2KZ8A

Solution nmr structure of mqsa, a protein from e. coli, containing a zinc finger, n-terminal and a helix turn-helix c-terminal domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
131
structure length
131
Chain Sequence
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and biophysical properties of MqsA, a Zn-containing antitoxin from Escherichia coli
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Uncharacterized HTH-type transcriptional regulator ygiT
total genus 18
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15731 MqsA_antitoxin Antitoxin component of bacterial toxin-antitoxin system, MqsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 2kz8A01
4PU7A 2PUDA 4MCTA 2PUBA 2EF8A 3ZHMA 1UXDA 1PERL 1WETA 2KEJA 1ZVVA 2WUSR 2CROA 2WIUB 1YSEA 4I8TA 2XI8A 1BDIA 4Z5HA 3OQMA 2FJRA 2PE5A 3JXBC 1ZUGA 4I6TA 4O8BA 1QP0A 4J1WA 3F52A 3EUSA 3GN5B 2EWTA 3BD1A 1ZZBA 3ZHIA 3KXAA 4X4CA 2IU7A 2LYQA 1ZS4A 2O4AA 1X2LA 3BS3A 2O49A 4X4HA 4YG1A 4IA8A 3OQOA 1BDHA 1DW9A 1UTXA 4X4IA 3SCGA 1RZRD 2HSGA 4FN3A 4I6RA 1CQTA 4Y42A 4PU4C 1AU7A 1QP7A 1ZZ6A 4JCYA 2D5VA 2PUCA 2AWIA 4Z5CA 2XSDC 4Z5DA 2KZ8A 1Y7YA 3PXPA 4X4GA 3UFDA 1LCDA 1RZSA 2KEIA 2LYLA 3D1NI 1LCCA 3FYAA 2GRMA 2BNNA 4FBIA 3L1PA 3CROL 4YG4A 1SQ8A 1E3OC 1IC8A 3ZKCA 3QYXA 3SCHA 1WH8A 2PUGA 3JXCL 5A7LA 3F6WA 1JH9A 3S8QA 3KZ3A 3GN5A 2BNMA 2IVQA 2MQKA 2R1JL 2R63A 2IVBA 1RZRA 2PUFA 2PPXA 4X4EA 1ZZ9A 1NEQA 4JCXA 4GHJA 3MLFA 2LYRA 4Z59A 2O38A 3RZZA 2LYSA 2MEZA 3BDNA 1QPZA 2IV1A 2IUOA 4J1XA 4MCXA 1L1MA 1ADRA 2KEKA 1R63A 1LLIA 1B0NA 2AXZA 2L49A 3DNVB 2AXUA 2H8RA 2LYKA 2LYPA 3GBFA 1HF0A 2AUWA 1EFAA 2BNOA 1LQCA 4X4BA 1ZZ7A 1R69A 1JWLA 1ZZ8A 2AXVA 2PIJA 2GRLA 3LISA 3CLCA 1VPWA 1OCTC 2HINA 3LFPA 3OP9A 1ZAYA 1POUA 1ZZCA 1XWRA 2XJ3A 2B5AA 4I6UA 4YARA 2PUEA 2LYJA 1Y9QA 1S7EA 4IVZA 3IVPA 4F8DA 1OSLA 2IVGA 3U3WA 4IWRA 1QQBA 1UXCA 2XCJA 3OQNA 3G7DA 4GQMA 2GZUA 1DWKA 3F51A 3HZIB 1QP4A 5K98B 2ICPA 1PRAA 1ZPQA 3R1FA 3KJXA 3QF3A 2BJCA 4YG7B 2OR1L 3O9XA 2LCVA 1PRVA 4OB4A 1GT0C 2A6CA 2JVLA 4X4DA 3H5TA 3TRBA 3VK0A 3JXDL 2EBYA 1WH6A 1JFSA 2XIUA 4YBAA 1LMB3 2L8NA 2OFYA 3SCFA 1QQAA 1NERA 2CSFA 1RPEL 4PU8A 2ICTA 1WIZA 2AW6A 3QWGA 1X57A 4X4FA 4JQDA 3B7HA 1O4XA 3QQ6A 2PUAA 3OMTA 4PU3C 2KPJA 3FMYA 3G5GA 1RIOA 4Z58A 1PRUA 3CECA 3FYMA 2JCGA 1PNRA 1CJGA 1JFTA 4NDWA
chains in the Genus database with same CATH superfamily
2PUDA 2L1PA 2KEJA 2WUSR 5GAGi 4I8TA 1BDIA 4Z5HA 3OQMA 4O8BA 3VWSA 1QP0A 3F52A 3GN5B 3BD1A 1ZZBA 3ZHIA 2LYQA 1X2LA 1UTXA 1RZRD 2HSGA 4FN3A 4JCYA 1ZZ6A 2XSDC 4X4GA 4DE8A 5DTRA 3UFDA 3L1PA 4YG4A 3QOWA 3SCHA 4EKIA 1JH9A 3KZ3A 2PUFA 4ER7A 2R1JL 4X4EA 1ZZ9A 1QPZA 4Z59A 3RZZA 2LYSA 3ZPXA 3M9LA 1R63A 3QOXA 2LYKA 3GBFA 2AUWA 2BNOA 4X4BA 3SR4A 2J7UA 2HINA 3LFPA 1POUA 1XWRA 2XJ3A 2B5AA 3LQXA 1Y9QA 4IVZA 4F8DA 1OSLA 4GQMA 2GZUA 3F51A 1PRAA 3KJXA 3QF3A 2BJCA 4OB4A 1JFSA 2OFYA 3SCFA 2ICTA 5DTMA 3QWGA 3SX0A 1X57A 4X4FA 1O4XA 4EKGA 3FYMA 2JCGA 4NDWA 4PU7A 2XXQA 4MCTA 2PXPA 2V3CC 2EF8A 3ZHMA 1UXDA 1PERL 1WETA 1ZVVA 1YSEA 2FJRA 2PE5A 1ZUGA 4HRAA 4J1WA 3EUSA 1ZS4A 3KXAA 4X4CA 2IU7A 2O4AA 4Q2JA 4YG1A 2PXEA 3OQOA 3TFLA 4X4IA 3DM5A 4I6RA 4PU4C 1LCDA 2LYLA 3OKZA 4WVLA 3CROL 2BNNA 1QZXA 1E3OC 3G0TA 4ER6A 1WH8A 3JXCL 2IVQA 3NDBB 4JCXA 1NEQA 4GHJA 3MLFA 2IV1A 2IUOA 2PXBA 2AXZA 2AXUA 2H8RA 3UWPA 1ZZ7A 1R69A 1ZAYA 4YARA 2IVGA 3U3WA 2XCJA 2HFZA 2PXQA 1DWKA 1QP4A 5K98B 2ICPA 3GZDA 1ZPQA 3R1FA 3NZLA 2OR1L 2LCVA 1GT0C 4X4DA 1HQ1A 3VK0A 3JXDL 2EBYA 3MEJA 1LMB3 1RPEL 2J7WA 3B7HA 4PU3C 4Z58A 3CECA 1JFTA 1CQTA 2XXPA 2XXAA 5JUWA 2PUBA 2PXFA 2WIUB 2XI8A 5GAHi 2HCNA 2O49A 5DRYA 4IA8A 4Y42A 1NW3A 1AU7A 1QP7A 4EQZA 2D5VA 2PUCA 2AWIA 4Z5CA 4Z5DA 3PXPA 2PXDA 2KEIA 3D1NI 2GRMA 1SQ8A 1IC8A 3QYXA 2PUGA 5A7LA 3F6WA 3S8QA 2BNMA 1RZRA 2R63A 2MEZA 4J1XA 1ADRA 4OBMA 2LNMA 1LLIA 2L49A 1HF0A 1LQCA 1JWLA 1ZZ8A 3LISA 3CLCA 1VPWA 3OP9A 1ZZCA 3NROA 4I6UA 2LYJA 2M4HA 1S7EA 3IVPA 1UXCA 3A9XA 3HZIB 3GZCA 1DULA 3O9XA 1PRVA 2PXUA 3ME5A 2A6CA 2JVLA 3H5TA 3TRBA 3A9YA 1WH6A 4YBAA 2L8NA 1QQAA 2CSFA 4PU8A 1WIZA 5DTQA 2AW6A 4JQDA 2PUAA 2KPJA 3FMYA 3A9ZA 1PRUA 1PNRA 2MXDA 2LLWA 3GZDC 2PXVA 2CROA 2ODRD 1QB2A 3JXBC 4I6TA 3KL4A 5DT2A 2EWTA 1U2ZA 4ER3A 2HCSA 3BS3A 4X4HA 1BDHA 1DW9A 3SCGA 4DE9A 3NXHA 4EK9A 2KZ8A 1Y7YA 3R09A 1RZSA 1LCCA 2PXLA 3FYAA 4FBIA 2PXKA 3ZKCA 3GN5A 2MQKA 2IVBA 2PPXA 2LYRA 2O38A 3BDNA 2JQEA 4EZIA 4MCXA 1L1MA 3PE5A 4ER0A 2KEKA 1B0NA 3DNVB 2VEOA 3GUUA 2LYPA 1EFAA 2PXTA 2AXVA 2PIJA 2GRLA 1OCTC 2YBDA 5DSXA 2PUEA 5DRTA 4IWRA 1QQBA 3OQNA 1MFQC 3G7DA 2FFHA 3TELA 4YG7B 4ER5A 3QFIA 2LLVA 2XIUA 1NERA 3TEPA 3QQ6A 3OMTA 1RIOA 3G5GA 3OWQA 1CJGA
chains in the Genus database with same CATH topology
4PU7A 2PUDA 4MCTA 2PUBA 2EF8A 3ZHMA 1UXDA 1PERL 1WETA 2KEJA 1ZVVA 2WUSR 2CROA 2WIUB 1YSEA 4I8TA 2XI8A 1BDIA 4Z5HA 3OQMA 2FJRA 2PE5A 3JXBC 1ZUGA 4I6TA 4O8BA 1QP0A 4J1WA 3F52A 3EUSA 3GN5B 2EWTA 3BD1A 1ZZBA 3ZHIA 3KXAA 4X4CA 2IU7A 2LYQA 1ZS4A 2O4AA 1X2LA 3BS3A 2O49A 4X4HA 4YG1A 4IA8A 3OQOA 1BDHA 1DW9A 1UTXA 4X4IA 3SCGA 1RZRD 2HSGA 4FN3A 4I6RA 1CQTA 4Y42A 4PU4C 1AU7A 1QP7A 1ZZ6A 4JCYA 2D5VA 2PUCA 2AWIA 4Z5CA 2XSDC 4Z5DA 2KZ8A 1Y7YA 3PXPA 4X4GA 3UFDA 1LCDA 1RZSA 2KEIA 2LYLA 3D1NI 1LCCA 3FYAA 2GRMA 2BNNA 4FBIA 3L1PA 3CROL 4YG4A 1SQ8A 1E3OC 1IC8A 3ZKCA 3QYXA 3SCHA 1WH8A 2PUGA 3JXCL 5A7LA 3F6WA 1JH9A 3S8QA 3KZ3A 3GN5A 2BNMA 2IVQA 2MQKA 2R1JL 2R63A 2IVBA 1RZRA 2PUFA 2PPXA 4X4EA 1ZZ9A 1NEQA 4JCXA 4GHJA 3MLFA 2LYRA 4Z59A 2O38A 3RZZA 2LYSA 2MEZA 3BDNA 1QPZA 2IV1A 2IUOA 4J1XA 4MCXA 1L1MA 1ADRA 2KEKA 1R63A 1LLIA 1B0NA 2AXZA 2L49A 3DNVB 2AXUA 2H8RA 2LYKA 2LYPA 3GBFA 1HF0A 2AUWA 1EFAA 2BNOA 1LQCA 4X4BA 1ZZ7A 1R69A 1JWLA 1ZZ8A 2AXVA 2PIJA 2GRLA 3LISA 3CLCA 1VPWA 1OCTC 2HINA 3LFPA 3OP9A 1ZAYA 1POUA 1ZZCA 1XWRA 2XJ3A 2B5AA 4I6UA 4YARA 2PUEA 2LYJA 1Y9QA 1S7EA 4IVZA 3IVPA 4F8DA 1OSLA 2IVGA 3U3WA 4IWRA 1QQBA 1UXCA 2XCJA 3OQNA 3G7DA 4GQMA 2GZUA 1DWKA 3F51A 3HZIB 1QP4A 5K98B 2ICPA 1PRAA 1ZPQA 3R1FA 3KJXA 3QF3A 2BJCA 4YG7B 2OR1L 3O9XA 2LCVA 1PRVA 4OB4A 1GT0C 2A6CA 2JVLA 4X4DA 3H5TA 3TRBA 3VK0A 3JXDL 2EBYA 1WH6A 1JFSA 2XIUA 4YBAA 1LMB3 2L8NA 2OFYA 3SCFA 1QQAA 1NERA 2CSFA 1RPEL 4PU8A 2ICTA 1WIZA 2AW6A 3QWGA 1X57A 4X4FA 4JQDA 3B7HA 1O4XA 3QQ6A 2PUAA 3OMTA 4PU3C 2KPJA 3FMYA 3G5GA 1RIOA 4Z58A 1PRUA 3CECA 3FYMA 2JCGA 1PNRA 1CJGA 1JFTA 4NDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PU7 A;  2PUD A;  4MCT A;  2PUB A;  2EF8 A;  3ZHM A;  1UXD A;  1PER L;  1WET A;  2KEJ A;  1ZVV A;  2WUS R;  2CRO A;  2WIU B;  1YSE A;  4I8T A;  2XI8 A;  1BDI A;  4Z5H A;  3OQM A;  2FJR A;  2PE5 A;  3JXB C;  1ZUG A;  4I6T A;  4O8B A;  1QP0 A;  4J1W A;  3F52 A;  3EUS A;  3GN5 B;  2EWT A;  3BD1 A;  1ZZB A;  3ZHI A;  3KXA A;  4X4C A;  2IU7 A;  2LYQ A;  1ZS4 A;  2O4A A;  1X2L A;  3BS3 A;  2O49 A;  4X4H A;  4YG1 A;  4IA8 A;  3OQO A;  1BDH A;  1DW9 A;  1UTX A;  4X4I A;  3SCG A;  1RZR D;  2HSG A;  4FN3 A;  4I6R A;  1CQT A;  4Y42 A;  4PU4 C;  1AU7 A;  1QP7 A;  1ZZ6 A;  4JCY A;  2D5V A;  2PUC A;  2AWI A;  4Z5C A;  2XSD C;  4Z5D A;  2KZ8 A;  1Y7Y A;  3PXP A;  4X4G A;  3UFD A;  1LCD A;  1RZS A;  2KEI A;  2LYL A;  3D1N I;  1LCC A;  3FYA A;  2GRM A;  2BNN A;  4FBI A;  3L1P A;  3CRO L;  4YG4 A;  1SQ8 A;  1E3O C;  1IC8 A;  3ZKC A;  3QYX A;  3SCH A;  1WH8 A;  2PUG A;  3JXC L;  5A7L A;  3F6W A;  1JH9 A;  3S8Q A;  3KZ3 A;  3GN5 A;  2BNM A;  2IVQ A;  2MQK A;  2R1J L;  2R63 A;  2IVB A;  1RZR A;  2PUF A;  2PPX A;  4X4E A;  1ZZ9 A;  1NEQ A;  4JCX A;  4GHJ A;  3MLF A;  2LYR A;  4Z59 A;  2O38 A;  3RZZ A;  2LYS A;  2MEZ A;  3BDN A;  1QPZ A;  2IV1 A;  2IUO A;  4J1X A;  4MCX A;  1L1M A;  1ADR A;  2KEK A;  1R63 A;  1LLI A;  1B0N A;  2AXZ A;  2L49 A;  3DNV B;  2AXU A;  2H8R A;  2LYK A;  2LYP A;  3GBF A;  1HF0 A;  2AUW A;  1EFA A;  2BNO A;  1LQC A;  4X4B A;  1ZZ7 A;  1R69 A;  1JWL A;  1ZZ8 A;  2AXV A;  2PIJ A;  2GRL A;  3LIS A;  3CLC A;  1VPW A;  1OCT C;  2HIN A;  3LFP A;  3OP9 A;  1ZAY A;  1POU A;  1ZZC A;  1XWR A;  2XJ3 A;  2B5A A;  4I6U A;  4YAR A;  2PUE A;  2LYJ A;  1Y9Q A;  1S7E A;  4IVZ A;  3IVP A;  4F8D A;  1OSL A;  2IVG A;  3U3W A;  4IWR A;  1QQB A;  1UXC A;  2XCJ A;  3OQN A;  3G7D A;  4GQM A;  2GZU A;  1DWK A;  3F51 A;  3HZI B;  1QP4 A;  5K98 B;  2ICP A;  1PRA A;  1ZPQ A;  3R1F A;  3KJX A;  3QF3 A;  2BJC A;  4YG7 B;  2OR1 L;  3O9X A;  2LCV A;  1PRV A;  4OB4 A;  1GT0 C;  2A6C A;  2JVL A;  4X4D A;  3H5T A;  3TRB A;  3VK0 A;  3JXD L;  2EBY A;  1WH6 A;  1JFS A;  2XIU A;  4YBA A;  1LMB 3;  2L8N A;  2OFY A;  3SCF A;  1QQA A;  1NER A;  2CSF A;  1RPE L;  4PU8 A;  2ICT A;  1WIZ A;  2AW6 A;  3QWG A;  1X57 A;  4X4F A;  4JQD A;  3B7H A;  1O4X A;  3QQ6 A;  2PUA A;  3OMT A;  4PU3 C;  2KPJ A;  3FMY A;  3G5G A;  1RIO A;  4Z58 A;  1PRU A;  3CEC A;  3FYM A;  2JCG A;  1PNR A;  1CJG A;  1JFT A;  4NDW A; 
#chains in the Genus database with same CATH topology
 2PUD A;  2L1P A;  2KEJ A;  2WUS R;  5GAG i;  4I8T A;  1BDI A;  4Z5H A;  3OQM A;  4O8B A;  3VWS A;  1QP0 A;  3F52 A;  3GN5 B;  3BD1 A;  1ZZB A;  3ZHI A;  2LYQ A;  1X2L A;  1UTX A;  1RZR D;  2HSG A;  4FN3 A;  4JCY A;  1ZZ6 A;  2XSD C;  4X4G A;  4DE8 A;  5DTR A;  3UFD A;  3L1P A;  4YG4 A;  3QOW A;  3SCH A;  4EKI A;  1JH9 A;  3KZ3 A;  2PUF A;  4ER7 A;  2R1J L;  4X4E A;  1ZZ9 A;  1QPZ A;  4Z59 A;  3RZZ A;  2LYS A;  3ZPX A;  3M9L A;  1R63 A;  3QOX A;  2LYK A;  3GBF A;  2AUW A;  2BNO A;  4X4B A;  3SR4 A;  2J7U A;  2HIN A;  3LFP A;  1POU A;  1XWR A;  2XJ3 A;  2B5A A;  3LQX A;  1Y9Q A;  4IVZ A;  4F8D A;  1OSL A;  4GQM A;  2GZU A;  3F51 A;  1PRA A;  3KJX A;  3QF3 A;  2BJC A;  4OB4 A;  1JFS A;  2OFY A;  3SCF A;  2ICT A;  5DTM A;  3QWG A;  3SX0 A;  1X57 A;  4X4F A;  1O4X A;  4EKG A;  3FYM A;  2JCG A;  4NDW A;  4PU7 A;  2XXQ A;  4MCT A;  2PXP A;  2V3C C;  2EF8 A;  3ZHM A;  1UXD A;  1PER L;  1WET A;  1ZVV A;  1YSE A;  2FJR A;  2PE5 A;  1ZUG A;  4HRA A;  4J1W A;  3EUS A;  1ZS4 A;  3KXA A;  4X4C A;  2IU7 A;  2O4A A;  4Q2J A;  4YG1 A;  2PXE A;  3OQO A;  3TFL A;  4X4I A;  3DM5 A;  4I6R A;  4PU4 C;  1LCD A;  2LYL A;  3OKZ A;  4WVL A;  3CRO L;  2BNN A;  1QZX A;  1E3O C;  3G0T A;  4ER6 A;  1WH8 A;  3JXC L;  2IVQ A;  3NDB B;  4JCX A;  1NEQ A;  4GHJ A;  3MLF A;  2IV1 A;  2IUO A;  2PXB A;  2AXZ A;  2AXU A;  2H8R A;  3UWP A;  1ZZ7 A;  1R69 A;  1ZAY A;  4YAR A;  2IVG A;  3U3W A;  2XCJ A;  2HFZ A;  2PXQ A;  1DWK A;  1QP4 A;  5K98 B;  2ICP A;  3GZD A;  1ZPQ A;  3R1F A;  3NZL A;  2OR1 L;  2LCV A;  1GT0 C;  4X4D A;  1HQ1 A;  3VK0 A;  3JXD L;  2EBY A;  3MEJ A;  1LMB 3;  1RPE L;  2J7W A;  3B7H A;  4PU3 C;  4Z58 A;  3CEC A;  1JFT A;  1CQT A;  2XXP A;  2XXA A;  5JUW A;  2PUB A;  2PXF A;  2WIU B;  2XI8 A;  5GAH i;  2HCN A;  2O49 A;  5DRY A;  4IA8 A;  4Y42 A;  1NW3 A;  1AU7 A;  1QP7 A;  4EQZ A;  2D5V A;  2PUC A;  2AWI A;  4Z5C A;  4Z5D A;  3PXP A;  2PXD A;  2KEI A;  3D1N I;  2GRM A;  1SQ8 A;  1IC8 A;  3QYX A;  2PUG A;  5A7L A;  3F6W A;  3S8Q A;  2BNM A;  1RZR A;  2R63 A;  2MEZ A;  4J1X A;  1ADR A;  4OBM A;  2LNM A;  1LLI A;  2L49 A;  1HF0 A;  1LQC A;  1JWL A;  1ZZ8 A;  3LIS A;  3CLC A;  1VPW A;  3OP9 A;  1ZZC A;  3NRO A;  4I6U A;  2LYJ A;  2M4H A;  1S7E A;  3IVP A;  1UXC A;  3A9X A;  3HZI B;  3GZC A;  1DUL A;  3O9X A;  1PRV A;  2PXU A;  3ME5 A;  2A6C A;  2JVL A;  3H5T A;  3TRB A;  3A9Y A;  1WH6 A;  4YBA A;  2L8N A;  1QQA A;  2CSF A;  4PU8 A;  1WIZ A;  5DTQ A;  2AW6 A;  4JQD A;  2PUA A;  2KPJ A;  3FMY A;  3A9Z A;  1PRU A;  1PNR A;  2MXD A;  2LLW A;  3GZD C;  2PXV A;  2CRO A;  2ODR D;  1QB2 A;  3JXB C;  4I6T A;  3KL4 A;  5DT2 A;  2EWT A;  1U2Z A;  4ER3 A;  2HCS A;  3BS3 A;  4X4H A;  1BDH A;  1DW9 A;  3SCG A;  4DE9 A;  3NXH A;  4EK9 A;  2KZ8 A;  1Y7Y A;  3R09 A;  1RZS A;  1LCC A;  2PXL A;  3FYA A;  4FBI A;  2PXK A;  3ZKC A;  3GN5 A;  2MQK A;  2IVB A;  2PPX A;  2LYR A;  2O38 A;  3BDN A;  2JQE A;  4EZI A;  4MCX A;  1L1M A;  3PE5 A;  4ER0 A;  2KEK A;  1B0N A;  3DNV B;  2VEO A;  3GUU A;  2LYP A;  1EFA A;  2PXT A;  2AXV A;  2PIJ A;  2GRL A;  1OCT C;  2YBD A;  5DSX A;  2PUE A;  5DRT A;  4IWR A;  1QQB A;  3OQN A;  1MFQ C;  3G7D A;  2FFH A;  3TEL A;  4YG7 B;  4ER5 A;  3QFI A;  2LLV A;  2XIU A;  1NER A;  3TEP A;  3QQ6 A;  3OMT A;  1RIO A;  3G5G A;  3OWQ A;  1CJG A; 
#chains in the Genus database with same CATH homology
 4PU7 A;  2PUD A;  4MCT A;  2PUB A;  2EF8 A;  3ZHM A;  1UXD A;  1PER L;  1WET A;  2KEJ A;  1ZVV A;  2WUS R;  2CRO A;  2WIU B;  1YSE A;  4I8T A;  2XI8 A;  1BDI A;  4Z5H A;  3OQM A;  2FJR A;  2PE5 A;  3JXB C;  1ZUG A;  4I6T A;  4O8B A;  1QP0 A;  4J1W A;  3F52 A;  3EUS A;  3GN5 B;  2EWT A;  3BD1 A;  1ZZB A;  3ZHI A;  3KXA A;  4X4C A;  2IU7 A;  2LYQ A;  1ZS4 A;  2O4A A;  1X2L A;  3BS3 A;  2O49 A;  4X4H A;  4YG1 A;  4IA8 A;  3OQO A;  1BDH A;  1DW9 A;  1UTX A;  4X4I A;  3SCG A;  1RZR D;  2HSG A;  4FN3 A;  4I6R A;  1CQT A;  4Y42 A;  4PU4 C;  1AU7 A;  1QP7 A;  1ZZ6 A;  4JCY A;  2D5V A;  2PUC A;  2AWI A;  4Z5C A;  2XSD C;  4Z5D A;  2KZ8 A;  1Y7Y A;  3PXP A;  4X4G A;  3UFD A;  1LCD A;  1RZS A;  2KEI A;  2LYL A;  3D1N I;  1LCC A;  3FYA A;  2GRM A;  2BNN A;  4FBI A;  3L1P A;  3CRO L;  4YG4 A;  1SQ8 A;  1E3O C;  1IC8 A;  3ZKC A;  3QYX A;  3SCH A;  1WH8 A;  2PUG A;  3JXC L;  5A7L A;  3F6W A;  1JH9 A;  3S8Q A;  3KZ3 A;  3GN5 A;  2BNM A;  2IVQ A;  2MQK A;  2R1J L;  2R63 A;  2IVB A;  1RZR A;  2PUF A;  2PPX A;  4X4E A;  1ZZ9 A;  1NEQ A;  4JCX A;  4GHJ A;  3MLF A;  2LYR A;  4Z59 A;  2O38 A;  3RZZ A;  2LYS A;  2MEZ A;  3BDN A;  1QPZ A;  2IV1 A;  2IUO A;  4J1X A;  4MCX A;  1L1M A;  1ADR A;  2KEK A;  1R63 A;  1LLI A;  1B0N A;  2AXZ A;  2L49 A;  3DNV B;  2AXU A;  2H8R A;  2LYK A;  2LYP A;  3GBF A;  1HF0 A;  2AUW A;  1EFA A;  2BNO A;  1LQC A;  4X4B A;  1ZZ7 A;  1R69 A;  1JWL A;  1ZZ8 A;  2AXV A;  2PIJ A;  2GRL A;  3LIS A;  3CLC A;  1VPW A;  1OCT C;  2HIN A;  3LFP A;  3OP9 A;  1ZAY A;  1POU A;  1ZZC A;  1XWR A;  2XJ3 A;  2B5A A;  4I6U A;  4YAR A;  2PUE A;  2LYJ A;  1Y9Q A;  1S7E A;  4IVZ A;  3IVP A;  4F8D A;  1OSL A;  2IVG A;  3U3W A;  4IWR A;  1QQB A;  1UXC A;  2XCJ A;  3OQN A;  3G7D A;  4GQM A;  2GZU A;  1DWK A;  3F51 A;  3HZI B;  1QP4 A;  5K98 B;  2ICP A;  1PRA A;  1ZPQ A;  3R1F A;  3KJX A;  3QF3 A;  2BJC A;  4YG7 B;  2OR1 L;  3O9X A;  2LCV A;  1PRV A;  4OB4 A;  1GT0 C;  2A6C A;  2JVL A;  4X4D A;  3H5T A;  3TRB A;  3VK0 A;  3JXD L;  2EBY A;  1WH6 A;  1JFS A;  2XIU A;  4YBA A;  1LMB 3;  2L8N A;  2OFY A;  3SCF A;  1QQA A;  1NER A;  2CSF A;  1RPE L;  4PU8 A;  2ICT A;  1WIZ A;  2AW6 A;  3QWG A;  1X57 A;  4X4F A;  4JQD A;  3B7H A;  1O4X A;  3QQ6 A;  2PUA A;  3OMT A;  4PU3 C;  2KPJ A;  3FMY A;  3G5G A;  1RIO A;  4Z58 A;  1PRU A;  3CEC A;  3FYM A;  2JCG A;  1PNR A;  1CJG A;  1JFT A;  4NDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...