV5 A;  4D65 A;  1IZN A;  2KMF A;  5LNK A;  4XNK A;  1OWA A;  1LKX A;  2VKO A;  4O4H E;  2CEA A;  3SY7 A;  3EVY A;  2KWH A;  3U3I A;  2N2L A;  3AA6 B;  3RC3 A;  2C0S A;  3LJC A;  1B7T A;  1U5P A;  1CUN A;  3HOE A;  4HN9 A;  2XE1 A;  4PK4 A;  4GYR A;  4MHC A;  5LBQ B;  3MXZ A;  2FGQ X;  1HFA A;  3DJB A;  2DWG A;  3NBX X;  5EK2 A;  3WAJ A;  2C5K T;  4QQ1 A;  5EK3 A;  4QKN A;  4X1I E;  4G76 A;  4QHO A;  1HCI A;  3SYS A;  1D1A A;  1LVK A;  3GN5 A;  3K3N A;  4LSE A;  2YU1 A;  4H9P C;  4I4T E;  3TZG A;  2KDY A;  2M06 A;  1HS7 A;  4DBR A;  2XTR A;  4QXB B;  4I55 E;  3IBP A;  3PUA A;  4O49 A;  3ZMS B;  3C64 A;  5F8P A;  3UUX B;  4ILU A;  1MMA A;  1KNZ A;  3HKB E;  4KBM B;  4UEL A;  3BQI A;  2E8I A;  1S35 A;  4YFS A;  3Q2M A;  3O1J A;  4XAX B;  5C8Y E;  1BR4 A;  1HG2 A;  5DL8 A;  2GK9 A;  5FNV E;  5HXS A;  3ZYK A;  2LT3 A;  3EDV A;  4G2A A;  2J1N A;  3O1I A;  4AKG A;  2K4T A;  4YJ2 E;  3QUJ A;  4JCH A;  1EZ3 A;  4EZH A;  5L3G B;  1D1B A;  5HYA A;  2EHO D;  5L3F B;  3T20 A;  3ZLI A;  3LK2 A;  2X9H A;  1U4Q A;  3HKC E;  5IHY A;  1YD8 G;  3UTK A;  7PRN A;  3NZP A;  4H63 V;  3KDS E;  4HGA A;  5ETW A;  2K5B B;  2W0G A;  5FP3 A;  5HXR A;  1G8X A;  3L3P A;  2W81 C;  2O4V A;  2QA7 A;  2Q9Q D;  2Y48 B;  3E08 A;  3FYX A;  5LOV E;  1NAF A;  4AYN A;  5JDM A;  2PBI A;  2NW7 A;  4PJM A;  5LHI B;  2PJQ A;  4AQF C;  4I43 B;  2V7K A;  4F4B A;  2XAQ B;  4GHB A;  1IAP A;  3JTY A;  5KDM C;  4XBF B;  2F1T A;  2XE5 A;  3AA0 B;  2RA1 A;  4XNL A;  4GK5 E;  2WSS V;  2XUE A;  4M1P A;  2W61 A;  3PUQ A;  2X9W A;  3JC6 D;  4O3X B;  4FES A;  3KVB A;  3GMI A;  1BXW A;  3PRN A;  2KZ7 B;  4EXT A;  4EYU A;  3Q5X A;  2MTQ A;  4FSO A;  4J2C A;  5DQV A;  2ZLY A;  3P8C D;  1H6S 1;  5H6Q B;  2Y6X A;  4WBN E;  4ZOL E;  2Z6E A;  4O3W A;  2N1G A;  5L3E B;  5EK4 A;  2CE7 A;  3HR0 A;  2X27 X;  3AAA A;  5LHH B;  4ZS2 A;  3N9O A;  1MM5 A;  5LG4 A;  2BDE A;  2LEH A;  3IF8 B;  4KR8 A;  3UAQ A;  6PRN A;  3ZC1 A;  1WYC A;  2WAU A;  2JJ9 A;  3ZMT B;  3POR A;  3RYH E;  3VY8 X;  3AAA B;  1MPF A;  4CXW A;  2ZFG A;  3CQX C;  3PU8 A;  4PJN A;  4PAG A;  1D0X A;  3GP6 A;  4EZ4 A;  3HWB A;  3KV4 A;  3KVD D;  2YIN A;  3QC9 A;  4P0A A;  1X79 A;  3C98 B;  4L5G A;  4AKR B;  3VKH A;  2K24 A;  4GOU A;  1G90 A;  2CWO A;  3P7I A;  2XAS B;  3WAK A;  5CA0 E;  2HH7 A;  2PG8 A;  4G63 A;  4PW8 A;  3RYI E;  4IE5 A;  2KWI B;  4GCQ A;  1IJ5 A;  4OYJ A;  3CX8 B;  3JC6 C;  3QRA A;  4DVD A;  4QXC B;  4BAY B;  4UVC B;  4AQF A;  4B6X A;  1QJ9 A;  4QX7 B;  3CX6 B;  5FYM A;  2VKJ A;  3I0Q A;  2YEV C;  3ZMZ B;  5J2T E;  2X9Y A;  2ZM8 A;  3O1H A;  2CXD A;  4JEH B;  2HPJ A;  3UUL A;  3VHL A;  3VU7 H;  1V9D A;  3B57 A;  1ZHX A;  5T5F A;  1P4T A;  3NZQ A;  2LM9 A;  4RJX A;  1IJ6 A;  2E9X B;  3N9M A;  3N9P A;  4IST A;  1ZHY A;  3LFM A;  1D0Z A;  4QWN B;  1QUU A;  3AAE A;  1WR6 A;  3GN5 B;  3EDU A;  3W15 B;  2POR A;  4RL9 A;  2IC9 A;  3WI3 A;  5DAB A;  4AYE C;  3VE1 A;  3K3O A;  3SS1 A;  2EHO B;  2VB6 A;  2XQY A;  3GA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...