2KZBA

Solution structure of alpha-mannosidase binding domain of atg19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
VEPPNERSLQITMNQRDNSLYFQLFNNTNSVLAGNCKLKFTDAGDKPTTQIIDMGPHEIGIKEYKEYRYFPYALDLEAGSTIEIENQYGEVIFLGKYGSSPMINLRPPSRLSAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autophagy-related protein 19
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzbA00
2KZBA 2KZKA
chains in the Genus database with same CATH superfamily
3UMTA 1IC5L 1RV6X 1MFMA 3ARDA 2F54D 3C2AH 5KS9F 3MDJA 4KKZA 3OQ3B 5F9WB 4HOZA 3L4XA 5FA3A 1UXSA 4K3DH 2CZNA 3V0DA 1WEJL 5F3HA 2P5PA 3FOLB 3ZKMD 4CUCA 2VC2H 5L8LB 3PREA 1DBKH 3LS5L 4UMSA 4OZHE 5HHMB 4LEOA 4I1PA 1DR9A 1U95A 3RX5A 1KIQA 4LVOC 3SE3C 4PGBB 1WWBX 4Y19D 5FKAA 1NBYA 5DQ9A 2G9KA 4I7ZC 5JDSA 1ZHLB 5D7JC 4JM2D 4QCIA 5CGYC 3WY4A 4YHNA 4UTBH 2ZCLL 4P2RB 3JT0A 2WLKA 1TJIH 4C4UA 3Q48A 2TRYA 1NJ9A 3VVVA 4CVZA 4NQXB 3ZHNA 5DR5H 1CZ8H 3BUDA 1JHKH 1AHKA 3WFHB 1MFAH 2BS9A 3FU3A 5F9DC 2Y2WA 3AS0A 2VMEA 4B60A 5DMGC 1PG7W 3LD8C 4HUUA 4LL1A 4U1NB 3ALPA 1XGYH 2DPKA 4ZMOA 1A7RL 4X4ME 3TBTB 4L4TB 5CP7B 3LQZA 3ZMEA 5IESL 4GEIA 3CFNA 2ZUVA 3L3OA 3V6OA 2GW5A 3OL2A 5E9NA 4PJAA 1SQ2N 1AZNA 4ZQKA 1O5PA 3FCUB 2HAZA 3SDXE 3SCMC 3OXRA 1MIEL 1BQ5A 1WVZA 4GKOA 2C4XA 3QZWG 3QZBA 5ALBL 3BEWA 5GZNC 5JPMA 5HI5C 3V9FA 3H9SE 3FQRA 1GAFL 4XO5A 3MV9D 5CD3B 5F1IA 4MNGE 2KT6A 4N2IA 3HG1E 3N43F 1D3CA 1IGJA 2A6IB 1QA9B 4ZO8A 4PVBA 3CN2A 1MCQA 1EX0A 1PLGL 3FUFA 5AAMC 3P3RA 5CCHE 2VXUL 4XN1A 5IREA 4Z7NE 2L0DA 5M94B 2K70A 2DQ6A 2OI9B 5E4EC 3ZL2A 3NACL 5IMKB 4FMFA 1QSEA 4XO9A 4AZ8A 5JPNC 5K9OB 5CS7A 1A3RH 4I89A 1U2YA 2E0PA 1UEYA 2XACC 3DWTA 7PAZA 3F7VB 2CJSA 3S34H 5B1JC 3LH2L 4PJ8A 1BX2B 4KUZH 4Z5RB 4LPVA 3HUJF 4NZUL 1E4XI 4Q89A 1E6JL 3SDYH 5H94B 1V5JA 3QZWB 5CIPA 2QKIC 1A7QL 1EZVY 2IDUA 3APMA 1KCWA 4HHAA 2Z6FA 3QR1A 1XH1A 2DWDA 3ZR5A 4WW2B 3SKNB 3I2CH 3PU7A 3PWPB 3QIUC 4U1IB 3ZTDC 2RFXA 3W0WD 1PZBA 1KBGL 4TNGA 2FSDA 4LDCA 2AERT 5IVOA 1Y6KR 2AK4A 2CO7A 3BFOA 1CYGA 2EYSA 2PP9A 5LKNA 4QRPD 4XTRD 5DRNA 5D7IF 1UD3A 5HI4D 1YMMD 3IBEA 1U36A 4PSRA 1B4JH 3RWFB 1JUFA 1SYVA 2LLLA 4BK5A 3ZGIA 4QNPE 1EJFA 4JFFA 3NJXA 4MB5A 1GS8A 4RMBA 4DFHA 1WPCA 4PCYA 3ZPDA 2NY7L 1GGIL 4WJ5B 1IM9D 2VIRA 5CKGA 4OIBA 1AVAA 5I16B 3P9MA 4KDTA 1PY9A 1KPUB 1X4ZA 2VZVA 4DGWC 5KSAA 1OTTC 4YGVB 3GNML 3MRQB 2H32A 4O51B 2J12B 2MNJB 3L9YA 4LPXA 4ZK8A 3GHPA 5T3XE 5IJVA 4RFNB 1CU4L 5E1QA 1XGPB 1GYUA 2E7MA 4WUUE 1ZLWK 1EDYA 1H15B 3NT0A 4HGMA 3RUGB 3TEXA 1X5IA 3CPLB 5JHDA 1K4DA 5DSCA 1UOVA 4XP4H 1KNOA 1W6WA 3D2UA 3LS4L 5GGVH 1R3KA 1A7BA 2AEWA 1OANA 1SLXA 5ICXB 4DN3L 3TURA 4QHUA 4PWGA 4X2UA 2JVUA 4LSQL 4M6MH 3ROLB 5IB3A 2ICWA 2WXGA 2OL3A 3QQDA 5ITFA 4DCQB 4C8XA 5AG8A 4ACPA 2E7HA 1IMHC 1YEIH 4N2HA 5EV7A 1MSPA 3UTSB 5DZAA 3ARXA 4HC1L 1BSIA 3Q0HA 1NFDF 4NHUA 2DW5A 4XNXL 4YC2C 3WGUB 4DTGH 35C8L 3S35H 4HGWB 2HMIC 3UL4A 4Y2OB 2DF3A 2YEZA 2XWCA 4FFZA 4LIQE 1T83A 5CMAA 1TCMA 4U1SB 2YN3A 3V9EA 5C0BE 4NO0D 4PGDB 4PJCB 3EO0B 4R2GB 1OEZW 1OK8A 3LQAC 4HIIB 1QFUL 3I74A 1F41A 1IGTA 3L4VA 4R4FH 2WXOA 4I5BA 4R7NA 9CGTA 5L2KD 1CD9B 3E3QE 4M1CD 3QHZH 4BZ2H 5I24A 1TEFA 1OP3K 4KUCF 3DBXA 2EEAA 3AG4B 4PV9A 2BP0B 5EIIA 3ZTJH 1ZHNB 5DUBA 3DX3A 3UTTA 3WU1A 1ITCA 3NG5A 3WFDH 1CFNB 1PZDA 1U8KA 1G7PB 3F12A 3QH3A 4IW4C 3PIQA 2QGBA 4APQA 4WUKH 2VC2B 3V10A 5IT2L 3ZDZE 2DWEB 4LQ1A 4PJ9A 4BWTA 1Z3RA 1ZWIB 2XN9A 3FZUC 2MCPL 2V6HA 1I53A 2D73A 1MHPL 4M02A 2GJJA 2O72A 1V8HA 5TDPA 4L0YA 3LNDA 4HIEA 2EO1A 5HHPA 1KIRA 2G0KA 1M42A 3G5XA 3GLDA 2HKHH 4P9HL 1FFOB 4CN4A 5MEND 4HAFA 4M6OH 5I74C 5FUCE 4PHZA 1DL7H 1IV8A 1ZSDB 2BSSB 3OKDA 4PJ5D 4OV5B 4I0PD 4X6BA 2B5IB 1ZSHA 3D0VB 2H1LM 5KSBE 3TWCL 1MI5E 4QXWA 2J6EH 1JHTB 1ES0B 4RGND 4RMSA 4YE0A 5IQ7H 1NC2A 5DC9B 4JZJB 1O7VA 2VAJA 3BKYH 4MB3A 2HB0A 1I3RA 1KV3A 2WTOA 3QO1B 2HVKA 3GBNL 3IDUA 3UZQB 1OCCB 4HMCA 1HHGB 4BZ1A 5LGJA 2IDTA 1IGFH 2YBGA 1Q38A 1VCAA 3QDMA 5AW9B 3CD4A 1QD0A 3ARQA 2XIBA 4PRPA 3RKDC 2BJMH 3U6RA 3MNWB 2X9WA 4X4KA 3GT6A 2VDQL 4KQ4H 1I85C 1RULL 3PNRB 5ICYB 1SPDA 3EUDA 5DC4B 5LQBL 3LMJH 2EAEA 5B4MD 1Q9LA 1S5HA 5HHVL 5F7YC 1B6UA 3AUVA 2E59A 4QD2E 1FFNB 1V3LA 1DLFH 5K9KB 1Q0XL 4KK5C 4YL4A 4OZHF 1DUZA 1A4JB 5HYSB 4TLKA 3WNKA 4MA7L 3VMNA 2EIZB 2LFEA 4PGCB 1Q0YL 2HJFA 3RRQA 3I6KB 3P4MB 1LO4H 3E2HB 1U8NB 3HE7A 3L4YA 3NPSC 1ZT1A 2DQHL 1MXGA 5ALCL 5T8IA 4IU3B 3WDIA 1PDKA 1EBAA 4QXGH 1LYQA 4G7YL 3DVIA 4OZGE 3BVXA 1GJWA 1IAMA 3MA7A 1MCDA 1UC6A 2I7SA 3KWWA 1YEFH 3FOLA 3SD2A 2XBZA 4MLSA 3HRZA 3BDYL 4BUQA 1KFAL 3A6BH 5EULV 4B9PA 1PU0A 3J07A 5D7SL 1WAEA 3HPLA 1Q72L 3JWOC 5C7ZA 4NENB 1HE8A 3B4NA 3FRUB 3H0TB 2J8OA 3L1GA 4PGBA 2WQRA 3KEDA 5EOTB 3PJNA 4WV1B 3T0EC 3T77B 1NMAH 1AXSA 3SDXF 3MRNB 2QADC 3NRFA 3O4LD 2OYKA 4DP7X 3DYOA 2GJPA 3HBGA 4OLWH 1U8IA 2EECA 5DD1H 4DH2A 1GSKA 5A2AA 4O00A 1U0QA 2VERN 5DHXB 2UUDH 2AQ2A 4KC3B 5GGUA 3RVXD 2Q10A 2A9BA 4FQ2H 2CJTA 1NLBH 1TU2B 3X13B 5CNHA 5MEOA 5AKTA 4H8PA 1AYOA 1YEGH 2YHGA 1I9RL 1PFOA 3QFJA 4HPOL 5FXCH 4AYFB 1KYOJ 2YAHA 3MJ9L 2HRGA 3TBTA 4Z7NF 3MRDB 4NN6C 3K1DA 5JZ7C 3KDMA 3DX0A 3QUXC 3TCLB 4ZMAT 5FYKE 5B1BB 1JZ3A 1EXGA 4HKJB 1E4HA 2QLYA 3WXVL 3VD9A 1PX4A 5DRXB 3HE6C 1E5BA 1F0LA 2XRAH 5DK0B 1DDHA 3MLTA 2YA0A 3GTNA 1NPJA 1I9JL 4WY7H 2D0GA 4M29A 5CD3A 2X88A 4D0DB 1JV5B 3ARFC 1E8WA 5JXAL 3ZTJG 1E4KA 3EJZC 4AC4A 3NJVA 3CFJB 4HBCL 1WZMA 3IMWA 4NUQA 2DI8A 3AW5A 4EN3C 2PW2B 2IPUG 4FQHA 3HUJA 2F19H 4BA0A 1AO7B 1X6NA 4EAEA 4PLJD 1RZIA 3I9AA 5C08E 3MRGB 3Q3GB 5LN4A 4GAYB 5IMKA 1QNZH 2YK1H 4L8CB 1L9PA 2WYHA 4KKLC 2LU5A 3DGGB 2ZUQC 2XZQH 1ZVNA 1YNTB 4JFYB 3I75B 2PPCA 1PY0A 4Z5RA 1M7IA 2PTVA 3QIBB 5H94A 4MMXC 1IBGH 4V1DE 1PFCA 4QNPF 4FLQA 3ME0A 4OCYL 1WBYB 2M26A 3OX8A 4GBXB 1FYTA 4IRJB 5E8OB 5LWYL 4G8FB 3TZVC 2NXYC 1CBJA 5H2BB 3K72B 3MSPA 5D7IA 5F9OH 2YXVA 2ZWSA 2YFNA 4NXSA 2BXZA 4M62L 3GSVB 4ADIA 3HC4L 4GLRH 3UX9B 2X4NA 1WZKA 3CVIH 3D5OF 3QDJA 2OMTA 4GKLA 5IVZB 5D7HA 3STZB 1RSYA 5DZVA 4GPVA 1A66A 3P3SA 4N8UA 3T2QA 2JIXB 4FQJH 3ZYZA 3PWNA 4N20A 5E1GA 5DJYA 3CFCH 4ZTPL 4P59H 3QEGH 1M9WA 3GI9H 3LEVH 4CW1A 3RKPA 3NTCH 4P3DB 2CIIA 1ZA3B 4M1DH 4MJ2A 1AQDA 5FPIA 1CXIA 3LRSB 3D3VA 2YC1B 3VA2C 4KVNL 5D1ZB 2VUYA 2YD7A 3OC5A 4FYSA 3P11L 5FW8A 5LNGA 1GS7A 4LFHG 1N3NB 2NNCA 3B2UC 3DV6A 4S1DC 4ZUWB 5C0AB 1DVFA 3IK2A 4KJQC 1FH2A 4N3TA 4OFKA 3UC0L 2GY7B 4HU8A 5C09A 4Z3IA 5KJ7E 1S9XB 2RTTA 3MRQA 4JVPA 2FIRT 2EACA 5C0CA 2IPKB 1RKRA 3DETD 1VFOA 3NFNA 4X9HA 1KYFA 1DO6A 3KJ4B 3AU1A 1T7XA 4GOSA 4AYDC 3AG2B 2OCJA 3CN3A 4PR5A 1HXKA 3T8MA 4ETYA 3VI4E 5FYJU 1NFDA 4KZEL 4L8BB 5BRPA 4C56D 3RX9A 3S97C 2WBJA 3C6LC 1F1AA 4GMSL 1VZIA 3DJ9A 4WNQA 3VXSD 3QCTL 4CKQA 4NQCA 3WLWD 2E8ZA 4HGWA 4PW3A 4PRNA 3TA3D 4LGPB 3P3YA 2A9NH 1J1OH 4PD4K 4TUOA 3ZDZF 2X44D 4Z3FA 3CDGA 5D4QA 5KWYC 4FAAB 4ICXA 5AVTB 1YA5A 4N28A 3J2PA 1LMKA 3RX7A 2ZUXA 3MLRL 4JCMA 1I7ZA 1ZA6B 1WWWX 3B1UA 1CF8H 3L7EA 5CAYB 1SOSA 4P9MH 4DFIA 5IHBA 4WWKB 1XXFC 4M5ZH 3PL6A 2XJKA 4J2QA 3BD4A 2WINA 1SFHA 2X53A 1O9VA 4WO4A 2BP0A 5FLUA 2OJ1A 4X6CE 1CC3A 3QNFA 5TQ2H 2Z0UA 3FFCD 4BSJA 2ZUYA 4N90D 2XXFA 5TDOA 2ZWLT 2X6MA 2QV2A 4YLCA 5HSFA 5I19L 1GY2A 5FV1L 2ESVD 3N3EA 2BVTA 4Z78A 4N0UE 1I8UA 4NFBA 1FA4A 1U3HD 2LABA 4FNLL 1TZIA 4FQLH 1DJZA 3CTTA 1HL8A 2BNUA 3OLIA 5LJYH 3VXQA 3PHOB 4HXBH 1HYRC 1KSRA 4LOFA 1URLA 4AW4A 1H8OA 1P84K 4XZUB 1C08A 4ALAL 2Y3NA 3SODB 2NW2B 5IV2A 5AALA 2G5UA 3NJNA 2R69L 2IANE 3FU7B 5IQLA 4L3CA 4GINA 4GKNA 1KJMA 5D5ME 3U1PA 4X42A 2L4OA 3D0VA 4R96B 5K33A 2P43B 3FSAA 1JHTA 2QQKH 2VQUA 3WN6A 1RUAL 2B39A 1U8CB 3E8VA 1DBMH 5I15H 3A3YB 1Q9WA 4FL4C 2JK5B 1G5AA 4RBPH 2Y06L 3L16A 1ZLSL 4EDWL 3PP3H 2D7PA 3IXTA 4PRIB 2DQCH 3UBGA 1LJMA 1KJ2L 2AGJH 5T33H 1LP9B 4BFKA 1L4IA 4HCRH 3D25B 3ZMRA 3EG9A 2P80A 1MCOL 4FFYL 2CRYA 4OZHA 3WO4B 1PZAA 4OD3H 4OZGF 3SPVB 3BWAA 2XETA 3AITA 3B37A 2VDRL 3CIAA 5DJ6A 5IJCC 2WLIB 1TQUA 4WTXA 5BJTB 2R4SL 4XN9A 4ZFOA 1ZVHA 1L7TL 4JRXD 3ZKSD 1P9MC 3QJHB 1IAIH 2AS5M 3F58H 5DJ2B 5E4IA 1X9LA 3PGDB 3BWZA 4G6ML 1C16A 4NPYB 4QHNA 1SM3L 5ES4B 2XQYG 1JRHI 1OM3H 2UXGA 2DYRB 4Y19E 3NFPB 1GZHA 4P23B 1RUKH 1Z9SA 2YEVB 3VFNA 1CWVA 1FNFA 5F2FA 3AREA 5D1QD 4XRCB 2XWBA 5CFHA 1S8DB 2XPGB 3QYCA 4X4MA 4Q97A 4ZYKB 5F7KC 5I8EB 1VFBA 2FJHA 3F7LA 5FHAL 2NY4B 2JMRA 3IFNL 4MCMA 1G9EA 1TKWB 3I02A 3KBHE 2DI7A 2XA8L 3SDXA 5A6MA 2ILLA 1F4WL 3UJJH 4J3OH 2R59A 2BM3A 2XWJB 4LVHC 1OIOA 1RJZB 4Z7IA 1N26A 4BFFA 1OSPH 1QPPA 2NY5H 3MCLL 4LLMB 4NENA 4WI0A 2GAZA 5E99L 1OHZA 4NYLB 3IXAA 3H9SA 1E0OB 3QDGB 3RFRA 1P4LB 4YE4L 4MNGA 1H8SA 2WY3B 4G6JH 4Y4FB 4HSAC 4LCVA 5AW2B 5T3ZH 3WN5A 3HG1A 1SGKA 3V6ZA 4NQED 1UGNA 2DM3A 3FQWB 4UV7L 3IJHA 1XCWA 1KLFB 1NGXB 1QW9A 3QWRD 4FZEL 5CZXC 3OKNB 2NTFA 5IROC 3KVQA 3GSWA 3FTWA 3ARYA 3VXMB 1IM3A 1TJGL 2OTWB 3W39B 3MV9E 3T8XB 2B77A 3D1MC 3MA9L 2VLKD 4JDZB 5EO9A 1UD8A 1N6QL 3EFDH 1QVOB 1U6AL 1T5XB 4NS0A 3SGKA 3VD5A 4IKNA 1CDHA 4HJTA 4Y5YA 2V5YA 5E8NA 4LHUB 1QBMH 3O6FC 4R4BA 5E6IC 3WIFA 3II2A 1CT8A 1MVFA 2H6OA 3KXFD 1EBPA 3M45A 5MEQB 1ZE3C 3ARDC 2ZG1A 1CE6A 1D9KB 1KC5H 2Z64C 3JV6B 2YQGA 1OE2A 1QLRA 3QNXA 3EDJA 2EKSB 1SXSA 1FDLH 4KH2A 1KCRL 4N2AA 5TF0A 4FKKA 4N2KA 2DBJA 4HZLB 1AZCA 1J8SA 4W68A 3EJCA 3PWJA 3OHMB 3V5DB 1AC0A 4PGEB 3NN8B 4JRYB 5I1KL 3DECA 3VXOA 2DIEA 3MRCA 2Y5TA 3ES6A 4I18B 5AKVA 2JKIS 4OU3A 4OLUL 3HR5A 3WFCL 1IU1A 3HAEH 1A64A 4JPVL 5IM7A 1HEHC 3QUGA 4Z3JA 1YNTA 2APBA 5EHFA 1T3FB 1R5WA 2RACA 4YXHL 1P7QA 1F4AA 3IAPA 3IWVA 1MJUL 1NWOA 4QRPE 3VG9C 1TXKA 1X5LA 1YMME 3EGDB 3OZLA 1U8LA 3T3MB 5D93B 3FO1A 4W9DC 3C5ZA 3IS0X 4G8FA 2ZCHL 1BM3L 2WZ5A 5DS1A 2VXVL 3DDFA 3FT1A 4WUUA 3F62A 4XNQB 4JM0A 4XPHL 1YUHB 3L3OC 3ML8A 3V6OC 2XWXA 4KU1A 4W9EC 4A2GA 1G9ML 1Q94A 3MRIA 4H25B 2WXQA 2FD6H 3LPOA 5PAZA 2CJ3A 5D6DA 2X87A 1XTLA 2JIXA 4XP1H 5JPMC 1OAZH 2IDQA 5K1NA 4F5CE 4E36A 3OKKB 1MQ8A 1H3PL 3VI4F 4OT1L 5C0GA 3QNZA 5E9AA 4ODSH 3WCYA 5A3IC 5LXGH 1I1YB 2ITEA 4PI2A 1WV7T 4XXCA 3LRSA 2XKSA 4P5KA 5CEZE 4ZMXA 5EO0B 4HLZH 1I1RA 5C0BA 1T7VA 4L5FH 1YN6A 3U4EA 3H4HA 5A1AA 4IQHA 3RNKA 3C8HA 3ZT5A 2IDCA 5J5EA 1J0KA 1T1WA 1WBXB 4Z0XB 3L9RB 4CADA 5HGHB 3FQXA 3C2SA 3FUJA 4S0SD 5TFSH 2X9XA 1B0GB 4PJ8C 5FDWB 3JWDC 2R7EA 4GP8B 5IR1B 4X6CB 4AUUA 4IRZH 1KACB 1A4CA 1WO2A 5A2LH 1CVRA 4CA4A 3MRBA 3RNQB 4TUKL 1WFIA 2D3LA 1SJXA 3ECUA 4RAVB 3TYGL 1EJOL 1KG0B 1NOFA 3REWA 4DAGH 3SBWA 2HJKB 2IFFH 3O45B 2CK2A 2P52A 3MV8B 5L2KE 5F88B 4A66A 2BERA 2Z9TA 4W9IC 2F9BT 3QG7L 5CIPH 4KI5D 5D1XE 5DD5H 1KCSH 3HMXH 4J3OG 4BH7B 3WAKA 4JHWL 1G9NL 4O2CA 2CSPA 1KF9B 4YHML 3I6GB 2ZKHH 7TAAA 1UD4A 1KB5A 2L7UA 4F37K 3BAEH 3BFQG 4J3WA 1JJUA 1HKFA 4AVKA 5HYJB 1JK9A 3T4AB 1E5AA 2RR3A 5E9DD 3KPOA 1JFQH 3PG2A 4XNZB 3X1FA 5KSBA 1MI5A 4BK5C 4RFEB 2IOMA 5IBUB 1AZRA 5FW6A 1CI3M 1MREL 4DVRL 2H1XA 4EN2A 4DSYA 4JCLA 5MENE 3P30L 5D5MF 4KDTC 3K7UA 1XB3A 1Z9MA 1A6AA 1W0WB 4PJ5E 2ZF8A 3O0LA 4GQ9H 4MD5A 1CTNA 2X2JA 2UX7A 4PJ7E 5KSAC 2PYFA 2Y1AA 3F7RA 2G4GA 1KN4H 1A6ZB 2GJ6B 4LO9A 1FHNA 2X7LA 4RGNE 2HVBA 1TSHA 3VWJD 4KKBD 3OC8A 3CXDL 4UYPA 1BF2A 5INCB 3EIFA 2BVOA 4MS8C 4GG6F 1KXTB 4XZUA 4JFHD 4N6RB 1J18A 4MASA 1OGSA 3HTLX 4TF4A 2FATL 3SDDA 3CZSA 5L7XH 1NCBL 3CDYA 5EC2B 4XVUC 3VTAA 5FR3A 3N1MC 3TX4A 4YBLB 1BEYH 1XD1A 4CU8A 2YXMA 5F96H 1LDPL 1T03H 3R4RA 3NIGB 1CXEA 3EBGA 3BVUA 4XC3L 1JNHB 3QEUA 1EZLA 4PTTB 5FM8A 3OAWA 1T83C 4PWHA 2OL3H 3O2VH 2NX5B 2MHAA 5J89A 2J8UE 4N3UA 2KZWA 3U2SA 2ZCKH 4OZGA 2NY3C 1EHKB 3HAEG 3K5SA 4OZFB 5AW6B 4X9FA 3WNPA 2DQJH 5C0RL 4TULL 1AE6H 4Z0BL 2EC8A 4JRWA 5JW4Q 4P07A 1F6AA 3ILEA 3ISRA 4XNMB 4NNXB 4X80L 2DYPD 4KK9D 4EDXA 4N2DA 4PYGA 1WT5A 1OB1A 2K6YA 3H1ZA 1TTGA 1XR8A 2XX1A 3HOGA 3IGKA 1BQSA 2HPTA 3JTTB 4ZSOA 4HF5L 1OP9A 2WLNA 4APQC 2ODIA 4Y8DC 3EGXB 4HUXB 1JPGA 5C2BL 2IH3B 2FB4L 5F1KC 2VE6B 4RH4A 2BSCA 2CIKB 4OCWH 4PJ9C 3DC0A 3NSYA 4PJXF 2F1EA 4GAJH 4OJFL 2VR6A 4G9DB 4XMPL 1A6PA 5GS0L 4EI6A 3VG0H 4QXTB 1VGKA 5KN5A 5JQHC 5ELIA 5FX3A 4M7JL 1YC7A 2IADA 3UBHA 1CG9B 3DO7A 5DHYB 4JR9H 4NHCH 1FVEB 1E3XA 4MGXA 1GXEA 4KGJA 1IFHL 2XWEA 1BMGA 2PO6C 2LTQB 3CC1A 3O4LE 5MP6H 3ASNB 4N0CD 1IJNA 2AI0L 5HJDA 1XGUA 4TVPH 4ZYKA 3NGBB 4HOXA 2BW5A 4U6XA 1J0IA 4FYQA 3HI5H 3LN5B 3OD3A 1TLKA 5TJWK 2WNWA 5CWSA 4HLZG 1PKQE 4JPWL 1K2DB 3RLSA 1DQML 1EQWA 3WXWL 3ZO0A 1RJZA 5EC1B 5F6HI 4ZX5A 1OPGH 1D5BB 1PZ5A 5CGMA 3SZKC 1CXKA 3M1OA 2WZ0A 4NYLA 2BVEA 2MH4A 1BYNA 5GSVA 5I66B 2BZ7A 3GHBH 3BD3A 3MBEA 5HDQH 2OXGB 5I28A 2WBKA 4G5ZL 4MX7A 4QOKD 1O7SA 3SDCA 3EOAB 4MB4A 4OKVB 5AW8B 1CO1A 1FNLA 1E28B 1DEEA 4ODXB 3TH3T 1BJMA 1TCRB 2UZIL 4AIZB 4TTDD 1HOCA 3OKNA 5CD5D 3L9EA 4E42A 2CUAA 5I17B 2ZKXA 2DLHA 5D2NE 1ZT7B 1HEZB 4PREA 4YIQB 4U3SA 1RZQA 4KJYA 5C08A 3B7YA 1WFMA 2G3ZA 3QJXA 2W9LA 4YDVB 3FQYA 3U7WL 1LMIA 2I9TA 4HKBA 4AKPA 1WLHA 4HFWA 4JDZA 1MWOA 2BSBA 2PTTB 3RB7A 3GSOA 3RPIB 1JWMB 4OAWB 2AJSL 2YD2A 4ZUUA 3SE9H 1K6QL 2IEPA 3HE7C 4V1DA 5A2JH 3VX1A 2OMUB 4FMKA 2BY2A 3DYMA 2A9ML 1D5MA 1T66D 4GUPA 2X4PA 3CBJB 4N0FB 3ULVH 5IF0A 4BXVA 2VT0A 1D9KA 3CSYA 5C0JB 5F9WC 5JOFB 1QUNB 2MTAA 4FYRA 4LE8A 1OT1A 3DVFA 4JUSA 2HFFA 3L4CA 3QUZA 4PIRF 1JNLH 4HCFA 3HRZC 5GGTL 3QHFL 4AYID 3HZ3A 5JMRA 1GOFA 3ZIMA 2XIDA 5A7EA 2WGNB 3RWEA 2WZPD 4P5TA 4ZI8A 3VW3L 4JKLA 4A6YH 2RGSA 3L6FB 4AXWA 3LNEA 4I18A 5F6IB 3MGTA 2HG5A 5D71L 1CFTB 3LVEA 4QRTA 1LEKA 5E0FA 3H9HB 5BW7A 5EORL 2X4UB 4BE6A 3V5HA 3NSFA 4M7KL 5H37H 5TE4L 1RZFH 1WUZA 4PV8B 3L5WB 1QMUA 3VGGA 2QHRH 2GFBB 5HY9A 5DJ0A 3LTVA 2XTSA 3U9WA 3THML 2XFXB 1MCSA 4HIPA 4IBVA 1A4AA 4JMXA 2Y36L 1J5IA 1RMFH 1ZKAA 4MJ6A 1T21A 5EBMB 1J8HD 2GSGA 3IYLW 5F93C 3RJOA 4K5LA 3SBRA 4CU7A 3SQOH 2VR4A 3QUML 3QUKA 2OZ4L 3QXDB 2ZAHA 3VSVA 1I8IB 2E86A 2DL2A 4JO4L 3VI4A 2OJZL 2Q8AL 2WXRA 2ZX5A 3BZFA 2UWEB 4HUNB 3DURB 4H25A 1DLHB 3KPRB 2RHEA 3RA7H 1VLXA 2P47B 3BPLC 2CWRA 3H9YA 1WG3A 4JUTA 4F7KA 2QFRA 2J25A 2J6WA 3LZNA 4IOFD 5LBSA 4UQAA 3BQUD 3L54A 4DKFL 3O41A 1CLOL 5F7EL 1VESA 5HDLA 1CGXA 3NQIA 4Y5XB 3VYPA 1YECH 3ZE0E 4F8PA 2DWSA 2DQDH 1QHQA 3BZ4A 1E4KC 4LQFH 4BSVB 1FJ1B 2OMZB 4OCXH 3V4VL 4C56E 4MAUL 5TE6H 2FX9H 3INUH 1Z0MA 1VACB 4JHUA 2X1PA 3FU6A 4LCWB 3VXSE 5I5RA 4YDLB 15C8H 3K81A 4NQVA 2AJUH 3QUYB 4K3EH 2X1QA 1MPAL 2NZ9C 3OHXA 4H2AA 5MI0C 4C4KT 2XXMB 3KPMA 4QHLB 3Q13A 4MQTB 5CBAB 4Z76B 2QDVA 2W9EL 4JDTH 4JFXB 3ISYA 1NKOA 4WW1A 2JJUA 1K4CA 3RHWF 2O1AA 4EOWH 3OKOA 1NEPA 4K94L 5J6SA 4N0UA 5KTEL 3PXLA 1RUMH 4GRLD 2AEPL 5ISZD 3JZ7A 3L3JA 3GMOB 4KXZH 3GBEA 4PJ7F 4B9GA 2DTML 1FORH 2EUZA 2H3NA 3HC3H 3GI8L 1GVIA 3FFCE 3CFDB 4N90E 4UZGA 3FUDA 4A7SA 1QX1A 4XN5A 4Z7WB 2E7DA 2IANA 3VWKC 4IEFB 5D5MA 5AW1B 2J5WA 4X6DB 3ZSTA 5DHVH 5G4OA 1QO3B 2ZX8A 1S7RB 3EDKA 5J3HD 1FFQA 2GIMA 1BF8A 2TAAA 2E75C 3E6FA 1OGAE 1HT6A 1VHPA 3FTUA 1E67A 2OX5B 2RIKA 3OXSA 1JDAA 1L3WA 4JW3A 5CGTA 3ZKND 3HG4A 3T0WA 4WI2A 3PJSA 3FO0L 4P49A 1G7QB 3QZLA 3IDYC 4MDJB 1EDQA 1LO0H 5IFAH 1NIFA 1DVFC 3IJYA 3H85A 3MNDA 5MI0B 2IALA 3D39B 4WI6A 2Y25A 3ARGD 2QTEA 5GGRA 4XXWA 2CJUL 1XT5A 2CAKA 3CU1A 4KAQH 5INCA 2J8UF 1W8EA 1KWGA 1W0VB 4GT0A 3F84A 5DZNA 4JMNA 5DDHA 3QK0A 4Y4HB 4ZO9A 3X12B 1MCKA 3MXWL 2F54A 1D5ZA 4P5MB 4XE0A 2WBJC 4HJEA 5DFVC 1Z9PA 1CD1A 2CO3A 2W07A 5IHUH 2Q7YB 2H3KA 1BF5A 3QPQD 4XMXA 1NCWL 1T4WA 3HZVB 1MNUL 4GO8A 5DVLA 4XP6L 5FCUL 3RI5F 3U82B 5ETUB 5HVFB 1UYWH 1L9NA 2F6AA 2VN6A 1JPFB 4J3BA 5E5RB 4J28A 4KK6C 4JO1L 4Y19A 1AG6A 3IDGB 1UB6A 4LESA 4YHIB 3ZY7A 1AIFA 5LBVA 3MYJB 3P1VA 3LRGA 4JM2A 5F7DB 1N7ML 1ZOXA 3F01A 3FCGA 4JRXE 4LCCA 1KB9J 1EVUA 1CYWA 4QEGA 4R2GC 4N8VB 1TQSA 4FP8L 4K5NA 5FO7A 5H37G 1XGQB 3F85A 1R1CA 3IB4A 3U25A 2ADIA 2PXYB 3WFBH 3PL6C 1JZ8A 1YNKH 3DIVA 4WO4C 4PJXA 5KS9B 3HI1A 4ZOCA 3NJIA 2FHCA 5JIHA 2NTSP 4LU5H 4I9XA 1WE5A 5D1QE 3PGFL 1EUUA 4DO4A 2B4CL 4UQBA 4ZUVA 3L45A 4HUXA 2IH3A 3TO4D 5D70L 2V9RA 5KAQF 4OM0L 3LXBA 3DX1A 1PLCA 4X4YA 1ZS8B 1OT4A 3KNBA 2J1ZA 4GSDH 4A6YB 1RIVH 2X4RA 3Q2LA 5D2NB 1A6TA 1FVEA 3MOBH 3D0LB 4TUJB 4XMLL 2FECI 5F7AA 2I9LB 4J39A 4AY0A 2YAQA 1NUNB 5AW4B 2R1WA 3MV9A 5INDB 1HQ4B 4GKSB 3OSKA 2WLZA 3QVAA 3LOWA 2B5IC 3BKCH 4HWBH 4XVTL 3AS1A 3TFKD 4XCYB 5D6CA 2ZOWA 1VDGA 1E6OH 2EIDA 3L5HA 4JN2B 4OCNC 5E1AA 2EIKB 4JLRB 3UTQA 4ZMNA 5B7EA 5BVPH 2Y24A 4JZOA 3IETB 4F91B 2PP7A 4U1JA 4OFQA 5DLMH 4JJ5B 4U4IA 1JDCA 4AG4L 2WN2A 5FECA 1CL7I 4NNPL 1JK8B 2IO5A 1UXWB 1X6LA 2X41A 3DTXB 3TV3L 4XP5L 5I6XB 2CBQA 1SMDA 1E9QB 1GY1A 2CGYA 2BP3A 4OFYA 2V3FA 3EBHA 5I9QB 1YLBB 3GB7B 5J6HB 3GZPA 1XMWA 3A4EA 3AABA 3ZYIA 1AFVL 3UJTH 3MPCA 3QB7C 5I73B 3N43B 3Q1SL 2G2RB 1KYOK 3W0WA 4LL4A 4PHXA 3QC5X 4GW1B 5CSGA 2EVIA 4P2OB 3VI3B 3B9DA 2QVMA 3BAJA 2H0JA 5JW3L 1EO5A 4OAWA 5SWZB 4QRPA 2WQSA 1YMMA 4X7CC 1G6RL 3WE6A 1OOWA 1GZHC 3ZK0A 4KOCA 4UCFA 4YDKH 2IQAA 1FH5H 3BH9B 3AREC 3F6IA 2E7BA 1KIPB 2VXTL 1TMCB 5L88H 2CKBH 1IM9A 2Q2LA 1G9HA 3BLKA 4IMLA 3SCMD 3L2MA 4ZO7A 3QJZA 4ATWA 4QYAA 1SHXA 3HJ0A 2ZG3A 3QPXH 3ATEA 1JSYA 2EDOA 1AAJA 1SHSA 1E4JA 2RA1A 4Y0GA 3MX0A 1XL4A 3BKJL 3OSVA 5F7HA 3OWRA 1AGCA 3KYMB 3AY4A 4MCYA 4MWFB 2XTJC 3LXUX 1PG7X 5BRZD 4F5CA 4J3SA 5ILTH 4JGMA 4AUJA 4AYMC 1OD7A 3IU4H 5HPMA 5GGSY 3NK3A 3WN5C 1SXNA 4Y16B 4IRSD 3VXPB 1LE5B 1TYRA 4O2EB 2WOBA 4IM8A 4TNVF 4ETQA 4YWGL 3KPSB 3HHRB 4XWGH 1BVLB 3BI9X 3BX7C 4JKMA 2DM4A 5DHVB 2GTWA 2I26N 4JNXA 3ZE0F 4KJPD 5T1MB 4MBRA 1EHNA 3QI9A 1NPUA 4CL7A 4WWID 3VU1A 2FNWA 2G60L 2EP6A 4IKKA 1AANA 3ZU8A 1UHVA 1MNNA 2CHZA 2GB2A 4KXDA 5CINL 3P73B 1BZ7B 4PUBH 1R17A 2F58H 1M9SA 1A9EA 1GC1C 2HFGH 4WKXA 3SGKC 3F5WB 4IS6A 2XT1B 4Y5YC 8FABA 4OI9A 2OTUB 2ID5A 1LK2B 4NO0A 4YDIL 1M7XA 1BWMA 1MAML 1LK3L 1MHCB 1YY8B 4AEIL 3P9LB 5CXPA 4HWEL 5DRWA 1KCVL 2W60B 4LB8A 1GC1H 5L2KA 5CU9A 1G6VK 4WK0B 5MERA 1CLYH 5D1XA 4AGQA 5AVRB 3GSUA 1FGVH 4HC1A 3EUUA 2R0LL 1Z32X 2OMYB 1SLVA 3AAZA 2VISA 4OGZA 4QXUL 4QAWA 4NKDA 4JGUA 4IU2A 1XF4A 2F7QA 2WNGA 4XC1L 4ELDA 2FRGP 2FWSA 4EVNB 2LFGA 3OPUA 3O3DB 4IOIB 1BYPA 1IKFH 4YHLL 3B9KB 2VN4A 1ONQA 2LVCA 2W38A 2XG5A 3BWUF 4KI5E 3UAFA 3AB0B 2EEBA 5F7LB 3HB3C 2ZYHA 3IDXL 4KQ3H 1T4KA 4PCKA 1M57B 4PS4H 4X8XA 5E56A 3SKMA 3VNYA 5MENA 5GSRB 1HWWA 1NCCL 1XGZA 1OTTD 3JV4A 5CBAA 4MMYA 4PJ5A 2VXQL 3SGDH 4I0PA 3BO8B 1QQDA 2YBRB 3L1OL 4PJ7A 4JL1A 3T8VA 5EU5B 3GIZH 1C5BL 2C3HA 1IX2A 3C5ZC 2OW6A 5B1KA 3UCRA 1J12A 1E3FA 1W2KT 3KM2A 3N06B 3AGWA 4LSSL 2BY0A 3AS3A 4RX4D 4XAWL 4G82A 1UA6L 3IGUA 3BE1L 3LQAL 4IIQB 5BCAA 1IE5A 4MNQD 2BH0A 5ANMB 1ASPA 3ARTA 3X3GL 2V9QA 3SKUD 4WU7B 4N87A 3HFFA 3HLKA 3IJSB 4DW2H 5D6DC 3V8CA 5I1JL 2F8XC 3MFFB 1F13A 3N5AA 3GZKA 1QBBA 3DPBA 1MH5B 2D2CC 2H7WA 4JFPB 4K9EH 1JWSA 1E9OB 1T0MA 4PJFB 4XVOA 5D8JH 4MZRA 1XCTA 2DJ4A 4I48B 4Y2DB 5HGDA 2YOAA 4XXCC 1IQWH 3T9WA 4AGPA 2J8UA 3IPEA 1I3GL 1RY7B 4M43H 1JRHL 3GS7A 5DS8A 3GXTA 2ZICA 5DUMH 7CGTA 3MUZ1 2JLPA 3MROB 2FYVA 1NFIB 4BGDA 1T1ZB 3FOMB 1RK1B 4NM8H 3FU9A 1NAKL 4X8JA 3E3QC 5TTRA 5E8DH 3CLEL 1S7VB 3LZFH 4Y4HA 1KENH 2A6KB 1FV1A 2WUBH 4X7SL 5CJ5A 5B38A 1FL6A 1AXIB 2ARJQ 3CFQA 5FUZL 2QMKA 4QO1A 5DGQA 1OF0A 3BP5B 3OJVC 4K23H 4AYSA 3BUBA 3SBWC 1LILA 4RMVA 3AFLA 4LDLB 1W72L 2R0ZH 4OUUB 3CN1A 3FO9B 2ZAIA 5AZEH 5IGXL 4WEBL 3FB8B 3BLPX 5FUCC 5D7LD 4CILA 3LSOB 5FAAA 5AVZB 2B59A 1HDMA 3O4OC 3KL5A 4C4KO 3GMPB 4MVBD 3O4LA 5LGYA 1MCCA 4PB9H 1U8MB 2J7LA 1WCBA 4G8IB 1J0JA 5I5IA 3H53A 4R90L 2DMBA 2W0KA 4LAQH 4N1EA 3OJDB 1PKQA 2LU4A 4H20H 4M4RB 3SJVB 3VD1A 2EVGA 1LD9A 4K8RC 3D09A 1JPSH 5TGBB 3CSFA 6TAAA 2CKBB 1JYNA 1I8MB 1KLUB 4J6RL 1KTLA 4R0LB 1WIUA 2ATPB 4BCYA 4Z7UB 1TQCC 4HJ0C 4JY4B 5FGSA 2YGNA 3TASA 4OLZL 1NIAA 1DE4B 1ADQH 1E8YA 2WQAA 3Q9PA 5D2NA 1VENA 4JG5A 1QG3A 5C9JB 4TKWA 3SDDC 1MFCL 1U3ZA 4BKTC 5LGHH 4FE9A 2OSWA 4NO2B 2OSYA 4X99B 5KBNC 1G0DA 3ZE1B 1D5IL 1ZLVH 1FHGA 2VDMH 2NNXA 3FTGA 3SGEI 3VFRB 3HMWL 2AAAA 2VDNH 4OGXL 2AANA 5GRUH 5JHAA 2IQ9H 2JQAA 1EAQA 1NC4D 1MCPL 3IJ8A 2N7BA 4NN7B 4NRZB 5KJRH 1FL5B 5LCVH 1S2EA 4FG6D 5IEKA 4GXUM 3WJMA 4JJ5A 2EYRB 2YMXL 4K7PX 4GXVL 3S96A 5B3NA 3N44B 3LH9A 1UXWA 2BMKB 2N3JA 5CSBA 1IT9H 1WH0A 2Y1YA 4X83A 1BBDH 1E9QA 2P5WB 3QULA 4DK3A 2VR8A 4GSXA 3V0VB 1CLZL 1WT5C 3WO4C 3NJGA 1RIUL 1K72A 2PTUA 4N6QA 1S7WA 2CLZB 3QAZC 3WLBB 2QADD 3EYUL 1M4KA 3HI6H 2EE3A 3QJVB 3R18A 4FQXB 3K71B 4UM9B 1I4FB 1NGZB 3KLAA 5EN2A 3QWOB 4P2OA 3B7RL 3U30C 4TTGA 2ADFH 3PGCA 1ED3B 2G75A 1ZJBA 2VL4A 3HC0B 4YSOA 5GRVK 1L3NA 3M17B 4PVNA 3V4UH 2Z31B 4I77H 4YSCA 1NSNL 3CFEA 5FO8A 3TESA 2BNQB 5E00B 1T1XA 1F58H 2I24N 5IK3A 5BZZA 3VM7A 4FFWC 1A2YB 3LKQB 4KV5E 2UYLB 2BIHA 3RE0A 4FI6A 5DO8A 4XWOC 4XPTL 1S78C 3LB6C 3X11B 3G04A 1EV2E 1R3HA 5SX5K 4U6VL 5ESQB 4AC2A 5C3LD 4YEFA 4OIIH 2AABH 5HDOA 1SXAA 1RUPH 4G43B 4AGLA 4ZZKA 1F3RB 2JSFA 4C58B 1J8HE 3QCVL 1AGEB 1A6WL 3CVHH 3VH8B 3MBEC 2FH8A 4B0MB 1SVZA 4AGMA 4EN3D 2IAMB 5KW9H 4Q9RL 3SDCC 3OVUB 4GSUA 3BAYA 5K9QG 2BFVL 5LHDA 3NH7L 1LE5A 4Q6YA 3TTSA 2EYTA 4C56A 2FX8L 3V6FA 4YPGB 1P1ZB 5HBBA 1CFBA 4U7SA 1MWAL 3K6FA 4PJ6A 4ADGA 1CICD 1WISA 1RZJC 2ADJB 4HD9A 4KKLD 4FABH 4QLWA 4NZFA 1J88A 2DH2A 4J1UA 5EUKA 3AACA 1T1YA 2EO7A 3PUUA 1AXTL 4JO8A 4M8UA 3VXSA 1KB3A 2H8PB 5CEXB 1EEQA 4E9SA 4G42B 1DBBL 2K4WA 1DQVA 2UY6B 3TA3A 4HK3J 4LRNH 1YJDL 5A40E 1TJHH 1GJUA 1KPVB 5KZCB 1GYAA 2BFGA 2ED6A 3DIFA 1TR7A 1RZJH 4G80A 4ESKA 3FMGL 4DZBA 4HJJH 2MCAA 3DO4A 4KI5F 2JJSA 1D7DA 1MOEA 3WTWA 5CUSL 4LEEA 2B1AL 1D9KC 4H1LA 3GJFA 5D2LB 4ODTH 4X5WB 4GRMA 1KV7A 3QUZC 5FF6A 3KYOB 3MLUL 4XPAL 5AVUB 3BGFC 4L29B 3FFCA 1FP5A 4F80A 4N1CA 1A8JH 4WJG3 1U8OB 4N9GB 1PYWB 4P5TC 3EOBB 1MY7A 2ESVA 1HHIA 4EVNA 3BAIA 1P6AB 1KXQE 3FBQA 2RCSL 4I18C 1U3HA 4I8DA 4ZAKD 1GSMA 3UP6A 4NQQA 3LIZH 2XCMC 5BW7C 2NXZB 1FGNL 4IDJL 5DYOA 3MBXL 4DP6X 1NDMA 4AITA 3MBWB 1DUYA 1VJSA 1OGAA 1EERB 4LNRA 1J9TA 2GHWB 1B2WL 1W15A 3QJQB 2DKUA 3G7TA 1F4HA 1MY5A 4XMTA 2WBXA 2AJ3A 4G6KL 4KJQD 2PR9A 5F1NB 5AW5B 2KLSA 1SBSL 2VDKL 4P05A 3BP6A 4Q9QH 5ABAA 4DP1X 3LEYL 5EU5A 2VABB 1QABA 3QA3A 1NA8A 12E8L 2WCSA 3OZKA 3V6BR 2XZAL 3V0WH 1AI1L 1RZ8B 3VFSA 4AEEA 1QWUA 2EDLA 5ICZA 4UAOB 3N91A 1CDCA 3P54A 4HAKA 5E2WL 5E6ZA 3VGAC 2Y72A 2YGQA 3EF7A 1CBVH 5G5DB 4WENB 4WNJA 4F7CB 4OI8A 2F8VA 3IKCB 1D6VH 5IKCA 5IFJA 2R69A 4X4XA 1MFDH 2VL5B 3QC6X 2X4TB 4LVNC 4NP4H 5FA4B 4DGVH 4E41D 1TYJA 5MHSD 1CGSH 1PJWA 1MCIA 2OA9A 3KEHA 1G7LA 1QFWL 3V4LA 3ZXAC 1A4KB 3KYAA 4Y2DA 5EF1A 1FO0L 4DVBA 3V8OA 5BVJB 1TQBB 1C1EL 5LBSH 4KTDL 2YKLH 4LPYA 1EFQA 2ZUWA 4KO9A 4W6WB 2IH1A 2VDMB 1QTPA 4JRXA 1L0YA 1HCVA 1NCDL 5IMOB 2P24A 2EVHA 1DFBH 3E38A 1HIMH 2HT3D 1A02N 3INOA 4L8SB 3B7SA 2J2ZB 1NFIA 3OAUL 5I0YA 1SMOA 3FOMA 3WSQL 4G8EB 5HI3D 1EAOA 4EIGB 1KJ2A 1ZIAA 2XICA 3OHXC 3PJLA 3GUFA 4KROC 1UWGL 4HGKC 3REVB 3ELQA 4HT1H 4EIZC 1S7VA 4FFYA 1JGLH 1IC7L 2MSPA 3ZTCC 3C12A 1S7XB 2QPFA 3U7YL 2DLTA 3ML9A 5D1QA 1HXYA 2UZXB 3S3JA 2QZQA 4Z23A 1F56A 1LXMA 2V3DA 3A6CH 3BP5A 3ZX1A 1YEHL 2PWHA 3UYRH 3W2DL 4HUVA 1F8TL 5AYUL 1QI5A 4B3EA 2ZNXA 1MFVA 3GGWB 4RIRB 1UJ3A 3EO9L 5AWNL 1F2XK 4RFOL 3RFZB 3O6LL 5J12B 4TLUA 5I1IL 1V55B 1X5HA 4GYBA 4CC0A 1AY1H 1H8LA 4HKXB 1J1XH 5E8EB 2AEQL 2VDLL 3GMPA 4MD0A 1UH3A 3P3TA 4GXFA 1U8MA 2ZPKL 4D0CB 3VQ1C 4IGBB 4KI1A 1U93B 2C4FU 2DQTH 3PP4H 2XFGB 3JT2A 3QWRA 4H8WH 4S10A 3DMMB 1FI8C 2DDQH 5E4AA 5IY5B 1X4YA 2IOOA 4IMKA 5J1TC 1LO3L 4O4YL 1GOHA 5EEXA 3K6DA 5D1ZI 1C5DB 4GEJA 4J8RB 2IWEA 4QLRA 2CLVB 3PHSA 4LSVL 1I8MA 1KGIA 4NN5C 1MKFA 1NM9A 4XXWC 1D7FA 2J56A 3B9VA 4IIZA 1NIEA 4P4RB 5D96B 5H4ZA 3P02A 5KYXA 4ES8A 3QXUA 1ZHBB 3EOYG 2HFEA 3ZL4H 4GUQA 1J5CA 3O3EA 2J88L 1P4IH 2A77H 1NH6A 4XHQA 1M1XA 3RGVB 1E5YA 1OAQH 8CGTA 4GB9A 3CVHB 5C9JA 2BVQB 5BZDA 5JNYB 4Z3GA 2W80C 4NO2A 4QRRE 2F7PA 4MTMA 3ZKMC 3FT4B 2QGEA 4OD2B 3SQBA 4I4WB 2WXPA 3O11A 4G11A 4HETA 3V4PA 1RIHL 3U36B 5I1DB 2CKNA 1MLCA 4F20A 4A04A 1GCYA 2PN5A 1FL5A 2YMOA 3Q1EA 4JM2C 3C5XA 2YAMA 4LCCC 3U9PL 3EBIA 3LJ3A 3N85L 1GKEA 4M9OA 4O02H 4OKDA 2VO8A 4HH9B 5EF3A 3KE0A 5FHBH 4HLJA 1UWXK 3M86A 1QRNE 3IJEB 3QS2A 2OYMA 4L8DB 5GS1A 1KGYE 2DLFH 2V8LA 4LHQB 4ONFL 4XCCH 3WMQA 3WENA 4ANWA 4E5XG 2O61A 2NQCA 1IC5H 4EF3A 1QLFA 5I0XA 3FO2B 5DHMC 4KKPA 2WTPA 1WEJH 2KS0A 3TBVA 3TEWA 3I3BA 3RL2B 2MCMA 1TG8A 4PTUB 2WB1A 5SWSD 4H8QA 1GZPB 3BXNA 1OSEA 4I1NB 4WDIB 3VD4A 5CLXA 4KRPD 2YEQA 2NSXA 2CUMA 3LN4B 4JPIA 1A7OL 3K74B 2Z92B 4PS8A 3MHZA 3HC0A 4OCRL 2Y9RT 2X0VA 3F7YB 3PHAA 4NO3A 5DVMA 5EUOE 4DOHE 2B3IA 4WI7A 5DEGA 4PJDE 3UTPD 2PWFA 2ZCLH 3QRBA 5KVGH 1OAXL 2KQMA 4GQZA 2ARJB 5DZPA 3BUYB 2J55A 4YAQA 5C6WH 3WEMA 3NGBC 1LWHA 2N59A 2B1HH 1J0HA 2WVVA 4E5XB 4GQQA 4JPKH 2AAVA 2CPUA 2WO2B 5EFIB 4ZMPA 5IVNA 1MEXH 4QY8B 4M6NL 1BD2B 1JTPA 3DX2A 2VMDA 5IW1B 4Q6IA 1A7RH 3A47A 3TO2B 3DRQA 5IESH 4LOUD 3VH8A 4UT7L 1NFKA 4U31A 4I3RH 4AQAA 5K9JH 1G43A 3BH8B 4XOEA 1CE1H 1EMTH 4ABUA 4WTQA 2IWKA 1S7UB 1CDUA 2APSA 1XSKA 4JBSA 5ALBH 3TVMB 4JREB 2V2TB 4U1GC 1RZKL 3PNWB 3F3HA 3ZQWA 2VRAA 4QYOB 4MSWA 1SJEB 5HGBB 3L7FA 4L18A 2NMSA 4G42A 1PZSA 4XCFL 2BDNL 1NCJA 2C26A 3LVTA 1PLGH 1CF1A 4YHYC 2O5NA 2G0LA 4AYGA 2BLFA 5BS0B 2B1OA 3PQYD 4NCDA 4XTRC 5HI4C 3P2TA 5DD3H 1ACYL 1BZQK 1UH2A 2IWFA 4S11A 3SKOA 2O5ZL 1PG7L 3NACH 4MA8L 3CFBB 3OKYA 3G5WA 2PPAA 3NRPA 3KR3L 3EHBD 2PKDA 2VITB 3LH2H 2VW7A 4GAGH 4NZUH 1FPTL 1S3KL 2R2HB 3ZZQA 1J9SA 1T5WA 4X98B 1N2RA 3ILPB 1TQVA 4BQBA 4ZTOL 4Q6KA 2BC4B 2C34A 5KSVB 2F53D 4GW5B 1DJXA 3KS0J 3AY4C 2O30A 3BEVA 3MLWH 1FG2B 3RBSA 3VWJA 4AGNA 5EA0L 1TPXB 4Z77A 3BZEB 5GPRA 4HPYL 4GLRI 4HJ1A 3B9AA 4NNYA 4HEPA 1KBGH 3QIWB 4MNQE 1JXFA 3C9NB 4NOFA 4ZFZB 2F1BA 5M95B 3KD4A 3R19A 2OJEB 1QSED 2Y7QB 5IEHB 4TN9A 3VXRB 3QI9C 4LEXH 5ECJE 4Y1AD 4R7LA 2OPCA 2N4IA 1RZ8A 4JFEE 5KVEE 2NY7H 1GGIH 5KVDH 5ESVA 1X4XA 2Y6TE 2UZYA 3SDAD 4WGVB 4ANXA 1G7MA 5B8CB 5DVPA 4AMKL 4HD5A 1AGBA 3ZOAA 3BCDA 3TN0A 3IJ9A 4YFLF 3MRPA 3S8GB 1CU4H 1FSKB 2XKUA 2LAAA 2AJZB 4FQQA 1I9IL 5E6UB 4KXAA 4ZPVB 2WXIA 5FA4A 3US0A 5EG6C 4W9HC 3OMIB 2DYPA 5D1XC 5C0ND 3IDMA 5J6GB 3S0PA 4GG6B 1RFDL 1THAA 3ET9F 3OWEA 4TXVB 4DN3H 3LPFA 1TJXA 4UDTA 4M7LH 4JFFD 3WKYA 1E8XA 4HC1H 1I1AD 4PY7A 4RVBA 3L4WA 4L8SA 4AIXA 1XF5B 2K1MA 3TBWB 2Z7WA 3BHBB 1V7NL 2EH7L 2ZOOA 4ICWA 3REVA 5BMFL 2D9CA 2WQXA 2FL5A 5D7LE 3S3CB 4O02B 4FXGB 5C0IA 4I0PC 5JXED 2FBJL 1OO2A 5B1AB 5ENWA 1QFUH 3D4YA 3US9A 3IRCA 1FFPB 4J3TA 4RGNC 5L2JB 1CL7L 3P2DA 3D2UD 2BIOA 3IF1B 2R27A 2NYYD 3GGWA 2V33A 3MACH 2R2CA 5SV4A 1MJ8L 4X7DC 5DZJA 5JLZB 4LZKA 3RFZA 4HUCA 3WEOA 1S9YB 4M9PA 2F1AA 4Q2ZA 3TA4D 2Q76B 5C6TL 4P9HC 3DXAD 4LEBA 3D4CA 1FQ9C 3QO0A 2AV1B 2YAEA 4QRRB 1U8QB 2KDGA 2XKNA 4JJHA 2MWCA 2MCPH 2DD8H 4X6EB 1MHPH 3LRLA 4F7PA 2B0SL 3OKEB 5HGGS 3V5KA 2BPBA 3NAAL 1XMEB 2KDYA 3EYVB 5B39B 3FH8A 2NY1D 2NOYA 4M00A 1G7JA 3FTSA 4L3EE 1MRFL 1LEGA 1IGYB 4XPBL 1BQUA 1OGPA 3EJQA 1UADC 4YXLL 5HD8C 1YN7A 3EJUA 4PP1D 3UADA 3F8UB 1ZEAH 3E7JA 3WHE0 1XGRA 1I7RB 5F89B 3BD5A 3PHQB 1QI3A 4DZ8B 3O2DL 3BESR 1JIBA 3H54A 5HJ3B 2CK0L 3GBNH 4FG0A 3DTUB 5GRJL 4DP5X 2I07A 4Y4HC 1IJ9A 4XB3A 2DIAA 3FTZA 2QEJA 3FN9A 4XNUH 1XQ4A 1Y1DA 5L0QC 5JNYA 1I8KB 3BPOC 4PS7A 4P57B 5LQBH 1NCTA 3QE5A 3ALXA 3NCJH 4I88A 5AYQA 5HHVH 3CZLA 2X28A 4KNTA 2WZPA 3DHJA 1UWFA 4WHDA 2BRQA 1H3TA 1KEML 2C3VA 1CXLA 3WJLA 1B2YA 2D7OA 5IOPA 1Q0XH 4JK0D 2DH3A 4M5YL 3VXUB 1MW1A 2GK0A 1IAII 3BRGC 1TVHB 3RWJB 3EYOB 1S7SB 2VQTA 3RVXC 1XTMA 1Q0YH 3L1EA 5EUOF 2GVYA 3M88A 4PJDF 3NPZB 1G7HB 4AQZA 2X70B 5ALCH 1VSCA 1SYSA 2NLJA 5GGTA 1I75A 3B3IA 1HHKB 3QDMD 4WF7A 2HN7A 2ERJC 4G7YH 1DVZA 3CZNA 3GEWB 4PBVC 4DP9X 2YUXA 3TH4T 1J8HA 1N6VA 4NDMB 1EAJA 3GKWL 5EO1B 3DI3B 5T1LD 1E43A 4HOMA 2A6DA 1WGVA 1K3IA 1YEDA 4URTB 4WGWB 4PRHB 3S5LG 4U0RC 3LAFA 1E5ZA 4G9FE 3LN4A 2Z92A 3T0VA 5HJBA 4F24A 4LSUL 5D2NC 3UPAA 2P8MA 4LCYA 4XX1E 1F11B 3TT1L 2V17L 3TNMA 3BQUA 1XVSA 1A1MA 2P45B 4WKZB 4A2EA 1AZBA 4UIMB 4LKXA 2VDPH 3B9EA 2YQ2A 5CGBA 5KSUB 3STLA 4X9YA 3D7PA 3H56A 2ZP8A 5FK9B 4NKIH 3NCYS 4X9IA 1PSKL 4OBSA 5JQ6L 3MCG1 5I5MA 1NQBA 4PLJC 5GRVL 1E3ZA 1KBVA 4FXKB 1YYLL 2PCYA 3HS0B 1NBCA 1I9RH 3MU3A 2GUOB 4HPOH 4P46B 4LARL 4ZUSB 1ORSB 3CHSA 1ZGLM 2K7PA 2R1YB 3MJ9H 4OJAA 5J4MA 2JJVA 4U0QB 3KGUA 5I1HL 4QJ4B 3S5LB 1H3GA 2EXWD 2VM4A 2V9UA 4Y9GA 4D0BB 4PJBB 4AE1A 2YRLA 3SQRA 3WXVH 4X4ZA 3V4VA 3P77B 1EH9A 4UU9B 2WKGA 3G6JE 2IFGA 5DQJB 1AHWB 1KXQA 1FZOB 4GRLA 4P2RD 4ELKB 5ISZA 1RZPA 1I9JH 4Z3EA 3ZL1A 5T1JA 3FCBA 1EHXA 5JXAH 1E2WA 2OMWB 3HKZA 1RD6A 3CVBA 4HBCH 4XAKD 2CGRL 1FN4A 2DMHA 4JKPL 2Y22A 3EOTL 3IGAA 4P2OC 3LDBC 3ZKQD 2YRZA 3CVCA 3WS3A 5LNDA 2AVFA 3BPCA 4OCSL 1G1CA 5ESAB 2I7OA 5GJTL 3RWDA 2Y5QA 3EXLA 3HZMB 2GG1A 2BRRH 3BVNA 4L4TD 4JFEB 5ECGA 1KEGH 1T6WA 1RZGA 4HX1B 3OAZH 1VPOL 3VA6A 4LASL 5FFOA 3TF7C 2R2HA 1C12B 3DVGB 5CBEA 5CCGE 5C0EA 1NPNA 1RK0A 4CSPA 2Y2TA 2ZZUT 3HS8A 3OB0H 4OCYH 2BC4A 2HT4D 4UIKL 4NT6A 5HTSA 4ZFFB 4AQ1A 1RZ7H 3VQ2C 1IBZA 5C97A 5LWYH 1MCWM 4GS7B 3RWGA 4R7XA 4ELME 1IQDB 3PFUA 1HSAA 2NYZA 3DETC 2EINB 5A7BA 5C7XH 1GMIA 5AVQB 2A9CA 4Q0XH 3TONA 3KPNA 1BVNT 3K2KA 3P4OB 3HC4H 3NJJA 4XP9H 1OLZA 4Y9EA 1F6LL 1M2VB 1SMAA 4L9LB 1VKXB 3VFGL 1CR9L 5C8JA 2FIKA 4KHTH 1LO2H 4JY5H 3OAYH 3V7AE 4JFDB 2FT6A 3WL9B 2CDEA 3DHUA 4DPRA 4E41E 3CBKB 4H0HB 2W0FA 3WLWC 3W11D 3TA3C 4FNQA 4L1TA 4LF3B 2GSIA 2M83A 3GBDA 3P11H 3L3KA 3B34A 3RDTB 3LIUA 1TT6A 4QT5B 4X7TB 3UC0H 2X6BA 1B9ZA 2GTQA 4F37F 2JJSC 2OK0H 1FZJB 4AV5A 1TVBB 2ZXDA 2BVYA 3PWPD 3MJ7A 2MQ3A 4NUJB 1ASOA 3DX9B 2JJWA 3HPJA 3GMMA 3KS0H 4LCUB 4ZG1A 1H6UA 1AD9A 2BS8A 2HLEB 2PR4L 2LE9A 4KZEH 3BWUC 2HTLD 3ZRSA 6FABL 1J05B 5HP5A 1DQDL 5DJXB 4OM1H 4X9GA 4H1LH 3BSZA 3GJFH 1ODUA 3PWLA 3TO4A 2QZ5A 4WQOA 2HRPL 4GMSH 5KAQG 5DTFB 1U3HC 4BUHA 2VN7A 4JZNA 1INDH 2JB6A 4F58L 3BWSA 4PY8J 2ZX9A 2D7QA 1U8JA 3VE0A 1A6UL 3RVWD 4WU5B 5A2BA 1W9XA 4L3EB 3PDDA 3FB6A 3F2LA 3PWVB 4JVUA 4FQCL 1A0QH 1YEWA 3JUYA 1LEIB 3QJOA 1YYML 3MCYA 4KMTL 4U1KA 2IWGA 1DJIA 3K0WA 5HHNA 1RSFA 4MMZB 2A4CA 3UJIL 4YSSA 1ZGLA 1SRDA 2Q76A 1OM9A 5I19H 3BVDB 1YEKH 1XR9B 4ALAC 3UTSD 3C2AL 3O6MH 1MAKA 2BOCB 4HSCX 3WKNA 4QRRA 1H8NA 1WFOA 1FVCB 4WI9A 3U9UA 3N9GL 3MUHL 2QPSA 5I75B 2X3AA 3MRKA 2WWMD 2VSDA 5C0DA 2VC2L 1T0NA 1NMCC 4AM0Q 4BFJA 2OMVA 4O2FB 1H6TA 4Y2DC 3BP7A 3DKHA 4F33B 1NCAL 1EEYB 3CBRA 4R2GD 2VDPB 1NBVH 1AMXA 1OK0A 1ZK5A 2SEBA 3QXWA 4XMVA 4BDVB 1RI8A 2N01B 3FXIC 4K2UH 3NZHL 4FKHA 5JDJA 3B7TA 3G5ZA 1TJIL 2MTPA 2X4OB 2X0UA 1QRNA 1JGIA 3CE1A 5DC0A 4KJWD 4PRBB 4RSYA 2IMNA 5AB0A 4HIHA 5DR5L 4KFZC 1FUNA 2Y06H 5D1QC 1ZLSH 4EDWH 1MFEL 5IMLB 4RRPM 4LPUA 2XI9A 4YHPB 2IMMA 4X8GA 3L2NA 3BZDA 2E47A 4QKTA 3RGBA 2JKJA 4A39A 4FFYH 3HLAA 4W9GC 1UJ3C 4BFNA 3MTXA 2VDRH 1IO4C 2E4TA 5EUOA 4IDLA 4HK3N 1I31A 4ANUA 4OUOA 4PJDA 1G6RA 1HQRA 1L7TH 4Z7OE 1K3ZA 4PP2A 4AWJC 1HZLA 2H0PA 2MQCA 1JPTL 1TVHA 2FYYA 2R0KH 1MIMH 2GT9A 4IRSA 1G87A 4G6MH 5HGAB 4F7TA 1S7SA 3S88L 5IZ7A 4ZFOL 2F74A 5EPMA 3MRRB 1AR2A 1LE9A 4IMKC 1QUPA 3UTPE 1AGFA 3GD1C 3E8UH 4JG1L 5EF0A 2FLBT 4NERA 2CXGA 5AVYB 5AW7B 4BFGA 2YWYA 5FHAH 2P80D 1A3RL 3H7BA 1DANU 3MRHB 3IFNH 4B5EA 1TTUA 4P2AA 3ESUF 3GKZA 3S34L 5B3JE 3U7AA 3GXUB 4KUZL 1MHEA 3VRIB 4FHBD 3M6DA 3W5MA 1T5KA 2OTPA 2CCWA 4DERA 3G6JB 2VR9A 1CFQA 4U4BA 5JORA 4APXB 1FRGL 3Q5TA 3I2CL 3PDOA 3MLVH 4MJ5B 2O6DA 2MPAL 2PWEA 4LRIA 3GIVB 2BVPA 3Q2WA 1IL1B 4UV7H 5KSUA 2YSSB 4Z7QF 4HQQL 2FWUA 3TJPA 5EBLA 5FYKU 4P04A 3HG2A 4H1LG 3TPKA 4WHTA 2HVJA 5I8CA 5GGQH 5FGCB 3IE9A 2W65B 3FT2A 1ETZA 2Q6WA 1F00I 5CKAA 1IC1A 3D52A 4P46A 1EZUA 1B4JL 3MA9H 3JTSA 1N6QH 3TBBA 2YGOA 3MMEB 4LKCA 4UQCA 3PQYE 5GS1C 4GIPD 4L23A 2XG4A 1R9FA 1R75A 5D4JA 1R3IH 3FT3A 3F05A 3ZR6A 1LVEA 2FJUB 3GTTA 4KH9A 2H26B 1DN2A 4PW9A 1AHWA 3P2BA 2FJFA 4HWZA 4RX4A 3L3IB 5SV3A 5HDBE 1AQKH 1ET8A 2Y3AA 4I85A 4NZRL 1KCRH 1HH9A 4MNQA 2EXYC 1LGVA 4NQDB 4XX5A 3ZDWA 3LNFA 2FJGB 2WVTA 3IDJA 3K4DA 1Z3GH 1T20A 3CZFB 1GOGA 4L3AA 2Q0ZX 5GHWH 4XP4L 4Y5VB 5I1KH 1JZ2A 4QRQB 1U4FA 4ZRGA 3S8FB 2F53E 1K8DB 3MYZA 4PM1A 4X5PA 3WIHH 4HIQA 2VXQA 2CRIA 5LXVA 3KLDA 5I30L 4NQSA 3ABZA 4ILDA 4WWNA 3ARSA 4JPVH 4M3HA 4J6IA 4EZLA 3HZKA 4JFEA 2P8LB 5ID0A 3TJHD 4DTGL 5EZIH 2FZ3A 1PZCA 3DVGA 3GJEB 4WGKA 2FWOB 2QSCH 2MIZA 1ZT4B 4LLVB 1XV8A 5J11C 5HHQA 2D03L 4LLDB 3MZTA 1AS7A 1BQHA 4UT9H 1G9MC 1F4XH 1RJYA 4Y1AE 2ZCHH 1BM3H 1UFGA 1KBPA 4M7ZB 4PGZA 2VXVH 4Q6IC 3UEQA 4WI5A 3VFVB 4F57H 2A73B 4R4FL 2VUKA 3AMKA 3HS9A 5T3XL 4BZ2L 4H7VA 1M2VA 4B50A 1AKJB 3MNMA 5IQ9B 2FR4A 4PPTA 4RRPA 3O9WB 1UT2A 4RA3A 3UPRA 3I9PA 2X9YA 3BAWA 1AO7D 4PQXA 3B2DC 2CU9A 3WFDL 1CN4A 5FM5M 2ADGB 3VJ6B 5H8DA 4WUKL 3WL9A 4OT1H 5E0QA 1X5ZA 3LZQA 4M61B 4KI5C 3CHOA 4KKNA 5CP3A 3FUMA 1MCJA 8PAZA 1OSZB 4GKZA 1MF2L 4ZXBB 1C7TA 2GJZA 3QIBD 1OQXA 2XZZA 4Z7VF 1UFUA 3RHWK 4ZDHB 1UCTA 2NUTA 3ETBF 5D7LA 3JYCA 1PL3A 3MLZH 3Q8EA 4GBXD 4IRJD 5HDRA 4K7FB 5IVXE 5T3XD 2JKNA 1T7WA 3KPQA 1DL7L 3VCLB 3T65A 3PY9A 3MLSL 2Y7LA 3BDXA 1QWNA 3QT2A 1R5IB 1T7ZA 4HUWA 3GLZA 32C2B 3A67L 4C57C 4GP5B 1R0AL 2BOBB 1T04B 1ZVSA 3G6DL 4PD4J 3Q6GL 4KKQA 4NLHA 3U0TB 5IQ7L 1JE6A 2CO6B 1SJVA 4DO6A 4ZPTB 3BKYL 1W72A 3O3BB 1GGTA 4F9PA 4FRWA 1J05A 2JIXD 4J3VA 1G9NC 5AOZA 3IRZA 1EJOH 3QNYA 4K3HA 4M93B 5J9PB 1NAMH 2ENPA 2VJXA 3VFWB 4DJMA 5IHHA 3D0AA 3GSXA 1JN6A 3VWJC 5CILL 5DTFA 2EDYA 4IBZA 1WF5A 3QG7H 2BJML 2WXFA 5I1CL 1ET7A 2KC0A 4TSCH 1A1NB 1ZLWH 4KQ4L 1B0RA 4JHWH 5D1ZD 4H0GA 3IT8D 4WU5A 3S48A 3VRJA 3X14A 3GRWH 5C0AD 4A2DA 2V2WB 3DOSA 3DXAE 4JANB 3GBML 2E3VA 4R97C 2HXAA 1QR1A 1QHPA 3R4DA 4PJIE 5KVFH 1DLFL 3H3PL 5DRZB 3CQFA 4QRBA 1MHHB 1KB5L 1EAPB 5ADPL 3DV4B 4Y9CA 3GMLA 1MREH 4GAAA 5F9JB 3K5RA 3P30H 1S46A 2GKIA 3RX8A 5KYWB 1NC4A 4CMMA 4YSRA 3H6AA 4P3CL 3SGJA 3MRLA 2GIXA 2Q9OA 4RAUB 3O8XB 4UB0H 3TN0C 2V7NB 2NY6B 4W9JC 4QXGL 1B3IA 1I1FB 5DMIH 3NIDE 1I8AA 1VGEL 3HVDA 5GGSA 1MDAA 1WIOA 5I6LA 4OZIE 1WFNA 1HHHB 4G72B 4UUJB 5IMMB 4KK9C 1YEFL 5EF2A 1GTFA 1OP3H 4HVBA 3A6BL 5BV7H 1PTZA 5BPPA 4X0KA 1NCBH 1TQBC 1Q4NX 2X6UA 2R2BB 1JZ4A 3G5VA 5IG7A 3KXFB 2KZKA 3CLFL 4WWKD 5AUMB 3V9CA 5LN8A 3AWGA 3WAJA 2PYEB 4G7VL 4RISH 4XC3H 5LUMA 5EZLA 4L8SC 1BIHA 3CC5A 4OLWL 3MUGB 5FB8B 2DLGA 4XO3A 2NSQA 1U8HA 4Z7OF 2VMCA 1XGTA 4B96A 3SPHA 1SDAB 4BK8A 2NDFA 2VZUA 2EDBA 1DQQA 4RDQF 2ARWA 4S1RH 4XXDB 1WQVT 1YEGL 3WKQA 4N0CC 5I2IA 5E23A 2E74C 1NIDA 4TULH 2G3MA 2MCG1 2D7MA 1KT2A 3OMAB 4X80H 1ZANH 2KYIA 2QVIA 3GRGA 5CEYA 2KH2B 2X2IA 4YDJB 3RFZC 4G9FA 3RVTD 3C08L 3D48R 3FQUA 4HF5H 4MA1C 5BV7C 1INQA 2FB4H 2YS4A 1WZLA 3EFOA 2FLRT 4U33A 2A74A 5CLZA 5B3JF 4TL5A 5TD4A 2VO5A 2VLJB 5TPWH 3MNZB 4OJFH 1HHJB 4TRPL 4F3FB 1F6FB 3FAXA 5GS0H 4G7RB 3D85B 1F86A 1X9UA 2P7TA 5DWUH 4TTDC 3ZHDA 5CD5C 3U46B 4POYA 2CBTA 2ZNWA 1IFHH 3E6HA 1D5XB 1CICA 3G5YB 2CCLA 4LLYB 3FNKA 1YG9A 4PRID 4XB8A 3ZJAA 1M2OA 2A99A 3BVTA 3K8KA 1TSRA 2B3RA 1P5UA 4NEHB 2AI0H 4ORGB 1QNZL 3W9DB 4FTVB 4AVJA 5CCJA 4YX2H 1RURL 4KTGA 4EUPH 4YL9A 4JPWH 2LLNA 1DQMH 2PABA 3WXWH 1IBGL 2H2SD 1HXMB 5F3BB 4WJKB 3LKOB 4BV1A 4TUUA 2IDSA 3SPJA 1UJTA 5IW3A 4UOZA 3RTQB 1Q9OB 1YMHA 2Z8WC 1FE8L 5HHME 1L5GB 1CFVH 1N4XL 3RL1A 2X4SB 3QR0A 1M1SA 5EEUA 2W9DL 1QPXA 3GIVA 1J5DA 2FO4A 2NUPB 1JYXA 4XBGA 3VQMA 2UZIH 3HJEA 4P23D 3ZIYA 3CVIL 5HDBF 4PBXA 4Y4KB 2P49B 4BH8A 5IBLC 1FCGA 4FJYA 4HISA 1MW3A 3PE9A 2N1KA 1SXCA 2W65A 4P2RE 4ZAKA 3WJLC 2C7UB 5IB5B 5B7FA 4GFTB 3U7WH 5MEPA 1SY6L 4QGTA 3VXNA 4EPSA 4PFEA 2ATKA 2NY4D 1G5GA 2Z1PA 4XAKE 4D9RD 3LEVL 2VH5H 2ZJSH 1VEPA 4MA3A 2AJSH 2DOCA 1E65A 4JFWA 5ID1B 1K6QH 4PAZA 3KYNA 3PXHA 3FN0L 1X5MA 5IIEB 1HTYA 1KTJA 3EJYD 1CYXA 4ZO6A 3QDGD 4UQEA 4ELMA 1N64H 3DROB 4L4TE 4NZTL 2HWZL 5ADOH 4EI5B 3N1FC 1BAGA 2P8PA 4Y4FD 4EI0A 3L3IA 4GXUN 5E9DB 4IYKA 4B53A 1XF3B 3UXFA 4NI3A 2MKWA 3QHFH 2FJGA 3PWUA 2ETWA 1NAMB 4AT6B 3VXMD 3MKKA 4AGOA 3R7RA 1UGKA 2HT2D 4HEME 1KIUA 1S7QB 2H2PD 3VXTB 3BRFA 3OKMB 3RY5A 3KJ6L 4IOFC 3BQUC 1MCFA 3Q8FA 4E41A 3BRDA 4M7KH 1P7BA 4DEPC 4PWFA 4L1BA 3EZ8A 4LHUD 4XNDA 3WNNA 3LZPA 1EGJL 4PIBA 2A9NL 1A9BB 1MCEA 1QSFB 2FWOA 3GJEA 3MRJA 4LLVA 1IBBA 2D0FA 2Z4TA 4OR1A 4GW4B 1D9KD 1NBZB 2IBZX 4BKLA 3QYNA 3D50A 2Y36H 4P2CG 1PAZA 2BCKB 3ARRA 3Q6FA 4H13C 3OGCB 4JQIA 5HVHB 4ONHA 2WIMA 3QUMH 4M5ZL 5IBTL 5IVXF 5K39A 2OZ4H 2OSXA 1W80A 1PPIA 3W9EB 4JRYD 4JO4H 3C60B 2Q8AH 1O75A 3CUPA 1L9OA 3D87B 4F2EA 2NNFA 2BWDA 2OAAA 3QDHA 4ODWA 3PWPE 2XBDA 3IWUA 3HZYB 4GRLC 4A7GA 4K4KA 3VJ6A 4DKFH 1CLOH 4W70A 1DFXA 2J5LC 5BV7B 2QTVA 4M61A 5E8PB 3IFLL 5GJSL 2J21A 2OQJB 1SOXA 1UTDA 1KDIA 1X5YA 1KXVA 3PABB 4MAUH 4UM8B 1ND0A 5LG1A 1A47A 3NJMA 1OSYA 3QXAA 5T5FL 1DEDA 3ABLB 4K7FA 3RZCB 3R06B 4HIJB 2OR7A 3S7GA 1CPUA 1G1YA 4IKIA 1HH6B 3JUZA 2A3TA 3ARVA 5B1CA 5J3HC 2EC9T 5D9SA 4K94C 3EGSA 1DN0A 3N55A 3UBXG 1L9SA 2QQKL 2WMPA 3SGDI 3L1FA 4PJIF 2W9EH 3LKRA 1BBJA 1JDDA 3FT0A 4U1LA 3WUWG 4F2MB 5I15L 4W81A 1GZQA 4AQ1C 1QKZL 4Y9BA 5DUPH 3TIEA 3GUTB 1XIWB 4K94H 3NIDB 2CDGB 5KTEH 2HZHA 3O6KL 2R2EB 3RUGE 3UZVB 4CRPA 2O5YL 3FHAA 2COVD 5DJCA 2AGJL 4EUPG 5F72S 2ATAA 1A1NA 2J4WH 2WYIA 2ED9A 2JXMA 4MNHB 3GI8H 4PWEA 5E2VH 4RGMC 3ETSA 3RU8L 4OD3L 5EOQH 4LOEA 2WXHA 4HYTB 3FTYA 4ZMTA 2X40A 4JANA 1YO4A 2GPZA 3UTSE 2EDDA 2FSEA 4OZIF 3V0EA 3QPQC 1E40A 1M05A 4KKCD 4J5VA 3UBXB 3VM5A 5EEWA 3F58L 1CK0H 2CR0A 2LGNA 3GSNB 2AZAA 3WUWB 5KYWA 3FO0H 4PJCE 4ADJA 2YOCA 2DY2A 2K9FB 1IFGA 2VM3A 2YXWA 3MV8D 5ACZA 3NESA 1R3JB 1NGYA 2CJUH 4EIUA 3CZGA 2ZOKB 4EUPB 5FOBB 3L3GB 2NY2B 5I26A 4P2QE 4AV4A 1WTLA 3SO3B 2YQ3A 2X4QA 4CN6A 1MAJA 3T04D 5EEYA 3CH8A 2C1OB 5KOMC 3UJJL 5I1GH 5HYJD 2A6JB 3D18B 2GABA 4YR6B 4E0RA 5JO5A 4QTHA 4P5SA 4RWYH 2R2BA 1OSPL 4NRYB 3TO4C 2AQPA 2NY5L 5CFAA 2WYTA 2XWZA 3G08B 3VACA 3MOAL 3NSCA 3P69A 3BW9B 5SWSA 4EE2A 4ODUB 1MNUH 1CI5A 4G6JL 5FCUH 1PS3A 1HYSD 5T3ZL 4NOBA 2CH8A 1JGVH 2HLAB 3KCPA 5FYLL 2APWA 2WJ7A 1M7UA 4JO1H 4N24A 3SO5A 5J13B 1ACCA 4OLYH 1JHLH 1QLEB 3VB8A 4B95C 1QTSA 4OSUH 4F15C 1SDDB 1N7MH 2VDOH 2GJ6D 3DX6B 4NJ9L 1OLLA 3G3LA 4MYPA 4TQPA 1J1PL 4I2XB 3I9GH 4J3OD 3TFKC 2EIMB 5EOCL 2HRHA 5IHLB 4FG4A 4PSPA 2VTFA 3N42B 3EFDL 5ANHA 4AQEB 3C5JA 3B5HA 1J9CT 3IMTA 1PNDA 3MGOB 3MTRA 5I5JA 3PGFH 5T3ZD 2B4CH 4XGZB 4H2CA 5KYUB 2WK2A 4OBRA 1MFNA 1ODAA 5FYLD 2GCYB 5D70H 1LDSA 2JKRM 4OM0H 3V0HA 1QBLL 2FX7L 1A14L 1KC5L 3D05A 3QQ3B 2BSRB 4Y7MA 5TH2B 1L9MA 4BSWB 3AXLA 4F3FA 2LOEA 1A4BA 1FDLL 2NX5D 4TQ8A 3QORB 2FBRA 1NCHA 1TTFA 1NEZA 1T22A 1URZA 2JKLA 3ENEA 4XMLH 1KYAA 5KYYA 1UXMA 5L4JA 2ICEB 1OV8A 3GSQA 4MQ7B 4NSKB 2FHFA 3L2LA 1UVQB 4XPGL 5JYMA 4FEMA 1HESA 1JF1B 4QF1A 1B0IA 1RHHA 1CJYA 4XVTH 3CQQA 4BGLA 1ZHKA 1MFUA 2PW1B 2ZOLB 4S1QH 4HLEA 3QYMA 4JFVA 1DQIA 2DQFA 1YNLH 4NBXB 4XO8A 3VI3E 1UKTA 2L8AA 1UB5A 3PQYA 1X7QA 2I60H 3JWNE 5FKPA 5IHZB 1N59B 1F3JB 1OE1A 4H5SA 4DKDC 1EJ8A 5EU6B 2C1PB 4MRCA 2R8SH 2ZP9A 3VFOB 1HXMA 2CUHA 2Z35B 3BIKB 4A38A 4UBDD 3TV3H 2GBTA 4DNLA 2VXSH 4FLHA 1T2QL 4JE4B 5EWIL 3ARBB 3ZDYB 4ONGL 4XCEA 4UQ3B 3DVNB 2F53A 1JWUB 2B9AA 2DQGL 1AFVH 1TTBA 2ZCZA 1Y18A 3MN8A 2R15A 2EE0A 3T2OA 2ZSVA 4BCZA 2J72A 3MREB 3ABKB 4NPJA 1OAZL 2W0LA 3OM3B 4B41A 5C71A 4IRSC 3CK0L 3VFUA 1X7SA 5JW3H 5BNXD 5BO1L 4QRUA 1S9VA 5LXGL 2V2XA 5ID1A 3DSFL 2XIIA 5CJBA 1SEQL 4PRDA 3TBYB 4L4JA 2Y1VA 1VF5C 2DWTA 2NT0A 4KJPC 2GITB 5DXWA 2UVEA 1IAKB 4AM0A 1QSVA 4NKOB 3TP4A 4Y1AA 2VXTH 3K6IA 3G9VA 3WTYA 3ERXA 4BJLA 5CF3A 1OGTB 4F7EA 4K55A 1ZTMA 5F1OB 4HWNA 2ICCA 3SDAA 4IBLT 2YJQA 4OFYD 5TFSL 4YSTA 3U0PA 1AS8A 1XL6A 4FNPA 4JL2A 3QAQA 1E27B 1FZKA 2ODHA 3TLRA 4AT6A 1AD0A 2PPEA 4ZMQA 3KLQA 3CH1A 1TZHB 4HKZA 4PJHE 4WFGD 3JV0A 3M07A 1EHLH 4MCNA 3OKLA 1YSOA 3DJTA 1MFBL 1FNGB 3ZKXC 5JR1H 5JA9A 2X6VA 2XV3A 2IFFL 3O3AA 3FONA 4MJIB 4WW2F 1A7PH 4LRIC 2KHAA 5DD5L 1WD8A 3C8KB 4N2GA 4I3GA 2XSKA 1CXFA 3GM8A 2Q3AA 1PVHA 5IB4A 1AO7E 4JFQB 1E8ZA 5IVXA 3SPCA 1EVTC 1WWCA 4BK4A 2H4EA 2J44A 1K9TA 3EADA 1BIIA 1I1AA 2XHNA 5CEZL 3L3HA 3IDNB 4P46C 4ZD3L 1K8IB 1JFQL 3BGMA 4Q8BA 5CINH 4BINA 1S9WB 4UQ2A 3SB3A 1EFXB 2DBLL 1RXLA 1XCQB 4GG8B 3W9EA 4R26H 1O9WA 1XEDA 3HFMH 4YDIH 1XX9C 5JXEA 6CGTA 3AC0A 3FYEB 1LK3H 5C9KA 4AEIH 1GGCH 3KPLA 1KJ3L 1AR1B 1JGDB 1MRDH 2FGWH 2YD5A 2CHDA 4ZMVA 3IFOB 3NIFB 1KN4L 1U92A 4IBWA 2AITA 3EYQD 4I0CC 5DEFB 1UZ8B 4PRAB 3KGRA 3U83A 2R0LH 1JV2A 5CEZD 2OQJA 4KVPA 3QQ4A 4B27A 2GTZA 4EJ1C 4XC1H 1GJIA 2YMTA 3RUGF 5E94A 2AXFB 3DXAA 5DI8A 3QI9D 2EEDA 3RZCA 2A9AA 4H88L 5C3IA 4PJIA 5L7XL 2O6CA 2EUWA 2P5EB 3TCTA 1BEYL 3IDXH 1AOZA 2NQDA 3TL5A 5DJAB 3F6JA 4OJCA 4O9HL 2YAPA 1WA1X 4G71B 2VDOB 5C0AE 4FFTA 3L1OH 3O2VL 3KPRD 5BOPA 1NINA 4FERA 2XNAB 1C5BH 5DQDL 5EU3B 3QP3A 1JZJA 3S37L 3I50L 1IAOA 4A7TA 3OV6A 4OW6A 4LSSH 5D1XD 2X1WL 4XAWH 1OCRB 3G6AB 1R19A 3UZVA 4PJCF 1EDHA 4P2QB 3S4SA 3LQAH 5BUAA 4OZIA 1BVKB 1AE6L 1HKLH 2C3WA 2O26U 1G7IA 4HJGB 3UROR 4J4PD 4MNHA 3ZTEA 2ZXAA 5F6HJ 4GO6B 1NGWB 1XZ0B 1FLRH 3EXJA 3HW7A 1RP8A 3UMNA 3LEXA 2IXQA 2HUHA 1S5IL 2LT9A 1KGWA 4POZD 4G8GB 4LCWD 1QFHA 3ORJA 1FNEB 3VFMA 2DQIL 1U91A 1FC2D 3QUYD 4YNYB 3CDZB 3ECQA 4OCWL 2E7CA 5CCKL 5ERWB 1DDTA 1O0VA 1U8PA 1YC8A 4TLSA 1A5FH 1XEUA 3UH8A 3VG0L 3O2DA 1P2CB 2I85A 1O6SA 1FBIL 4LDEB 4LVOB 4U2YA 1OF2B 2X10A 3IVKB 2QPDB 4M1GL 4UQDA 1JRHH 3IU3A 4MVBC 4Q4EA 5CP3H 5D7JB 4C83A 3FS9A 1MCHA 2WXKA 4WTZG 5FOBA 4NC2B 3C6SB 4X6FB 4TVPL 4WAFA 4HS3B 3CLEH 4MDIB 1H5BA 5K59F 1Q9KA 3TXAA 3JZYA 5I6KA 1XSJA 2EDNA 1KTDB 4F9PC 2X9ZA 3GLEA 5FUZH 3V95A 1OARL 4R3SA 1OWRM 3D18A 1MVUB 3LD8B 4N0YL 1WFUA 1D2PA 1M6OB 2IBZY 1OPGL 5ACMA 1RJLA 5T1LA 4PBWD 1AP2B 1J5OH 3I6LD 5F0PB 3GHBL 2WXMA 4ATTA 1PQZA 2F5AL 5HDQL 1X5FA 4JDEA 5FGBA 4U1HB 1BQRA 2F7IA 5TK2A 2R23B 4WEMB 4YGAB 5HD8D 4L4VB 3UO1H 4TVPD 4G1EB 1Z5LB 1MLBA