2KZBA

Solution structure of alpha-mannosidase binding domain of atg19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
VEPPNERSLQITMNQRDNSLYFQLFNNTNSVLAGNCKLKFTDAGDKPTTQIIDMGPHEIGIKEYKEYRYFPYALDLEAGSTIEIENQYGEVIFLGKYGSSPMINLRPPSRLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autophagy-related protein 19
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzbA00
2KZKA 2KZBA
chains in the Genus database with same CATH superfamily
4Z8FH 3L7FB 1WIPA 5JZ7D 2L8AA 3ARBA 2EKSA 4UT6L 3KPSE 5IVXF 3FRPG 3HG5A 4P05A 3T4AC 3F85A 4QPEA 3AQDA 4JO3L 3GUFA 2BLFA 3NSXA 5IMLB 2JVUA 3IE4A 3JTTA 4L4VD 4LEOA 4U3SA 4XOEA 3RUGF 1NMAL 3GZQA 3OR7B 3O4LA 4U6XB 2FX9L 3RPKA 1NPNA 4OCWH 4YS4A 2A1WH 3FYEB 4TSBL 1VADA 1LYQA 5F6IC 1YEJH 4AE1A 5HHXL 2J6EL 1CFNA 1ZHKA 3H9ZA 4GXFA 2I5YL 3KGUA 2C7UA 4Y2DC 4PLNC 2EDKA 2W1NA 3KPNA 5E23A 3UTSE 2X1QA 3WOVA 1WBYB 2WINB 1MLBA 4YEEA 1B2WL 1G6RB 1MF2L 1EXGA 4KO5A 2R29A 3JV6B 4CN1A 3U2JA 5C71A 3C9NA 3MACL 1WFNA 3TO4A 5DMKB 3ZJAA 4TVSa 2D31B 5EZIH 2NUTA 1WSST 5GPRA 3CN1A 3K6FA 1IC4H 5AOZA 1T89A 3HNSL 3KYKH 4NWTH 3I2CL 1T5XB 1JGLL 1PY9A 1GIGH 1J1XL 1UG9A 2BNRB 2VLRA 3PP4L 3POHA 5EN3A 3DROB 5C09A 5DHVB 1DQTA 1BF2A 2CJSA 2VR6A 5GS0C 1HAUA 2FJFB 4OLUH 2XWTA 2IBBA 1P1ZA 1AHWB 2C4FT 4FP8H 4NO0B 4P2QA 5LG1A 4EKXA 4DN4H 2YA2A 3N1MC 1YEKL 3ME0B 4P23A 1I8IB 2EVJA 2VDQB 1NQBA 5ADPH 4Z3EA 5DSCA 2DQIH 4FJYA 4P5KA 3RIAK 5I8OL 1M1SA 4NN5C 2DL2A 1ONQA 3P0VL 4JN2B 5IHHA 1QNZH 4R0LB 3GBLA 4Z7OE 3L3DB 3KPSD 4W9FC 2X38A 3Q7JA 4YPJA 1FBIH 2OJEA 3CZKA 4JPVH 5BVJB 3UPRA 3LZRA 3O11A 2Y7MA 4FQPA 3NIFE 3L5WA 1QR1B 4I3RL 3FTWA 1QSEE 3MRMB 3NT0A 1ED3A 1KB5L 5ANHA 2RA1A 1BVLA 1N6VA 4X6CA 1CFSA 1OGAB 3ELQA 1PD1A 3MRKB 5DJ2A 2YKLH 3V0WH 3MFGB 3ATFA 3BJ91 3HRZA 2XN9A 2X6CA 5CU5A 4J8RB 3P9LB 3LJ3A 4NQEB 3NCYS 4JFFE 1KCRH 2ZOOA 1ID2A 4NM4H 1TQBB 5HDRA 2CKNA 4HBCH 2VR5A 4NUJA 2Q20A 1W0YT 1NWOA 2A6JB 3UTSD 1GA2A 4P04A 1N8ZB 4MXVF 1N7ML 3KLKA 4PYGA 2XUWA 5CBEA 3H9SA 1MCWM 3FUJA 3U1SL 2BOCB 5HHQA 2NW3B 5HYJA 3QI9D 2FL5A 3LEYH 4J3UA 5IZ7A 5DJ8B 4OCSH 1UT2A 3IFOA 5J12B 1J1OH 1H8SA 4MS8D 3B2MA 1XEDA 1PL3A 5EZPA 5GZOD 5H2BA 2NXZB 1CE1H 4YXHH 1RJZB 2NMSA 5H37A 3UMTA 3K71A 5BRQA 4X4KA 6FABH 2B7DT 1R17A 4LCWB 3UTTE 2AXGA 3AAZA 4MLSA 3IK2A 4OZFA 1HHIB 5AZEH 3MROA 4H4NA 1KBBA 5AVRB 2QLVB 4XCFH 3ISRA 4PRPE 3CFEA 2WZ0A 5FUCC 3RL1B 3K72B 4FXGB 5ISZB 3CK0H 1WRFA 3LIUA 4AJYV 1KC5L 4PP2B 3AG2B 3MVSA 4R5VA 1C1EL 4ZXBC 4HHAB 3FTGA 5D7LE 5FO8B 5JIMA 4TNWF 4N85A 3MC0A 4M6OL 1VEOA 4UOW0 1CDYA 1JRHL 4QIRA 4UINL 2JIXA 1J5OL 2COVD 2KS0A 5IG7A 4F7PA 1EDYA 4M8QA 2EE9A 3HMWL 5CLTA 3ARBB 1CQKA 1M6UA 4Q6IC 2EKSB 4RISL 4XVOA 1QHOA 5ILTH 4LLMA 1H15B 4APQB 5KVEH 4M7ZC 3VI4E 2IXQB 5LKNA 4KK5D 1SJEA 4IJ3B 3GMOB 4J23A 1REIA 2VZTA 3PQYE 4XXCA 4LEOB 2YAMA 4U3SB 3A67H 4KUZL 4XAWH 4XN9A 2VXSL 3OPUA 2XV0A 2OYMA 2LVEA 3DARA 3S7GA 4JO4H 4I18C 1AHKA 3QFGA 3S2AA 2D3JA 2G2RA 1VADB 1A6TA 3FU7A 1UKQA 4PD4J 2WTRA 2BRRH 3QWOA 2VDOH 3RWFA 1CFNB 5JXAL 3FB6A 3NJMA 3LPOA 2DKSA 1B4JL 3NIDB 5HYQB 1UVQB 1T7WA 2OMXA 3AFLA 3DX1A 3BSGA 4UT6H 4S11A 5AW8B 2AZAA 5I66A 1D5IH 1LXMA 1P9MA 3KVQA 3O2WL 4JO3H 3C9NB 4LNRA 1BJ1H 3TO4B 2LOEA 2NZ1A 4O4YL 1J10A 4A7VA 5LDSA 4GUOA 2NUTB 4WKZB 2P26A 3O4OB 2Z9TA 2OQJB 4YEFA 4JL1A 5AOJA 1M53A 2YBGA 3T0EC 2W9LA 3ZE2B 4TSBH 3T2PA 4LPCA 1MCQA 2VLRB 4M1GL 3RPIA 5IFAL 2VO5A 1SXSA 5AENA 1ZHNB 2Q8BL 5I1LA 4X4ME 1PAZA 2I5YH 4L1SA 2XWTB 5I2IA 1U4EA 4P2QB 2VERA 2WWMD 1KPRA 3H7BA 4W9GC 4FQIH 3V8CA 4WJKB 3E1ZA 2R29L 3T3PE 2ALWA 1B2WH 1KF9B 2QGBA 3QORA 1MF2H 3C09C 5DSCB 3QDJE 4WI0A 4QKTA 1HHHB 2TAAA 5HJBA 4AL8L 1U0QA 3ULUE 3AQZA 1S7TA 4MJJA 4M5TA 4QMEA 1Q1JL 1AVAA 1DEDA 5ITFA 4CA4A 3FOMA 4RA3A 3TESA 2OJEB 4G8GA 1MJ8L 4M4RA 3ESPA 3O11B 1PEZA 1FE8H 4FCHA 3QZOA 3PQYD 2EDTA 4QHMA 1YYCA 2VRKA 3CZUB 2NDGA 2VTFA 4X6CB 4YE4L 1CFSB 3EJSA 4Q14A 2DV6A 5D93C 5DJ2B 3CSFA 2EIDA 1G6RH 2XN9B 4UTAL 4KNUA 4GO8A 1YEKH 4Z5RA 3LDBB 4CU6A 5D72L 2HRLA 4NUJB 5FYLE 5IFHL 2X40A 4OV5A 4X5WA 1YZZA 3H9SB 4WHYH 3QUXB 3DIVA 1XF5B 3O6FD 5LQBH 5HHQB 4GQRA 1NOFA 4MZ2A 2FL5B 3ZW3A 3K5RA 3V0AC 4K3DH 2A74A 4TLUA 3IFOB 4ALAC 1SFHA 5B1CA 4E9RA 4UYQA 4LPUA 3GHEL 5H2BB 9PCYA 2YD4A 3VRLF 2VDQH 3GMQB 3IDXL 3N3EA 3S3SA 3WLBA 4L4TE 3TFBA 1SXCA 2FIKA 1CDIA 2Y5TA 1TCRB 4I4WA 5CMAA 4U33A 5SX4I 2GJ6A 4EI5A 2AXGB 3AAZB 3ZE1B 2DM7A 4OZFB 3DOSA 3DUUA 4ONHA 4Z7UF 1ULVA 2IMMA 3MROB 4QRPB 5ID0A 3LKSB 3FB8B 5AB2A 4XXDA 2XZQH 1N7MH 5CD5C 4FC3E 3ZHKA 5IQ9A 2R59A 5KSAD 3OB0H 1QBML 1SEBA 3V0IA 1LMIA 2FWOB 3C6LC 4RRPG 3U6XA 1RZ8A 3SYCA 1NFDE 5I73C 4EIUA 3ULUD 5HVWA 3CFQA 1DQKA 3FTGB 5I0VA 2ZSWA 4RGNB 4CMHB 3I6KA 3NAAL 5GZNA 4JCLA 5GGVY 4P46A 2JIXB 3UG5A 4QXTA 4H8UA 4F7PB 1YMMB 1SBSL 2B4CL 4M8QB 5HDLA 4ZMZA 3O3BA 3K7UA 1G1CA 5DK0A 5CLWA 4LLMB 1R5WB 4YSSA 4I8DA 5E8DH 1L9RA 1KEGL 4FFTA 4FMVA 3UTPE 2GSIA 4KRPC 2ZWLT 4ZMTA 5E94A 4FQ2L 4ZYKA 3E3QC 4YO0A 4AT6B 2DQCH 4D0BB 2F53A 1KJMB 1KC5H 3B1TA 3EJYC 1TTRA 5FYLD 3OXRA 3PXLA 3AG3B 1C1EH 1H3XA 1A6TB 3FU7B 1XGZA 4DP5X 3QEGL 3QWOB 1ZY9A 3E6FA 1DVSA 4L3ED 3AWFA 3IWVA 4C58B 4UINH 3OLIA 2K70A 4HXAL 4WO4D 5L4MA 2P24A 2ESVB 4P06A 1I7ZA 1WP6A 5HVHB 4OBRA 1FL5A 2OMXB 3QQNA 4XVUD 5AW4B 4RISH 4CSPA 4EE2A 1I1AD 1WEJH 3GI8L 3BAWA 2AV7B 1X6NA 4GUCA 2X4RA 3WJLA 3OAZK 3UAJD 3UIYA 4Z3JA 4KTYA 2H5UA 2VL5A 4JZNA 4KUZH 3AY4A 3AG1B 5CJOH 3KPMB 5FS5A 5IHUH 2OMTA 2RBLA 4RMTA 3I3BA 4N2KA 1ZK9A 5MERB 4X7CC 1WA1X 4ANXA 3GBNH 4ELKA 3GGWA 3S5YA 2LFEA 2SEBA 3RPIB 3B9EA 2Z7YA 4XNMA 2ZONA 5D4QA 4HV8A 4TOYL 1EV2E 3O9WC 5I1LB 2ZOKA 4AYGA 2FECL 3TIDA 1BQLH 4PUBL 1U95A 3H7BB 2N4IA 4KJQC 2YUXA 5DUJA 4LQ1A 4LGRB 4K55A 4H1LB 5A2LH 3QORB 4HDIA 2XFXA 2H1PH 3OKLA 2WQWA 3QCUL 4G6AC 4OFVA 2NY3D 3O2WH 2DEYX 5FM5O 3K6SA 1XGRB 5F72S 2BS71 2UZIL 3L95B 1JZEA 3K6DA 2BP5M 4OUUA 4M00A 3FOMB 3KW8A 4Z7OF 4FLSA 4POZC 4G8GB 1EGJL 3HKZA 7TAAA 1BEYL 3S4SG 1PKOA 5ERWA 1CLYH 2H2SC 4QAMB 3NIFF 2VC2B 4HMDA 1NMBL 4Y9GA 4M6NH 4JHBA 1P53A 4NP4L 3KLAA 4Y2LA 3L13A 2Q8BH 4M1CD 1JTPA 4OLYH 4OIFA 3WY1A 3KVDD 2NTSP 3B5GA 3GHPA 5CUSL 2VR7A 3DX8B 4OFKA 2BSRA 3CNKA 4MA3A 1NCDL 3BI9X 1D5ZA 5D70H 4WJ5A 4LRNL 4XP4L 3B8SA 4G1MA 1F90L 4N2FA 1DP0A 2PYEA 1S2EA 2FQGA 2XV2A 3MV8B 1Q1JH 3GF8A 2NNAB 4X5WB 1NFKA 1UOVA 1CFTA 2GW5A 3MLXH 3WFBL 5FWRA 2VC2L 4IRZH 3A24A 1SHMA 4GKZA 1X5FA 2FSDA 4GT0A 5B1AB 3RPBA 4KITB 1CBVL 1J5CA 2QBWA 3QULB 2ZX7A 2JKSA 4X9GA 2EDWA 4ENED 1JPTH 4XP5H 4YE4H 2F7PA 3WLBB 1A6VL 4TPRL 3KBFA 1JRHI 1UURA 3BIKB 5C0GB 4I4WB 2WSKA 5CMAB 4EI5B 5E2TL 3GUTA 1MCWW 3BWSA 5HGDA 2W0KA 5DF0A 4P2RE 3DUUB 4ONHB 2O5ZH 5ID0B 2ZOWA 4OU3A 1X7QA 1L9MA 3EH5B 2BHUA 4WWKC 1DHKA 4ODWA 2QELA 4POYA 5IQ9B 1NGQH 3S3BB 3VXTA 2BXYA 3ARED 3D85B 2CMRH 1RZ8B 3HBPA 2FT7A 3H2WA 3ARRA 3RU8L 4D94A 1F3JA 1WH0A 4JFDB 3RNKA 1NIDA 3QG6B 4G6FD 3QPXL 2XTJB 3HG0A 4W9DC 4OV6F 1KB9K 3FCUB 5A7EA 4EUPA 1RIHL 1BQRA 1OKEA 4TTDD 1A65A 3ABZA 3IDXH 4P46B 1BX2B 2EDBA 4QXTB 3APNA 3LNGA 5CGMA 2XWXA 2ENYA 5FYKU 5CILH 2VSKB 3LNDA 5DK0B 1EEUA 5MI0B 2JLPA 5KZCB 3HE6A 2F58H 4LQFL 4UIMA 2NYZA 2ADIA 2GSIB 2VDPB 3BISA 3GSUB 3GRWA 2UXGA 4YDKL 3VA6A 5E94B 3VI4F 3ZZSA 2CHNA 5IVNA 4OFYD 1URZA 3NCBB 5D6DC 1UOWA 4YO0B 4RNRB 4HK3J 5ALCL 1AC0A 1RSFA 2ZPKH 4BJLA 4W9CC 1YYLH 3OXRB 7PCYA 3FUIA 4CMMA 5JMOC 3EYOB 3EXLA 1AD0B 2C9UA 1JYXA 1HI6A 3EOYG 3FHEA 3FULA 2ZXAA 5F1IA 2M83A 2O4EA 3NAAH 5ESQA 1ZPLA 3ROLB 4CKQA 4EN3A 2OCCB 4HF5H 1P4LB 3HG4A 4Y7OC 5SWZE 2DYRB 4OZFH 1UD5A 4XN5A 3ZHDA 3UZEA 4OD2A 2RFXA 4TF4A 5KVFE 5F3BA 2X4RB 4OZGE 2TRYA 1Z0MA 3N41F 4C55A 4KZDL 3EYSL 2VL5B 4U1SB 5KANG 1KXVC 3US1A 1GYVA 1MSPA 2WO2B 4MA1B 2OMTB 4NENA 4P2RD 4V1DD 3WTTA 4NWUL 3DX6B 3VGFA 2PCFA 4ZX6A 1NCAL 2J12B 1MFDH 3MNMA 2D2CC 3GGWB 4IRSA 5D1ZB 2FQDA 3PDOA 2VZUA 5D9SA 3QEGH 3O2DA 3L5XH 5IQLA 2ZOKB 2HYMA 3LN9A 3TIDB 5CGBA 4KKQA 4AYEC 5C0CE 1H6EA 1DTUA 4NQCE 5E99H 2A4ZA 4G72B 2VQUA 4HDIB 3T3PF 2DQEL 4P4KD 5DJXA 1FF5A 4HH9A 1IUZA 3K6SB 5B7EA 3MBEB 3PE9A 4ERSH 3RURA 3UMNA 3ULUF 4CBZA 5FYJE 1F45A 2AGJL 3MJ7A 1JYVA 1OSYA 5IMKB 2XN1A 4L8DA 3RVUC 5IT2H 3HS0B 4B9CA 3WI9A 1KIPA 3WFDL 1AG6A 1S7RA 5ESVA 4F37K 1AFVL 3BN9D 2IH8A 3VVVA 2HT2C 1QEXA 3KLAB 3U79A 4NRYA 3SJVE 4KC3B 3IETA 5F0JB 4FQCL 1N12A 1A7PL 2BSRB 1IKNA 5J5EA 4MA3B 1EHLL 3ZQWA 35C8H 2EYTB 5ICUA 2W9DL 5IBTH 5SV4A 4I48A 4NLHA 4U2ZA 3V0DA 4FQXD 4Z0XA 4G1MB 1PX8A 5SWZD 1DLFL 2QPSA 4JKNA 4JG1L 1RPKA 1OTUC 3D18A 4ZRGA 4GMSL 4JRLA 4XC3H 5BZWA 6CGTA 2AK1H 2WP3T 4QRRE 4LXFA 4JHVA 5ITBL 1QR4A 3UO1H 4PGCA 1NMBH 1RSYA 3GSQA 2C3GA 3X3FL 1FRGL 4H1LH 3VMOA 5T1DH 1DVUA 4DAGL 3C5XA 4JKKA 1Q94A 2E7HA 1NCDH 4K94L 3W81A 4AVIA 4AQ8C 4UF7C 4WRLA 5HGDB 3KPRE 1KMGA 3B3BA 1S7SB 3UP6A 3STBA 1F90H 2X0UA 5EB9A 4ODWB 3RL2A 4NIYE 4QYAA 4Q0XH 3VXTB 2ICCA 4JRFA 2EDFA 2CDFB 2QADB 5E0QA 5IWLC 4JN1L 4XP6L 2VC2H 2W07A 1NFDF 5K9JH 2CHDA 4QTIL 2X4UA 4CC0A 1F3JB 3RNKB 3ZMNA 4D3CL 3OMIB 1SJHA 2CSPA 4YK4C 2BINA 4UNUA 3UROR 4BFJA 3ARGC 4K8RC 5FYJD 2AJ3B 1TMQA 1DJSA 2BNQB 2N0KA 3FFDA 2ADFL 4X6DA 3AJ7A 4LHQB 4BZ1L 4RIRA 3Q1SL 5EO9B 2FYYB 2OXGA 2J71A 3RDTB 2XKNB 2IPTH 2VSMB 4KK8D 2ADIB 2YUZA 3JWDH 2GEQA 4E41E 3OHMB 2IGTA 1FSKB 4MQ7A 2OMVB 4UAOB 4XN7A 5I0WA 1IM9D 2X09A 4YHML 3L3KA 3RU8H 3MRIA 4I1PA 1A7RL 3QUZA 4YSPA 4EI6B 2NY2D 4N4YB 1FDLL 3QPXH 1XB8A 2IH3A 3AXIA 5AAMA 1HI6B 1OSEA 4MXQD 5F1IB 4E2OA 1A3QA 5IROA 1QEWA 1R3IH 2C3XA 5DC2A 3EFOA 3QB7C 2OMZB 4GMTH 4N2IA 4EN3B 4OF0A 4G42A 4QRRD 5I19H 3CN4A 5IB2A 1RU9L 1E4HA 2D73A 4FG0A 2F61A 3CSYA 5T5NG 2WZPD 3GRWL 1EAPB 3ILQD 5K5YA 1XH3A 4U1LA 2NUPB 2V9QA 3GJFK 1G7PB 4NQDD 4XP1L 2FHBA 3LRMA 5F3BB 1CK0L 5EF3A 1T4KA 3P30H 3BN3B 1MY5A 5IBUG 3ZT6A 2DJMA 4TMPA 5DS8A 4PB9L 3BZEA 3CVIL 1A7OL 3KPRD 4NENB 3QJFA 4GY4A 1QHPA 1GC1C 3T1WA 4KJPC 5ALCH 3T8VA 3POCA 2PCFB 1C16A 1N4XL 1Y1UA 3R4DA 2NNXA 4TUKL 5EV7A 3Q0HA 4YC2C 4HU2A 3MRLA 5D2NE 3ORJA 5FDWA 5D9SB 4QHUA 2CGRL 2V2XA 4X7DC 4XPBH 1T1YB 2X05A 3MUJA 2Y5EA 2B5IC 2E9BA 3U46B 4LP4A 5DQDH 3TS8A 3EG9A 4POUB 4PJ8C 2WWMC 3V5HB 2WOBA 3C2SA 4TSCL 1LEKA 4HH9B 2NXYB 3DRTB 1BZ9A 4KZDH 4MB4A 4YDLC 2AXFB 2APXA 2BY3A 3WY4A 4OTXH 3V6OE 3D39B 3MJ7B 1PZ3A 4WWID 2WLKA 4E41D 1U3HD 4JFHE 2K45A 1HILA 1KIPB 3NACH 4PM1A 3X2QB 5ESVB 43CAB 4DETA 4M5YL 1BD2E 2YAEA 1GRWA 3RGVC 1BZDA 3ARWA 3L6FA 4HBQA 3IXTA 4JE0A 4JUSA 4NRYB 5KSBE 3KGRA 3LNHA 4UTCA 2C5DC 2CQVA 4PWJA 1G9NC 1HXKA 1ZV2A 3F7VB 5DO2D 4I48B 5FM4A 2PPCA 4YX2L 2OSWA 3CBRA 4FERA 2DQEH 5DD1L 1OALA 2FNBA 2AXWA 2YD3A 3C75A 5GGSB 4YXKH 4N0FB 3M86A 2AGJH 2Q8AL 4JGMA 1UWYA 1ZT4A 3IU3A 4KDWA 4TVPL 2VL4A 4N2LA 5MENA 4LSTH 5ADOL 4AG4H 2YZ8A 3GSQB 3VG0L 1A6UH 4JM2D 2OI9C 4P9HH 1C8PA 3VXSA 1HL4A 1A7PH 3K6OA 3EHBC 3T4YA 4U3XA 1XT5A 2XXMB 2KPNA 1UB6B 4CNIB 2ZYHA 4JHAL 4OQTA 1TJHL 2I9LA 4HIHA 4XPFL 3D0AA 4FNRA 3O3DA 4O58H 2O61A 3FUNA 3BZFA 4J2QA 3CVHA 4P3CL 1K6QH 1F4YH 4GH7B 1DLFH 1A1OB 2DDQH 3ERXA 4TQPA 4JG1H 4M93B 4NERA 1G5GA 2EXTA 4FXTA 4DZ8A 3GS4A 4N8VA 4Y5VA 5CHNA 4GMSH 3QDAA 3X1BA 5IOPB 5I6XB 1C08B 1YQVL 3D25A 4R4BA 5KSAC 1ZGLB 1SJHB 4UTBH 1DN2A 4JKMA 1JWSA 5HD8D 4AIXA 2XV6B 1FRGH 1AQKL 4JFHD 1UCBH 3FFDB 4NHCL 4IRJD 1EJFA 5E24E 4ORZC 4X6DB 1IAKA 4RIRB 1QWNA 3ETTA 3P2DA 1BD2D 4XBGA 3L3JA 4XMPH 3TH2T 2I69A 4XB7A 4MNQE 1NANH 4F33B 1UWFA 3QCTL 5CN1A 3B2VL 1Z9LA 1PKQB 4FNLL 4HSQA 1GKEA 1K5NB 4PG9B 1WTGT 5BOPA 5ELIA 1J0YA 4OSUH 3JQOB 2AW2A 3BIBX 4MZ3A 3GSNL 5L0QC 3L3KB 4JN1H 2DQTH 4KKZA 1YPZA 5J3HC 3MV9E 4D3CH 3SE3A 4KKBD 2YHGA 5EPMA 2IQAA 4JNXA 2GBUA 2JJUA 2IH3B 4BFFA 1PEWA 1NH6A 2V5SA 1NC2A 1R3KA 2YPLD 1NDTA 1QEWB 4HUVB 3STLB 3EFOB 1FHNA 2XVLA 2ORBH 3GM8A 4U1JA 5IB2B 2YO3A 4WV1C 1HZKA 1EXUB 2EIBA 4WFEE 1GOHA 4G7YH 1KIQA 4JFTA 4U1LB 4WO4C 4ZMXA 2P8LA 5A2FA 1FORL 1T4KB 2BSBA 3VTAA 4OZGF 1JHKL 5L8JB 1NMCC 4PRIA 4R26L 4ODXA 5DJ0A 3NRPA 3BZEB 2G3MA 3EJUA 3QJFB 1WFOA 5HHOB 5IY5B 3UAJC 1MFBH 1RMFL 1JP5A 4EUPH 5AVWB 2X0VA 1FDLH 5A6MA 3FOLA 1MLCA 3T9WA 4QHUB 1EUTA 3WD5L 1HQRA 1FVDB 4L18A 1PFCA 2F9BT 2IAND 4HIJB 4K7PL 4N0RA 4S0SD 2BIPA 2AAAA 3FN0L 3ES6A 5HJDA 1FLRL 1LEKB 2BZCA 1BZ9B 5A3IC 5CNHA 1ES0A 5L8KB 5EZJB 5BJTA 4M3HA 1CU4H 2PF6A 3H9HA 4MNQD 2WXOA 2MKWA 2P42B 1XGQA 1A47A 1HILB 1N4XH 3JWOH 2EVIA 5EDSA 3P4OA 4TUKH 1C12A 4MAZA 4Z7QB 2OP4L 1PS3A 2BERA 4MGXA 1UA6H 3KJ6L 4B9KC 2CGRH 1AXTL 1AMYA 4GSDL 5GRUH 1OAQH 1OF2A 1T4WA 2ID5A 3F64A 2WQXA 1IT9H 3MV9D 1PLGH 5DHYA 4Y4FA 2Y69B 5DGQA 1NIBA 1UB5B 1UM5H 4I2XA 4IBUA 1BM3H 2WNGA 4M1DL 3RFZB 4QCIA 4YHNA 3BH9B 1W80A 4TSCH 3SDAC 5ABAA 4LO9A 3SHSA 2WVVA 1NANI 4X50A 4WFED 1ZOXA 2AS5M 3OXSA 1MH5A 5IHZB 3IVKA 4HJSA 4Y4KD 1AGCB 4FTVA 4PBXA 3WDIA 3ZDZB 4EVNA 1ZT4B 3NK4A 5F7WC 1HYRC 2E7BA 3O2DH 5DFAA 2OYPA 4G7VH 4ISVB 2QJDA 2YD6A 4S1RL 2ZXWB 4HKBA 1YEFH 3CPUA 4X9HA 4NKIL 3HUJE 4JFUA 2APVA 5D1QB 1CMOA 1TJIH 1UUNA 1ZANH 1ZVSA 2IEPA 1O6SA 3ASOB 1KYFA 5GIRA 5I1IL 5HGHA 3RJOA 2Q1EA 3T4YB 3FB7B 1EK3A 2QV2A 5J7CC 1KIUA 1JAEA 4WFHD 1AQDA 4QHKJ 3KDMB 1CL7L 2C9SA 3VXRA 3UYRH 3GHBL 2I9LB 1FFRA 4B0MM 4YX2H 3OWRA 2HJKB 3B2PA 5BCAA 1JZ5A 1JNJA 5DD1H 4MKTA 2CNYA 5D2LA 5AG9A 1KYOK 1YEEL 1MI5A 2FD6L 3QZWA 4BIKA 1QOKA 5E6YA 2FB4H 4X7TA 3QUYD 3L1OL 4X0KA 5EOTA 3D25B 4R4BB 4M62L 1GSMA 4TVPH 3AREC 3RBSA 4PJ9A 5T8IA 1CF8H 5ADOH 1BREA 3DPBA 3SGJA 3VG0H 4WI6A 5BQDA 5C6WH 3EO1A 4R90L 1IAKB 3HE7A 3ARUA 3QUKA 4OQTL 5LCVH 1YLBB 3VU2A 5MEOA 2Z7UA 1G1OA 2CALA 2V8LA 4OGXL 3CVHL 3BFQG 1BW8A 4LDOB 3KL5A 4OBSA 4XPFH 3W0WD 4F2MA 4JFEA 1SVZA 3D33A 4F27A 4P3CH 1PVHA 1WFIA 1NGXA 2RD0A 3VGHA 4J3OH 1RUMH 3BOVA 1EDHA 1KLFB 1QVOA 4KDTC 2Z31A 3EIFA 4LSRL 1YPZB 1EJOH 5EPMB 3TFKD 3GSOA 2IQAB 4LKXB 1XF1A 2WXRA 3VFGL 1MCEA 3ULVE 3D09A 1NC2B 2XWBA 1JNLH 4NHCH 4MMXB 2CIIA 4J6RH 3BPNB 1NCCL 4KFZC 1FUNA 3RWDB 5IGXH 4HXBL 1T04A 1IFHH 1AJ7L 3NJGA 1OPGH 1BBJB 5C92A 2P8LB 4YDNA 1O7DE 4HS6A 1K8IA 1CICB 3B2VH 2E7DA 3MLTB 1OHQA 5SX5K 4ODXB 3WE6A 5KBLA 3U0WH 1OCRB 3ULSA 3OHXA 1AQMA 2JH2A 3MRJB 3C5JA 2EVGA 5INCA 4LBEA 2DH3A 3JBG7 5F70A 2WLNA 4KKAD 1MCKA 1LK3L 2X1WL 4LEEA 1MFVA 5IEHA 1IC7L 1MLCB 3FCTA 3GM0A 5L2KA 1HQRB 5J6SA 1BBDL 4PVMA 3LQAH 4AEHL 5ACLA 4HD5A 5DJCB 5JHDA 1U8JA 1JPFA 2A9NL 3GI9H 1AG0A 4WGWB 3PABB 2V2WB 3AADB 3N50A 2NX5A 4S0TD 4AL8C 5I1EH 1V3KA 2RH0A 3ES6B 4HHGA 2XXFA 4HMEA 4K71B 4R26H 1ES0B 3IYLW 3OG6B 4RFNB 3O3AB 3GB7B 2CCLA 5BJTB 1FGNL 2CLRA 5FO7A 1QLFA 2X70B 3H9HB 4HUXB 1XGQB 2HFTA 4LASL 4P57B 1OLZA 1NINA 3ECBA 1GOFA 1JXKA 1E2WA 3IXAA 1FFTB 4L8SB 1RZKH 1YNLH 5JHAA 4AYDC 2CR3A 2XY2A 1G9EA 4B5ZA 4GSUA 1I8LC 2B1HL 3RLSA 5KSBF 4RGMC 4Y4FB 3BN9C 2PETA 3HCVA 1OZUA 3MRGA 3KBPA 4I2XB 3HC3H 3ULVD 5K59E 1RQ5A 3WFEH 3MJGX 4XCCL 4YHNB 5EULV 1KACB 3JWNH 1NM9A 2J21A 2BVOA 2FX7L 2HFFA 4L1DA 3QO1A 5FGBC 1T2XA 1C8QA 3FQRB 4TL4A 2OV0A 2XZAH 1JTTA 4BHUA 2LHAA 3LZOA 3WS6C 3IVKB 5DGRA 4PS7A 2FRGP 3V9FA 1KZQA 5FW7A 1XZ0B 3ZK0A 2Z1PA 2OP4H 3HG1D 3W3BA 4HKBB 3KJ6H 2KT6A 4WUUD 3RTQC 3LQZA 3U1PA 5GIRB 1L7TL 5HGHB 2B3IA 1KIUB 4Y4HA 1ETZA 2NR6C 4PJIA 3TYGL 1RKRA 4EPSA 1AQDB 1MOEA 1MPAH 3VXRB 4M1DH 1UXMA 2Y2YA 5AB9A 5JIDA 5L88L 4FABH 5DJ6B 2WGNB 4K9JA 4UM8A 4XAKD 5D7JA 5K33A 1YEIH 5D2LB 2GY5A 1IAII 5JOPE 2FAUA 2CDEA 4NO5A 1S3RA 3BRDA 1X5YA 3GEFA 5GGUA 1U8HA 3EKCA 4X0KB 2O30A 5EOTB 5C0DA 2DLTA 5F89A 3TVMB 1S5IH 2WLYA 2YRLA 4PI2A 4MSWA 5FHAL 4S1RH 1MAKA 3RY6C 4P2OD 5I82A 4FG6D 4NKIH 2C9PA 3EO1B 1XQ4A 2B4CC 3WNLA 5I1IH 1NAMA 1BECA 2EC8A 3HE7B 3KWWB 2XN0A 4KH2A 3RHWK 3VFVB 3NK3A 1NKRA 1CL7H 2ZX9A 5EN2A 3GHBH 1PAMA 4ES9A 2IWGA 4F2MB 5GSRA 4JFEB 2V3EA 3ZKXB 1CPUA 4HGKC 3ZKMC 3WBDA 4JCMA 4LGPB 4LHUG 3MUHL 1QVOB 1TITA 4XWGH 4MCZA 2NNFA 3II3A 3L1OH 1X5MA 2CXKA 3EOTL 3DVFA 3GSOB 2QSCL 3MLRH 4L2YA 2EDDA 3U6RB 2H1XA 2X2HA 5EOQH 3QYNA 2EINB 3FQTA 2G9HA 2J72A 4U31A 4YR6A 2ZCZA 4JDEA 2NY2C 2XWBB 4Z7VE 1D7FA 3RX7A 4E5XA 5A40E 4R90H 1JWMA 4OQTH 5AZ2H 3CSBA 3PWJA 3QDME 3VH8G 4OGXH 4JJHA 1T04B 2VISA 3RY5A 4HS6B 1K8IB 4LP8A 5J56B 1JFHA 4JGUA 2Y1VA 3LRKA 2AV1A 3IAPA 4L3AA 1MHHA 3ILQC 4UDTB 5BRZB 3W39A 4B3VA 3RUGB 4N6QA 3OHXB 5IREA 1MFAL 4HCRL 2WPGA 3C5JB 3UTQB 3EDKA 1K3ZA 4YBLC 2YLKA 5F9WB 5JOPD 5IEHB 3MOBL 1ZA6B 3U82B 3FCTB 2WLZA 4GAGH 2NY0B 4MJ6B 3VI3A 3TCLA 4J3BA 5JHDB 1U8JB 3RWCA 2Q9OA 1JPFB 1IKFL 3V5KA 3VM5A 5ECGA 4H8PA 1SDAB 4PREB 1M42A 5ACMA 3VA2C 2NX5B 2ZF8A 4RMWA 1L3WA 2ZWSA 3WENA 2BSTA 3DK2A 5IB1B 3NP3A 5LB1A 1CFMA 1SOKA 1P7QA 3NZHL 3GBDA 5DFVC 1TOXA 3MPCA 2X1OA 2G60L 2CLRB 3QAZC 1KCLA 1O75A 1QLFB 3NCXA 5AZUA 2IDFA 4BBWA 2IOMA 3ZT5A 3U7YL 4J3XA 4Y16D 2B0SL 4YHZL 3BT2L 5JOFA 3IPFA 2X42A 3CG8A 1ZT7B 3VD0A 5BS0E 4AQEA 4M5SA 1KT2B 3T04D 4M7JL 3C5ZA 1HKLL 4LLDA 2NY7L 3HCVB 3MRGB 4K5PA 3G6DH 3U36A 4BGDA 1AGDB 1R3LB 2RMNA 3GXTA 1H0DB 1S3KH 5GGSY 3ARYA 4UQDA 1CL7I 2BVOB 2VW6A 3DXAE 5F1SA 1QSFE 3QO1B 3WL9A 1SXBA 3U4KA 1DSFL 3D3VD 3L4XA 4E36A 3QDMD 4LLUA 4PY7B 2ICEB 2YRZA 2BS8A 4JFVA 4DWHA 3QIUB 2DZEA 2WY3B 1KFAH 1FGNH 4DOHE 1TSRA 2CJTA 2G30A 2D0FA 4GQ9L 1ZGLP 3DPDA 5TPWL 1DEEA 2ILLA 3MLWH 5EEXA 2DQHL 1DVFD 5AYQA 4IBQA 4DW2L 2ZCLL 1CURA 1ZLUK 2WQ8A 4KDVA 5AW3B 2F18A 2VLKD 3LN5A 3L4ZA 2B1HH 4KKLD 1F6LL 1KLGA 3HUJF 2MQGA 1XL6A 5IFJB 3TT1L 4Y4HB 3GBML 1ETZB 4PJ5E 4PJIB 4QEGA 4JM2C 2E75C 3LRSA 3TBYA 3NCYP 3G5XA 4NT6A 5L6YL 1NGYB 4Z7WE 4UM8B 5E2WL 3VWJB 4MAYC 5D7JB 1X5GA 1SUHA 1NCWL 2VWEC 4F7CB 3O8XC 4HS8L 1T2QL 1F8TL 4YXLL 2E59A 1T3FA 2CDEB 2X1PA 1ZTXE 5B7MA 1RZ7L 1MW1A 3PDGA 1F1DA 1GGBH 5GGUB 3LRHA 2R69L 1U8HB 4NBXB 5LBSA 3HC2A 5F89B 4JDVB 3H56A 4MSWB 2C3WA 3NQKA 1KLUA 2YJLA 3IDYB 4G9FE 2AHIA 2ZUQC 2HX8A 4KO7A 4ZSOB 3J27A 2VN5A 4IK6A 1HVXA 1F56A 4X6FA 4KJWD 4A04A 1UZ8B 3TYGH 1VFMA 3NESA 4N28A 3Q1EA 3ZTCC 5ACZA 5BS0D 2WBJC 1UD2A 4A7SA 4G7SB 5DUPH 1F4WL 1NDGA 3PL6B 3ASWA 3MXWL 5EZLB 1SOQA 2VQ4A 3MRCA 4XMXA 2EVHA 2R0WL 4YBHA 1RVFH 4KNQA 3ILDA 2XDHA 4DJMA 2CPCA 3BGFC 3QVAA 3T8XB 2EQDA 4X42A 4NRZB 5LG6A 4NHUA 2QV4A 1QSFD 1G4RA 2J2ZA 3IDIB 4FFVD 5CSZA 5FCSH 5FHAH 3M1OA 5B39A 2CH8A 1HQ4A 1NAML 2G9HB 3C6SB 3ULVF 3DHUA 5D7EA 4E5XB 2JSFA 2ZX8A 4QNPE 5T1JA 2ZSVA 3ARFD 2XJLA 2X89A 1JWMB 4WSKA 3MBWA 3PWJB 1YJDL 2DWXA 3P3YA 4Q56A 4DCQB 4PJFE 3DETD 1L9NA 1T6WA 3FO9B 4GYBA 4EBQH 3AS2A 5BRPA 4PJ7E 4IHOA 2AV1B 2Q5BA 1MHHB 4PJ5D 1DQIA 4WTZG 2HTKC 5BQ7A 2D3NA 1T83A 3W9EA 3TC9A 5BW7A 2BOBA 1FFNB 1RUPL 2BP3A 1MFCL 3RE0A 4IOSA 1BSIA 2QSCH 4FLHA 4O51A 5IR1B 1PDKB 1I9RL 3ZPDA 5KVEE 5KYYA 4LBAA 5LGKA 4ETQA 2AQ2A 3TCLB 3UO8B 3AWEA 2KKQA 3V5KB 2NLJB 1G0YR 3SKOA 3SGDI 3QNZA 2GKIA 2XETA 5C0BA 4AZ8B 4C56A 4G9FD 2WWNA 2V9RA 3A6BL 3AW5A 3KPPA 4H0HB 3MR9A 3AACA 4OM1L 2OYLA 1ACZA 3TGXA 5ICZA 1AS6A 3ECQA 3TH4T 1P7QB 1E5ZA 2A83A 2CLZB 4CSSA 1MFAH 1QP1A 2DL9A 4GNKB 2FCBA 3VD2A 1FL6B 3IKCA 1JOIA 5DRNA 3NJHA 4HU8A 3SDDA 5DFTA 4CU7A 5E6ID 1JI1A 3G5ZB 3CBKB 4TVUA 4JZJC 2P5EA 4IKJA 4NSKA 2XPGA 3T2QA 4LAJH 5GS1C 2APWA 2F5AH 1N64H 1RHHB 3KW7A 3C5ZB 5DEZA 4LLDB 1GAFH 5I74C 3U36B 3O3EA 2Z91B 4HUKB 2AVFA 4ZNCD 5K59F 1WZAA 4PY8J 2KUTA 5E8OA 3PWNB 3W38A 2EDEA 1PLAA 4HJ0D 1XSIA 5D5ME 3PWPB 1E5UI 1U8MA 4K3EH 4BE5A 1LWHA 1Y6KR 1OP3H 4WTXA 5KEZA 1IVTA 4L8CA 1DEEB 2NY6D 4R2GC 3BEVA 1CIDA 1XV8A 2B0SH 2UYLA 3BT2H 4JRXB 4YLCA 1OM3H 1QO3A 3CH1A 1II4E 4I7ZC 1AZUA 3LN5B 1KLGB 2BVQA 3EH4B 2NQDA 1T21B 2ZWYA 3NPSC 4M7JH 2WVTA 4N5UA 4Y2OA 4WY7L 1KJ2B 1H6UA 2ICWB 4AEFA 3AM8C 4NT6B 4NKDA 3HZMA 4L4VB 2AITA 4ZX3A 1UASA 4BA0A 3F7PC 4ODSH 2YC1A 5ALBL 3PWUA 3LHAA 4OCRH 2UWEA 4CVXB 1BWMA 3WEOA 1RLWA 4I0PD 1LO4H 2DEWX 2X1XR 1BQSA 2GC4C 4P2AA 2ZCLH 2HT4C 3FU9A 4GXUM 3D6GA 4UDUB 3ZUCA 3QUYC 4IM8A 5AVYB 1KLUB 3AROA 3GT6A 4XMZA 5TE6L 4JVUA 5CGYD 1SDDA 4EN2A 1INDL 2NTFB 3OZ9H 4WHCA 1JWUB 1Z2KA 2XKUA 3BWUF 3GBMH 3L3HA 3V0VA 3ECWA 1H9DA 3IN2A 5DMYA 1OANA 5ACZB 1DJXA 3V6BR 5DVPA 4XH2A 1LO3L 3UTTA 3ZHLA 1XCTB 4KXDA 3BZDA 3GK8L 3FRPB 3MRCB 4WW2C 4Y8DC 1NCWH 1Y0LA 3FFCE 3L7EB 4LLQB 4UCFA 1F8TH 1TQUA 1N2RA 5F3FA 4PRPA 4G83A 4MD5B 5DA0B 4U1KA 3UJIH 3BVDB 1I53A 3H3PL 3KM1A 5CSZB 4UV7L 1J0HA 4MMYA 1KYUA 2BDNL 1OP5K 5EEVA 4OT1L 2VABA 5KVGL 3QUHA 1ZWIA 4TNVK 4Z7VF 3QIBA 1QRNE 4FI8A 2X12A 1QBLL 2DTSA 5MHSD 4KI1A 2DLIA 4UZGA 4AM0Q 2O6DA 3I9GH 4GBXA 5I0ZA 3TURA 3C08L 4LIQL 2DWYA 3KPQA 4IHOB 3MXWH 4W9ZA 3VM7A 1UKSA 1OGAE 2AP2A 3P4MB 2A38A 3PLYA 5BQ7B 3ZZ1A 2P8PA 3PIQA 4IBTA 2BOBB 5CFHA 2YAPA 1BIHA 4O51B 5HHVL 1RUKH 3SQOL 4HUWB 1WT5C 3IMSA 5KYYB 1NAMH 3HAEG 2IOIA 4AX3A 2JQZA 5T3XH 3SODB 3CLEL 3PAYA 3SKOB 3K91A 4LLWA 1YJDH 3QNZB 3LZLA 3FN9A 4C56B 3SYQA 1FVEA 3UTSB 2A9BA 3KPPB 4BSVA 1L9OA 1TEYA 2AABL 1YMHA 2YOCA 3MR9B 4WGVB 5ICZB 3QZBA 1J1PH 2W81C 1WITA 4KU1A 2OMYA 3GIZH 3QG7L 2A83B 2V33A 1BVOA 4N0UA 4I13B 4W9JC 4KMLB 4DQOL 4GKSA 4N2EA 5DRNB 4Z3HA 2VM3A 3SDDB 1MFCH 3LX9A 1B2YA 4PV1C 3IDNB 1Q9KB 3BUBA 2JI2A 3QJUB 2P5EB 2YAQA 3UH8A 3U0PB 1XH0A 3G08B 4RFEA 1FI8C 4E9XA 5A16A 3OMAB 4CL7A 5JHLA 1IFRA 5F7HA 5ISZE 2F54E 4MZIA 1UH3A 1UZ6E 2YQ3A 1FLTX 3BKYH 2Q3ZA 4LL1A 4OM1H 2XWJA 2FWSA 3VFUA 3CH8A 4UQAA 1QRND 5ANME 4RETB 3C8KA 3TZVB 4HFWA 4PRBA 4MA7L 1U8MB 4OZ4A 5G5DA 1O9WA 2VZOA 5KG9A 4Z7OB 3L17A 2EEAA 3G7TA 3BEVB 1TENA 1OGAD 1VEPA 2QKIA 2UYLB 3D0VA 4OFIA 4HQQL 5GISL 3CH1B 3NIFB 5FAAA 3IRZA 1QSEB 1BFVH 3AS1A 4NQED 4LVNB 4MXWL 3U9WA 5KYNA 3O4LE 1T0OA 4GKNB 5E56A 1KENL 4Y2OB 1F6AA 1KZYA 4I1NB 3IRCA 8CGTA 1DVYA 3FW6A 4WENB 3GJEB 3MDJA 5E1QA 2G5UA 4PBWD 3HZMB 4JM4L 1LP9A 4JFFB 4Q4IA 3DJTA 3OC8A 3LQMA 2Z8SA 3NFSH 2YC1B 4KX8A 4Z7WF 3O81A 3PWUB 4K9EC 4AC4A 3AGVA 1HH9B 3CFNA 3T2NL 6TAAA 1B9KA 1RZJH 2NCMA 4NCC2 4KPHL 3PAVA 4NFCA 1R3JA 2OCJA 4FFZA 1HT6A 2NXZD 5DR5L 4OLXH 1OD7A 3RJQB 4D9LL 1UJ3C 1X7SA 4DFIA 4ZMAT 4LCWD 3EF4A 5BV7C 4OLWL 4N6RA 4PBVC 2BSCA 1WICA 5EBWA 3V0VB 1JCVA 1IGTA 4L4TA 5CJ8A 2VE6B 4YSUA 4TLSA 2X53A 3MN8A 5DT1L 4FKHA 2WP3O 4DVBA 4XH2B 2LTQB 3HI5L 4LE8A 2ADJA 1NEZA 3LTVA 1U93B 4QRFA 4PJ6A 5C09E 3UTTB 3QH3B 5CCGE 5ISZD 4QRTA 4O9HL 5ALBH 5DVOA 4BCZA 4MQTB 1N2RB 1OCWL 2WMPA 1CLVA 4H20H 5BOZG 3OAUL 4PRPB 2FBRA 1AS8A 4AMKH 4U1KB 1SJMA 1GCFA 5I1JL 2WYTA 1O9ZA 4H40A 1BQHA 4ZMYA 4L1BA 1G7QA 3HLAA 1N5AB 3G9AB 4MMYB 2J25A 1PSKL 5AYUH 5D7LB 4F9PC 2VABB 1M7DB 4JANA 3ARBD 1KY6A 1WBXA 1P84K 7PAZA 3F7LA 4QNPF 3MLSL 2EACA 3ZDXE 4XT1C 4FQLH 3CUPA 4BSJA 3EXJA 2Y2WA 2FSEA 2YMOA 3H0TA 3INOA 3MTRA 3RIKA 1J5IA 1QQDA 1EO5A 1ZA3A 2WXMA 2VDNB 3EJZD 4PJFF 1NBZB 4UT9A 3O4LD 5E95B 1IZJA 1MHEA 4PJHA 3FRUA 1T0MA 3VI4B 4PJ7F 4R4FL 4EZJA 1SYVA 3DBSA 5GRVL 1GHFL 3IDJA 5LBSH 4A7GF 3FSOA 2XN9E 4B97A 3CN0A 1C5CL 1DL7L 2E27L 2KYIA 1A9EB 3NJNA 3H3PH 2QQKL 2AJYL 4UV7H 2AERT 4JRYA 3QNYA 5AW1B 3TBTA 4YUEL 3CFCH 3T2LA 5KVGH 4Q9QH 1XXDC 4LSUH 1TO4A 4R7LA 3H9SE 1DFXA 4D9RE 5HYJE 3DWTA 1HE7A 1MZZA 4I77L 4WFFD 3TO4D 3MYJA 3FK3A 2D7MA 2FEJA 4BSVB 3HC0A 3RZCC 1Z3GL 5C07A 4LIQH 1IM3B 2HG5A 3M7FB 4W68A 4AVHA 4WDIA 3DIFB 2H3XC 3O6FB 4HAFA 3CX5K 2J5LC 2CO7A 1Z7JA 2OMYB 3N41B 4RBPK 5DUMH 1OV8A 2R0ZL 2HFGL 2Y3AA 2VLRD 2WGXA 1FNSL 1XB6A 3B9KB 4W6YB 3T1FA 4KQ0A 4ZQKB 4E9YA 1GY2A 2YKKA 3I9PA 4JRWA 3F3HA 2DLHA 3JYBA 3ZE1E 5AVVB 3S4SA 4KQ3L 4P2QD 4UIKH 5A43C 3SQOH 3NJFA 1ZAGA 1AIFA 1CDJA 4HHWA 4P23D 4XMLH 3CDFA 2QVKA 1KN2L 2BSEA 5C3TA 5I6PA 5LGJB 2J44A 2FHCA 2HTLC 1FNGB 3NCFB 3CZSA 4XHJD 2XLLA 3NQIA 3SKNB 3GSRA 4UNVA 3ZVVA 1JGDB 2AABH 4Q6KA 2XWJB 3VFUB 2ERJB 4KHXL 4JVPA 4K15A 2X6MA 4CBPA 2CJUL 4G8IA 5F7NC 4Z1PA 3QDJB 2WIIB 1GZPB 4HFWB 5D5MF 1VDGA 4DN3H 5G5DB 4MA8H 1OZTG 2IBZX 2Y07L 5H37G 5HJ3B 2H8PB 4F8NA 1BFOA 4AH2A 4U1GC 4DQOH 2NSMA 4Y9FA 4HUCA 2BNUA 2QKIB 2F1AA 3DMMB 1SRDA 2AJUH 2DTMH 3HW7A 1ZS8A 2QTEA 1U41A 3OZLA 2P49B 2XN9D 4RGOL 1ZLWH 4XC1L 2K6YA 3EFDL 4KXCA 3WU1A 2TRHA 4GRLC 4R7DB 1DVFC 2C7FA 1YNKL 1T7VA 3T65A 5F7EL 3UC0H 3KPOA 4ZUUA 3M8OH 4HD9A 2CUMA 4GRMA 4GUQA 1MREH 4DZBA 3CXFA 1HNGA 1LEGA 1LP9B 2OA9A 3H9SD 4HZLB 3QUXD 3TEXA 4KZCA 1GR7A 3VMNA 5HYJD 1FNFA 5T5FA 1L7IH 4XNYL 1EZVX 3G9VA 2Y36H 1Q0EA 1YA5A 3GSVB 4PJDA 1U2YA 4IIQA 5GGTL 1DBML 2EIJB 5KYWA 3MBXL 3QEUA 3EYUL 1LILA 3O45A 4HQQH 5GISH 1A5FH 3JT2A 2DKMA 2JELH 2ENQA 3BDBA 1SLXA 2DQ6A 1E0OB 1BF8A 1I1AB 2D7TH 4U6YB 1PD6A 4QRPD 4OKVA 4AQ1B 1IGTB 4L4TB 2V7HA 4P5MA 4FZEL 3UGEA 3II2A 2N56A 4X5PA 4JM4H 2PW1A 2ADJB 1YEGH 2WXGA 3U30C 1JMXA 1UATA 4C83B 1I9JH 4QRTB 2KDGA 2PXYA 1JV5A 4MDRA 5JUEL 3TV8A 4LSQL 1WIUA 3CFKA 4M61A 1HL5A 4ODUA 2IDUA 1AY1L 4FFZL 2EDYA 1VKXB 2V37A 5AKTA 4UOZA 3PWLA 4MWFA 1NFIA 2PP9A 3I6GA 2BHYA 1MW3A 5C9JB 2JIXD 1G7QB 4HCGA 3B83A 1ZHLB 5JR1L 5F0PB 1YMMD 4JANB 1WBXB 3L4TA 4FFVC 4GP4B 5HGGS 2WAQA 1KTDA 2CE6A 3D34A 4N5ED 1ZCRA 4G8GE 3LKRB 1MVYA 2FSEB 3H0TB 2WLIB 2YRBA 3TX4A 3T0BA 4W4NA 5DT1H 1UTDA 3DGDA 1S9WA 4KV5E 3UG3A 3U83A 4PJHB 1PG7L 3FRUB 4N2AA 5JIHA 4KGJA 4AUUA 5I1HL 5JW4M 4MD4A 3BSHA 2R15A 1SYVB 1PCSA 2WB7A 2XQYK 3FTYA 3P2BA 4U6HA 1OCWH 4BA8A 1I8KA 1Z5LA 3OAUH 1MCJA 5I1JH 3BH8A 4GS7C 5E4OA 2IDTA 4B27A 3F5WA 1T0NB 2VRAA 4L2LA 4JRYB 4NPYA 1SM3H 2FQEA 2AQSA 3U9PH 4F5CA 4N2CA 1NAKH 2IF7A 3Q13A 4NX0A 4NYLB 5EUOF 1NJ9B 3ZBMA 4XZ4A 4UT9L 1MXGA 1CLZL 3WEBA 1BVNT 3MYJB 4QXGL 5H35A 1V55B 1T2JA 3Q6GL 1PNCA 1Z5HA 5C07B 4N9GB 1N3NB 4M4PA 4WDIB 4C4BA 2BVTA 4R4FH 5IQNA 2P5WA 1KYOJ 1JHTB 4FYQA 3DI2B 4AW4A 4TM9A 3MTXA 3T1FB 2GJ6E 4I5BA 4Q52A 4ZNEA 3IMTA 1KULA 4P3WA 3ISYA 1Y18A 2QQKH 1AGFB 2AJYH 3S4SB 2WNKA 1AIFB 3ATEA 1XSJA 4G1EA 5LGHH 5K9KA 3C60B 5E6SB 4PLJD 3TWYA 3B9DA 4BFIB 3ZKND 3QORD 1U8IA 2JJSA 3X1NA 5IJKA 3SDXA 1AAJA 4JCWA 3S0PA 1P7BA 4H8VA 1UZ6F 2ROXA 3WV0A 4I77H 1UGNA 4TSAH 5EC2A 4HOZA 4HGMA 5C0CA 4NQCA 4Y1TA 4IKKA 2IH1A 2CBOA 2QQNH 3BZ4A 1NCOA 4M8UA 2R4RH 2F0CA 4G8IB 4P9MH 5B1BB 3WEAA 4G8GD 4Y5XC 3AT0A 2D3LA 1OGTA 1WDAA 3GRGA 4OZHA 2HFGH 1BFOB 1FNSH 4I3SL 4AH2B 4HJ0C 3VG9C 2WAHA 2F08A 3CFDB 4LL9A 5IOKA 3EFFA 3ML9A 4UI2A 2JCCA 1H3PH 3S88L 1T6BX 2VW7A 3PAZA 4KQ3H 3WHE1 5DYOA 3TYFA 4ODHH 4HFUL 4LRIC 3T65B 4L9LB 2BVEA 2NY5H 2UXTA 1QYGH 1JZ4A 2ZUTA 1IEAA 1KTJA 3KPOB 2F53E 5KBNC 2X9WA 3FSAA 3L4UA 4B9ZA 1AR1C 4DZBB 4YHLL 3IPEA 1Y07A 1OHZA 5C0AE 3MV8D 2XG4B 5DEFB 3VXNB 1E3ZA 2NY1C 1YN6A 3LS5H 3LMJH 1TTBA 2YPVL 2UZXA 5AVQB 1J7VR 2C4XA 2QPUA 1KYAA 7FABL 3APCA 4PJDB 4KI5C 1WK0A 2BM3A 3U4BH 3IJYA 5KYWB 1T5WB 4WTQA 1MFMA 2DM4A 3ZDYB 2RB8A 3O45B 1T7XA 1HWHB 4XC1H 3COOA 4Y2DA 4EI5D 2YSSA 3MA9H 4KO9A 3CVDA 4JY4B 5TGBB 2NDFA 1HS6A 1TDQA 2OTUA 1R5IA 2V7HB 3NN8B 1QFPA 2IAMB 2PR4L 4P5MB 5CGYC 3WNJA 3FCSA 4NKMA 3UIZA 3VX0A 5E1AA 5JXEC 4XE0A 1ZLDA 4KKCC 4GSXA 3SD5A 2PXYB 1BDYA 4XNYH 3CFKB 4MD0A 4M61B 2ZCKL 4NN6C 1J87A 3WELA 4ZMOA 4K7PX 1GGIL 2PCPA 5JW5A 3E7JA 1THAA 5FECA 4YHOL 2JI3A 1JK8A 5EIVA 4ANWA 3PWLB 1DBMH 4MWFB 3GMRA 2YD1A 2XQBL 3D08A 4HWBA 3DUSB 4XMWA 5GZND 1CN4A 3RQ3A 4P46D 4ZZFA 1XX9C 3QDGA 4JE4B 1WGVA 3FT2A 4M43L 4QOKE 1EIBA 5AW5B 4CW1A 4PJGA 3EDEA 3V7AE 2CHWA 2APTA 4LT7A 3VD9A 4YSEA 5KZCD 1KTDB 4QJ3B 4OVUA 3HI1A 1F41A 3ZDXF 2VDKL 5GRWA 3GZOA 4FZEH 4P2YA 1C9SA 2RJMA 5ID1A 2B2XL 1LDPH 2F53D 5CP7A 5JUEH 1F1AA 4XPGL 5IJCC 2V8MA 1JGEA 5B3JE 3MO1B 5SV3A 1T1XA 2ZCHL 1AY1H 4FFZH 5L7XH 2ZQKA 1R5VB 1Z5LB 1IC5H 3D8MA 4MFHA 1VGEL 3JV4A 2JB6A 3UYPA 3KJ4B 3F5WB 4GG6A 2AQTA 2VQ1B 4NPYB 3DDFA 5K69A 3VRJA 2PYEE 3CFJA 2VN7A 2MSPA 4XMKH 3SDYH 2FH6A 3V7AG 4RFOL 2W91A 5C7XH 2MFNA 5EU6A 3TA3B 4HETA 3GMPA 1H8OA 4L8BA 2ADGA 4FQXB 1TYRA 1IRAY 2Y22A 3DV6B 5LBVA 3TIEA 2ZP0T 1JPEA 4ZPVA 1R46A 5EDXA 2O5XH 3EOAA 4PRHE 1P5VA 1VENA 2UUDK 3IE9A 2P5WB 1UKTA 2DYPB 4OZGB 3FHAA 1WD9A 3K8MA 2XIDA 4PPTA 1TYEB 4I5BB 5KJ4A 3VNYA 4OD3H 5LGYA 2OSXA 4HPOL 1FGVL 4NZ8A 3QQ3A 3OBAA 4E0RB 1GYAA 3LH9A 3ZE1F 1RURH 1XWVA 1NEPA 1G9ML 3OTTA 1DBAL 4NJAL 1PY4A 5DEGA 5HHME 1K5WA 1U92B 1ZJAA 2UVFA 5J57B 12E8L 4YSOA 4ORGA 3TJHC 1BZ8A 4M7KH 1EEYB 1PPIA 4N2DA 5TFSL 1ZE3C 1P2CA 4UT9H 3FF7A 3IU4H 3DO7A 5EC2B 1CLZH 3F12A 5C0CB 4QXGH 1XF2A 4NQCB 2A9CA 3FBQA 4N20A 4PCSA 3BZ4B 5LAXA 2E46A 3VX1A 1P6AB 3UDWC 4DVRL 2RAMA 4R0LC 3FQYA 4LDLB 4LVHB 1QAWA 4OZHB 3A6CL 5AAWC 3NRFA 4ZXBA 1VB9A 4LCUA 1HHGB 2P46B 4NPKA 2JCCB 3D4ZA 1NICA 2VXQL 4HH8A 1I4FB 4M6ML 5DYOB 4OAWA 1AE6L 1GKOA 3V4UL 1DBBL 3DTUB 1IEAB 1QWHA 3THML 4Q6IA 1E6JL 4URTB 3SJVB 5KSBA 3A4AA 1B6DA 3HRPA 5C0FA 2PYED 4LK4A 1TQBC 3QBTB 3RA7H 1QPXA 1NSNL 4JDTH 4EUPG 3H55A 1U8PA 4G9DA 2MHAA 4JQIL 2UZXB 2EDOA 3OPZL 4PV9A 3MCG1 4I18A 1IE4A 3P9WB 3BD5A 3LKOA 3IJYB 4O02L 1MRCL 4PTTB 5J12C 5JA9A 5B3SB 1V05A 5D8JH 4J39A 2J8OA 2VJ0A 5TF0A 3S98A 4TTGA 4Y2DB 5LNDA 3VXUA 2CM5A 1OIOA 1FFPA 2YSSB 3DNKA 1RULL 2NXZC 5MEQA 2JQAA 1XGUA 1WUNT 3BAXA 1KEML 1R5IB 1RUQL 4M7LH 4YHLH 4PGBA 4Z7AA 3TEWA 2GQHA 3FT1A 4UUJA 1OAUH 4U3HA 1SVCP 4TXVB 2WKGA 2PP8A 2ZXGA 2Y6SD 2QADD 4UOJA 1A6ZA 2CO4A 1FNEA 2WUBH 3DJZA 3HTLX 4W4OC 4BCYA 4ABWA 3I02B 7FABH 4FXGC 5FECB 3B37A 2HA1A 1JK8B 3S97C 2FO4A 4LARH 5AKVA 3D0LA 2VZSA 4IIZA 5BZDA 3AQYA 3REWA 2CNZA 5EBMA 3QDGB 2MTAA 3FT2B 1NLDL 3V4PA 4CW1B 2BZDA 2JB5L 3RP1A 3BESR 5HBBA 3LXUX 3HE6D 3K80A 5KUMA 2NZ9C 3WMQA 4S1QH 4GAJL 4HWEL 3X14A 1WHOA 1RH8A 2VUYA 4A6YA 4NN5B 4WWNA 4APQC 5T5FH 2XBDA 3CFMA 5CJXC 2R56H 3WTYA 1AD9B 4KV5F 4TVPE 5I6LA 4IJ3C 3CIAA 3GTTA 4FRWA 3WKML 1XGYL 2ZCKH 5EBLB 5IBUB 3O41A 4CADA 2DWDA 1GGIH 1KPVA 2XBTA 5DMGC 4HWBL 3SBWA 1BXXA 1BQUA 3ZYJA 4YH6A 4R8WL 1ADQL 4YHOH 4XNBA 4CILA 3AU1A 3UTZA 4ZG1A 3V79C 5I5JA 5EOCL 3UYPB 1LTXA 1T7ZA 3BAYA 5I76A 4EN3D 3NJJA 5AOLA 4M43H 3VRJB 4F91B 4L3FA 3CJJA 3CFJB 4AJWA 3GMLA 5DRXA 3APFA 1YEDB 3F2LA 2ZXDA 4FA7B 5EU6B 4LMQI 4N8CL 3GMPB 4HGWB 4B9PA 2VKXA 2ADGB 1BLNA 5E2JA 4OB5L 3TIEB 5E5UB 2VXVL 1X9RA 1HYSD 4ZPVB 3BPLC 3BE1H 3VYPA 3N06B 2P3YA 4BFGA 1AI1L 2WJ5A 4IRSD 2ZCHH 3O6ML 4GP8B 4YFDB 3SO3B 5I0XA 5HHPB 4JG0H 2XU9A 1T89C 5F7FA 3QQ3B 2H2PD 3GINA 3OB0K 3PFUA 3CV5A 1UM4H 2WM0A 3UBXA 5DEGB 5D2NB 3L5JA 4HIEA 3TBCA 1S7XA 3EGXA 4N1HB 3RIFK 4ORGB 1SXAA 3VJ6A 4G5AA 4BV1A 3UZVA 1P2CB 2NXYD 1L9QA 3F12B 4HG4K 2ZICA 3FTSA 1KXQA 4NUGL 4GXUN 1J86A 1DVQA 2MIZA 5CEXA 2DW5A 3D39D 4WKXA 3W37A 1H6TA 4OM0H 2LE9A 3ZYIA 3VDBA 3KH3A 3C6LA 1JF5A 3HNTL 3HR5B 4NXSA 3ALXA 2BMKB 5DHXB 1RZFL 4GB9A 4J12A 1KV3A 1KCUL 4F7EA 2R0LH 3W2DH 4TVPD 3TPUB 1P4BL 4UNIA 3MLZL 5TE4L 2Y7LA 1D6EA 1P7KB 1G9MH 3HN8A 1DBAH 4NJAH 4OAWB 4AC2A 3BFWA 1W72A 4AWJC 4GW1A 4A7TA 2X3CA 5KSBB 2JKNA 4R7NB 1E27A 4L0PB 5TFSH 1I9EA 4M7ZB 3GEWB 5C0FB 4DF9A 3LDBC 4QO1A 2ROYA 4X5RA 1U8PB 3P69A 4J3OD 4DVRH 2MHAB 4AQZA 1CC3A 1JXJA 4PV9B 5CEYA 3TWCH 1MFUA 3QUXC 4XCEB 1TR7A 5F96L 1ERNA 2HKFL 3G5VA 4JS7A 2D4FA 1QTPA 1AC6A 3LKOB 3MRFA 3QIWB 1GJIA 1Q38A 1T1ZA 2IPKA 4ZS7H 3ABMB 5TDOB 2OZNA 5DJAA 5HPMB 5CEZL 1FO0B 1AE6H 2X4OA 1OAYL 4QJ4B 3N85L 5MEQB 4K3JH 1IBGL 1XGUB 3THMH 1E6JH 4H26A 4YVNA 3SQRA 3MCKB 1MJUH 2EYRA 2PP7A 2B8OT 4KOCA 5GRJL 3D9AH 4UUJB 2Q2EB 1NSNH 4JY6B 1FNEB 3NCEB 1KBKA 2VR4A 1AO7A 3WY3A 4AZUA 1FIEA 5DZJA 3OPZH 1L0PA 4PGEA 5D7SH 3RX9A 1KELH 4AENB 2Q10A 2QDWA 2FO4B 4NC1E 2CUIA 4XOCA 3ROOB 2OJZL 3JVGC 4HSAC 1JG9A 1NBVL 3RBGA 4K2UL 5BZDB 3GXIA 5B38G 1MHCB 1CR9L 3NZSA 3V4PB 3KVPA 3N1GC 1XR9A 1OSPH 2ZNXA 4NGHL 4RGNC 5DK2B 4QHKI 4CMHC 5I6MA 2G75A 3MRPB 3NMEA 4HJ1A 1ACYL 3C09B 1F11A 3X14B 1KEMH 3CDZA 1RUQH 3MNWA 4A6YB 1MCIA 4Z7QE 1MRFL 2IDSA 4PVBA 2J1WA 2X7LA 1HCFX 1F42A 1WS7A 4MNQB 2CLVA 3QUZD 3FKUS 3WIHL 4DKFL 4B53A 4IK7A 3VDAA 5B3JF 1KPVB 2VDLL 2BRQA 3ETBF 3OSVA 4FFYL 1KNOA 5I1GL 2AJXH 4KKPA 3F58L 4AITA 1AXSA 3C8DA 4HKZB 3NSFA 1RLBA 1F58L 5I76B 3DURA 2WQVA 4HIIA 3AVEA 1VCAA 3MV9B 4EZLA 1NLDH 2GJRA 3KZ8A 5DRXB 4NUMA 2JB5H 2LAGB 2CBMA 1WFMA 3LZPA 2PCXA 3L08A 2ZOUA 3JUZA 2DMBA 4HWEH 3ZDZE 1BLNB 2P47B 2IGFL 1XO8A 2B59A 2GEEA 1TZHB 3VQ1C 1IGMH 3BUTA 5MENE 4P5SA 1E4XL 4AGMA 4Q6YA 1ODUA 2WVSA 5CKGA 3DKHA 3QJZA 5HGAA 3ZTEA 2F19L 2K8QA 2HUEA 3VXSE 2YBRA 5J9PA 4WVRA 2NPLX 4ZBJA 4HWBH 2MQ0A 4PQXA 1HU8A 2XXGA 1VLXA 3E6HA 4FZ8L 4W93A 4OJFL 1S7VA 5GS0H 5JYMA 3HG3A 2DQFA 5CM1A 2MOGA 5EOCH 3T0AA 5I71B 3N5AA 3CXHK 4FX5A 5DMIL 4FKEA 1ZEAH 1AYRA 3LN4A 4HIEB 4NQXA 3S96B 3QRLA 5I8CA 4C59B 3BZ5A 5AWNH 3T3MB 2NYYC 4N8CH 3IFNH 1HDMA 3SYPA 3WXWL 4OB5H 4WWKA 2VXUH 4AI7A 3FNKA 4G6ML 5CEXB 4G71B 1NIFA 2RCSL 2LABA 5FGSA 4ALAL 2IQ9L 3HOGA 3WTUA 1AI1H 4LP5A 3IJSB 4HX1A 3R19A 5DCCA 4F7EB 5B8CA 3GNML 1SVBA 4XN4A 1MHPH 1KBPA 2WW8A 3QR1A 2XY1A 1D6EB 3CIQA 1A7NH 2QR0A 1RY7B 5C70A 1J9RA 1MN4A 3P4LA 4GW1B 2FBJH 4MJHA 3TNMA 1E27B 4N8VG 4HEPG 3S37L 3SOTA 2KI6A 2PKDA 3R1GL 4YDIH 4DGIL 3MGOA 3EGSA 5D6DA 1HH6B 1GPOH 2ITEA 3MOQA 4I0CC 3LAFA 3HNTH 5CEYB 3K4ZA 1RZFH 4FQHB 3G5VB 4PJBA 5MEND 2HPOA 4KXAA 2V5RA 2C26A 2K1MA 5ICXA 5C0JB 1P4BH 1W72L 2IPKB 4AJ0A 3VXSD 3DO4A 5TE4H 1WFUA 1U42A 2HVBA 4PRIE 2GSGA 1BAGA 2Y1ZA 3TBVB 2ZYIA 4MNGE 5C0RL 3S35H 2LLGA 1CG9A 4H26B 2H0EA 3T6XA 1MIMH 3HB3C 3UPCA 2ZT9C 2BP8A 4MHHI 4PI0A 5L4FA 5L9DL 1Q1PA 2PWGA 1F18A 4HIQA 5EWIL 1W8OA 3SY0A 1Q72H 5FV1L 4Z18A 1KXVA 5F9OL 2Q6WA 3EYQD 2P43B 1BZOA 4PGEB 3TL5A 2HVKA 3EJQA 2FATL 3RWHA 4PTUA 2YWZA 3CDGA 1JF6A 4YHKL 5KTEL 1IFGA 5F7UA 2XTJC 1DE4A 1YY8A 1EHKB 1XR9B 1TMCB 2R1YB 4R3SA 2BWDA 2G75B 3D87B 5BO1L 1BHGA 3GJFA 1F11B 4H88L 4WI9A 3DA0A 3CDZB 3MNWB 1XBRA 4H2CA 3ESNA 1F2XK 5MI0C 3CAFA 5KAQF 2DD8L 5HGBA 2X7LB 2F68X 3S36L 1XCXA 3L9EA 5F8QC 4Y5YB 2CLVB 5JDSB 1EFXA 1QWUA 2D7NA 4FQJL 3RI5F 5JO5A 1S78C 3E1F1 1BG1A 1ZJBA 1G84A 1A6AA 4F57L 1JPSH 4JFQB 3ZL4L 1NC2D 5G55A 4UT7L 1AXSB 5I6OA 2AI0H 3GTVA 4BGLA 1LE9A 4G6JL 4U6VH 3E9TA 4Q9RL 4LLAA 3IDGA 1E8XA 5C2BL 3KLHC 3G5YA 5DRZA 1J48A 3IRPX 1ACYH 2QMKA 4FTVE 1CICD 2R23A 3FQ4A 4J3OF 5ABDE 4XVJL 3EAKA 4PRID 2FR4A 4ZW5A 3BUYA 3WIAA 1MRFH 2GYSA 4OLVH 4ZUWA 5F7AA 3H3KA 4BD4A 3TTYA 3Q3GA 1BZ7A 2OJ1A 4P8QA 1E8ZA 4DKFH 5KW9H 1JYWA 4WW1A 2YBRB 5J9PB 3E6HB 4YJZL 1S7VB 4E9LA 2DQFB 3F58H 3VXRE 3V4PH 1GS8A 1OPOA 3LNEA 3IFLL 1F58H 1MCOL 4G70B 5D1ZC 3RG1C 2YZ1A 4NNXA 3ZHFA 3LN4B 2F8OA 1S7QA 2BFGA 3FPXA 4NQXB 4X5QA 2GABA 5D2LE 1MI5E 5I8CB 3NA9L 3OAZH 2V17H 2VUOA 4A6YH 1Q9WA 3TA4D 4Z0BH 4AQ8A 2UY6A 4MRCA 2YGQA 4P9HC 5E2VH 3ZTJG 3P3SA 4JPWL 1CTOA 25C8H 4WWKB 2E6QA 3VCLA 1E4XH 1MAMH 4LCYA 4QYOA 3MBEC 4QRUB 3QEHB 3KG5A 4UQ2A 2N1KA 4UOW1 5IWLA 3K74B 1DBKL 3DIDA 3H2PA 1WAEA 4MCNA 4FZ8H 3OM3B 1XXFC 3CHSA 3QPKA 4JUTA 4LSSH 3HS0C 1Z3RA 5B8CB 5LXGL 1FHGA 3ARGA 3W9DA 2DB8A 5AUMB 4F2ME 4WFGE 4JFEE 5GHWL 3SPJA 1E4KC 3B3IB 4Y4FD 2O5YL 4AYFA 4HOXA 1E2ZA 4FYSA 1P84J 2FX8L 2ITCA 3HA0A 3QZWG 4XN2A 1M6OB 2BVPA 1VFBB 2OL3B 4UQBA 2B20A 5E4EB 1SMAA 4OZIA 2O72A 2HFEA 1MAJA 3OR6A 2ZKHL 3DXAA 4FEMA 4JGJA 3BUDA 3QJOA 3KNBB 1HEHC 3AITA 3F7YA 1IGFH 3VYNA 3QCVL 4KKRA 5ICXB 1TNNA 2APFA 1SPDA 5DJDB 5JW4N 1R34A 2GSGB 3RILA 4GP5B 4W9EC 5I1KL 5EO1A 4GXVL 3VXRD 4ZFOA 2N3JA 1CG9B 4FE9A 5LBGA 5BO0D 4M8VA 3QC5X 1C5BH 1MIEL 4KVNL 1YYMH 2BP8B 4QTFA 4Z77A 2VJXA 3GO1L 3BC9A 2A9AA 1BFSA 2PCYA 1Z0NA 3AC0A 1MI5D 3SY0B 2ED6A 3BKJH 3C2AH 1H8LA 3F04A 4S1SL 5D55A 4DGIH 5L2KE 2EDMA 4IGBC 2Q6WB 5JHDE 2CAKA 2EDLA 2KMWA 1BF5A 1ID5I 2ED9A 3VB9A 4ESKA 2XBZA 3LSOA 2HVKB 1SF5A 4HJGA 4LHUB 3RWHB 4PJ9D 3HPLA 2NX5E 5E70A 4ZTPH 3CDGB 2X10A 3D1MC 1QZNA 2O6CA 3CHPA 4XVTL 3L45A 2E4TA 2XT1B 3HE7D 5DD3H 4IEFA 1KBVA 2HUHA 1HSBB 1JGUL 4R3SB 4R96B 3OQRA 4KRMB 4WFGD 4JFED 1QKZL 4HISA 4HKJA 4H2AA 4PJ8A 4LVEA 5D71H 2BFVH 3PRZA 2A0LD 3RDTC 1Q4NX 1CBJA 3OKEA 3VH8B 3EBGA 5HGBB 4Z7QF 3WIIL 2IADA 1NCBH 1PZ2A 4BQCA 2Z31D 3VTTA 5FKPB 4XMTA 1E4XI 4UAOC 4BZ2L 1J8SA 4L0ZA 3ZSTA 2M2DA 3NDZE 1A9VA 5JIIA 2F7QA 4KQ4H 2FATH 4HJEA 3RGVA 4PIBA 3FQUB 3U2IA 1KBGH 1LE9B 2K3TA 3P9MA 5DQJB 5FR3A 3BO8A 4JB9L 1TETL 1FZOB 1KOAA 2YQBA 4J4PC 4NC0B 3IDGB 3W82A 1K2DA 3G5YB 3VFPA 5DRZB 3BWAA 3BDYH 3UYOD 1L5GA 4FI6A 4HPHA 4Z7VB 2BC4A 1QFUL 4H88H 1N59A 4YVUA 4KMTH 2ZXEB 4K7FB 4QHPA 3UADA 3ZDZF 4QTHA 3QDMB 1FFQA 4ZUWB 3ZUNC 3HZ3A 4Z3GA 2VAAA 2QGEA 4KWUA 4JO2L 3Q3GB 4YL9A 1ZSHA 2XICA 5DWUH 1NCGA 4WW1B 4FQJH 5MP6H 2AJZB 2G5RA 5EZOH 4F57H 4PJIE 3Q48A 5L2KD 2NY0D 3F83A 4IBYA 5AOIA 1AP2A 4B9JA 5JHDD 3MRNA 3UBXI 1S7QB 4IKLA 1MJ7H 1ZLSH 2NX5D 3IM1A 1SGKA 4WEEA 3BP6A 5AOKA 1G43A 1Q9WB 4ELMA 4PCTA 3MRBA 2GJPA 1QUNA 1TLMA 3ZGIA 3SE4C 1ZXKA 2QPFA 2KQMA 2ZTBA 3GYRA 4PB0H 1IBHA 4PBDA 3MODL 1I1YA 4K3HA 4LCYB 4OFPA 2EUXA 3VU1A 4UQ2B 3HHRB 3ZQ9A 4HLEA 1L6PA 4Y2NA 1OAJA 2FLMA 5AVZB 4XB8A 3DRQA 3TO2A 5BMFL 4XXWC 4FNQA 5T3XE 2NQCA 3ARGB 5CKAA 5DURB 1RIUL 2EIKB 2DLEA 3WNOA 4BFKA 1YC8A 3M7OA 8PAZA 3ZSSA 4ZFGH 1F1GA 2FVNA 1F4XH 2ITCB 3K2IA 3VQLA 4A55A 1G6VK 2BVPB 4XNZB 3HIZA 3ZZLA 4ZAKB 1IKNC 1P1VA 5IV2B 4DESA 4HPYH 4YSDA 1J9QA 4EXPX 8FABB 3I85A 4OZIB 5TTRA 4ABVA 3HMXA 5EU7C 4DH2A 2PYFB 3OR6B 2CDGB 2PR9A 3TNNA 2OW7A 1E65A 3DC0A 2ARJA 2PO6C 3DXAB 3CFIC 4JM0A 4WSGA 1FZKB 3OGCA 3FTZA 3F00A 3HFML 4I85A 4OFDA 2Q76B 2J6EA 2R8SL 4PR5A 4DEWA 5J1TC 2YS4A 3GQFA 3SOBL 3ZL2A 1CS6A 2V2TA 5GHWH 3NFNA 1H9VA 4DGVH 4QRSA 3QRFM 3A4EA 4Y4HD 4WV1A 3MJ8A 4GQZA 4BM7A 4QRBA 4ZFOB 5EA0H 2XNAB 4N9OB 2X4QB 2BHFA 3QUML 4F80A 1VEMA 4WO4A 5DZNA 3SYOA 2CUAA 3FN3A 3VWJD 5D7JD 1JHLL 3M1CA 1ZDQA 2XZCL 5A7BA 1CLOH 1GJUA 1EZUA 3L3IA 1N0LA 2ZKHH 2B3RA 2V3FA 4HMCA 3VI3E 2QPEB 4U1IA 5ESAA 4M48L 3LSOB 4ICXA 3WS3A 1IJ9A 5HDQL 4KK9D 1MFEH 4JR9H 4XWOD 3V6ZB 1AQHA 5I6XC 2NY4B 3QCVH 2MCMA 1XTLA 2C9XA 3E8UH 2FYVA 4LLVA 4N0CC 4XTRC 1EX0A 4ZFOL 3B6SA 5FB8A 2O93L 2B5IB 2F74A 2FZ3A 1HWGB 4LEXL 5T3XD 2OL3H 3VW3L 1AANA 1XL4A 1SMOA 4GXVH 3QQDA 2VRQA 3BVXA 4LSDA 3LQAC 2VDML 4KVNH 4PJ8B 4O2FA 3VXMA 5L2JB 3OKEB 1GC1L 2IADB 4FDWA 3BHBB 1F2QA 4NEHB 1RIVL 2WHVA 4N2HA 1UWGH 1RJYA 1S7UB 3UAAA 3QNXA 4TQEH 1WA2X 3FFCA 1VPOH 2FBOJ 5FGRA 3WMPA 1KB5A 2FJGA 2K0RA 1FC1A 3ILEA 4PRAA 2QQLL 5T3ZH 3PUUA 3UJTL 2UXVA 4QDGA 4BH7A 4J5VA 3P9MB 1FVCA 2YPKA 2KH2B 2Y06L 1RZKC 1K2DB 4PGDA 3HAEA 1X5AA 2QHRL 2DWEB 5DHEA 1L5GB 4HUUA 3P40A 5HYSG 3FU8A 2BC4B 1QKZH 3QARA 2JMRA 4NAJA 5AW2B 5J6HA 1A3LL 2JTDA 5J1AA 2H3NA 3SDAA 4UU9B 5C6TL 3SBRA 2VAAB 5I5RA 1JIBA 3AUWB 5AKRA 1INQA 4KNSA 5E2UL 3JWNC 4QRQA 3DHMA 3P2TA 2NY6B 4CGTA 1FFOB 2AEPL 4ABUA 2VT0A 5ABZA 3BVNA 2FT8A 2VLMD 4MJIE 1JD7A 2I9TA 1ACCA 2FJHB 2MOVA 1K4CA 1AP2B 3DV4B 2R4SL 3PJLA 1BQ5A 2BY0A 4TULL 4PS4L 4KMQA 4LCIL 4OCLC 1GGCL 4NUPA 1G9NL 3EH2A 4ZX4A 1OAXH 3EHBB 3K2UL 4QF1A 4HJJH 5D2LF 3UTOA 5GS2H 4X8GA 3BP6B 4HLJA 4DPAX 2J1KA 4ELMB 3HI6H 4JZOA 2MRYA 5EUOA 1EHNA 5EORH 3WKYA 2OK0L 2DBJA 4NJ9H 1P7QD 1QUNB 1XSOA 3SPHA 4XPTH 1JUFA 3VFMA 4GAAA 5FHBL 15C8L 1QNIA 3N0AA 3VB8A 5FWQA 1NLBL 3TN0C 2XHNA 3DRQB 3Q44A 4L1LA 1KG0A 5AQ0A 5KVGE 1RAMA 2YMXH 3BX7C 4LGSB 4X6BA 1J8HA 5HXMA 2VLLB 4EOWL 4A7QA 2GT9A 3C5ZD 1IU1A 1OP4A 1J0JA 4PSRA 3I3EA 4LIQE 1CGYA 1YQ2A 5IM7B 1T1WB 4V2BA 4YHPA 2IG2L 4MQXD 3BW9B 5EIIG 2IC2A 4TKWA 1G7IB 3FO0L 4AQOA 3RFZC 5CSBA 1CD1A 4BYHA 1D7DA 3TNNB 2EUZA 1SUJA 3QJVB 4KDTA 5KJRL 1D5BA 5L0QB 2E9WA 2HX9A 3E80A 5D5MB 3G5WA 4JRXD 3Q06A 4BH8B 5BMFH 4IOFC 1QW8A 2FJUB 1DJGA 1J88A 3WFCL 4LKCA 1KCSL 4PR5B 3X3GL 4ZD3L 5IQ7L 1PMYA 2HXAA 3MJ9L 5FKAA 1RIUH 2V2TB 3NFNB 3FTVA 2Y7SA 2JJVA 1WO2A 1PG7X 3BVUA 2X4SB 3INUH 5DVKA 5K39A 1RJCA 5D1QC 3NZ8B 1I9IH 3I75A 1U8KA 1DSWA 3HMXL 3UL4A 1H5BC 4K73A 2CUHA 2VH5H 5I6NA 1VSCA 4LPTA 3WN5C 1WUZA 3D07A 3CC5A 5B39G 3L3IB 1ZHBB 2AQPA 4L48A 1RPQA 2XX0A 1E3XA 3NSDA 4A66A 4K8RH 2C8NA 4X7SL 3KCWA 1XAKA 4QHNA 1CWVA 1HE8A 5CFAA 5I1AA 1JPGB 5C0BE 4C56E 1MCBA 3ARDC 1J0IA 2DQJL 4LLYA 1ASQA 4LLVB 3B6SB 3UG4A 5FB8B 1MWAA 2F74B 5F9JA 5IKCB 2F8VA 3QQDB 3Q9QA 3HFFA 3VFRA 4NKOB 4DEUA 3BJLA 5F0MB 2YGPA 4MCMA 4O2FB 3LH8A 2DQDL 4I9WD 4Y88A 1O0VA 2JKTM 3OJDA 3PWVA 4KROC 2P5EE 3IFPA 5BZXA 2Q3XA 4NZTL 4PW9A 3HVNA 4MNHA 1J0KA 4NOFA 1OTSC 3QNXB 3B7SA 3TT3L 1KIRA 3FFCB 4CC1A 1IARB 3M45A 1KB5B 5JLZB 1XEUA 5GGVH 2JKXA 4ZFQA 2CWRA 4PRAB 1SEQL 3UAEA 4Y9CA 1FVCB 1I8LA 1MRDL 2IAAC 4UTAA 4EDWL 3EW3B 2CKBA 1P0SE 3F7KA 4LEXH 4PGDB 4C47A 3HAEB 1NKOA 1CFBA 4P5TC 3BAIA 4MMXC 4X99B 4HUUB 1V7MH 2XWRA 3U48A 3KYAA 3PREA 3BPNC 4LF3A 2OXHA 4DGYL 3DYPA 1MVFA 1QRNB 1C7SA 4H8WL 5J6HB 1CDUA 5I17A 3SDAB 4ONFL 5FGBA 1MCPL 5IUSA 4NO2A 1WVZA 3TXAA 1U58A 2Z93A 4PWKA 1TQCC 1CICC 1EA9C 3MREA 3WS6A 1H3TA 3LEVH 1YVLA 2B15A 4PP1C 4QRQB 4W9LC 1ZTXH 3NEOA 4IOSD 4UANA 3CD4A 4B41A 5D1XC 3BVNB 4AGQA 1BIIA 1BJ1J 4FEIA 3LXCA 4AKOA 1SOXA 4PJIF 2QQLH 1OP9A 2X4NA 2AJSH 3UJTH 3RTQA 4X8JB 1OO2A 3KYOA 2R0KH 4PWHA 3VXQA 2C1OA 5AVTB 5AFAA 5C0IA 2PPFA 4C56D 3QZPA 2UWEE 2KBGA 2GUOB 2NR6A 2YD0A 3AS3A 3LHPH 4M3KB 4UV4L 5EBGA 5B4MD 4QXUL 4FNPA 4ACTA 3MNVB 4JZOB 5EUOB 4EF3A 3QHZL 2WKOF 1A3LH 2V3DA 3CQPA 4U1MA 3VRIB 1DBJL 3FH7A 3SQBA 3TV3L 3VFMB 5D7IA 4K71C 2R7EB 1Q0YL 3VXPA 1UGKA 5GSVA 3SDDD 1N70A 1VAHA 2AEPH 2IIJA 4F9LA 3X13B 4GUPA 2GITA 2NYKA 2P5ED 3QXAA 2WSDA 4YHIA 3SE9L 1EEZA 4KXBA 2BIQA 1J8HB 3NTCL 3I6LE 4TULH 3RY6A 4L8SC 1E9PA 2WXKA 2C9AA 2GT9B 5DD6A 3CMOL 3RJDA 1HCYA 1GGCH 1G9NH 1LNUA 1CD8A 2P8MB 1D9KC 4G3YL 4D8PA 4YHPB 4FQQA 3QRGH 2F54B 3D51A 3TZVD 4W6XB 3S34H 1I3GH 1CD1B 5J6GA 4MDIA 5FHBH 15C8H 3QQ9D 3J8F7 1D5BB 5ANMB 3V0EA 5T33H 1VRSA 1SY6L 5EEZA 1D5MA 1TJXA 2X4TA 3WEXA 1IM9A 2E8ZA 4FMFA 2WXNA 2EYSA 1QSED 2LU5A 2W95A 5FKAB 2MQ3A 1A3RL 2QMJA 2XZZA 4EOWH 1JNNH 4DUXA 5K39B 4IBZA 1BZEA 4P3DA 4WUKL 5H4YA 3I75B 1UYWL 1I85C 3JTTB 4JFFD 1TZGH 1JZFA 1U3NA 4NQSA 4LOFA 4NZUH 3O4LB 3CLFH 3DSFL 4QGTA 4PS8A 4IYKA 5EU4A 4QXVA 2JTYA 4R97B 1JZGA 1U8NA 4RX4A 4NQDA 3HZYA 1JN6A 2OTWA 3LH2L 3P0YH 3FF8A 3VI3F 5DTFA 3BAEL 1ZHKB 1TJGH 3MAWA 5DMJB 4D0CA 2VCOA 5PCYA 4C4KO 4LAQH 4QHNB 3VSUA 2I60H 2C7UB 5SX4H 2N7BA 5I1AB 1A0QH 3WFCH 3KPNB 4DO5A 1MCNA 3TVMC 3KPTA 4LLYB 1MLBB 5C0EA 5DJYA 3LRGA 4KX7A 5I1CL 5F9JB 3EJPA 3BAJA 1Y1DA 3KM2A 4HT1L