2KZ7B

Solution structure of the carmil cah3a/b domain bound to capping protein (cp)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
270
structure length
270
Chain Sequence
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the CARMIL CAH3a/b domain bound to capping protein (CP)
rcsb
source organism Gallus gallus
molecule tags Protein binding
molecule keywords F-actin-capping protein subunit alpha-1
total genus 80
structure length 270
sequence length 270
ec nomenclature
pdb deposition date 2010-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01115 F_actin_cap_B F-actin capping protein, beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.570 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2kz7B01
2.40.160.80 Mainly Beta Beta Barrel Porin Porin 2kz7B02
3AA7B 3LK3B 3AA1B 2KZ7A 3AA6A 1IZNB 3LK42 2KXPB 3LK2A 2KXPA 5AFUK 2KZ7B 1IZNA 4AKRB 3LK2B 3AA0B 3AA0A 4AKRA 5AFUL 3LK41 3AAAA 3AAEA 3AAEB 3LK3A 3AA1A 3AAAB 3AA7A 5ADXL 3AA6B 5ADXK
chains in the Genus database with same CATH superfamily
4DR5T 2W63A 4DV0T 3CIRA 2ODVA 3P4PA 1BR2A 4JCHA 2ZLDA 4PK5A 3AECA 1H6S1 3HOLA 2BBHA 4KP3C 3I0QA 2AXDS 3CVRA 3W15B 3RYFE 4DV6T 1BXWA 2AXTO 3AA7B 2K4TA 3UULA 2WQYA 2IWWA 2QA7A 4DIDB 1FMWA 1Z8UA 2W80C 2WBLA 3KBUA 4WZXA 1XZYA 3PGSA 2WSSV 3GWHA 3PRNA 2WJQA 4JI5T 4KR4A 1FMVA 1W0BA 2XAFB 3O1HA 4EOZB 3I9YA 5IYZE 2L9QA 2NW8A 5HCMA 1US7B 3P4WA 5JDPA 2E9XC 2YEVC 3ZCIA 4C00A 2K24A 2RPAA 4HFCA 3TLVA 4KHPT 4D5UA 3QRCA 5L4HA 1IJ5A 3PQSA 2C0SA 3SS1A 4UEMA 2F4VT 4NXNT 4IDQA 3UQ7A 2V7JA 3ZT6A 3GP6A 2YNKA 2D2SA 4FRXA 4B3TT 3DA4A 5JREA 1HX1B 2WS3A 3EDVA 3AEEA 5ABGA 3IF8B 2YU2A 2W61A 3EHZA 3DP7A 5JDNA 2DWKA 3N9LA 4PJLA 2YDRA 2MNHA 4HWCA 4IE7A 5HEOA 3FZFB 4FMSA 3O1IA 3AE7A 5DJQC 4U9CA 3NRXA 3RIAA 3AAIA 1HTJF 3ZJ2A 4YFSA 1N32T 3F57A 1IBKT 4I50E 1M62A 1VRBA 3UUNA 3AA0A 4O3XB 4EZ4A 2EHOA 3I1AA 3AE8A 4HFIA 3AE9A 2CM0A 1Y01A 4ZI7E 3AAAB 2W81C 2HPLA 1KEYA 4P1NA 4B61A 5L3DB 3R6NA 5EZYE 4ZS2A 3ONJA 4K3BA 3M65A 3P8CD 4ZEYA 4G76A 4LMKA 5C8YE 4GHBA 2BDEA 2XG6A 4U7YA 3BK9A 2LLYA 3E22E 2V7LA 5FL1A 2LHFA 2FGRA 3SYSA 2ES0A 5EK2A 2R6GF 3C98B 4TWFA 3RH3A 5LCYA 2R4OA 4JBWF 1KK7A 1ZHCA 5ABHA 4UVAB 3ZSSA 5IYUA 5F5WA 5FVKA 5BMVE 1HXTA 3F31A 3C50A 3POQA 3SZDA 5LBQB 1IBMT 4K0UA 5LGTB 2J47A 4PJ0O 3UU5A 3KVDD 3PQUA 4CTDA 4J2CA 3PURA 3KZIO 3QNUA 5LHIB 4X66T 1LVFA 1ZHXA 4DV5T 5FY0A 2JQ9A 4X64T 3JCUO 2OV9A 1IAPA 1OSMA 2I6HA 2WZHA 3FB2A 1I6ZA 5L3GB 5HWXA 4I55E 1S94A 4TN7B 2N1GA 2A9UA 3JC6C 3OYZA 4P0BA 4CXXA 2XE1A 1QLBA 3KV4A 3D0TA 2A3DA 1KNRA 3AE1A 3HKDE 4NXMT 1YKEB 3C4XA 3T24A 4E7ZA 4HFVA 5AQNB 1MM5A 2WU5A 2NP9A 3JAEA 3NBXX 3FZLB 4IE5A 2WDRA 1MMGA 4YSYA 2PJQA 1V9DA 2R89A 5TAOA 3L09A 2MBGA 4LSIA 2N2MA 3AE4A 4ZZCA 2UXCT 2V6XA 2E5VA 2Y2XA 1Y64B 3AA6B 4CI1B 3RKOA 2H89A 3ZT5A 2NTYA 4U2YA 1UURA 3HI2A 5J1GA 4LF8T 4OFZA 4EYYR 2IMLA 2LFUA 1R8IA 3QB5A 3S4UA 2WMNA 1QSDA 4XBFB 4GCSA 1LRZA 4Z8XA 1GFOA 4ISSA 2X9XA 2D9DA 2BS4A 3CQCB 2P9BA 2WM9A 1HX8A 3CQGB 1WYBA 4ILBA 5LG3A 2VL8A 3AEBA 4BA9A 4YTNA 4AKHA 3H3AA 4QKNA 2PORA 3MK7C 4IDZA 3C4ZA 4LF6T 4UF0B 3WU2O 4CN4A 5FP3A 5LMNT 4EEBA 3KV5A 4Q25A 5AFUL 4QH1A 5HEGA 4AZLA 3Q9DA 3UQ4A 2BG9A 2MTQA 1O3XA 2X27X 4BUMX 2BKOA 1HNXT 1IZNB 5J0ZA 2Z6EA 3EMNX 4IHJE 1PHOA 4LF4T 2LM2A 3NZQA 4ANJA 1B7TA 4E7SA 3ZN1B 5FVLA 1H7CA 2UXBT 3J9X1 2JRKA 4TV8E 3RIFA 4WNKA 2M07A 2X67A 2XSAA 4X1YE 2XAJB 3UUMA 1T16A 3ZEFB 4X1KE 1D1CA 3V5UA 2V8SV 4QH5A 4UV8B 3HKCE 3CK6A 2ACZA 1QUUA 2XE3A 3AA0B 1BR0A 2XHEB 2EHOB 4WBOA 2C5IT 3PDYA 1KF6A 4YJ3E 1MMNA 3K3QC 3ZSTA 5LGUB 4U72A 4UV9B 3IHRA 2QVAA 4DR6T 5G39A 1ZP0A 2XAHB 2E9XD 4L0RA 1X9BA 3ONLC 4PUXA 3NKZA 1T72A 2CBIA 2JQKA 5BR8T 2DI4A 4JI1T 4IE4A 4DV3T 1MIWA 3CWZB 1OXZA 3PV0F 5L3EB 3K8PC 3PU3A 3ESLA 2QYWA 4UELA 4ISTA 3WI4A 3PUAA 2CXLA 4QXHB 4XAXB 1I94T 3AEAA 2D0UA 2X0HA 2YDQA 2PG8A 2LM9A 4YTMA 4AIUA 3UU2A 4O3ZA 2XQ5A 4IE6A 1D1BA 3L39A 3KFWX 3PU8A 4EXTA 3SZVA 4AUIA 4ZI2D 1S5LO 3HOEA 3B57A 4JI6T 2X9YA 2F1CX 3OBVE 4KUMB 5JR9A 4AYID 3CX6B 2D0TA 1HG2A 4O8SA 3IBPA 3RI5A 2VK9A 2LHNA 4CN1A 5AQFB 3UFEA 3AXJB 3K19A 4LF9T 2W00A 2DNXA 2CLYB 3Q2MA 3P4RA 3UU6A 3E0ZA 3SFDA 2LE8A 1X79A 2YK0A 2ZFGA 4GYSA 4HWDA 3X1DA 2WVPA 2WAUA 5JDMA 2C5JA 3U78A 4G63A 3P4SA 1E2AA 3ZCJA 2KZ7A 2XAGB 1YS5A 1GFQA 1OWAA 2DHRA 1QJPA 2VASA 2LSIA 3UT5E 4GF4A 2LSKA 3AAAA 4JI3T 5HAXA 2R4LA 4QHOA 5JDHA 3VY8X 4CI2B 5CJ5A 3E08A 4A97A 3OJAA 3VR8A 2CXFA 1IJ6A 3A2SX 1VCTA 3FBZA 4KR8A 2XMXA 3PTRB 4YHJA 3RC3A 2NW7A 3ZC0A 5AQVB 1NEKA 3N9MA 5AQGB 5JRCA 2VKDA 3TLUA 4JLEA 4FOZA 3V8UA 5AQKB 1T8BA 4UVBB 4RLCA 2IC9A 2O4VA 2WDQA 1W0AA 4YHHT 5FVNA 3ABVA 4DR4T 4UF0A 1UUSA 4O3YA 5EE2A 5HXCA 4H9RC 5HXRA 4PW8A 3VZTX 3BQIA 3ZT7A 5FYMA 4WYVA 5L47A 2KSRA 4C90A 4CI3B 1VCSA 2LKGA 4QXCB 4TWDA 1YKHB 2WDVA 3POXA 5JDLA 4AYEC 2XQ9A 3LK2A 3WI5A 3VR9A 4N75A 2XTQA 4U7IA 3VE2A 1ZHWA 2X9HA 4LSFA 3OKQA 2WWVA 4LSHA 5JQGE 4N59A 4HKAA 1GQEA 1THQA 5LXTE 4ZS3A 4DMVA 2K5BB 2IC6A 3MKDA 3RF1A 1XMQT 1FIOA 4Z91A 5JDFA 3KBTA 5GV0A 3QB5K 5J2UE 2V7IA 1KNZA 2XY8B 2DLRA 1PRNA 2YINA 4QX7B 4GYRA 4DBRA 1AJ3A 4DUZT 3ZYLA 3R84B 2F1VA 3RYCE 5B66O 4EGWA 3HW9A 3TLTA 5M4YA 3V5SA 1OEDB 3RRCA 3UU3A 3QK6A 4Z90A 4N58A 4AYNA 4ASKA 3N2GE 3AEDA 5L2LA 7PRNA 6PRNA 1SE7A 3VRBA 2WWUA 3BQLA 3H3MA 2WB5A 2XUEA 3U3IA 4ZI3C 3POUA 2BBJA 2PFVA 2K0LA 1WR0A 5T5FA 4ZOLE 5KAFO 4WW0A 3N9QA 3VHLA 2Y7SA 2MAWA 2Y48B 3WAJA 2EHOD 3JADA 4C4VA 4G2AA 2PBIA 3P50A 2BKNA 3NVOA 4BAYB 3AA6A 4KI0F 1N36T 4QX8B 1W9RA 2Q9QA 3Q5XA 3TZGA 2CMRA 3P7IA 2X51A 1MMDA 5AQJB 3RBHA 1D1AA 3PUSA 4O4UA 1YW0A 3PUXF 4I4TE 2ZM6T 3DWOX 4WBNE 4IGUA 4HEAA 3I0OA 5HXEA 3GN5B 2KT9A 1J1JA 2PTFA 5L4EA 2FUPA 3PUWF 2CHOA 4PK4A 4DR3T 2YKSA 3EUHA 4ZI3D 2FJDA 1MNEA 4CN6A 2BZBA 2GE4A 2JMHA 4KX6A 1VOMA 5C3JA 4EV6A 5F3JA 2ODJA 3RHWA 4U33A 5AQUB 2VURA 5JDQA 1M7KA 4YSXA 2KXPA 3B5MA 2N2LA 5ABFA 2XE5A 4QWNB 4NIQA 3H37A 3OVUA 3A8YC 1ZHZA 3HKBE 1U4QA 3PF1A 1WCRA 2RP4A 2VB6A 4OYKA 3LK3A 4JI0T 4GCPA 5L3FB 2ERVA 2J1DG 4EZHA 5CGMA 3BQKA 3C4WA 2XTLA 4B3MT 2XQ8A 3FYXA 1IZNA 2Y0LA 3SFEA 2E5LT 2K48A 2R8AA 4YTPA 5LG4A 2VQET 3I9WA 4O2BE 4MFRA 1BH3A 4YSZA 4K3CA 5CA1E 5FY1A 1XWMA 4UXNB 5CA0E 3ZMUB 3FZMB 1YQ4A 5JRCB 4HWFA 1OEDC 2WMOA 4HN9A 3CQXC 3UPGA 4IL9A 5AQRB 5LHGB 4UB6O 4U31A 4UB8O 4DNDA 4KRAA 3DTOA 4GK5E 5FKYA 4LF7T 2UU9T 2NTXA 3ONXA 2W62A 4HE8A 4LF5T 3NSGA 2J1NA 4XZCA 4F8HA 3PORA 4JYAT 1EZ3A 2M6BA 4RLBA 4EYUA 3FZKB 4FZLA 4TX5A 3DJBA 2E2AA 4TV9E 4LMJA 2UXNB 4AYDC 2Y0KA 1Z0PA 1ZV4X 4ZHQE 1N33T 3VKGA 4IDNA 3RIUC 2H7OA 3A5XA 1L0VA 1ORMA 2QTKA 1LKXA 5EK3A 3ZJ1A 1HFAA 1P4TA 3PGRA 5AQIB 3EVYA 2HN2A 3ZMSB 1ZOYA 2M06A 4O2AE 1MIYA 4HWHA 5AQMB 2Y6XA 4FUVA 4AFKA 4KHZF 4GKJT 3RQWA 2H3RA 3MXZA 1SUMB 1Q9GA 4RJWA 2CA5A 1UX5A 2FGQX 5KAIO 3T20A 2YN6A 5DQWA 5F8PA 3O0EA 2HPJA 5LBMA 4EIWA 3SRZA 3VZWX 2IHR1 2E9XA 3AVSA 3C5OA 4YY3T 4JEUB 1N34T 2IAKA 4FSOA 4H9OC 4V1Av 4TUYE 4XNKA 3TKLB 2OLTA 3VRAA 5HXSA 3UTKA 4FESA 2H7VC 1XNRT 4LSEA 2LHRA 4IE0A 2AE9A 3ZPOA 3EABA 2EHOC 3P4QA 4P09A 4IREA 1HCIA 2JPFA 2KZ7B 5ABEA 5FL0A 1D0XA 4IL4A 3LSVA 2V7MA 3UUBA 4JUYA 3PGUA 1U5PA 2XJ7A 4HTEA 3O1JA 5HEHA 2M67A 2WY2A 3PUGA 4PJMA 1BR4A 3NJTA 3Q5EA 1WRDA 5E0OA 2LOSA 2CHNA 2XM1A 1MM4A 5DL8A 2V5DA 4X5TA 2ZM2A 3PJAA 3ZYMA 2LSGA 2XQYA 3AVRA 1WYCA 4MBQA 2MHLA 3N2OA 3BS0A 2ZLYA 3M3ZB 4QXBB 3AE6A 5FXXA 4X62T 4O4XA 5GONE 4FZNA 2CEAA 3MZKB 3GN5A 4AKMA 2SPCA 3EI0A 4FI5A 2LSYA 3GA8A 2BS3A 4AKRB 3G7GA 2HHHT 3TLSA 5FXWA 2JQYA 5TISO 3PE0A 1ZKEA 5FXZA 4U3CA 2KXPB 5IWAT 2CWYA 1J5WA 3RYHE 2YOEA 4YLHA 3ETUA 5LOVE 2WJRA 2KINB 1NAFA 4CXWA 2UXXB 4FZMA 5CB4E 1CHUA 2V6YA 4IDPA 2FJAA 3CKDA 1UGOA 4FT6A 3LK41 2JMKA 1OEDA 1NWMX 4GIWA 4HFHA 4U2ZA 2XQAA 3ZN0B 2MPKA 2V1DB 2WP9A 4C91A 3AXJA 1XNQT 3K3NA 4BJNA 4CZZB 3LK2B 4PNIA 4TNVA 4MALA 4A56A 3HWBA 5LJMA 5KDMC 1GFMA 2JIWA 3UU4A 2VL0A 1OEDE 3A7MA 4P0AA 4H63H 5KX5E 4CXYA 1G8XA 1YXRA 2LT3A 2R88A 4AISA 5JR9C 4NUUA 5FMNA 2YPVA 1MPFA 2B76A 5AQOB 3AA7A 5CFBA 1G73A 2KNDA 3RQUA 2OA5A 4RL9A 3CX7B 2KWIB 3HKEE 4FRTA 5AFUK 2VVNA 4GCQA 4X65T 2K3WA 4HFBA 3J7Yq 3MJXA 4YXDA 3FBLA 4AQFC 1G90A 4XNLA 4JEHB 3OTOT 3AE2A 3ANWB 5ADXK 4OX9T 3AA1B 2W2UA 1FEWA 2KMFA 4HGAA 1OPFA 5AQSB 2V7KA 4PAGA 1ZEEA 4JI4T 2H88A 4H9SE 5LGNB 4COFA 1W09A 2IUBA 4H63V 2VVSA 2LKHA 5G26A 2XM2A 4O49A 5ABFB 2OMFA 3JCFA 1S35A 5IUXA 3AEFA 5LYJE 2Q9QB 4ZZBA 3OYXA 3QRAA 2KWHA 8PRNA 4AQYT 1KNPA 3LBXB 2HH7A 4PK6A 4PR7A 3AEGA 3Q5WA 4DUYT 1HNWT 2WZIA 1E1HB 3RYIE 5HYAA 5H6QB 4DMWA 3KINB 2DWGA 4C69X 4GK0E 3G06A 4EEDA 3AB3B 5LJNA 1E54A 1UX4A 1JNRA 3RKGA 1DU2A 2QGSA 2GK9A 2FBWA 2VKJA 5B5EO 4IIJE 4KMCA 3RLFF 1HR0T 2W4XA 4AQFA 1D0ZA 2NOXA 1T98A 1HS7A 4O4HE 1HXUA 2X68A 3IEEA 3IA3A 5FY7A 3RGLA 2LRKA 3NZPA 3KDSE 2Q9QC 3KV9A 5ADXL 2W66A 4DBQA 3LK3B 4Z3TA 5HWYA 3SY7A 4NUVA 2JQQA 3JTYA 2BS2A 2NR4A 5LHHB 4G75A 5KMGP 4DV2T 4AKIA 2KC0A 2VWAA 2D5UA 2YU1A 2X9KA 5HCJA 5JH7E 2XQ6A 3AAEB 3N5LA 2CXDA 2VKHA 3GMIA 2I0MA 1QJ9A 2QRXA 3RPUA 2IDOB 3JAFA 3KV6A 3T0SA 5FNVE 4NPPA 3O4XE 2Q9QD 3EAMA 3ZKRA 3VE1A 2N9DA 2NWBA 2ZM8A 4DV1T 3C51A 5DL5A 3LG7A 4IL6O 4TNWA 4MHCA 5EK4A 1HG5A 2CBJA 4E1SA 2ZM0A 4C4VB 2HN1A 2Y8DA 3FHNA 4CQIA 2RA1A 2XASB 3PUVF 3NWIA 5DQVA 2MOZA 1J5ET 2J62A 2A2FX 3AE3A 2LSJA 1HF8A 2V6YB 2L8KA 2XAQB 4AKLA 4JV5T 3QC9A 2CLYC 3T1YT 2ACXA 4RJXA 4DO0A 1JNZA 5LP6E 1YQ3A 1WFDA 3LK42 2CCQA 2IWVA 4JI8T 4ZI2C 2W0GA 1QJ8A 3BRZA 2C5KT 2J4UP 5J2TE 2BVLA 2M6IA 3CMLA 2XTRA 2F1TA 4O4LE 4D65A 5G38A 2X0LB 2XE2A 4OYJA 4L9IA 4TZ4C 2ODUA 2XZEA 4X1IE 4H9NC 1XDPA 3QOFA 2JQHA 2IIUA 2WU2A 3HA4A 1T7SA 3UAQA 2WCAA 5C2TA 2UUAT 4PFOA 3CX8B 4MLKA 1ZHYA 4HFEA 3FXDB 5KXJA 4JI7T 3N9OA 4PJJA 4LFBT 2ZMAA 5LMUT 1Q9FA 4I43B 2E9XB 4DR2T 4GOUA 3PUQA 4KBMB 5L3CB 2PRNA 5PRNA 4AXPA 4AI6A 4QQ1A 1HNZT 1BT9A 5LNKA 4YJ2E 1T1LA 1NENA 3B13A 3A0BO 3N9PA 3ZMTB 4AYMC 1LVKA 3C64A 3RC8A 4IDOA 3LFMA 2X66A 2VQFT 4E1TA 1WR6A 4B3RT 4AQGA 4UIGA 3FZHB 3ZC1A 4LMLA 5A1LA 3OPCA 3Q5DA 2NW9A 3ZYKA 3LDQB 5DABA 2IW5B 2BG9E 1XDOA 5AQQB 3L8RA 5D5DA 3WAKA 1CUNA 1YD8G 2JMMA 1SA0E 3SOLA 5L3BB 1WLXA 2FJBA 4U74A 4QH4A 4FQEA 5AQLB 3N9NA 1ZHTA 5AQPB 2FJEA 2CE7A 1UK5A 2X0YA 4BJMA 2BG9B 2XQ7A 3FXEB 4FJOA 2XQ4A 4OK0A 4A5XA 3TLWA 4LFCT 4O4JE 3JC6D 2KDYA 3MA9A 5GTHO 4TWHA 5HXHA 4FSPA 4AKRA 1UCUA 3F2EA 3ZMZB 1GFPA 2VKOA 4EB6E 4F4BA 2L3LA 1MNDA 5HEUA 3O9XA 4N78D 2K9AA 1XMOT 4M1PA 3A0HO 4DV4T 3K1SA 5DL7A 4JI2T 2V26A 4EAHA 5ETWA 2LJLA 4ILAA 2X9WA 4X20E 4DV7T 2LRLA 2KLQA 3LJCA 3RIUA 2MYSA 1FJGT 5AQHB 1MMAA 1D0YA 4HFDA 5H2FO 3VZUX 4B3ST 4ILUA 2J4GA 4DR7T 3PUYF 3AE5A 5GTIO 4DVDA 3RRWA 3HL6A 1E7PA 3KVAA 2XPKA 4A98A 3BRYA 3AAEA 5DL6A 2Y0HA 3VKHA 4L5GA 3AA1A 2JJ9A 2UXDT 3MACA 4ERRA 4JFBA 4DR1T 3EDUA 2BG9C 3ZMVB 4O3WA 3UU8A 3L3PA 4LFAT 2N2NA 2R4PA 4K0KT 5LB7B 3VU7H 2YDSA 1HXXA 5AQTB 3T1HT 1GFNA 3HR0A 2UUBT 4B6XA 3KVBA 3N2KE 4GKKT 5JR9B 3NRYA 4UR9A 2B1EA 3QUJA 2LOPA 5FXVA 2A72A 2XQ3A 1IBLT 2LEHA 3ANWA 4OHFA 4AKGA 5JDGA 5G3AA 2I59A 2XSBA 2R4NA 4ILCA 4N74A 3UUXB 4F6RC 3K3OA 2CPTA 2CWOA 3WI3A 3UFGA 2G0UA 3SYBA 5IHYA 1BR1A 3PUZF 2DCFA 3DWNA 3VY9X 3SY9A 1SHZC 2BKPA 3ETVA 4H9PC 2V5CA 5JTGA 4D64A 4UVCB 3T8OA 2BVMA 5HEJA 5JVDE 4ADZA 4O4IE 5E79O 3LBXA 2E8IA 4YT0A 3DA3A 3ZLIA 4PFPA 4I0UA 4ZXLA 3DZMA 3PJAJ 3CPZA 2W67A 2DL1A 4PJNA 4H9QC 5H6RB 1KFYA 4IT4A 5LA6E 2CRBA 3SWHA 2UUCT 4HWIB 1MIVA 3RX6A
chains in the Genus database with same CATH topology
2XAHB 5FY1A 3LK3B 2E9XD 4UXNB 4Z3TA 4L0RA 5HWYA 5CA0E 3ZMUB 3SY7A 2W63A 4NUVA 2JQQA 3JTYA 5JRCB 2ODVA 4UV9B 4PUXA 1BR2A 4JCHA 2WMOA 2ZLDA 4PK5A 5LHHB 4G75A 5KMGP 2DI4A 4IE4A 4AKIA 1H6S1 4HN9A 2KC0A 3HOLA 2VWAA 2D5UA 1MIWA 3CWZB 3I0QA 1OXZA 4KP3C 3CVRA 3W15B 2YU1A 3CQXC 3UPGA 5L3EB 3RYFE 5LHGB 5JH7E 3K8PC 3PU3A 3ESLA 3AAEB 3N5LA 2CXDA 2VKHA 3GMIA 4ISTA 4UELA 4DNDA 1BXWA 1QJ9A 4KRAA 3RPUA 3WI4A 3AA7B 3PUAA 2CXLA 3DTOA 4GK5E 4QXHB 3T0SA 2NTXA 3KV6A 3ONXA 2W62A 4HE8A 2K4TA 5FNVE 4XAXB 3O4XE 2J1NA 3NSGA 2D0UA 2Q9QD 3UULA 4XZCA 3PORA 2PG8A 1EZ3A 2N9DA 3VE1A 2QA7A 1FMWA 2NWBA 2LM9A 2ZM8A 3C51A 4RLBA 4EYUA 2W80C 4FZLA 5DL5A 2WBLA 3UU2A 3KBUA 3LG7A 4O3ZA 5EK4A 4MHCA 4IE6A 2WSSV 4TX5A 3GWHA 3DJBA 1D1BA 3PRNA 4KR4A 1HG5A 1FMVA 3KFWX 4TV9E 4E1SA 2ZM0A 2UXNB 2XAFB 2Y8DA 3FHNA 3PU8A 4EXTA 4AYDC 3SZVA 3O1HA 2Y0KA 4CQIA 4AUIA 1Z0PA 1ZV4X 4ZI2D 2RA1A 2XASB 4EOZB 4ZHQE 3I9YA 3VKGA 5DQVA 3HOEA 2MOZA 5IYZE 3B57A 2L9QA 2H7OA 2X9YA 2A2FX 2NW8A 3A5XA 1US7B 2LSJA 1HF8A 3OBVE 4KUMB 5JR9A 2L8KA 5JDPA 1ORMA 2QTKA 2XAQB 4AKLA 1LKXA 2E9XC 4AYID 3CX6B 2D0TA 3QC9A 2CLYC 5EK3A 1HFAA 3ZJ1A 1P4TA 2YEVC 1HG2A 3ZCIA 5CA1E 3EVYA 3IBPA 2K24A 4O8SA 2ACXA 4RJXA 4DO0A 3ZMSB 2M06A 5LP6E 4O2AE 2VK9A 2LHNA 3LK42 2CCQA 1MIYA 3UFEA 3K19A 4ZI2C 2W0GA 2W00A 2Y6XA 4FUVA 4AFKA 2DNXA 2CLYB 1QJ8A 3QRCA 3Q2MA 3V8UA 2C5KT 4D5UA 2J4UP 1IJ5A 5J2TE 2BVLA 2H3RA 3MXZA 1Q9GA 3PQSA 3E0ZA 3CMLA 4RJWA 2CA5A 2C0SA 3SS1A 4UEMA 2XTRA 1UX5A 1X79A 2LE8A 2YK0A 2FGQX 4GYSA 2ZFGA 2F1TA 2WAUA 3T20A 2V7JA 4O4LE 5JDMA 5DQWA 5F8PA 4D65A 3O0EA 2HPJA 2X0LB 5LBMA 4EIWA 3SRZA 2C5JA 4OYJA 3U78A 2XE2A 2YNKA 3GP6A 2D2SA 3VZWX 4L9IA 4FRXA 3RBHA 4G63A 4TZ4C 2E9XA 3AVSA 2ODUA 3ZCJA 2KZ7A 2XAGB 4X1IE 3DA4A 4H9NC 3C5OA 1YS5A 3HA4A 4FZNA 5JREA 1GFQA 1OWAA 2DHRA 4JEUB 2VASA 1QJPA 2LSIA 3EDVA 3UAQA 2IAKA 4FSOA 3IF8B 4H9OC 4V1Av 4PFOA 4TUYE 3UT5E 3CX8B 4XNKA 4GF4A 4MLKA 1ZHYA 3TKLB 2YU2A 5HXSA 3UTKA 2LSKA 3AAAA 2W61A 3DP7A 5HAXA 3FXDB 4FESA 5JDNA 3N9OA 2H7VC 2DWKA 3N9LA 4QHOA 4PJLA 2MNHA 4LSEA 5JDHA 4IE7A 4PJJA 2LHRA 4IE0A 3ZPOA 4FMSA 4CI2B 3VY8X 3O1IA 2ZMAA 2EHOC 5DJQC 4U9CA 3E08A 3NRXA 3ZJ2A 3AAIA 1HTJF 1Q9FA 4YFSA 4P09A 4I43B 2E9XB 1HCIA 4GOUA 2JPFA 2KZ7B 3PUQA 4KBMB 3OJAA 5L3CB 3F57A 2PRNA 5PRNA 4AXPA 4AI6A 4I50E 4QQ1A 1D0XA 5LNKA 1BT9A 2CXFA 1IJ6A 3A2SX 3FBZA 4YJ2E 1VRBA 3UUNA 3AA0A 4KR8A 3B13A 2V7MA 3N9PA 2EHOA 3I1AA 3ZMTB 4EZ4A 2XMXA 3PTRB 4JUYA 4YHJA 1U5PA 2NW7A 3RC3A 3ZC0A 4HTEA 4AYMC 1LVKA 2CM0A 3C64A 3O1JA 3RC8A 2M67A 4ZI7E 3LFMA 3AAAB 2W81C 4O3XB 2HPLA 2X66A 3PUGA 4PJMA 3N9MA 1BR4A 4E1TA 1WR6A 4B61A 5L3DB 1WRDA 5E0OA 2LOSA 3R6NA 5EZYE 4ZS2A 5JRCA 1MM4A 4AKMA 4AQGA 5DL8A 3M65A 3P8CD 2VKDA 4UIGA 4G76A 4JLEA 2ZM2A 3ZC1A 4FOZA 2LSGA 2XQYA 3AVRA 1WYCA 4MBQA 3ZYMA 5C8YE 3N2OA 2MHLA 4UVBB 5A1LA 4RLCA 2BDEA 2XG6A 2IC9A 2ZLYA 2O4VA 4QXBB 2NW9A 3ZYKA 3BK9A 5FVNA 5DABA 5FXXA 2IW5B 4UF0A 4O4XA 3E22E 4O3YA 5GONE 5EE2A 2V7LA 2CEAA 3MZKB 3GN5A 2LHFA 2FGRA 2SPCA 2ES0A 5HXCA 5EK2A 5D5DA 3SYSA 3C98B 3WAKA 4H9RC 1CUNA 5HXRA 1YD8G 4PW8A 3VZTX 4FI5A 3RH3A 1SA0E 2JMMA 3SOLA 5LCYA 2LSYA 3BQIA 1KK7A 3GA8A 5L3BB 1WLXA 1ZHCA 4AKRB 4U74A 5FYMA 3N9NA 4C90A 4CI3B 1ZHTA 4UVAB 2CE7A 4QXCB 5IYUA 3G7GA 5FXWA 4BJMA 5BMVE 1YKHB 1HXTA 3F31A 3C50A 3FXEB 3PE0A 1ZKEA 3POQA 3SZDA 5LBQB 3POXA 5FXZA 4FJOA 5JDLA 4K0UA 5LGTB 4OK0A 4AYEC 4O4JE 2KXPB 3JC6D 2CWYA 2KDYA 3LK2A 3WI5A 3MA9A 2XTQA 3RYHE 3KVDD 3PQUA 4YLHA 1ZHWA 3VE2A 2X9HA 3ETUA 5LOVE 4LSFA 3OKQA 2KINB 1NAFA 4CXWA 2UXXB 4FZMA 5CB4E 4J2CA 3PURA 5HXHA 4FSPA 4AKRA 1UCUA 3F2EA 3ZMZB 5LHIB 4LSHA 1LVFA 3CKDA 1GFPA 5JQGE 1ZHXA 4FT6A 4HKAA 3LK41 4N59A 2VKOA 5FY0A 2JMKA 4EB6E 4F4BA 2L3LA 4GIWA 1NWMX 1MNDA 1THQA 3O9XA 1IAPA 4N78D 5LXTE 4ZS3A 2K9AA 4DMVA 2K5BB 4M1PA 2IC6A 3MKDA 3FB2A 5L3GB 1OSMA 3ZN0B 5HWXA 5DL7A 1FIOA 2V26A 2V1DB 1S94A 4I55E 2N1GA 4TN7B 3JC6C 4C91A 3OYZA 4P0BA 4CXXA 2XE1A 5JDFA 3KBTA 3K3NA 5GV0A 4BJNA 4CZZB 3LK2B 4EAHA 5J2UE 2V7IA 4PNIA 5ETWA 3KV4A 1KNZA 2LJLA 2DLRA 2X9WA 4MALA 4A56A 2YINA 4X20E 4QX7B 4GYRA 4DBRA 3D0TA 5LJMA 1AJ3A 2A3DA 1PRNA 3HWBA 3ZYLA 3R84B 2KLQA 3RYCE 5KDMC 2F1VA 3HKDE 3LJCA 1GFMA 1YKEB 2MYSA 3HW9A 3C4XA 3T24A 4E7ZA 4HFVA 5M4YA 3V5SA 1MMAA 1D0YA 1MM5A 2NP9A 3RRCA 3NBXX 4P0AA 4H63H 5KX5E 3VZUX 3QK6A 4CXYA 1G8XA 4N58A 4IE5A 1MMGA 4AYNA 2PJQA 4ILUA 1V9DA 2LT3A 4ASKA 5TAOA 3L09A 3N2GE 2MBGA 4LSIA 5L2LA 7PRNA 4DVDA 3RRWA 2N2MA 3HL6A 3KVAA 5JR9C 4NUUA 6PRNA 2WWUA 5FMNA 3BQLA 3AAEA 5DL6A 2XUEA 2Y0HA 2Y2XA 3VKHA 3U3IA 4L5GA 2YPVA 3AA1A 2JJ9A 1Y64B 4ZI3C 1MPFA 3AA7A 3AA6B 3POUA 4CI1B 3RKOA 1G73A 2KNDA 2PFVA 3MACA 2OA5A 2NTYA 4ERRA 2K0LA 4RL9A 3CX7B 4JFBA 5T5FA 3HI2A 2KWIB 3HKEE 4FRTA 4ZOLE 5AFUK 5J1GA 4GCQA 3EDUA 4WW0A 3ZMVB 3N9QA 4OFZA 4O3WA 4EYYR 3J7Yq 3MJXA 3FBLA 3L3PA 3VHLA 4AQFC 3S4UA 2LFUA 2Y7SA 1G90A 2WMNA 2Y48B 4XNLA 4JEHB 3WAJA 2EHOD 1QSDA 4XBFB 2N2NA 4GCSA 1LRZA 4Z8XA 1GFOA 3ANWB 4ISSA 4G2AA 3VU7H 2PBIA 2X9XA 5ADXK 3AA1B 4BAYB 1HXXA 3AA6A 3CQCB 1FEWA 4QX8B 2P9BA 2WM9A 1HX8A 3CQGB 1WYBA 2KMFA 2Q9QA 2VL8A 3Q5XA 1GFNA 3HR0A 4B6XA 3KVBA 3N2KE 4BA9A 4HGAA 5JR9B 3NRYA 3TZGA 2CMRA 3P7IA 4AKHA 2B1EA 1OPFA 2X51A 1MMDA 2V7KA 3H3AA 3QUJA 1D1AA 4PAGA 4QKNA 2PORA 3PUSA 2LOPA 1YW0A 4I4TE 5FXVA 4O4UA 1ZEEA 2A72A 3MK7C 4WBNE 4IGUA 4H9SE 4IDZA 5LGNB 3C4ZA 4GHBA 4HEAA 4H63V 2LEHA 4UF0B 3I0OA 5G26A 3ANWA 4OHFA 4AKGA 5HXEA 3GN5B 5JDGA 2I59A 4O49A 2KT9A 5FP3A 2OMFA 3UUXB 1S35A 4PK4A 4F6RC 5LYJE 2Q9QB 3EUHA 4ZI3D 3K3OA 3KV5A 2CWOA 1MNEA 3WI3A 3OYXA 2BZBA 3QRAA 5AFUL 2GE4A 2KWHA 4AZLA 2G0UA 8PRNA 2JMHA 3Q9DA 3SYBA 2MTQA 5IHYA 1BR1A 3LBXB 1VOMA 2DCFA 1O3XA 2X27X 4BUMX 3VY9X 5F3JA 3SY9A 2HH7A 4PK6A 1SHZC 2ODJA 1IZNB 2Z6EA 3EMNX 3ETVA 4IHJE 1PHOA 2KXPA 5JDQA 2N2LA 3NZQA 3Q5WA 4ANJA 1B7TA 4E7SA 1E1HB 3RYIE 3ZN1B 5H6QB 5HYAA 4DMWA 3KINB 2DWGA 4C69X 4H9PC 1H7CA 4GK0E 2XE5A 4QWNB 3J9X1 3H37A 3AB3B 5LJNA 2JRKA 4D64A 4TV8E 1E54A 4UVCB 4WNKA 1ZHZA 1UX4A 3T8OA 1U4QA 3HKBE 2BVMA 2X67A 4X1YE 2M07A 2RP4A 2VB6A 2XAJB 2QGSA 4OYKA 5JVDE 3UUMA 4ADZA 2GK9A 3LK3A 3ZEFB 4X1KE 4O4IE 4GCPA 2VKJA 5L3FB 2ERVA 2J1DG 1D1CA 4EZHA 4IIJE 3V5UA 3LBXA 3BQKA 3C4WA 2XTLA 4KMCA 4UV8B 2E8IA 4AQFA 3DA3A 3ZLIA 4PFPA 3HKCE 1D0ZA 3FYXA 1IZNA 2NOXA 1QUUA 1T98A 3CPZA 2XE3A 1HS7A 4O4HE 3AA0B 1BR0A 2Y0LA 1HXUA 2K48A 2XHEB 2EHOB 4WBOA 2C5IT 4PJNA 4H9QC 2X68A 3IEEA 5FY7A 5H6RB 3PDYA 5LG4A 4YJ3E 5LA6E 1MMNA 3I9WA 3SWHA 3K3QC 3NZPA 4O2BE 4MFRA 1BH3A 5LGUB 3KDSE 2Q9QC 3KV9A 4U72A 5ADXL 3IHRA 1MIVA 3RX6A 4DBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AA7 B;  3LK3 B;  3AA1 B;  2KZ7 A;  3AA6 A;  1IZN B;  3LK4 2;  2KXP B;  3LK2 A;  2KXP A;  5AFU K;  2KZ7 B;  1IZN A;  4AKR B;  3LK2 B;  3AA0 B;  3AA0 A;  4AKR A;  5AFU L;  3LK4 1;  3AAA A;  3AAE A;  3AAE B;  3LK3 A;  3AA1 A;  3AAA B;  3AA7 A;  5ADX L;  3AA6 B;  5ADX K; 
#chains in the Genus database with same CATH topology
 4DR5 T;  2W63 A;  4DV0 T;  3CIR A;  2ODV A;  3P4P A;  1BR2 A;  4JCH A;  2ZLD A;  4PK5 A;  3AEC A;  1H6S 1;  3HOL A;  2BBH A;  4KP3 C;  3I0Q A;  2AXD S;  3CVR A;  3W15 B;  3RYF E;  4DV6 T;  1BXW A;  2AXT O;  3AA7 B;  2K4T A;  3UUL A;  2WQY A;  2IWW A;  2QA7 A;  4DID B;  1FMW A;  1Z8U A;  2W80 C;  2WBL A;  3KBU A;  4WZX A;  1XZY A;  3PGS A;  2WSS V;  3GWH A;  3PRN A;  2WJQ A;  4JI5 T;  4KR4 A;  1FMV A;  1W0B A;  2XAF B;  3O1H A;  4EOZ B;  3I9Y A;  5IYZ E;  2L9Q A;  2NW8 A;  5HCM A;  1US7 B;  3P4W A;  5JDP A;  2E9X C;  2YEV C;  3ZCI A;  4C00 A;  2K24 A;  2RPA A;  4HFC A;  3TLV A;  4KHP T;  4D5U A;  3QRC A;  5L4H A;  1IJ5 A;  3PQS A;  2C0S A;  3SS1 A;  4UEM A;  2F4V T;  4NXN T;  4IDQ A;  3UQ7 A;  2V7J A;  3ZT6 A;  3GP6 A;  2YNK A;  2D2S A;  4FRX A;  4B3T T;  3DA4 A;  5JRE A;  1HX1 B;  2WS3 A;  3EDV A;  3AEE A;  5ABG A;  3IF8 B;  2YU2 A;  2W61 A;  3EHZ A;  3DP7 A;  5JDN A;  2DWK A;  3N9L A;  4PJL A;  2YDR A;  2MNH A;  4HWC A;  4IE7 A;  5HEO A;  3FZF B;  4FMS A;  3O1I A;  3AE7 A;  5DJQ C;  4U9C A;  3NRX A;  3RIA A;  3AAI A;  1HTJ F;  3ZJ2 A;  4YFS A;  1N32 T;  3F57 A;  1IBK T;  4I50 E;  1M62 A;  1VRB A;  3UUN A;  3AA0 A;  4O3X B;  4EZ4 A;  2EHO A;  3I1A A;  3AE8 A;  4HFI A;  3AE9 A;  2CM0 A;  1Y01 A;  4ZI7 E;  3AAA B;  2W81 C;  2HPL A;  1KEY A;  4P1N A;  4B61 A;  5L3D B;  3R6N A;  5EZY E;  4ZS2 A;  3ONJ A;  4K3B A;  3M65 A;  3P8C D;  4ZEY A;  4G76 A;  4LMK A;  5C8Y E;  4GHB A;  2BDE A;  2XG6 A;  4U7Y A;  3BK9 A;  2LLY A;  3E22 E;  2V7L A;  5FL1 A;  2LHF A;  2FGR A;  3SYS A;  2ES0 A;  5EK2 A;  2R6G F;  3C98 B;  4TWF A;  3RH3 A;  5LCY A;  2R4O A;  4JBW F;  1KK7 A;  1ZHC A;  5ABH A;  4UVA B;  3ZSS A;  5IYU A;  5F5W A;  5FVK A;  5BMV E;  1HXT A;  3F31 A;  3C50 A;  3POQ A;  3SZD A;  5LBQ B;  1IBM T;  4K0U A;  5LGT B;  2J47 A;  4PJ0 O;  3UU5 A;  3KVD D;  3PQU A;  4CTD A;  4J2C A;  3PUR A;  3KZI O;  3QNU A;  5LHI B;  4X66 T;  1LVF A;  1ZHX A;  4DV5 T;  5FY0 A;  2JQ9 A;  4X64 T;  3JCU O;  2OV9 A;  1IAP A;  1OSM A;  2I6H A;  2WZH A;  3FB2 A;  1I6Z A;  5L3G B;  5HWX A;  4I55 E;  1S94 A;  4TN7 B;  2N1G A;  2A9U A;  3JC6 C;  3OYZ A;  4P0B A;  4CXX A;  2XE1 A;  1QLB A;  3KV4 A;  3D0T A;  2A3D A;  1KNR A;  3AE1 A;  3HKD E;  4NXM T;  1YKE B;  3C4X A;  3T24 A;  4E7Z A;  4HFV A;  5AQN B;  1MM5 A;  2WU5 A;  2NP9 A;  3JAE A;  3NBX X;  3FZL B;  4IE5 A;  2WDR A;  1MMG A;  4YSY A;  2PJQ A;  1V9D A;  2R89 A;  5TAO A;  3L09 A;  2MBG A;  4LSI A;  2N2M A;  3AE4 A;  4ZZC A;  2UXC T;  2V6X A;  2E5V A;  2Y2X A;  1Y64 B;  3AA6 B;  4CI1 B;  3RKO A;  2H89 A;  3ZT5 A;  2NTY A;  4U2Y A;  1UUR A;  3HI2 A;  5J1G A;  4LF8 T;  4OFZ A;  4EYY R;  2IML A;  2LFU A;  1R8I A;  3QB5 A;  3S4U A;  2WMN A;  1QSD A;  4XBF B;  4GCS A;  1LRZ A;  4Z8X A;  1GFO A;  4ISS A;  2X9X A;  2D9D A;  2BS4 A;  3CQC B;  2P9B A;  2WM9 A;  1HX8 A;  3CQG B;  1WYB A;  4ILB A;  5LG3 A;  2VL8 A;  3AEB A;  4BA9 A;  4YTN A;  4AKH A;  3H3A A;  4QKN A;  2POR A;  3MK7 C;  4IDZ A;  3C4Z A;  4LF6 T;  4UF0 B;  3WU2 O;  4CN4 A;  5FP3 A;  5LMN T;  4EEB A;  3KV5 A;  4Q25 A;  5AFU L;  4QH1 A;  5HEG A;  4AZL A;  3Q9D A;  3UQ4 A;  2BG9 A;  2MTQ A;  1O3X A;  2X27 X;  4BUM X;  2BKO A;  1HNX T;  1IZN B;  5J0Z A;  2Z6E A;  3EMN X;  4IHJ E;  1PHO A;  4LF4 T;  2LM2 A;  3NZQ A;  4ANJ A;  1B7T A;  4E7S A;  3ZN1 B;  5FVL A;  1H7C A;  2UXB T;  3J9X 1;  2JRK A;  4TV8 E;  3RIF A;  4WNK A;  2M07 A;  2X67 A;  2XSA A;  4X1Y E;  2XAJ B;  3UUM A;  1T16 A;  3ZEF B;  4X1K E;  1D1C A;  3V5U A;  2V8S V;  4QH5 A;  4UV8 B;  3HKC E;  3CK6 A;  2ACZ A;  1QUU A;  2XE3 A;  3AA0 B;  1BR0 A;  2XHE B;  2EHO B;  4WBO A;  2C5I T;  3PDY A;  1KF6 A;  4YJ3 E;  1MMN A;  3K3Q C;  3ZST A;  5LGU B;  4U72 A;  4UV9 B;  3IHR A;  2QVA A;  4DR6 T;  5G39 A;  1ZP0 A;  2XAH B;  2E9X D;  4L0R A;  1X9B A;  3ONL C;  4PUX A;  3NKZ A;  1T72 A;  2CBI A;  2JQK A;  5BR8 T;  2DI4 A;  4JI1 T;  4IE4 A;  4DV3 T;  1MIW A;  3CWZ B;  1OXZ A;  3PV0 F;  5L3E B;  3K8P C;  3PU3 A;  3ESL A;  2QYW A;  4UEL A;  4IST A;  3WI4 A;  3PUA A;  2CXL A;  4QXH B;  4XAX B;  1I94 T;  3AEA A;  2D0U A;  2X0H A;  2YDQ A;  2PG8 A;  2LM9 A;  4YTM A;  4AIU A;  3UU2 A;  4O3Z A;  2XQ5 A;  4IE6 A;  1D1B A;  3L39 A;  3KFW X;  3PU8 A;  4EXT A;  3SZV A;  4AUI A;  4ZI2 D;  1S5L O;  3HOE A;  3B57 A;  4JI6 T;  2X9Y A;  2F1C X;  3OBV E;  4KUM B;  5JR9 A;  4AYI D;  3CX6 B;  2D0T A;  1HG2 A;  4O8S A;  3IBP A;  3RI5 A;  2VK9 A;  2LHN A;  4CN1 A;  5AQF B;  3UFE A;  3AXJ B;  3K19 A;  4LF9 T;  2W00 A;  2DNX A;  2CLY B;  3Q2M A;  3P4R A;  3UU6 A;  3E0Z A;  3SFD A;  2LE8 A;  1X79 A;  2YK0 A;  2ZFG A;  4GYS A;  4HWD A;  3X1D A;  2WVP A;  2WAU A;  5JDM A;  2C5J A;  3U78 A;  4G63 A;  3P4S A;  1E2A A;  3ZCJ A;  2KZ7 A;  2XAG B;  1YS5 A;  1GFQ A;  1OWA A;  2DHR A;  1QJP A;  2VAS A;  2LSI A;  3UT5 E;  4GF4 A;  2LSK A;  3AAA A;  4JI3 T;  5HAX A;  2R4L A;  4QHO A;  5JDH A;  3VY8 X;  4CI2 B;  5CJ5 A;  3E08 A;  4A97 A;  3OJA A;  3VR8 A;  2CXF A;  1IJ6 A;  3A2S X;  1VCT A;  3FBZ A;  4KR8 A;  2XMX A;  3PTR B;  4YHJ A;  3RC3 A;  2NW7 A;  3ZC0 A;  5AQV B;  1NEK A;  3N9M A;  5AQG B;  5JRC A;  2VKD A;  3TLU A;  4JLE A;  4FOZ A;  3V8U A;  5AQK B;  1T8B A;  4UVB B;  4RLC A;  2IC9 A;  2O4V A;  2WDQ A;  1W0A A;  4YHH T;  5FVN A;  3ABV A;  4DR4 T;  4UF0 A;  1UUS A;  4O3Y A;  5EE2 A;  5HXC A;  4H9R C;  5HXR A;  4PW8 A;  3VZT X;  3BQI A;  3ZT7 A;  5FYM A;  4WYV A;  5L47 A;  2KSR A;  4C90 A;  4CI3 B;  1VCS A;  2LKG A;  4QXC B;  4TWD A;  1YKH B;  2WDV A;  3POX A;  5JDL A;  4AYE C;  2XQ9 A;  3LK2 A;  3WI5 A;  3VR9 A;  4N75 A;  2XTQ A;  4U7I A;  3VE2 A;  1ZHW A;  2X9H A;  4LSF A;  3OKQ A;  2WWV A;  4LSH A;  5JQG E;  4N59 A;  4HKA A;  1GQE A;  1THQ A;  5LXT E;  4ZS3 A;  4DMV A;  2K5B B;  2IC6 A;  3MKD A;  3RF1 A;  1XMQ T;  1FIO A;  4Z91 A;  5JDF A;  3KBT A;  5GV0 A;  3QB5 K;  5J2U E;  2V7I A;  1KNZ A;  2XY8 B;  2DLR A;  1PRN A;  2YIN A;  4QX7 B;  4GYR A;  4DBR A;  1AJ3 A;  4DUZ T;  3ZYL A;  3R84 B;  2F1V A;  3RYC E;  5B66 O;  4EGW A;  3HW9 A;  3TLT A;  5M4Y A;  3V5S A;  1OED B;  3RRC A;  3UU3 A;  3QK6 A;  4Z90 A;  4N58 A;  4AYN A;  4ASK A;  3N2G E;  3AED A;  5L2L A;  7PRN A;  6PRN A;  1SE7 A;  3VRB A;  2WWU A;  3BQL A;  3H3M A;  2WB5 A;  2XUE A;  3U3I A;  4ZI3 C;  3POU A;  2BBJ A;  2PFV A;  2K0L A;  1WR0 A;  5T5F A;  4ZOL E;  5KAF O;  4WW0 A;  3N9Q A;  3VHL A;  2Y7S A;  2MAW A;  2Y48 B;  3WAJ A;  2EHO D;  3JAD A;  4C4V A;  4G2A A;  2PBI A;  3P50 A;  2BKN A;  3NVO A;  4BAY B;  3AA6 A;  4KI0 F;  1N36 T;  4QX8 B;  1W9R A;  2Q9Q A;  3Q5X A;  3TZG A;  2CMR A;  3P7I A;  2X51 A;  1MMD A;  5AQJ B;  3RBH A;  1D1A A;  3PUS A;  4O4U A;  1YW0 A;  3PUX F;  4I4T E;  2ZM6 T;  3DWO X;  4WBN E;  4IGU A;  4HEA A;  3I0O A;  5HXE A;  3GN5 B;  2KT9 A;  1J1J A;  2PTF A;  5L4E A;  2FUP A;  3PUW F;  2CHO A;  4PK4 A;  4DR3 T;  2YKS A;  3EUH A;  4ZI3 D;  2FJD A;  1MNE A;  4CN6 A;  2BZB A;  2GE4 A;  2JMH A;  4KX6 A;  1VOM A;  5C3J A;  4EV6 A;  5F3J A;  2ODJ A;  3RHW A;  4U33 A;  5AQU B;  2VUR A;  5JDQ A;  1M7K A;  4YSX A;  2KXP A;  3B5M A;  2N2L A;  5ABF A;  2XE5 A;  4QWN B;  4NIQ A;  3H37 A;  3OVU A;  3A8Y C;  1ZHZ A;  3HKB E;  1U4Q A;  3PF1 A;  1WCR A;  2RP4 A;  2VB6 A;  4OYK A;  3LK3 A;  4JI0 T;  4GCP A;  5L3F B;  2ERV A;  2J1D G;  4EZH A;  5CGM A;  3BQK A;  3C4W A;  2XTL A;  4B3M T;  2XQ8 A;  3FYX A;  1IZN A;  2Y0L A;  3SFE A;  2E5L T;  2K48 A;  2R8A A;  4YTP A;  5LG4 A;  2VQE T;  3I9W A;  4O2B E;  4MFR A;  1BH3 A;  4YSZ A;  4K3C A;  5CA1 E;  5FY1 A;  1XWM A;  4UXN B;  5CA0 E;  3ZMU B;  3FZM B;  1YQ4 A;  5JRC B;  4HWF A;  1OED C;  2WMO A;  4HN9 A;  3CQX C;  3UPG A;  4IL9 A;  5AQR B;  5LHG B;  4UB6 O;  4U31 A;  4UB8 O;  4DND A;  4KRA A;  3DTO A;  4GK5 E;  5FKY A;  4LF7 T;  2UU9 T;  2NTX A;  3ONX A;  2W62 A;  4HE8 A;  4LF5 T;  3NSG A;  2J1N A;  4XZC A;  4F8H A;  3POR A;  4JYA T;  1EZ3 A;  2M6B A;  4RLB A;  4EYU A;  3FZK B;  4FZL A;  4TX5 A;  3DJB A;  2E2A A;  4TV9 E;  4LMJ A;  2UXN B;  4AYD C;  2Y0K A;  1Z0P A;  1ZV4 X;  4ZHQ E;  1N33 T;  3VKG A;  4IDN A;  3RIU C;  2H7O A;  3A5X A;  1L0V A;  1ORM A;  2QTK A;  1LKX A;  5EK3 A;  3ZJ1 A;  1HFA A;  1P4T A;  3PGR A;  5AQI B;  3EVY A;  2HN2 A;  3ZMS B;  1ZOY A;  2M06 A;  4O2A E;  1MIY A;  4HWH A;  5AQM B;  2Y6X A;  4FUV A;  4AFK A;  4KHZ F;  4GKJ T;  3RQW A;  2H3R A;  3MXZ A;  1SUM B;  1Q9G A;  4RJW A;  2CA5 A;  1UX5 A;  2FGQ X;  5KAI O;  3T20 A;  2YN6 A;  5DQW A;  5F8P A;  3O0E A;  2HPJ A;  5LBM A;  4EIW A;  3SRZ A;  3VZW X;  2IHR 1;  2E9X A;  3AVS A;  3C5O A;  4YY3 T;  4JEU B;  1N34 T;  2IAK A;  4FSO A;  4H9O C;  4V1A v;  4TUY E;  4XNK A;  3TKL B;  2OLT A;  3VRA A;  5HXS A;  3UTK A;  4FES A;  2H7V C;  1XNR T;  4LSE A;  2LHR A;  4IE0 A;  2AE9 A;  3ZPO A;  3EAB A;  2EHO C;  3P4Q A;  4P09 A;  4IRE A;  1HCI A;  2JPF A;  2KZ7 B;  5ABE A;  5FL0 A;  1D0X A;  4IL4 A;  3LSV A;  2V7M A;  3UUB A;  4JUY A;  3PGU A;  1U5P A;  2XJ7 A;  4HTE A;  3O1J A;  5HEH A;  2M67 A;  2WY2 A;  3PUG A;  4PJM A;  1BR4 A;  3NJT A;  3Q5E A;  1WRD A;  5E0O A;  2LOS A;  2CHN A;  2XM1 A;  1MM4 A;  5DL8 A;  2V5D A;  4X5T A;  2ZM2 A;  3PJA A;  3ZYM A;  2LSG A;  2XQY A;  3AVR A;  1WYC A;  4MBQ A;  2MHL A;  3N2O A;  3BS0 A;  2ZLY A;  3M3Z B;  4QXB B;  3AE6 A;  5FXX A;  4X62 T;  4O4X A;  5GON E;  4FZN A;  2CEA A;  3MZK B;  3GN5 A;  4AKM A;  2SPC A;  3EI0 A;  4FI5 A;  2LSY A;  3GA8 A;  2BS3 A;  4AKR B;  3G7G A;  2HHH T;  3TLS A;  5FXW A;  2JQY A;  5TIS O;  3PE0 A;  1ZKE A;  5FXZ A;  4U3C A;  2KXP B;  5IWA T;  2CWY A;  1J5W A;  3RYH E;  2YOE A;  4YLH A;  3ETU A;  5LOV E;  2WJR A;  2KIN B;  1NAF A;  4CXW A;  2UXX B;  4FZM A;  5CB4 E;  1CHU A;  2V6Y A;  4IDP A;  2FJA A;  3CKD A;  1UGO A;  4FT6 A;  3LK4 1;  2JMK A;  1OED A;  1NWM X;  4GIW A;  4HFH A;  4U2Z A;  2XQA A;  3ZN0 B;  2MPK A;  2V1D B;  2WP9 A;  4C91 A;  3AXJ A;  1XNQ T;  3K3N A;  4BJN A;  4CZZ B;  3LK2 B;  4PNI A;  4TNV A;  4MAL A;  4A56 A;  3HWB A;  5LJM A;  5KDM C;  1GFM A;  2JIW A;  3UU4 A;  2VL0 A;  1OED E;  3A7M A;  4P0A A;  4H63 H;  5KX5 E;  4CXY A;  1G8X A;  1YXR A;  2LT3 A;  2R88 A;  4AIS A;  5JR9 C;  4NUU A;  5FMN A;  2YPV A;  1MPF A;  2B76 A;  5AQO B;  3AA7 A;  5CFB A;  1G73 A;  2KND A;  3RQU A;  2OA5 A;  4RL9 A;  3CX7 B;  2KWI B;  3HKE E;  4FRT A;  5AFU K;  2VVN A;  4GCQ A;  4X65 T;  2K3W A;  4HFB A;  3J7Y q;  3MJX A;  4YXD A;  3FBL A;  4AQF C;  1G90 A;  4XNL A;  4JEH B;  3OTO T;  3AE2 A;  3ANW B;  5ADX K;  4OX9 T;  3AA1 B;  2W2U A;  1FEW A;  2KMF A;  4HGA A;  1OPF A;  5AQS B;  2V7K A;  4PAG A;  1ZEE A;  4JI4 T;  2H88 A;  4H9S E;  5LGN B;  4COF A;  1W09 A;  2IUB A;  4H63 V;  2VVS A;  2LKH A;  5G26 A;  2XM2 A;  4O49 A;  5ABF B;  2OMF A;  3JCF A;  1S35 A;  5IUX A;  3AEF A;  5LYJ E;  2Q9Q B;  4ZZB A;  3OYX A;  3QRA A;  2KWH A;  8PRN A;  4AQY T;  1KNP A;  3LBX B;  2HH7 A;  4PK6 A;  4PR7 A;  3AEG A;  3Q5W A;  4DUY T;  1HNW T;  2WZI A;  1E1H B;  3RYI E;  5HYA A;  5H6Q B;  4DMW A;  3KIN B;  2DWG A;  4C69 X;  4GK0 E;  3G06 A;  4EED A;  3AB3 B;  5LJN A;  1E54 A;  1UX4 A;  1JNR A;  3RKG A;  1DU2 A;  2QGS A;  2GK9 A;  2FBW A;  2VKJ A;  5B5E O;  4IIJ E;  4KMC A;  3RLF F;  1HR0 T;  2W4X A;  4AQF A;  1D0Z A;  2NOX A;  1T98 A;  1HS7 A;  4O4H E;  1HXU A;  2X68 A;  3IEE A;  3IA3 A;  5FY7 A;  3RGL A;  2LRK A;  3NZP A;  3KDS E;  2Q9Q C;  3KV9 A;  5ADX L;  2W66 A;  4DBQ A;  3LK3 B;  4Z3T A;  5HWY A;  3SY7 A;  4NUV A;  2JQQ A;  3JTY A;  2BS2 A;  2NR4 A;  5LHH B;  4G75 A;  5KMG P;  4DV2 T;  4AKI A;  2KC0 A;  2VWA A;  2D5U A;  2YU1 A;  2X9K A;  5HCJ A;  5JH7 E;  2XQ6 A;  3AAE B;  3N5L A;  2CXD A;  2VKH A;  3GMI A;  2I0M A;  1QJ9 A;  2QRX A;  3RPU A;  2IDO B;  3JAF A;  3KV6 A;  3T0S A;  5FNV E;  4NPP A;  3O4X E;  2Q9Q D;  3EAM A;  3ZKR A;  3VE1 A;  2N9D A;  2NWB A;  2ZM8 A;  4DV1 T;  3C51 A;  5DL5 A;  3LG7 A;  4IL6 O;  4TNW A;  4MHC A;  5EK4 A;  1HG5 A;  2CBJ A;  4E1S A;  2ZM0 A;  4C4V B;  2HN1 A;  2Y8D A;  3FHN A;  4CQI A;  2RA1 A;  2XAS B;  3PUV F;  3NWI A;  5DQV A;  2MOZ A;  1J5E T;  2J62 A;  2A2F X;  3AE3 A;  2LSJ A;  1HF8 A;  2V6Y B;  2L8K A;  2XAQ B;  4AKL A;  4JV5 T;  3QC9 A;  2CLY C;  3T1Y T;  2ACX A;  4RJX A;  4DO0 A;  1JNZ A;  5LP6 E;  1YQ3 A;  1WFD A;  3LK4 2;  2CCQ A;  2IWV A;  4JI8 T;  4ZI2 C;  2W0G A;  1QJ8 A;  3BRZ A;  2C5K T;  2J4U P;  5J2T E;  2BVL A;  2M6I A;  3CML A;  2XTR A;  2F1T A;  4O4L E;  4D65 A;  5G38 A;  2X0L B;  2XE2 A;  4OYJ A;  4L9I A;  4TZ4 C;  2ODU A;  2XZE A;  4X1I E;  4H9N C;  1XDP A;  3QOF A;  2JQH A;  2IIU A;  2WU2 A;  3HA4 A;  1T7S A;  3UAQ A;  2WCA A;  5C2T A;  2UUA T;  4PFO A;  3CX8 B;  4MLK A;  1ZHY A;  4HFE A;  3FXD B;  5KXJ A;  4JI7 T;  3N9O A;  4PJJ A;  4LFB T;  2ZMA A;  5LMU T;  1Q9F A;  4I43 B;  2E9X B;  4DR2 T;  4GOU A;  3PUQ A;  4KBM B;  5L3C B;  2PRN A;  5PRN A;  4AXP A;  4AI6 A;  4QQ1 A;  1HNZ T;  1BT9 A;  5LNK A;  4YJ2 E;  1T1L A;  1NEN A;  3B13 A;  3A0B O;  3N9P A;  3ZMT B;  4AYM C;  1LVK A;  3C64 A;  3RC8 A;  4IDO A;  3LFM A;  2X66 A;  2VQF T;  4E1T A;  1WR6 A;  4B3R T;  4AQG A;  4UIG A;  3FZH B;  3ZC1 A;  4LML A;  5A1L A;  3OPC A;  3Q5D A;  2NW9 A;  3ZYK A;  3LDQ B;  5DAB A;  2IW5 B;  2BG9 E;  1XDO A;  5AQQ B;  3L8R A;  5D5D A;  3WAK A;  1CUN A;  1YD8 G;  2JMM A;  1SA0 E;  3SOL A;  5L3B B;  1WLX A;  2FJB A;  4U74 A;  4QH4 A;  4FQE A;  5AQL B;  3N9N A;  1ZHT A;  5AQP B;  2FJE A;  2CE7 A;  1UK5 A;  2X0Y A;  4BJM A;  2BG9 B;  2XQ7 A;  3FXE B;  4FJO A;  2XQ4 A;  4OK0 A;  4A5X A;  3TLW A;  4LFC T;  4O4J E;  3JC6 D;  2KDY A;  3MA9 A;  5GTH O;  4TWH A;  5HXH A;  4FSP A;  4AKR A;  1UCU A;  3F2E A;  3ZMZ B;  1GFP A;  2VKO A;  4EB6 E;  4F4B A;  2L3L A;  1MND A;  5HEU A;  3O9X A;  4N78 D;  2K9A A;  1XMO T;  4M1P A;  3A0H O;  4DV4 T;  3K1S A;  5DL7 A;  4JI2 T;  2V26 A;  4EAH A;  5ETW A;  2LJL A;  4ILA A;  2X9W A;  4X20 E;  4DV7 T;  2LRL A;  2KLQ A;  3LJC A;  3RIU A;  2MYS A;  1FJG T;  5AQH B;  1MMA A;  1D0Y A;  4HFD A;  5H2F O;  3VZU X;  4B3S T;  4ILU A;  2J4G A;  4DR7 T;  3PUY F;  3AE5 A;  5GTI O;  4DVD A;  3RRW A;  3HL6 A;  1E7P A;  3KVA A;  2XPK A;  4A98 A;  3BRY A;  3AAE A;  5DL6 A;  2Y0H A;  3VKH A;  4L5G A;  3AA1 A;  2JJ9 A;  2UXD T;  3MAC A;  4ERR A;  4JFB A;  4DR1 T;  3EDU A;  2BG9 C;  3ZMV B;  4O3W A;  3UU8 A;  3L3P A;  4LFA T;  2N2N A;  2R4P A;  4K0K T;  5LB7 B;  3VU7 H;  2YDS A;  1HXX A;  5AQT B;  3T1H T;  1GFN A;  3HR0 A;  2UUB T;  4B6X A;  3KVB A;  3N2K E;  4GKK T;  5JR9 B;  3NRY A;  4UR9 A;  2B1E A;  3QUJ A;  2LOP A;  5FXV A;  2A72 A;  2XQ3 A;  1IBL T;  2LEH A;  3ANW A;  4OHF A;  4AKG A;  5JDG A;  5G3A A;  2I59 A;  2XSB A;  2R4N A;  4ILC A;  4N74 A;  3UUX B;  4F6R C;  3K3O A;  2CPT A;  2CWO A;  3WI3 A;  3UFG A;  2G0U A;  3SYB A;  5IHY A;  1BR1 A;  3PUZ F;  2DCF A;  3DWN A;  3VY9 X;  3SY9 A;  1SHZ C;  2BKP A;  3ETV A;  4H9P C;  2V5C A;  5JTG A;  4D64 A;  4UVC B;  3T8O A;  2BVM A;  5HEJ A;  5JVD E;  4ADZ A;  4O4I E;  5E79 O;  3LBX A;  2E8I A;  4YT0 A;  3DA3 A;  3ZLI A;  4PFP A;  4I0U A;  4ZXL A;  3DZM A;  3PJA J;  3CPZ A;  2W67 A;  2DL1 A;  4PJN A;  4H9Q C;  5H6R B;  1KFY A;  4IT4 A;  5LA6 E;  2CRB A;  3SWH A;  2UUC T;  4HWI B;  1MIV A;  3RX6 A; 
#chains in the Genus database with same CATH homology
 2XAH B;  5FY1 A;  3LK3 B;  2E9X D;  4UXN B;  4Z3T A;  4L0R A;  5HWY A;  5CA0 E;  3ZMU B;  3SY7 A;  2W63 A;  4NUV A;  2JQQ A;  3JTY A;  5JRC B;  2ODV A;  4UV9 B;  4PUX A;  1BR2 A;  4JCH A;  2WMO A;  2ZLD A;  4PK5 A;  5LHH B;  4G75 A;  5KMG P;  2DI4 A;  4IE4 A;  4AKI A;  1H6S 1;  4HN9 A;  2KC0 A;  3HOL A;  2VWA A;  2D5U A;  1MIW A;  3CWZ B;  3I0Q A;  1OXZ A;  4KP3 C;  3CVR A;  3W15 B;  2YU1 A;  3CQX C;  3UPG A;  5L3E B;  3RYF E;  5LHG B;  5JH7 E;  3K8P C;  3PU3 A;  3ESL A;  3AAE B;  3N5L A;  2CXD A;  2VKH A;  3GMI A;  4IST A;  4UEL A;  4DND A;  1BXW A;  1QJ9 A;  4KRA A;  3RPU A;  3WI4 A;  3AA7 B;  3PUA A;  2CXL A;  3DTO A;  4GK5 E;  4QXH B;  3T0S A;  2NTX A;  3KV6 A;  3ONX A;  2W62 A;  4HE8 A;  2K4T A;  5FNV E;  4XAX B;  3O4X E;  2J1N A;  3NSG A;  2D0U A;  2Q9Q D;  3UUL A;  4XZC A;  3POR A;  2PG8 A;  1EZ3 A;  2N9D A;  3VE1 A;  2QA7 A;  1FMW A;  2NWB A;  2LM9 A;  2ZM8 A;  3C51 A;  4RLB A;  4EYU A;  2W80 C;  4FZL A;  5DL5 A;  2WBL A;  3UU2 A;  3KBU A;  3LG7 A;  4O3Z A;  5EK4 A;  4MHC A;  4IE6 A;  2WSS V;  4TX5 A;  3GWH A;  3DJB A;  1D1B A;  3PRN A;  4KR4 A;  1HG5 A;  1FMV A;  3KFW X;  4TV9 E;  4E1S A;  2ZM0 A;  2UXN B;  2XAF B;  2Y8D A;  3FHN A;  3PU8 A;  4EXT A;  4AYD C;  3SZV A;  3O1H A;  2Y0K A;  4CQI A;  4AUI A;  1Z0P A;  1ZV4 X;  4ZI2 D;  2RA1 A;  2XAS B;  4EOZ B;  4ZHQ E;  3I9Y A;  3VKG A;  5DQV A;  3HOE A;  2MOZ A;  5IYZ E;  3B57 A;  2L9Q A;  2H7O A;  2X9Y A;  2A2F X;  2NW8 A;  3A5X A;  1US7 B;  2LSJ A;  1HF8 A;  3OBV E;  4KUM B;  5JR9 A;  2L8K A;  5JDP A;  1ORM A;  2QTK A;  2XAQ B;  4AKL A;  1LKX A;  2E9X C;  4AYI D;  3CX6 B;  2D0T A;  3QC9 A;  2CLY C;  5EK3 A;  1HFA A;  3ZJ1 A;  1P4T A;  2YEV C;  1HG2 A;  3ZCI A;  5CA1 E;  3EVY A;  3IBP A;  2K24 A;  4O8S A;  2ACX A;  4RJX A;  4DO0 A;  3ZMS B;  2M06 A;  5LP6 E;  4O2A E;  2VK9 A;  2LHN A;  3LK4 2;  2CCQ A;  1MIY A;  3UFE A;  3K19 A;  4ZI2 C;  2W0G A;  2W00 A;  2Y6X A;  4FUV A;  4AFK A;  2DNX A;  2CLY B;  1QJ8 A;  3QRC A;  3Q2M A;  3V8U A;  2C5K T;  4D5U A;  2J4U P;  1IJ5 A;  5J2T E;  2BVL A;  2H3R A;  3MXZ A;  1Q9G A;  3PQS A;  3E0Z A;  3CML A;  4RJW A;  2CA5 A;  2C0S A;  3SS1 A;  4UEM A;  2XTR A;  1UX5 A;  1X79 A;  2LE8 A;  2YK0 A;  2FGQ X;  4GYS A;  2ZFG A;  2F1T A;  2WAU A;  3T20 A;  2V7J A;  4O4L E;  5JDM A;  5DQW A;  5F8P A;  4D65 A;  3O0E A;  2HPJ A;  2X0L B;  5LBM A;  4EIW A;  3SRZ A;  2C5J A;  4OYJ A;  3U78 A;  2XE2 A;  2YNK A;  3GP6 A;  2D2S A;  3VZW X;  4L9I A;  4FRX A;  3RBH A;  4G63 A;  4TZ4 C;  2E9X A;  3AVS A;  2ODU A;  3ZCJ A;  2KZ7 A;  2XAG B;  4X1I E;  3DA4 A;  4H9N C;  3C5O A;  1YS5 A;  3HA4 A;  4FZN A;  5JRE A;  1GFQ A;  1OWA A;  2DHR A;  4JEU B;  2VAS A;  1QJP A;  2LSI A;  3EDV A;  3UAQ A;  2IAK A;  4FSO A;  3IF8 B;  4H9O C;  4V1A v;  4PFO A;  4TUY E;  3UT5 E;  3CX8 B;  4XNK A;  4GF4 A;  4MLK A;  1ZHY A;  3TKL B;  2YU2 A;  5HXS A;  3UTK A;  2LSK A;  3AAA A;  2W61 A;  3DP7 A;  5HAX A;  3FXD B;  4FES A;  5JDN A;  3N9O A;  2H7V C;  2DWK A;  3N9L A;  4QHO A;  4PJL A;  2MNH A;  4LSE A;  5JDH A;  4IE7 A;  4PJJ A;  2LHR A;  4IE0 A;  3ZPO A;  4FMS A;  4CI2 B;  3VY8 X;  3O1I A;  2ZMA A;  2EHO C;  5DJQ C;  4U9C A;  3E08 A;  3NRX A;  3ZJ2 A;  3AAI A;  1HTJ F;  1Q9F A;  4YFS A;  4P09 A;  4I43 B;  2E9X B;  1HCI A;  4GOU A;  2JPF A;  2KZ7 B;  3PUQ A;  4KBM B;  3OJA A;  5L3C B;  3F57 A;  2PRN A;  5PRN A;  4AXP A;  4AI6 A;  4I50 E;  4QQ1 A;  1D0X A;  5LNK A;  1BT9 A;  2CXF A;  1IJ6 A;  3A2S X;  3FBZ A;  4YJ2 E;  1VRB A;  3UUN A;  3AA0 A;  4KR8 A;  3B13 A;  2V7M A;  3N9P A;  2EHO A;  3I1A A;  3ZMT B;  4EZ4 A;  2XMX A;  3PTR B;  4JUY A;  4YHJ A;  1U5P A;  2NW7 A;  3RC3 A;  3ZC0 A;  4HTE A;  4AYM C;  1LVK A;  2CM0 A;  3C64 A;  3O1J A;  3RC8 A;  2M67 A;  4ZI7 E;  3LFM A;  3AAA B;  2W81 C;  4O3X B;  2HPL A;  2X66 A;  3PUG A;  4PJM A;  3N9M A;  1BR4 A;  4E1T A;  1WR6 A;  4B61 A;  5L3D B;  1WRD A;  5E0O A;  2LOS A;  3R6N A;  5EZY E;  4ZS2 A;  5JRC A;  1MM4 A;  4AKM A;  4AQG A;  5DL8 A;  3M65 A;  3P8C D;  2VKD A;  4UIG A;  4G76 A;  4JLE A;  2ZM2 A;  3ZC1 A;  4FOZ A;  2LSG A;  2XQY A;  3AVR A;  1WYC A;  4MBQ A;  3ZYM A;  5C8Y E;  3N2O A;  2MHL A;  4UVB B;  5A1L A;  4RLC A;  2BDE A;  2XG6 A;  2IC9 A;  2ZLY A;  2O4V A;  4QXB B;  2NW9 A;  3ZYK A;  3BK9 A;  5FVN A;  5DAB A;  5FXX A;  2IW5 B;  4UF0 A;  4O4X A;  3E22 E;  4O3Y A;  5GON E;  5EE2 A;  2V7L A;  2CEA A;  3MZK B;  3GN5 A;  2LHF A;  2FGR A;  2SPC A;  2ES0 A;  5HXC A;  5EK2 A;  5D5D A;  3SYS A;  3C98 B;  3WAK A;  4H9R C;  1CUN A;  5HXR A;  1YD8 G;  4PW8 A;  3VZT X;  4FI5 A;  3RH3 A;  1SA0 E;  2JMM A;  3SOL A;  5LCY A;  2LSY A;  3BQI A;  1KK7 A;  3GA8 A;  5L3B B;  1WLX A;  1ZHC A;  4AKR B;  4U74 A;  5FYM A;  3N9N A;  4C90 A;  4CI3 B;  1ZHT A;  4UVA B;  2CE7 A;  4QXC B;  5IYU A;  3G7G A;  5FXW A;  4BJM A;  5BMV E;  1YKH B;  1HXT A;  3F31 A;  3C50 A;  3FXE B;  3PE0 A;  1ZKE A;  3POQ A;  3SZD A;  5LBQ B;  3POX A;  5FXZ A;  4FJO A;  5JDL A;  4K0U A;  5LGT B;  4OK0 A;  4AYE C;  4O4J E;  2KXP B;  3JC6 D;  2CWY A;  2KDY A;  3LK2 A;  3WI5 A;  3MA9 A;  2XTQ A;  3RYH E;  3KVD D;  3PQU A;  4YLH A;  1ZHW A;  3VE2 A;  2X9H A;  3ETU A;  5LOV E;  4LSF A;  3OKQ A;  2KIN B;  1NAF A;  4CXW A;  2UXX B;  4FZM A;  5CB4 E;  4J2C A;  3PUR A;  5HXH A;  4FSP A;  4AKR A;  1UCU A;  3F2E A;  3ZMZ B;  5LHI B;  4LSH A;  1LVF A;  3CKD A;  1GFP A;  5JQG E;  1ZHX A;  4FT6 A;  4HKA A;  3LK4 1;  4N59 A;  2VKO A;  5FY0 A;  2JMK A;  4EB6 E;  4F4B A;  2L3L A;  4GIW A;  1NWM X;  1MND A;  1THQ A;  3O9X A;  1IAP A;  4N78 D;  5LXT E;  4ZS3 A;  2K9A A;  4DMV A;  2K5B B;  4M1P A;  2IC6 A;  3MKD A;  3FB2 A;  5L3G B;  1OSM A;  3ZN0 B;  5HWX A;  5DL7 A;  1FIO A;  2V26 A;  2V1D B;  1S94 A;  4I55 E;  2N1G A;  4TN7 B;  3JC6 C;  4C91 A;  3OYZ A;  4P0B A;  4CXX A;  2XE1 A;  5JDF A;  3KBT A;  3K3N A;  5GV0 A;  4BJN A;  4CZZ B;  3LK2 B;  4EAH A;  5J2U E;  2V7I A;  4PNI A;  5ETW A;  3KV4 A;  1KNZ A;  2LJL A;  2DLR A;  2X9W A;  4MAL A;  4A56 A;  2YIN A;  4X20 E;  4QX7 B;  4GYR A;  4DBR A;  3D0T A;  5LJM A;  1AJ3 A;  2A3D A;  1PRN A;  3HWB A;  3ZYL A;  3R84 B;  2KLQ A;  3RYC E;  5KDM C;  2F1V A;  3HKD E;  3LJC A;  1GFM A;  1YKE B;  2MYS A;  3HW9 A;  3C4X A;  3T24 A;  4E7Z A;  4HFV A;  5M4Y A;  3V5S A;  1MMA A;  1D0Y A;  1MM5 A;  2NP9 A;  3RRC A;  3NBX X;  4P0A A;  4H63 H;  5KX5 E;  3VZU X;  3QK6 A;  4CXY A;  1G8X A;  4N58 A;  4IE5 A;  1MMG A;  4AYN A;  2PJQ A;  4ILU A;  1V9D A;  2LT3 A;  4ASK A;  5TAO A;  3L09 A;  3N2G E;  2MBG A;  4LSI A;  5L2L A;  7PRN A;  4DVD A;  3RRW A;  2N2M A;  3HL6 A;  3KVA A;  5JR9 C;  4NUU A;  6PRN A;  2WWU A;  5FMN A;  3BQL A;  3AAE A;  5DL6 A;  2XUE A;  2Y0H A;  2Y2X A;  3VKH A;  3U3I A;  4L5G A;  2YPV A;  3AA1 A;  2JJ9 A;  1Y64 B;  4ZI3 C;  1MPF A;  3AA7 A;  3AA6 B;  3POU A;  4CI1 B;  3RKO A;  1G73 A;  2KND A;  2PFV A;  3MAC A;  2OA5 A;  2NTY A;  4ERR A;  2K0L A;  4RL9 A;  3CX7 B;  4JFB A;  5T5F A;  3HI2 A;  2KWI B;  3HKE E;  4FRT A;  4ZOL E;  5AFU K;  5J1G A;  4GCQ A;  3EDU A;  4WW0 A;  3ZMV B;  3N9Q A;  4OFZ A;  4O3W A;  4EYY R;  3J7Y q;  3MJX A;  3FBL A;  3L3P A;  3VHL A;  4AQF C;  3S4U A;  2LFU A;  2Y7S A;  1G90 A;  2WMN A;  2Y48 B;  4XNL A;  4JEH B;  3WAJ A;  2EHO D;  1QSD A;  4XBF B;  2N2N A;  4GCS A;  1LRZ A;  4Z8X A;  1GFO A;  3ANW B;  4ISS A;  4G2A A;  3VU7 H;  2PBI A;  2X9X A;  5ADX K;  3AA1 B;  4BAY B;  1HXX A;  3AA6 A;  3CQC B;  1FEW A;  4QX8 B;  2P9B A;  2WM9 A;  1HX8 A;  3CQG B;  1WYB A;  2KMF A;  2Q9Q A;  2VL8 A;  3Q5X A;  1GFN A;  3HR0 A;  4B6X A;  3KVB A;  3N2K E;  4BA9 A;  4HGA A;  5JR9 B;  3NRY A;  3TZG A;  2CMR A;  3P7I A;  4AKH A;  2B1E A;  1OPF A;  2X51 A;  1MMD A;  2V7K A;  3H3A A;  3QUJ A;  1D1A A;  4PAG A;  4QKN A;  2POR A;  3PUS A;  2LOP A;  1YW0 A;  4I4T E;  5FXV A;  4O4U A;  1ZEE A;  2A72 A;  3MK7 C;  4WBN E;  4IGU A;  4H9S E;  4IDZ A;  5LGN B;  3C4Z A;  4GHB A;  4HEA A;  4H63 V;  2LEH A;  4UF0 B;  3I0O A;  5G26 A;  3ANW A;  4OHF A;  4AKG A;  5HXE A;  3GN5 B;  5JDG A;  2I59 A;  4O49 A;  2KT9 A;  5FP3 A;  2OMF A;  3UUX B;  1S35 A;  4PK4 A;  4F6R C;  5LYJ E;  2Q9Q B;  3EUH A;  4ZI3 D;  3K3O A;  3KV5 A;  2CWO A;  1MNE A;  3WI3 A;  3OYX A;  2BZB A;  3QRA A;  5AFU L;  2GE4 A;  2KWH A;  4AZL A;  2G0U A;  8PRN A;  2JMH A;  3Q9D A;  3SYB A;  2MTQ A;  5IHY A;  1BR1 A;  3LBX B;  1VOM A;  2DCF A;  1O3X A;  2X27 X;  4BUM X;  3VY9 X;  5F3J A;  3SY9 A;  2HH7 A;  4PK6 A;  1SHZ C;  2ODJ A;  1IZN B;  2Z6E A;  3EMN X;  3ETV A;  4IHJ E;  1PHO A;  2KXP A;  5JDQ A;  2N2L A;  3NZQ A;  3Q5W A;  4ANJ A;  1B7T A;  4E7S A;  1E1H B;  3RYI E;  3ZN1 B;  5H6Q B;  5HYA A;  4DMW A;  3KIN B;  2DWG A;  4C69 X;  4H9P C;  1H7C A;  4GK0 E;  2XE5 A;  4QWN B;  3J9X 1;  3H37 A;  3AB3 B;  5LJN A;  2JRK A;  4D64 A;  4TV8 E;  1E54 A;  4UVC B;  4WNK A;  1ZHZ A;  1UX4 A;  3T8O A;  1U4Q A;  3HKB E;  2BVM A;  2X67 A;  4X1Y E;  2M07 A;  2RP4 A;  2VB6 A;  2XAJ B;  2QGS A;  4OYK A;  5JVD E;  3UUM A;  4ADZ A;  2GK9 A;  3LK3 A;  3ZEF B;  4X1K E;  4O4I E;  4GCP A;  2VKJ A;  5L3F B;  2ERV A;  2J1D G;  1D1C A;  4EZH A;  4IIJ E;  3V5U A;  3LBX A;  3BQK A;  3C4W A;  2XTL A;  4KMC A;  4UV8 B;  2E8I A;  4AQF A;  3DA3 A;  3ZLI A;  4PFP A;  3HKC E;  1D0Z A;  3FYX A;  1IZN A;  2NOX A;  1QUU A;  1T98 A;  3CPZ A;  2XE3 A;  1HS7 A;  4O4H E;  3AA0 B;  1BR0 A;  2Y0L A;  1HXU A;  2K48 A;  2XHE B;  2EHO B;  4WBO A;  2C5I T;  4PJN A;  4H9Q C;  2X68 A;  3IEE A;  5FY7 A;  5H6R B;  3PDY A;  5LG4 A;  4YJ3 E;  5LA6 E;  1MMN A;  3I9W A;  3SWH A;  3K3Q C;  3NZP A;  4O2B E;  4MFR A;  1BH3 A;  5LGU B;  3KDS E;  2Q9Q C;  3KV9 A;  4U72 A;  5ADX L;  3IHR A;  1MIV A;  3RX6 A;  4DBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...