2KZBA

Solution structure of alpha-mannosidase binding domain of atg19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
114
structure length
114
Chain Sequence
b'VEPPNERSLQITMNQRDNSLYFQLFNNTNSVLAGNCKLKFTDAGDKPTTQIIDMGPHEIGIKEYKEYRYFPYALDLEAGSTIEIENQYGEVIFLGKYGSSPMINLRPPSRLSAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autophagy-related protein 19
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 10
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2010-06-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzbA00
2KZKA 2KZBA
chains in the Genus database with same CATH superfamily
3RZCC 4JFPB 3QR0A 2JIXD 3AXLB 5FF6B 2E76C 1M56B 3GSNH 3N85L 4JDTL 3KPSB 1LEKA 2NYYC 2HKFL 2OKMA 4H2CA 2UYLA 2GIYA 2BW5A 3HAEA 1KJVA 5GJSH 4N8CL 1ZHLB 5E24E 1BMWA 2UY6A 3RPIA 3JTTA 5DO8A 5E6IA 3JUYA 1NIBA 1U3HC 1O75A 5I6PA 2DICA 2EIJB 4AUJA 2A0LC 1OB1B 1OE3A 2J2ZB 2AW2A 1O0VA 1MRFL 3WTXA 3F58L 3IMTA 4LGRB 4ZX4A 2HKFH 4H26B 3ZYZA 3VYNA 1YRKA 5BXFA 3BLBA 3GSQA 4IW4C 4APXA 3OAUL 1N5AB 1T66C 3DSFL 4MDJB 3EDKA 3UBXB 3KE0A 4F7KA 1MRFH 3F58H 1NFIB 1A22B 1ILUA 3QUZB 5GSVB 2JLLA 5DD6B 3ZY7A 5DLMH 4Z7IA 5DEFB 4HZLA 5FCUL 2D9QB 4GG6F 2WUCL 1CFTB 3DSFH 4HKBA 2O61A 1AR1D 1T03L 5J1AA 4XNQB 3P2TA 3K8LA 2X88A 2AJYL 3T0DA 2C26A 3W9EB 2MPAH 2ISDA 3QR2A 3D18A 3PPEA 2IPKB 3REWA 4PSRA 5E0FA 3QULB 3D0LA 5FCUH 3US9A 4F8LA 4F7PA 2WUCH 1BFTA 2BMKB 3QUML 4LBEA 4XVJL 5GGTH 5BV7C 5EO0A 1T03H 2FD6L 2FGZA 5IT2L 1SF5A 3UP6A 2AJYH 4ZX5A 1U3NA 5AZUA 2A77L 1YMHB 2G0LA 4HS8L 2C3HA 4Y4HC 3BAWA 1VSCA 1JDCA 4PLOB 1F90H 2DWSA 1OF2A 3QUMH 4XVJH 4K73A 3HPLA 2DQDL 2FD6H 4QT5A 4A7VA 5A1AA 1RPQA 5F9WC 3QPQC 4JPKL 4M7LT 3IN2A 4X83A 1EFXB 1J5CA 2WNGA 1TZIA 1NMCC 2A74C 3GSRA 1AD9A 2A77H 4LHUB 4YDLB 2IPUG 4HS8H 3V4VL 4B7IA 4HS6B 4DGYL 4F15C 4WHDA 1HCVA 5E8OA 3BEWA 4M5ZL 1FYTB 1GS8A 1ZT7B 3IS0X 3NCMA 2DQDH 2PO6B 2JTDA 3DPBB 3FT4A 3TT1L 1MFAL 2Z31D 4DERA 2NW3B 4LSVL 1JYWA 5BZDB 3SO3C 1CFNB 5DI8A 4G42B 2NY2C 4XWOC 1TXKA 2F15A 4R7DB 4GIAA 3V4VH 4DGYH 3AQYA 3RIFF 1D7BA 1P5UB 4M5ZH 3EOTL 2YK1L 3IU3A 3QA3A 3VXUD 2VW4A 3MV7B 1MFAH 3T77A 3TT1H 4GNKB 1M71A 4LSVH 3GPSA 1KLUA 1E5ZA 3JWNH 2KDGA 3MZGB 4Q58C 3WUWA 1VZIA 4HIQA 2I27N 2A6IB 1HQRB 2CUHA 4BFIA 4ANWA 4PP2B 5TQ2L 2Z92A 3REVA 2N3JA 4XZUA 4WNQB 3T65A 2ENPA 3AFLA 2ZCZA 2QV2A 3LIUA 4LVHB 3W3BA 4DKEL 1QBBA 3EOTH 1D7DA 4J3SA 1DVUA 5MENB 4GP5B 5F1SA 2GABA 5AOLA 1OY3B 3CVHH 4XZ4A 5CZKA 3MA9L 3EFFB 3AQDA 3LZLA 3VI4B 1SBSL 3QQ9C 4Q8BA 1MFMA 1H15A 2YGVA 5TQ2H 1MJJA 4ZAKC 1EA9C 3HZKB 4PRBA 2BLFA 4JRXE 5DRWB 1FZOA 1GJIA 3IYLW 2YA2A 1RY7B 3AT0A 5DD0L 4UQ2A 3MA9H 4JRXA 4OUUA 3ML8A 4RNRA 3JV0A 3MRJB 2QADC 1U9KA 5I17B 4ZJ9A 4K5OA 4PJGB 1QSFE 2EIDA 4I18C 2IDFA 4HJEA 4CSTA 2C1OB 4E41B 4PWKA 3IT8D 2VMCA 4XXCC 5F1NA 1PZ2A 2ADGB 3QXDA 1NM4A 4HS3B 4P3WA 1EXHA 5DD0H 1QSFA 5DHVB 3QAQA 1VFUA 4EN3C 4GJTB 5B1BB 1CDJA 1SOQA 3BXNB 2F1EA 4BD4A 1SJMA 2C4XA 1KYAA 4XAKD 3SQBB 4JGMA 2ITDB 1UWEH 2GJ6D 3CIAA 2QPEB 4JJ5B 3WJLC 1KGIA 3MYJB 4O2CA 1QKZH 1EK3A 3K1KC 1IZJA 4LSRH 2VSMB 1N19A 3EDFA 6CGTA 1RK1B 2OSLB 3BVNB 4ELKB 1MWAL 4RFEA 4PTUB 1OSZB 2YPKA 2D3VA 3CMGA 3MKKA 4GQZA 1XCXA 1E28A 2APFA 3B7TA 3C09B 2B59B 3MLZL 4UQIM 3WENA 4K3DL 1GAFL 3MV9D 3AXHA 4ZUWB 4LLAA 1SFHA 1ZLWK 2JJSA 5DUBA 3RY6A 1N8ZB 3DVGB 1QASA 3KPRD 2YD1A 4XVOA 2R23B 2CBTA 4AM0Q 5F44A 4MNHB 3MJ9A 3ZUCA 2WBWB 1MWAH 1A1NB 4NJAL 5LNEA 3MLZH 3QCTL 3ZK0A 3CPUA 4PJHE 3EYOA 1GAFH 4P2OD 4RCAA 4TUOA 1BYOA 2FEDD 1A25A 3IRZA 5GS1C 5C7XL 4IGBA 4ZSOE 4HKZB 4JRYD 2X41A 2BNRD 3I74A 4Q0XL 1BAGA 4PJHA 4B3VA 5D93B 4ZSOA 1RJCA 4ANUA 3H9ZA 3WLBB 1KGUA 3QJOA 5DHEA 1ZLUH 3ARFC 4QHMA 1HHGA 1XGPB 3FW6A 4NJAH 3QCTH 5EC2A 1DN0A 3WKQA 4CVUA 4Q0XH 2I25N 1ZT4A 1G6RH 3I75B 3MQIA 1T7VA 1RCYA 2L8AA 2BX5A 4ZXBC 1OQOA 1LWJA 1IAMA 3KPQA 5D1ZD 4ZMXA 4Y5VB 2XWCA 2J1XA 2HT4C 5EZIL 1I7TA 4KUCF 1CGUA 5D1QC 2XVLA 3O3BB 3P30H 4ZZFA 3MLWL 5L8LB 3HMWL 4WU5B 3NFPB 3B7UX 4OY9A 1JHTA 5CBEB 2H6PA 4DP5X 3RX5A 2BZ7A 5JOPE 2C34A 4LZKA 4OT1L 1S3KH 3MRCB 3AM8A 2AJSL 2PF6A 3PHQB 5D72L 5DWUL 3BCDA 5EIQA 5EZIH 1AZRA 2OW7A 3TJEL 2AXGB 4OJCA 4PGZA 1DVFC 2OXGA 2QSVA 2WLLA 4TVSa 1B0RA 1Z9SA 3MLWH 1PDKB 2PCPA 3FUEA 3HMWH 5INCB 4NWTH 3RFZB 3FCSA 4BCZA 1HESA 4IK6A 3UZEA 3S8FB 4OT1H 1WTLA 2OMVB 1I82A 1BQHB 1QFWL 3HIZA 2AJSH 5DWUH 3GSWB 3ZXAC 2JKXA 4ETQB 3TJEH 4OZGB 1PPIA 3L3GA 2QZQA 5FM8A 1UOWA 2CLRA 3QIUB 4XTRC 2LAGB 3EJSA 2YRLA 3ESMA 3BT2L 3H2QA 2CO2A 2EO9A 2HJLB 4NQDB 4TLUA 3RKDD 4KV5E 4DP2X 2R7EB 2X3AA 3NOIA 4JQXA 3QJHA 4X6CF 1QFWH 2NNRA 3UTZB 4PN6A 3FFCB 3CTTA 3MNVA 3KPPA 5E9DE 3TA3A 3QYNA 2E9WA 4X7EC 1U8PA 1ZJBA 3K6IA 2Q7YA 1A3RL 3KG5A 3PGDB 3OB8A 2DB8A 3AY4C 4CC4A 1CT8A 3VFUA 5E9DA 2IDSA 3BT2H 4N90D 3TASA 5ICZA 1E4KA 3BKJL 3DK0A 1XF2B 5I1GL 1T1XB 2PCFA 4GT7A 3VB9A 3HPJA 3Q48A 5E5UB 4B53A 3K3QA 3GUTA 1BCIA 1OP4A 2VQTA 4MNQD 5C07E 2H1XA 4DVBA 1J9SA 2QLVB 4PUBL 5CSZB 1A3RH 2G30A 1HXMA 5L2KD 3B43A 1KFAL 2X4QA 5HI5C 3P9LA 5C07A 2X89D 1V10A 3MJ7B 3BKJH 3T0WA 2LGNA 3DHMA 4H4NA 5I1GH 1PZ3A 1JPEA 1IKOP 1I1FA 3N9GL 4RFOL 4PUBH 1BFOA 3KL5A 4FQQA 1EGJL 3U83A 4BEIA 3ELAT 1KFAH 2ZWZA 3EO0B 4XO5A 1OAZL 2X4PB 2FHBA 1XTMA 3GHEL 4A1RA 4YX2L 3SDAA 1WJ3A 3L4ZA 4TSBL 1J86A 4URKA 3MNDA 3MUGB 1DLFL 2CK2A 4U1HB 4GUCA 3N9GH 1NDGA 3BMVA 2X53A 3EOAB 4RFOH 1EGJH 1NDMA 1CB4A 3QFDB 4U7MA 5BJTB 3CN2A 3NIDF 4PREB 2BHUA 4LVEA 1OAZH 4C56A 3GHEH 3MNZA 3I9PA 3V6ZA 2BFVL 4GKZA 4KY2A 5FXCH 2L0DA 4EIUA 3NQKA 5EO9A 5EZLB 3QO1A 1QW9A 4GQ9L 4O5LL 4GIOA 3K8MA 4WI6A 1DLFH 4N68A 1ZVNA 3UMTA 4UT9L 4OV5A 5ACZA 5AG9A 4TSCL 4JG1L 2XKNA 2EYTB 1XF4B 4LK4A 4Z78B 4LSSL 3IPBA 3QIWD 3OLIA 3FF7A 4RZCB 5AL0A 1LK3L 3NJHA 4MS8D 1C5BL 3OX8A 4JN2B 1DQML 4N1EA 4GQ9H 4O5LH 2P3YA 5E94B 4RDQF 3MX0B 1NICA 3RUGF 4UT9H 2DDQL 4WTZA 3BVWA 3JTBA 4TSCH 4JG1H 4PRPE 2MRYA 3A47A 2GTZA 3QZLA 4AXWB 3AY2A 2ZX7A 1LK3H 1FWXA 2VSDA 1C5BH 1DQMH 4EAEA 5AB1A 3EOBB 3SCMC 1EAJA 2HT2C 3BUYA 3CDZB 1AZZC 5IVNA 2DDQH 2HKAA 4MZIA 2WGXA 5ECGA 1SVCP 3E6FB 2NY4B 3PWVA 1WFOA 1SHMA 2APBA 1RUAH 3DXAE 4M8VA 1GOHA 5I5JA 3HE6C 1AIZA 4YE4L 3TZVD 1GIGL 4JDVA 2F7QA 1IVTA 4GO9A 3LTVA 4EBQL 5TK2A 2XJLA 4DEWA 3DXAA 3AG2B 4UMSA 3DHJA 3APNA 4JPVL 2ITCB 3DROB 1HZLA 1EFQA 5F8RC 4L8CA 4QCIB 5E6ID 15C8L 1JVKA 1NEZA 2QHRL 2D0GA 2EEXA 1QLRA 1OD7A 4YE4H 5BNXD 2O6EA 3RWDA 3W1ZA 1GIGH 4WV1A 1B4RA 5IM7A 4OJDH 3M1BA 3N0AA 1D9KD 2JB6B 4EBQH 3G08A 5IEKA 3QZBA 4AVJA 1UUSA 5CEYB 3QORA 4B9PA 4YFDB 2F19L 4JPVH 4L37B 3FBQA 4LSDA 2BP3A 4GAAA 3VUAA 2W65B 3D85B 4MQ7A 2ICEC 1SXNA 4O51A 4PLKD 4PAZA 3VFWA 4KMTL 1W0YT 3DRQB 4KK8D 5SV4A 4Y89A 3C6LB 4IRSD 1CL7H 4JZNB 3LRKA 4UM9A 4WTQA 1HI6A 4J3OG 3BESR 5JHDE 4AM0A 1OWWA 4XI5D 4WWKA 3IB4A 1FNAA 4QAMB 5I0YA 3WIIL 5KVFL 1FRGL 1QFWI 1E30A 4UB0L 4GEJA 4WI0B 5GGRA 3IM1A 4HWZB 5JHDA 2I07A 2CJUL 4KMTH 3RILA 1ZWIA 3PJNA 2FSEA 1EANA 1OWRM 1CICB 1LMKA 4KK5D 3L4VA 4L3CA 4JQVC 3RVTD 2WMPB 5KYNA 5HHVH 1NCCL 3WNIA 5AVRB 5KVFH 1W72L 1A7QL 4IEFB 3WIIH 3STZA 4UB0H 5I0XA 4I5BB 1ZE3H 3O9WD 1KJ2L 2DW5A 3LKQB 3ARDC 4FFTA 4B0MB 3TWCL 4L3FA 5EN2B 3IJSB 1KCVL 1XGRA 1MHCA 1GYUA 2EDHA 2QVMA 1SQMA 4PJ8C 4Q9QH 4U2ZA 4DUWA 1NCCH 2H6UA 3DTXA 1W72H 2XN9D 5D6CA 2C9UA 1WZ1L 3L81A 4M62H 1KJ2H 5DD5L 1XGQB 1DYZA 5DUJA 1KCVH 5HGDB 2IWGA 5CGYD 3VACA 3VD7A 5BVPL 4RGNB 3S4SG 2EEDA 1QLEL 4WHTA 2C4FT 4QXTA 5HGHA 1L0QA 3L4WA 4Y5YC 1PZUB 1HH6A 4AQ1B 3MGOB 1WZ1H 2K3TA 3GXTA 4NIYE 1JV5B 1KEML 3KM2A 5HDBB 3TF4A 3HG4A 4UNTA 5DD5H 4NKDB 1FSKB 2BZDA 2VE6A 1QFWM 2EXWC 5KJRL 5DS2A 2AMGA 4G1EB 5FOBB 4NYLA 3IFOA 3NK3A 1JZDC 5EA0L 5BVPH 4NUMA 1JFHA 5C0NC 4M7LL 5HHME 3SY6A 2B15A 2EE2A 1MAKA 5FYJH 3MRQB 1G5GA 1Z3GL 4QKXB 2NY6B 3JVGC 1D6EB 1KEMH 3V0AC 4Z7QF 4CILA 2EDMA 2GBAA 3CDGA 5KYYA 3T09A 4TUUA 1WDAA 3WY4A 5KJRH 2WSPA 2XVKA 5EA0H 1KIRA 2ENQA 4Y8DC 4M7LH 1A9EB 4NX0A 4ZS7L 4PGEA 1ED3A 3CFMA 3PABB 5IEHB 4JRLA 1ACCA 1BVZA 1PEZA 1Z3GH 2WINB 3S5LB 2CO7A 3VH8B 2PNDA 4HIPA 3TBSA 1QNIA 5E5MA 1NEPA 2H3NA 1BHGA 4Y5XB 1IFGA 4TPRL 4ZS7H 4R90H 1UM5L 1I3GL 4B9CA 3MV8B 3FQ4A 4ZW3A 2J73A 5JIDA 4TLTA 1GXEA 1S9WA 3VA6A 3FQXB 4J8QA 4JFED 4EUPG 3PREA 3F6IA 3SKOA 3ZE1E 4HGKC 4NDMA 4NCC1 3ULUF 4XCNA 5E1QA 3GMMA 3GD1C 5J7CC 3U4BL 4PS4H 3IJ7A 3N1PC 5C9JA 2VW6A 3OKEA 4TPRH 1UM5H 1I3GH 5AVWB 4FXKA 1A7BA 1F86A 3MTXA 3QEQE 1R5VB 4AZ8B 3ZT5A 1UXWB 2HT3C 3DX4A 5I1JL 5AW2B 1KXQE 3DK2A 4WJ5A 5CKAA 1HEZA 3EYFA 4Z7NE 3QEQA 3MCKA 4JZJC 1KXVA 5MEQA 1ONQB 1S7UA 4WSJA 3U4BH 3V5HB 1KXQA 5KVDE 5E7BA 4J39A 3MMEA 1DCLA 3DX6A 3MOAL 4L3AA 1GOFA 2FT8A 1SPDA 2BJML 3N1QC 3LIZA 4BUGA 4N2CA 3OF6A 3HEIB 4TQIA 1TNNA 2WAHA 3FB5B 3RDTC 5IIEA 4K8RC 1WA2X 1H5BB 5CLYA 2DH2A 4JG0L 3OKDA 3MOAH 4PR5A 4WI8A 3RX7A 2BJMH 3SPVA 3UJJH 1CDUA 4LHJB 1MH5B 2GBTA 3WNKA 4KKNA 3QUXD 2VRQA 2IC2A 3QG7L 1I3VA 1R3IL 4JG0H 3Q8EA 4J4PD 1TR7A 1YNTF 5CIPH 1CE6A 4P46D 5FEBA 3KGTA 3D6GA 3K2UH 4XBPB 1RZGB 5DSCB 4QJ3B 5DEJA 5MHSE 3K2IA 3N06B 2X4UB 5D7LB 5EU5B 3BIBX 2VXVH 3VVWA 4AQAA 4R83A 4X6BB 2FNBA 3FU6A 1K5NA 3Q8CA 1R3IH 1NAML 4KKAC 1NCDL 1XD0A 4JFYA 5ESVA 3ZDYF 1IQDB 2CK0L 1S7RA 5HYQB 4JM2C 1H3XA 3GDCA 4F7CA 4YLCA 2KT6A 4HUWA 1M7IB 1N7ML 5IB2A 3IBEA 2D3LA 1N59A 2DKSA 2BSDA 2W07B 5BO1L 4H8WL 4IM8A 1I8IA 1NAMH 2PW2B 3IGUA 4K2UL 1Z6JT 5F7HA 3MRBB 4GRLC 1E90A 3BP4A 4I2XE 3LQAL 4QJ4B 1AR2A 2XT1B 2G75A 1G4RA 2X4SA 1Q94B 2OMZB 3BGMA 1YAIA 5F9DC 4N4YB 4N8PA 4S2SA 1KYOJ 1IM9A 1N7MH 2VW7A 1F11B 4ZPVA 2P5WD 4I2XA 1AGBB 3BUDA 3QXAA 4UNUA 5BO1H 4H8WH 2E7CA 4OZFA 2VLJE 4PGCB 1A2YA 2QGCA 5DO2D 4HISA 3ZYIA 2JI2A 4LQFL 3SPGA 3EYQD 4N22A 3LQAH 2VN4A 1X6LA 1QA9A 3NSCA 4NQEE 2VLJA 2XYBA 4CVXA 1AO7E 1A6TB 4KKQA 1EEUA 3GJFB 3U46A 4E42B 7PAZA 3FYIB 1GZHA 1KCSL 3KWWB 3J07A 4KZCA 2X09A 3SD5A 5J6HB 5KSAC 1O7SA 4NQEA 3VDAA 3U1SL 1AO7A 5DJ0A 5EU4B 2WXMA 3LKRA 4OFPA 2ARJB 3APDA 4LQFH 4PJAB 4FAAB 5FO7A 1DSWA 3CE1A 4LVNB 1OP3K 3ZL4L 4YHNA 2J12B 4LU5L 4GFXA 5JZ7D 2BSTB 4X7CC 3DV6A 4GP4B 4P57A 1DJHA 1Z9LA 2VR8A 2Z93B 4HH9A 1THCA 2COVD 1KCSH 3UERA 4FERA 5L88L 3NQIA 1J0KA 3WJJC 2IOOA 2MCPL 4CBPA 1EUUA 3S35H 5IKCB 4XXDA 4WDIA 3ULVC 2NUPB 1WWWX 1FBIL 3ZL4H 5LHDA 5CGMA 2OLDA 3E8VA 1PLAA 2NY3B 3CVIL 1X7SA 4GXUM 1AXSA 5DS8B 4M9OA 3WFDL 2NW2B 2PTTB 2F53D 2VIRB 3U6RB 3PQYB 1OAJA 4NQSA 4QO1B 3FKUS 3O6FD 4BQ9A 2G4GA 5HI3D 2K9FB 3VFPB 1A47A 1TQTA 3QUYD 3CVIH 5IJKC 3OC8A 4MD5A 3KPMA 1MLCB 3VRIB 2G2RB 3HAEG 5HXMA 2XG5A 5J8OA 4QWWD 3FRPB 3NA9L 4LPWA 3L6FB 4EZLA 4OJYA 1VGEH 1CIDA 4YZWA 4PJ7B 3ZDXE 1BW8A 2V2TA 5CD3B 2J5LC 4LQ1A 3NJIA 1XCQB 3KBPA 2XNAB 2WBXA 3CU1A 1HL8A 5E2TL 3EW3B 5GQBA 2XPGA 5IB5B 5TH2B 2LE9A 3ZQ9A 1AG0A 4AGQA 1Z9MA 5B39B 3PHOA 1ANUA 4EDXA 3NA9H 3VI3E 4N9GA 3BWUF 3UZQA 4PJIF 1ZHKA 1RZIA 2GI0A 1MCKA 2R1YB 3D2UB 4RAUA 3GSXB 2J71A 4FTVA 2UUDK 2K45A 2P7TA 2R0LL 4FQXC 5B8CB 2K6YA 1MELA 2VM4A 1H3WM 3VI3A 4P2QD 3ROOB 4P4KD 4Z77A 5L2JA 5E2TH 2OV0A 4R5TA 3TH3T 2DBLL 1PLBA 1UD2A 2Y7QB 5T3ZH 2OL3L 4BV1A 1E9PA 1JGDB 2RTTA 3LS4H 3LN4B 4JQIL 3UACA 4A7QA 3BPNC 3NVQA 5KAQG 2MCMA 3V55A 1TZHA 2R0LH 3LZPA 5I1EL 1BXVA 1JPTL 2WSDA 5F3FA 5T3XL 3KNBA 3FU7B 2ED7A 2Z0BA 5K39B 2W88A 2BNQD 1PY4A 3ARBB 1NCTA 2DBLH 4KKLD 2YRZA 2OL3H 1JOIA 1VFAB 5AKRA 3M17B 2X1WL 3GLEA 2IGFL 3H42L 1NOLA 1XHHA 3TN0D 4JQIH 3AABA 5HHOA 2EC9T 3HS9A 5D4JA 3ULUL 4HUCA 3AWFA 5I1EH 2UY7A 5T3XH 1JPTH 4MYWB 3QJFB 2LOEA 5ERWB 2I9TB 3T6QC 2VSKB 1QWHA 3RBGA 4B27A 2DIEA 2HVJB 1AI1L 4XMLL 3VG9B 1JGEA 3TWYA 4G70B 3P4MB 2CIIB 2H2SC 4U33A 4R7XA 2IGFH 3H42H 4OGAD 2WYZA 1H0DA 2W0FA 5MP6L 4YDJB 3GMQB 3UAJD 1N0XL 2J6EA 3ULUH 5LQBL 2Q7AA 1T6VN 1GOGA 2FLMA 1WWBX 3G5YB 2KBGA 3BZFB 3M1CA 1DQKA 3BUIA 4AENB 1AI1H 4XMLH 1TQSA 2E9IA 3MFFB 5DQ9B 5HHQA 5MP6H 4ZW8A 1N0XH 2A9CA 2XJKA 2X2HA 4LCCB 3F5WB 4NZFA 4W68A 1ZSHA 4E9VA 5LQBH 4L3ED 4AYSA 2F0CA 1GGCL 4D3CH 1IJNA 3H3BC 4H0IA 4DPBX 2X6CA 2DLFL 4S0HA 2V0AA 4Q7DA 1NLBH 5J1TC 1HWHB 5BQ7A 3SDCA 4OD1L 4X9HA 4N3TA 1M7XA 5DR5H 5DZPA 3BZEB 1WAEA 3GJFK 4W9IC 5D7SH 1NLDL 1GW0A 1LEGB 4FYSA 3HE7C 3I02A 2BSCA 2QQNL 2O6PA 4PPTA 3LKPB 3WUWG 1YPZE 2X6AA 5F88A 1TDQA 4LNRA 4P99A 5LN4A 2VR5A 1H8SA 1L7TL 2BHFA 2IQAB 4GH7B 5DDHB 3RZWA 1DBJL 2IBGA 4PRAB 4DO5A 4N0CC 1I9RL 4RWYL 3KMDA 1D5RA 1OCZB 1YPZA 5LBSH 1NGYA 5AW8B 3TBYB 1NLDH 2CNZA 4YDNA 5C92A 3NCYS 2AJVL 2PN5A 3FB7A 3C8HA 5F6IB 4E0RB 1GKOA 5SWZB 4XX5A 2QQNH 4ZOAA 2G3NA 2FJSA 2ZE0A 4ZYKB 4JY4A 3CFJB 3W0WE 1QBLL 1YEKL 5FA3A 1L7TH 2YAEA 3CXHJ 3ZOAA 1DBJH 1JV2A 1QSZA 4RWYH 5HJ3B 1I9RH 2ZKHL 5JDSB 5E95B 1RUKL 2P26A 3W0WA 4AQEB 4N9OB 5DK0A 4XBEL 4PBVC 1HSAA 2NMSA 1JPGB 1TU2A 1BM3L 2ATKA 2VN3A 5B38A 1JBJA 3RWJA 2IAND 1F4YH 3DECA 5A2JH 1S7QB 4M5TA 1GC1C 1HL4A 3FONB 3X3GH 4Z7OE 2QVFB 4NB7A 2D31B 3SPJA 2OTWB 3EH1A 1MIEL 1QBLH 1YEKH 2GY5A 2KC0A 4XN2A 5D5MF 3RNKB 1K6QL 2ZKHH 1YAZA 4EOWL 1EHAA 1RV6X 3LAFA 5FWQA 4XBEH 3MJWA 1BM3H 2C8NA 3EBHA 4FMKA 4DVRL 1KJMB 2AK4D 1UM6H 4I0KA 2BY3A 4OKVA 3V5KB 1RZKL 3CPLB 4MWFB 3D8MA 1JI1A 3NBNA 3V6FB 2EVFA 2VITB 1LTXA 1JNHB 2CJTA 3QQ3B 5HDRA 2X40A 2RFXA 5EUOE 1W16A 2G3ZA 5IHHA 1K6QH 3PDOB 2FX7L 1SXSA 1UJ3A 4NJ9L 4QRPB 1YDPA 1UH3A 1BWWA 4XOAA 5DQJA 1HQ4B 2TSBA 4DVRH 3P9WB 2Z7ZA 4G7SB 4XCYA 2ZT9C 5EUOA 1MY7A 2H0EA 4PJ9C 4HBQA 3GO1H 2EDQA 3CSFA 3EJPA 2JK5A 1RZKH 3V0WL 1AP2B 1SJEA 2PP8A 3HNSL 3WHXB 3KLHD 1E4JA 3DGDA 2EZ0D 3FT3A 4MQTB 3OHXB 3NABL 2NNFA 3T3MF 4J5VA 3FU0A 2FX7H 4NJ9H 3FFDB 4KTEL 2CHXA 4XOCA 1VFMA 2QR0A 1OTTD 4P23A 1XDTT 4A2LA 4ZQTA 1OIOA 1VJSA 2IBZX 1UH4A 5ABAA 3IDIB 5KVMC 3ILPA 5JIQA 3V0WH 4DKFL 1KTJA 1HX0A 4QTHB 5J3HD 4ZD3H 5I6NA 3OR7A 1J8HB 3QZNA 3NABH 4JDEA 4PCYA 1UZ6E 5I16B 5D9SB 4KTEH 1RJLA 4OR1A 2F58L 2Y5EA 2YAFA 3DVFA 4I7ZC 3BISA 3UTOA 5I1HL 2F8XC 1R24A 1DHKA 4WENB 3FPYA 1P2CA 2VLLB 4QY8B 5HP5A 3SE8H 2B4CL 1LWRA 2WWOA 2BY1A 4P5MA 2AJZB 4NKIL 2Y07L 3WNJA 3QDME 2PKDA 4KDTA 4MAYA 2E9GA 4PD4K 5EBGA 3CLFH 5KS9E 4PJDB 3QBTB 1G9EA 2F58H 1X5XA 4JVPA 3ARED 4MCZA 1AZUA 1A65A 5TDPA 5TF1L 5FDWA 2YKKA 4H1LB 2P8LB 4GO6B 5KS9A 3MRHA 4A2EA 2Y4SA 4Q74A 5LJYH 4JHAH 4WI5A 4YSRA 2XWXA 2B4CH 4A7UA 3K71B 4TNVF 5I6LA 1H8NA 4XGZA 4NKIH 5EBMB 2IH1B 1GCFA 5FLVA 3QI9A 2NY0D 4I1NB 2NUTB 2OX5B 4LFHD 4X6DB 5E4IA 3LMJH 5F6HJ 2P45B 3HC4H 3KPSE 2UXFA 2BH0A 4PW3A 5IFAL 1UTDA 1K2DB 4JFPA 5TF1H 3AXLA 4OFIA 4XNUL 5FF6A 1HL9A 1IC1A 5FYLH 5KSUA 2KL6A 4S1RL 3KPSA 1FL3B 2AQ3A 3T2PA 2WWKT 2V33A 2YD7A 3B6SB 4GQPH 2WCPA 4HHGA 1JWSB 1I1AB 4EI5C 2EP6A 3K1DA 2IG2L 4GXUN 4I8DA 3V10A 1BD2D 5FYJU 5IFAH 2HTLD 3INOA 1FNHA 2DWEB 3TYFB 1KGWA 4XNUH 1OK8A 1OB1A 2J2ZA 1AZBA 2ALWA 1J5DA 3B9VA 2DIJA 4S1RH 4ZS6D 5MI0C 3DPDA 4MRCA 4EF3A 4H26A 5T1MB 3QIBD 5BUGA 1HHKB 4R5XA 3T1WA 2IG2H 4KBPA 3VWJC 2DLHA 3VFVB 4NHUB 1ET7A 2OFQA 5CO1A 3H0TB 1N5AA 4QKTA 4M1CC 4MDJA 4U4BA 1FHNA 4NXSA 4UV7L 4U6HB 3UBXA 1GZPB 4FNRA 1NFIA 4JPWL 5AVYB 3EFOB 4HCIA 4BZ1L 1ASPA 1W91A 3NACL 3QUZA 2C9XA 5GSVA 3T8MA 5DD6A 1EQWA 5IHBA 4PY8J 3QO0B 4TNFA 5DEFA 1BQLL 1RHHB 2EDTA 3ABLB 1CFTA 1KGXA 3CLWA 3T0ED 3DI2B 4TQHA 1Z9NA 3AJ7A 2HRPL 3JTSB 4XNQA 3CN3A 1VRSA 3KYKL 1GGUA 3LD8C 1A4CA 4BZ1H 3A4AA 3W9EA 4N2NA 4CMMB 3NPSC 3GZPA 5ACMA 2R9HC 2IPKA 3EGSB 2BPBA 4U3XA 1V8HA 5FUOL 2FT6A 4I85A 1AR1C 4JO2L 2EXYC 3X11B 2W60B 3QULA 1BQLH 1TJIL 2KI6A 5KYWB 2BMKA 4KZDL 3RVUC 1OAXL 2HRPH 3KYKH 3L13A 5IBLD 2NSQA 5HI4C 2J88L 2OK0L 4A6YL 4HETA 5I26A 1YMHA 4MMZC 5FUOH 4ZMZA 5CBAB 1GJWA 2WQ8A 4JMNA 5CINL 3WHE0 3CFQA 2B77A 1DQTA 3C60D 2H1LM 4KZDH 1OAXH 1WFJA 2E47A 5I5MA 5IV2B 1ZD6A 3PRZA 1A4AA 1X4ZA 1EFXA 2J88H 3VM5A 2OK0H 2CDGB 4A6YH 1FYTE 3EJRA 6FABL 4MQXC 1JXFA 1MDTA 3PL6D 1LO4L 2IQ9L 4LHUA 3UTTB 4HS6A 5CINH 1EUTA 1PX3A 2XN2A 3L4XA 3BKCL 1FYTA 2N4IA 1ZT7A 2DTML 2PO6A 4S0TD 5EC1B 3DPBA 1A7OL 3KYMB 2ESVE 4BFNA 3QDGD 2NW3A 4W9LC 3I3BA 2WW8A 5BZDA 4PBDA 3RLSA 1CFNA 4F57L 4G42A 6FABH 3OC5A 2BSEA 3D39B 1LO4H 2IQ9H 3NCCB 4R7DA 3MV7E 1MRCL 2QL1A 2X87A 3S98A 2Z31C 1P5UA 4KK6D 3BKCH 1R5IB 3EJTA 2DTMH 3ZDWA 1AGFB 1A7OH 3D1MC 4XCCH 3MV7A 2VKXA 3L3OB 4NT6B 3ESVF 3LDBB 4F57H 1W8EA 1ULVA 3K6OA 4WTZG 3AROA 2A6IA 1HQRA 5MENE 2BP5M 4PP2A 5GGQL 1MRCH 3WKMH 1LL1A 1BAWA 1EEYB 2I5YH 2Q0ZX 3KWXA 4WNQA 5DEGB 4YPJA 3UBXI 3VD4A 3LV3B 3B37A 3VI4E 1DE4B 5MENA 3HJEA 1AVAA 2V8LA 4FX5A 3EFFA 4M8QB 3VI4A 2WQWA 2D4FA 2F54D 3NESA 3PLYA 5B3JF 2QQKH 1WP6A 4A7TA 5GGQH 4LCVA 2G5RA 5C7ZA 3HZKA 4MGXA 3RI5K 1LP9F 3AAZB 1AZCA 5DRWA 5CCKH 1OAYL 4M93B 3OLEA 2DLIA 4AL8C 4DN4H 4CJ1A 3ULSB 1QRNB 4PJGE 1MW3A 5BUAA 2V17H 4E41E 1U2HA 3MRJA 5KYXA 2ILLA 1NEZG 1PEWA 5I17A 1ZXQA 4PJGA 1HOEA 3B1TA 1MHHB 1QNZL 5IHWA 4HLZG 2OSYA 2JXMB 2C1OA 1EZSA 5DUML 3ZMNA 3D0VB 4E41A 4F2EA 3L4YA 1OAYH 2GBVA 1CDBA 2ADGA 4HS3A 1NJ9B 4PMFA 1EV2E 2RD0A 1BZQK 5DHVA 4N2GA 3MSPA 1RP9A 1YMMD 2I7OA 3AQZA 3T08A 3QDAA 1B6UA 3BXNA 1JHKL 2XLLA 4HWBA 4FTVD 1NUFA 3QZMA 3SQBA 4RMRA 2ITDA 3MUUA 5D4HA 1QNZH 2K78A 4JCWA 2GIXA 8CGTA 1OOAA 2CMRH 5DUMH 2F5BL 4JJ5A 4F8TA 5EBWB 4CSSA 1IC7L 3DBSA 3MYJA 4HIXH 5AW4B 1X9LA 5F6HI 4B96A 1RMFL 3MU3A 1RK1A 1TLKA 1JHKH 2OSLA 2KKQA 3BVNA 1QUPA 3O6KL 4ELKA 2IMMA 4PTUA 1OSZA 2J8UB 5E9AA 2B59A 4JAMB 4HT1L 3LVTA 4N2BA 4JKPL 5FGBA 2EVHA 2F5BH 5C0CD 5EWIH 1K85A 1IC7H 4E9YA 1WYJA 1CLCA 4NKQB 1F8TH 1N8ZA 3DVGA 1W6WA 1RMFH 3GM8A 5HHOD 4MNHA 2XV2A 4TLSA 4XMPL 1A1NA 1C7TA 3VXRD 3T2LA 3FQTB 4WEUD 2D2CC 1KXTB 1CFSB 4HT1H 4QRFA 2CJ3A 4MLIA 2YC1B 4OLEA 4HKZA 2NXZD 2HB0A 1JYVA 1L3WA 2XTJB 1Q90A 3A6OA 4FABL 4P2OC 2GBUA 2FEDC 4YDIL 3H8NA 3MAWA 1IE5A 3BRGC 1XGPA 2QSQA 1MHPL 4PRHB 5DJ8B 4A68A 4YHPB 3SJVB 4KNQA 3MJ8B 4OI8A 1BM7A 3HOGA 4QXVA 5F21B 5DMIL 4AIXA 4XNYL 5KTEL 3NRPA 4H40A 3I75A 3V4UL 1U30A 4PY8I 4MJHA 4U6XB 3RTQB 4OD3L 4B41A 3K6NA 3MUHL 5ES4B 1PZAA 1TPXC 4Y5VA 1E50A 3ILEA 3MOBL 4WJG3 4YDIH 3SBWC 1MHPH 5T3ZD 3LKNB 3GYRA 4BK5C 3TCXA 3GIVB 1KTDB 4QHPA 4KJQD 2EDWA 5K59E 3O3BA 5EOQL 4HQQH 5DMIH 1XWVA 4C8XA 4Z3EA 5KTEH 2YXWA 5D1ZC 3L9BA 4WU5A 5AYUL 3NFPA 5JQHC 4PFEA 3V4UH 2JKNA 2NQ3A 3ZHFA 5CBEA 4P4RB 5AW1B 1SDAB 4OD3H 2XETA 3FMGL 3L5XL 3MOBH 4AGLA 4NFBA 3MRCA 1E42A 4Z7UB 3PHQA 2C9AA 2E7HA 4M4RB 2AXGA 4L1LA 1I4FB 1FNEB 2QKSA 1WG3A 4JE4B 3EGDB 1T5XB 5EOQH 4UU9B 1NAKL 1PDKA 5T1LB 5AYUH 5INCA 3RFZA 1N2RB 2FZ3B 4M7JL 5TJWK 3WFBL 2BM3A 1I7RB 5T3XD 4OZGE 3A67H 3FMGH 4QHKJ 4W9FC 3L5XH 4R2GC 1FO0B 2J57A 1BQHA 2OMVA 2FR4B 3GSWA 1KCLA 1ZMYA 4ETQA 3EBAA 3B83A 2XY1A 4OZGA 4NQDE 5LGJB 3ZHKA 5E51A 4OQ1A 4NAMA 2I24N 2OYMA 1NAKH 3QIUA 3ULUD 2PTVA 3FFCE 3WFBH 4M7JH 4V1DD 2HJLA 4NQDA 3M8OL 3E0GA 2R7EA 4Y2DB 3RVVC 5J4MA 2CU9A 3NIGE 3OAYH 3UTZA 2GAZB 3FFCA 5EF3A 1EJOL 3L1OL 3LNGA 1DQQB 2UXTA 3PGDA 4XP1L 3RKDC 2ATAA 1J5IA 3II1A 1A5FL 5TE6L 1GKEA 5D1XD 3F7QA 3B4NA 5IBUB 3RAJL 2A83B 2N7BA 2W0KA 2B1AL 3M8OH 3VM7A 4P2RD 4L1HA 1XF2A 1DL7L 1T1XA 1S3RA 1M4KA 3EF7A 1YNLL 4A7GA 1OP9A 3F8UB 1OGPA 4Q2ZB 5LO7A 2E6QA 1BJ1H 1EJOH 3L1OH 5CSZA 1KG0B 2N1KA 4XP1H 2CCWA 4H8HA 3RYMA 2D9CA 1BV8A 1A5FH 1CGVA 3RAJH 5AKSA 4ZW5A 3FQ1A 3QARA 5TDOB 2HLFD 3ZBMA 2B1AH 3MJ7A 3UX9B 3VG0H 5AB2A 1CQYA 2V2WB 4CSPA 2B08A 3QAZB 1ZXKA 2EDFA 2Z35B 3WKPA 3O8XB 3DMMB 1LQBC 1MSPA 4H0HB 5HJGA 3EO0A 1AHWC 2BIQA 4PG2A 3ARQA 2X4PA 3KCWA 3IDNB 1OCCB 3MBEB 4W4OA 2IAMC 1BF5A 2Q86B 1JF5A 2VTFA 1I85A 3MUGA 4I3SL 4U1HA 5BV7H 2X12A 3EOAA 4KROB 5DURD 3QFDA 3C8KB 5BJTA 3T2OA 5C6PB 1TJGL 1U8JB 4R6UA 4PREA 4Q6KA 1UB6B 4XPTL 4DO6A 1MFEL 1SMOA 1JTTA 3LVEA 4PWFA 4KX8A 5EZLA 3K4DA 4P5TD 5HYFA 1NPUA 2IDUA 4HWEL 4ENED 1XXDC 4I3SH 2O5XH 1FV1B 3T04D 1MCIA 1K3ZA 3N91A 3OSKA 3SDDC 1CIUA 2HRLA 1TJGH 2EYTA 1XF4A 3MACL 4Z78A 4RZCA 2VN5A 3QPKA 4XPTH 2ZKWA 3BMWA 4BGDA 1MFEH 5ID1B 3NJLA 2QHLA 4HPYL 4JN2A 4HWEH 1R1CA 5E94A 3SY0B 1GYAA 3MX0A 4MS8C 2WTOA 5EZJB 3PU7A 4UYQA 5F1OB 1YZZA 4AXWA 4ZO9A 1EHLL 4NZ8A 2WNKA 3MLSH 3WYRA 4HPYH 2VZ1A 3HZVB 4BFGA 3SZKC 3TNMB 3EOBA 3GLZA 1USQA 3QWRD 3IEAA 3BT0A 4DPRA 3CDZA 4TLKA 2VMJA 5LKNA 1XEDA 2HUEA 1G9MC 3E6FA 4R5VA 3LEXB 2DKMA 3TEZA 1UGKA 3BP6B 1EHLH 4OZFG 3WEMA 3OKOB 2FWOB 3NSDA 5T5FL 4ZK8A 5E1IA 4IYKA 4JR9L 1ODUA 3R0NA 2CHDA 1JF6A 3POCA 5J12B 5DA0B 2RQEA 2VDNL 1PSKH 2ITCA 3DROA 3U2IA 1BDYA 3TZVC 4OZIF 1H3VA 4QCIA 2F8VA 4YHKL 2AJXH 4PJ5B 4Y19E 4HSCX 1TNMA 3WAKA 4LPTA 2LR4A 2WWKO 2H32B 4Z23A 1MCHA 5B7EA 2NY1C 2CHNA 3CFUA 1L9SA 4JR9H 2JB6A 1AYOA 2G4EA 3VD0A 4U2YA 5E6IC 1R4XA 2NCMA 2VDNH 5CEYA 1WQVT 4L37A 4OLXL 5KEZA 2ZUWA 4YHKH 2W65A 3HRZB 3OKMB 3D85A 3VXSB 4KKZA 3SSGA 3MNWB 3DSNB 4HXAL 1HAUA 1HKLL 3DRQA 3HW7A 1I75A 3C6LA 4WW2C 3TH4T 4JZNA 5GGRY 2V5YA 3ESNA 5EPMB 3T2NL 1A6AB 4KO5A 4F3FB 1SXAA 3P11L 2ARJQ 1J5OH 3N40P 3U48A 4DP7X 2XKSA 2M83A 4PLKC 4OLXH 1MN4A 1T83A 4KK8C 1WLHA 4IRSC 4WI0A 4HWZA 2YJLA 4G83A 1D7CA 1HKLH 2HRHA 3ARGB 1EERB 2PPCA 3KL3A 4MDIB 5A16B 2XXCB 3FSVA 1F4WL 3FXIC 4ABWA 3F84A 3ESUF 3T2NH 1SVBA 1CICA 5GS0L 3FOLB 3QVAA 2WMPA 3IGFA 2N7AA 2NR6A 2XFGB 3P11H 4QRBA 2ICWI 1ZLSL 1HIML 4OB5L 5FYLD 2L7JA 1WPCA 2CXKA 4IEFA 4I5BA 4L1DA 3RDJA 2ALAA 3W39B 1XL6A 3LKQA 4KK5C 5C97A 5F7FA 3CVDA 4MNGB 1Z2KA 4L4TD 4QHKI 5EN2A 3IJSA 4M29A 1F4WH 4EIZC 3PG2A 1CDCA 4PWEA 4XX1E 3ZZQA 4GW1B 1IEBB 4B9YA 3O9WC 1ZLSH 1HIMH 4Z7WF 4OB5H 1NCNA 4PW9A 1EAOA 1G7PB 4CBZA 5T5FA 2GSGB 1HJCA 5CM1A 3DKHA 2FQGA 4RGNE 5IVXB 3BPCB 4XO4A 1XGQA 5HGDA 2YPLB 2E4TA 4ELMB 1DVSA 5TFSL 3RIKA 5HGAB 2I7SA 4JFVA 1THAA 4I4WB 5HDBE 4FXGB 5IFHL 4LHUD 4BH7B 1TQCC 2GT9B 5JR1L 3NTCL 3MGOA 2ITEA 2BS9A 3TEUA 1L0XA 2C1PB 5BZWB 1JV5A 1CDGA 1XO8A 5CGYC 3RHWF 3VRJB 2PO6D 4NKDA 4H5SB 3PDDA 2FEEL 3C12A 5FOBA 4G1EA 2ODHA 2GUOB 4LLYB 5TFSH 4L8SC 1WC7B 3ETBJ 1HL5A 1DFBL 5DQDH 5IFHH 2PXYB 2VLRD 2EH7L 4XVUD 3T6XA 3U0TB 5A6LA 3MRQA 3SDXB 2X6VA 3NTCH 1IU1A 1K8DB 3GINA 1PS3A 1D6EA 2WNXA 5DZ9A 1F41A 1TSRA 2A74B 3W56A 2L7QA 1OPGL 1N70A 4YIQB 3ZU8A 5J56B 2HFGL 2DWTA 2FJHB 2ZUQC 1A9EA 3KLSA 1DFBH 3VFOB 4NAQA 1IGYB 3PABA 2EH7H 4NO0B 5IEHA 2QPDB 2H1PL 5GRVL 2WINA 4WI2A 1ASOA 3S5LA 3CIQA 3VH8A 4PB0L 2BP0B 2NY2B 3R4DA 3MV8E 1OPGH 2HFGH 4Y5XA 4CGUB 1CLYL 3APCA 3L3DB 2PWHA 5I75B 3MV8A 3CG8A 2H1PH 3CZSA 2D73A 3FQXA 4N2AA 4PB0H 2EYSB 1NBVL 3D9AL 4XP4L 1RQ5A 5BS0D 3A23A 1LDPL 1U93B 2F1AA 3E3QE 3U6XA 2BIMA 2EXSA 4GMSL 4LPCA 4KO7A 2WOYA 2NDFA 3ZKMD 5D2NE 4M61B 4X4KA 5FO8B 3HLAB 4OIAA 4RDBA 1R5VA 3HI6L 4AZ8A 3W9DB 4R0LB 1UXWA 2BC4B 1FE8L 1MCQA 1PFCA 1QYGL 2OZ4A 5EOCJ 3D9AH 1G7HB 2ZKMX 3IGKA 1LDPH 3ATAA 4GEIA 4K94C 2DD8L 4GMSH 4ZAKB 1ONQA 3V5HA 4MCYB 5I5RA 4YHZL 3ECWA 1I7UB 4OM1L 5IB4B 4MA1C 4N2OA 1R17A 1SUJA 4IIQB 3B5TA 3HI6H 4GSRA 4RMUA 5B4MD 4XC1L 5HYJD 1E4HA 1FE8H 4LOFA 1QYGH 3TJHD 4RX4D 1M7DB 1YNKL 4R7NB 5E2UH 2UWEB 3IXTB 1XTLA 2D8KA 3IU4L 2ZWYA 2DD8H 3O2WL 3T1FB 3FB5A 4I18B 5KJ4A 4PJCF 4KKBD 1H5BA 4YHZH 1EJ6A 2R0WL 3W38A 4LDCA 3QJZA 3JWNC 4XC1H 4YLQT 4MMXB 4PYGA 4A04A 1GPOL 2E3VA 4RFNC 1YNKH 3DYOA 3DWTA 4OCSH 1MH5A 3IU4H 3O2WH 5KOVC 1JZ8A 5JW4R 1SMAA 1X6NA 3JT2A 1TTAA 1G4MA 4X4YB 5KVEE 3KVQA 4NOBA 1MJ7L 3VX0A 4H13C 3V0FA 5D7LE 5T1JA 4HYTB 5FWRA 4OGXL 2JJSC 5DSCA 4XBPA 1RZGA 1GPOH 1MI5B 2FIKB 2X9YA 5E2WL 3QUXC 2VR3A 5B38G 5BMFL 3GEFA 2AQTA 4ERSL 2X4UA 5D7LA 3JQOB 5EU5A 4J4PC 4B0MM 4HGWB 2NRDA 4X6BA 7PCYA 5ABZA 3TM6A 1MJ7H 3V4PL 2DTSA 2VR7A 5HYIA 2ZP9A 1ZHNA 1IQDA 1W6LA 4YN3A 4IGBC 2X1QA 4OGXH 5HYQA 4OFYA 4H44C 1U4EA 3F05A 1B4TA 3QDJD 5BMFH 2OP4H 2B14A 5A7BA 1MQ8A 2B5IC 1M7IA 4F37F 5JHAA 5EU6B 3AB0C 1X5ZA 2WYTA 2W07A 1U8QB 2CE6A 2PW2A 3PGCB 4ZTEA 3V4PH 3HS0B 3CDFA 2ITFA 2MQ3A 3WD5H 3ECBB 4NUGL 2ZXCA 3MRBA 2H8PB 3GMRB 4YSCA 3SHSA 4Z8FL 4Y16D 1T7XA 5H35B 1Q94A 2OMZA 3HRPA 4NCC2 4OZHB 5ENWB 4PJXB 3UAAA 5FYJE 4AK2A 4DUVA 1KTKE 4L1SA 1F11A 4TOYL 3KJ4C 1AGBA 4HV8B 2V5SA 2EILB 3K2MC 4PGCA 2QLYA 1KULA 5GIRB 4NUGH 1T21B 3S48A 4Z8FH 4F1ZA 3CFTA 1TQWA 3IBOA 4I87A 4JM2F 2H5UA 4ZO6A 1L0YA 2Z7UA 5FHBH 4ZXBB 1A6TA 3HB3B 3TO4D 4QGTA 3GJFA 4E42A 1ZTXL 1M6OB 5DO2C 3OMAB 1KNOB 2MSPA 2QQQA 3AM8C 4CKVX 3KWWA 1A14L 5J6HA 2E7LC 5SWQB 1SLUA 5EU4A 3WTWA 5D1QB 2JLPA 3BHBB 3EO1B 5DLLA 3C6EA 4UTBL 2ARJA 4PJAA 4ZFOB 1IO4C 5LXVA 4LL9A 4PV9B 3MGTB 2B7DT 2BIPA 3VB8A 1U8HB 2Z7WA 3BN9D 1WSST 2IH3B 2O6FA 2X1XR 3DC0A 1EZVX 2WTRB 2BSTA 1LVEA 3QIUD 4PD4J 2Z93A 4Z6AT 1ZTXH 2HA1A 2YXFA 3L4CA 4Y1TA 1A14H 4OF8A 4B9GA 1CD8A 1DVFB 1I9EA 1XZWA 3AG4B 3B8SA 5IKCA 1CLOL 4Y2OB 2NUPA 5H37H 4OVVA 3PQYE 1YY9D 2FHCA 1N68A 4Q9RH 5DS8A 4JQXC 3D05A 1WAPA 3TIDB 2WQVA 2NW2A 2ZUUA 2PTTA 3KYNB 4I77H 4LB8A 4W4NA 2YAQA 2VIRA 3SE9L 3U6RA 3PQYA 3RVWD 4QO1A 4X6FB 3RURA 1OD9A 2X2YA 1TTBA 3D2TA 4KH2A 4UT6A 2JNZA 4Y7OC 1MJUH 2WB1A 3SPCA 1UD4A 5HVGB 3VFPA 3BUTA 3FH8A 5MEPB 3DYPA 4TMPA 5C09B 1TQVA 3Q2WA 1L6ZA 3O6FC 3JYBA 5LNDA 4G59C 2X28A 3SE9H 4KKCD 2ADYA 1YLBB 1MLCA 3VRIA 4ZMPA 2G2RA 4PJ7E 4XNDA 3FRPA 4M43H 4AK1A 2XWEA 3L6FA 3CZGA 4ABQA 2GITB 3ULVF 4N2MA 5IROD 5F3BB 3LEVL 4GRWF 1AQ8A 4PJ7A 1E5UI 1J0YA 1UD3A 5CD3A 4FL4C 3K5SA 1KV3A 1XCQA 2NNAB 2XNAA 4HWUA 5I9QB 1WAAE 3FUJA 3QJQB 5TH2A 3V9EA 5IB5A 1PMYA 3WN5B 5B39A 3GJEB 1G1YA 2NYYD 4X6EB 4X42A 1WAAA 2XIIA 3D2UA 3LEVH 2R1YA 2VDMB 2YUXA 3P0VH 4Y9EA 3GSXA 4IBVA 2J6WA 3TLRA 5D7JB 5EIIB 2NPLX 1RP8A 3QB7C 5B8CA 4PP1D 1NIDA 3UBXG 3X12B 3LEYL 4UTBA 4BHUA 1A4BA 3ROOA 2VWEC 3VU2A 2A0LD 3FO1B 3SGEH 2Y7QA 1HILB 3MDJA 4J6IA 3GXFA 4IBTA 1JGDA 3LN4A 5E8PB 5E4EB 4AV5A 4GSDL 1MAML 1UA7A 3LEYH 3FU7A 2C3VB 3QNXA 5K39A 2ZAGA 1XQ4A 4TNEA 3ARBA 3LH8A 2GK0B 5GGVY 1VFAA 2LVEA 3M17A 3UYRL 2Z91B 3HCVA 5KZCB 4WWOA 1FIEA 3OZKA 4KI5F 2X42A 4GSDH 1MAMH 4HJIA 2I69A 2WHVA 4PIRF 3RIAF 3VYOA 1TYEB 2I9TA 3QJFA 3ATDA 4KKLC 5ERWA 2CPUA 1T7ZA 4AQ8A 2HVJA 3OHMB 5DRXB 5C0RL 3Q2CA 3QISA 3P4MA 2CIIA 4IBZA 5GJTL 3UYRH 4FQ2L 4WO4B 5G4OA 3X2QB 1DZBA 4MXQC 5AW3B 1F18A 1A7RL 3GMQA 4W9GC 4YDJA 5PCYA 2N56A 1DVXA 4Y9GA 3G5YA 4AYFB 5AEAA 3BZFA 3GFUA 4O02L 4OGAC 2SODB 4X4XB 4AENA 1AY1L 5JTWA 4M6NL 5C0RH 2EEBA 3UAJC 3T0BA 1NC2D 3MFFA 5DQ9A 1N3NB 1N8OE 4FQ2H 4LHUG 3TIEB 4LCCA 5E6UB 2VISB 3F5WA 3PAUA 2PCYA 1CXIA 2R1WB 1G43A 4Y4HD 4AITA 1N64L 1W9XA 2VJ8A 4HKJB 4O02H 1VZHA 2FATL 2X9XA 1AY1H 1CLZL 4M6NH 1L6PA 2JCCB 1BSIA 4NERA 4GUOA 1KCWA 3BJ91 1X5GA 2O5YL 3HE6B 3QPQD 4KXAA 3IJYB 3BZEA 3FTUA 5DJZB 2DQUL 1E3FA 3D85D 2KQMA 2FJUB 1N64H 2XZAH 4LP4A 3MOQA 2VL5B 1LEGA 3HA0A 2FATH 4X4ME 1YYML 1CLZH 3U36B 1MCFA 5E8NB 3LKPA 4OH2A 4QI3A 1W0WB 4RIRB 5EF2A 3NPZB 3CN0A 5I24A 1QW8A 2IQAA 4X4MA 5SWZE 5DDHA 5DMGD 1HINL 4PRAA 1IBBA 1OCOB 4APQB 2PYED 4BHUI 4PJBF 4MFHA 3TBYA 4OV6F 1O9VA 1P7QA 2W8CA 4QRRE 4E0RA 1IT9L 5F7LB 1YYMH 5SWZA 3A4DA 1QVOB 4FG4A 2MH4A 3ZR5A 2K6WA 4N2EA 4WWKC 4ZYKA 3CFJA 2ZSWB 1JHLL 2E7BA 5IBTL 4LCUB 2B1OA 4L8BB 5D7KE 3FDWA 1HINH 5HJ3A 2GB2A 3VXQB 3BC9A 1JI2A 4K8RH 1UEMA 4AQEA 2XN0A 3D7PA 1JPGA 4JEGB 1IT9H 1BXXA 3V4LA 1PW3A 1S7QA 2VXQA 3FONA 4CC0A 3TVMB 2D31A 2OTWA 1UC6A 4GBXB 3G6JF 4UQ3B 4YZFE 4FXTA 4F8NA 3G04B 4CAGA 4HCRL 3RNKA 1CFMA 3K91A 4WVRA 4LIQL 3T8VA 3E1F1 4XXWC 4UOW1 4BSJA 3S34L 2XFXB 3CWGA 3EUDA 4FFYL 1KJMA 2NXYC 2VZSA 3X17A 3SZ6A 1FZMB 4QRPE 3V5KA 3CPLA 3SDYL 3ZGIA 4MWFA 3DOIA 3V6FA 1OALA 2VITA 1JNHA 3QQ3A 2IJ0C 3GBEA 5ITBL 1ZCRA 4HCRH 5C08D 2QADD 3PDOA 3S96B 4LIQH 4QRPA 4GXVL 5E2VL 1HQ4A 1JK9B 2AQPA 2ZP0T 3SQOH 5FFLA 2JF1A 2D0HA 5E4AA 4UNVA 2CBQA 1E4WL 3I2CL 4HDIB 1TSHA 3SDYH 1AP2A 3GRWL 2AZAA 3WHXA 4AEFA 1TVHB 1M9WA 4EN3D 3TTSA 5SWSD 3OHXA 1UH2A 5ITBH 3EXJA 2NY6D 3O3EB 1YVLA 3FFDA 3L48A 5E2VH 5ELIA 3WFZA 3ETSA 1RJZB 1Y6MR 1ZDSA 1A7PL 3ZMEA 1J8HE 1WZLA 2A9NL 3KBFA 3IDIA 4Y5YB 4CN4A 2CM5A 3B9DA 1E4WH 3EJYD 3DDGA 3I2CH 4BFJA 4HW6A 3GRWH 4ODSL 4QTHA 1KPRB 1OTTC 1T89A 4GINA 1J8HA 1B0IA 3RY5A 4OQTA 4MKMA 5I16A 5D9SA 3CGTA 5GS0D 4F91B 5DC9B 3BP7B 2QVTA 1MKFA 2VMEA 1A7PH 2A9NH 1PQZB 4WUUB 5J3HC 5AQ0A 1HEHC 4QY8A 2VLLA 3I9GL 4J6RL 3VU1A 4PJDE 1OEZW 2CKBH 4G8EB 4LPVA 2AJZA 5F7BA 4FMVA 3ZE0B 3NGBC 1PAMA 1KIUB 1AOHA 2JELL 4X5LA 4DEUA 5DD3L 3SKUD 4B5EA 2GPZA 5A7EA 4PJDA 1QSED 1C8QA 2WKOF 2EE3A 1F1GA 3D25B 4FFZL 5A2IH 2OMNA 2CSPA 5JHLL 3IDJB 4H1LA 1OB0A 2P8LA 3VXMD 3I9GH 5L6YL 4X6DE 3ULVL 3K71A 3A6BL 3B7RL 5EBMA 2W9EL 2IH1A 4D0BB 3BDXA 4FFYA 1XZ0B 3AREC 3QG6B 5DD3H 2AJUL 2HXAA 4HC1L 1PX4A 1WGOA 2OX5A 2P5EB 3ARFD 4G8AC 4X6DA 2NUTA 1XGYL 4FFZH 4HIJB 4GAJL 1K2DA 1FVEB 5JHLH 3M07A 4KGJA 1FP5A 4FXKC 2ADJB 4I9XA 2VZOA 2Z6FA 4LKCB 3O0RL 4WY7L 2BVUA 5C0EB 5L6YH 5M7QA 3ULVH 4BCYA 3A6BH 1FL3A 2W9EH 1F1DA 1S7WB 2IPTL 3Q5TA 4FZEL 4GRWH 1OARL 3B6SA 4UTCA 5JA9A 1JWSA 2AJUH 1I1AA 4HC1H 2AP2A 1OLLA 2EH8H 1KXVC 4OJFL 5DVPA 4L0ZA 3UEQA 2HT4D 3IJ8A 1XGYH 4OCMC 4GAJH 5LWYL 2DWEA 3TYFA 1HXKA 2A4EA 4E5XB 1KENL 1B2WH 4JFOB 3O0RH 1FORL 5T5NG 1EHKB 2DQJL 3BGFC 1K8IB 2WLMA 4K71C 1L9NA 1BQHG 4DGIL 4KY1L 2IPTH 3F7RA 5T1MA 1OARH 4Y1AD 3AS2A 3CV5A 4JZJB 4TTDC 4OJFH 4UT7H 2A6KB 1DO5A 3N42F 2XRAL 5E56A 3VFVA 1VEMA 4YSPA 4GAGH 4NHUA 1DVQA 3CFEB 3H0TA 1KENH 2YS4A 1FORH 5F9AC 1JZFA 1XIWD 4U6HA 3FNKA 1GZPA 4DGIH 4DZBB 3C5JB 4JLRB 3EFOA 2GTWB 1NFDB 5EH1A 4MAUL 3RDTB 5BW7A 4HJSA 3S9DB 3QEHB 1PL3A 4NC1C 2XRAH 3QO0A 5CP3H 1SLWA 3E7JA 1RHHA 4KRPB 3MXVH 1SOKA 3TF7C 2VDKB 4HIEB 2FH6A 3JTSA 1SXZA 3WKNA 2MCAA 4Z7AA 5E7FA 2RCSL 4CMMA 2WQUA 3QPXH 4MAUH 5EU7E 4PWJA 3EGSA 3W2DL 4Q4IA 3T0EC 1V7NL 4TRPL 3X11A 1DCEA 3CFCL 3T71A 3FRUB 5KYWA 4DKDC 3A3YB 4EI6B 5I23A 4UQDA 3CXFA 2FVNA 3C2SA 3G5ZB 4FRWA 2E9BA 5C0BD 4PCTA 2IWEA 3NCXA 2APXA 2R59A 5AVUB 2MEJB 3IRCA 1I3RB 3OKNB 3S2AA 3B2UC 4TRPH 5CBAA 3K4ZA 4G1MB 4RAHA 5J57B 5IBLC 3RHWK 1OGTB 3IMBA 1MCDA 3RB5A 4DNLA 5IV2A 1KB5B 3HC0B 3UTTE 5D96C 2DS4A 4ZI8A 2WXIA 1I8KB 3UZVB 2M2DA 4J7RA 2CDGA 5F2FA 4N0YL 1TZOA 1XB3A 1ORSB 3UTTA 5IQNA 4P2AA 1XBRA 5FAAA 1NBYB 4Q56A 4GRLB 1BQKA 3D39E 3IMWA 3KYMA 1JWMB 2ZOKB 2ZXBA 4ZMOA 4M7ZC 1NMBH 1H8LA 3NK4A 3U2SB 3AU0A 2E0PA 4N0YH 3M46A 4BFKA 4LL1A 1GZHC 2WLNA 3D39A 1L5GB 1LXMA 1J9QA 3CN1A 4ENZA 4WFED 1Z0MA 1R5IA 4BZ2H 2Q10A 3RGHA 4F1SA 1DQLL 2DM2A 2HVBA 1AGFA 1X5HA 3D4ZA 2YMOA 3L3KB 3L3OA 3HFFA 4NT6A 4E2OA 1LQSR 3L9YA 2QKIB 4W6XB 4KK6C 2HJKB 1W0VB 2ZP8A 5KSAB 3Q5OA 2OM5A 1ECYA 1V3MA 4YC2C 2WGNB 4HFUL 4C47A 2NY3D 1EEYA 3KHQA 5DEGA 4U6VL 3QJTB 3LV3A 3QRFM 3QC5X 3TFKC 1DQLH 2N59A 2EDBA 3KGSA 5DGQA 1DE4A 3RB7A 3ALXA 2VZUA 1O9ZA 3FO0L 4ZMAT 1YC8A 3IFPB 1VEOA 4LNVA 1MFBL 2P8MB 3TEWA 1NCHA 2EEAA 3LNEA 1ZHBB 4HFUH 1QRNE 1T1WB 1SJVA 2FBRA 2CGYA 4F7TB 4U6VH 3CHXA 3AAZA 5IZ7A 1J88A 4CVZB 5KBLA 4FHJA 3FO0H 1QRNA 2OMYB 2VB5A 3H9YA 4G9FB 5DFAA 3ULSA 1FVDB 2PP7A 5I1AB 3TBWB 1BBDH 1MFBH 4RGOL 1R46A 2HT2D 3LQAC 2ZICA 4YE0A 1GC1L 1T1YB 1Z66A 4NO5B 1UD6A 1MHHA 3NIFF 2BOLA 2JXMA 3D0VA 1OTUC 2NCEA 4PRPB 4J3OF 3BWZA 1NJ9A 1OGAD 3PWNB 1MCEA 2IWFA 4LVOB 4AIOA 3K72B 5IMKB 4RGOH 4J3WA 4CN1A 2J72A 4LRNL 1X5LA 1TETL 3D2UD 2V9UA 5HHXL 3B7YA 2PP9A 3IE9A 4ZW6A 2VR6A 1GC1H 3L8QA 1U2YA 1NL0H 2JI3A 2LLLA 2ZG3A 3OB0K 5LCVL 4WI3A 4ELMF 5EBWA 2YD3A 2FECL 2ZYSA 1Q4NX 2CGRL 2J8UE 3S3SA 4AVIA 3B34A 2J5LB 3AU1B 4NOFA 4LRNH 2V3DA 1TETH 3A5VA 5HHXH 4YBQD 4U6YB 2J8UA 3VD3A 4I48B 4Y4KB 3T4YB 5HY9B 1ZV9A 4JAMA 3D3VB 5LCVH 4LF3B 4QIRA 3QUKB 4UCFA 3NJXA 2QQLL 1HOCB 4JREC 3OXRB 1RUQL 5IW1B 3OWRA 5HGGS 3FQTA 4W93A 1KXTA 1CFSA 3FCTB 4UM9B 2YC1A 3N6YA 1F58H 2QQLH 4AI7A 3KLKA 4PRHE 3QNFA 5SX5K 1ASQA 1UFUA 1V3LA 1QTSA 3SJVE 4MHHG 3VD5A 1DUYB 2GW5A 1RUQH 4WFGD 4XX1G 3KJ6L 1FCGA 1LO2L 2W9DL 1A6WL 5J6GB 4K07A 4PRHA 5DJ8A 1KTCA 4WI9A 3GSVB 4YHPA 3SJVA 3MJ8A 4WFFD 3MLRL 4XBMA 3ARDD 2H0FA 4D94A 5DFVC 3CFNA 5C0AE 1EWHA 4JJHA 4TVUA 3BUPA 5I6OA 3Q6FB 4U6XA 3RTQA 3H9SB 1MFDH 2HKHL 3KJ6H 1WIOA 3MREB 1PX8A 2W9DH 3FCBA 1A6WH 3BFOA 1CK0L 4XHJD 3LKNA 2VZVA 4DP4X 1F2XK 3GIVA 1KTDA 4HKXB 4FGMA 2YGQA 1YO4A 4AGPA 1SN2A 4Z7UE 3L1EA 1JYXA 4BA8A 5FR3A 4P4RA 4WGVB 1WS7A 4YHIB 2HKHH 2LLGA 1E5YA 4Z7UA 1CK0H 1YEGL 1N10A 1P1ZB 2K0RA 3D52A 4M4RA 5EU3B 3WS3B 1I4FA 1KCUH 1FNEA 4N0UB 1QFUL 4W6YB 2LLNA 3EGDA 1T5XA 3SDCC 4UU9A 1CMOA 3U30C 5T1LA 3GKZA 3QCVL 1N2RA 2FZ3A 3IAPA 1I7RA 1S5HB 4WNSA 2X0UA 2FR4A 1FO0A 3S5LG 3VH8G 3BAIA 4G8IB 2QSTA 4XPBL 1YEGH 2ADFL 3RGVB 1IJ9A 3DRTB 4LHQB 1QFUH 1KLFB 5EBLB 3BPLB 3QRBA 2XBZA 3IWUA 2WKOA 4U1NB 4OM0H 4MXVF 1X5IA 2XY2A 3BIAX 2R27A 4L9LB 5M94B 2NZIA 4Y2DA 3TOPA 5L7XH 1WF5A 5D5ME 3L2LA 2GAZA 1CWVA 2R69L 4XPBH 5HHMB 4RAVB 2ADFH 5IQ9B 1RZQA 1DQQA 2WXNA 1IBYA 4WEEA 2E6PA 5KSBE 1OHZA 3FTSA 3FHAA 1UWYA 3BLPX 1ID5I 1CVSC 4AKQA 2A83A 4KTYA 1KDJA 3B3BA 4AQ1C 3Q6GL 3QFJD 2J44A 4Q2ZA 3HUJE 4AYMC 2D7TL 1KG0A 5F97E 2VH5L 2Y23A 3B9KD 4OFQA 3ZJAA 2WANA 5TDOA 4G6FD 3QDHA 4NRXB 5CFAA 4XNXL 2Y1AA 1VADB 2V2WA 3Q6GH 4FEMA 4L1BA 4IK7A 2FBJL 2R29L 2Z35A 4OU3A 1H8OA 2A9ML 5F89B 3KW7A 2HT3D 3O8XA 3II2A 2D7TH 1URZA 2VH5H 3DMMA 4Y4FB 1UT1A 2X1PA 4A55A 2DRUA 4PCKA 3IDNA 4R7VA 3E9TA 3ZTEA 4XNXH 3GI9L 4FOMA 1AYRA 3VFSB 1T1ZB 2FBJH 1IMHC 4NQCD 5D2LF 2Q86A 2KUTA 2WQSA 5C0IB 1QMUA 2R29H 2A9MH 2Y5TB 2ZWLT 3NAAL 1NUDA 4OGYL 4AMKL 1Q72L 2LTQB 3BO8B 1S46A 3C8KA 1AQMA 3QZOA 2WVTA 3IS1X 1U8JA 2MMXA 3QQ4B 3H3PL 1UB6A 3TEYA 4GUQA 3DX6B 1A6PA 1ET8A 4NQQA 4P23C 5DHYB 2FECI 3UO8B 1CDIA 3GI9H 4L4VB 3T0XA 4HIIB 5DZNA 2WJ5A 1RUML 1YEIL 2NX5D 1I8MB 1FV1A 4OGYH 3ZT6A 2WBKA 1Q72H 5GGUB 2Q6WB 4ZMLA 4P9HL 5EEXA 5CLTA 4PV8B 4OJAA 4Q52A 4YHOL 1P0SE 3H3PH 4P5TC 4NFCA 2R69A 5ID1A 4YQXL 5K9QI 1RZ7L 4FMFA 2DMGA 2ZXEB 4OBRA 3LOWA 2FQFA 5CJBA 1J9RA 1ZRUA 2DMCA 5DMYA 1RUMH 1YEIH 3SY0A 1A6UL 3FT9A 2WBJB 3TJPA 5I71C 3U9WA 5EZJA 1CBJA 2VLKD 4HOZA 4OKDA 5F7UA 4A67A 4KDTC 4MAYC 3LKOB 3IMSA 4YQXH 3DX8B 3HZVA 3NCWA 4IJ3B 3TNMA 1RZ7H 3N2JA 5B21A 2CO6B 5IQ7H 4FNPA 1RAMA 2IAAC 1MDAA 2WQXA 3RJOA 1A6UH 2VDRB 3GPEA 3UYOD 1Q9WB 4JM2D 3LEXA 3DLQR 3BP6A 1IBFA 1J1XL 4MB5A 2VXSL 3VAEA 3OKOA 4Z0XB 3HZYB 2FWOA 2P48B 4PJ5E 1RZKC 3K8KA 2WVSA 1HNFA 3U1PA 3C75A 2ZXGA 3KXFB 4HLJA 2WZPA 3BAKA 1MPAL 2Y1YA 3T8XB 1JMZA 4G6AC 2A73B 4GQRA 5DGRA 4AL8L 1PFOA 4J3OH 1AS8A 2A9DA 2BRRL 4PJ5A 1HNYA 2QGEA 3TO2B 3GTNA 4F5CE 3W5MA 1NCAL 1J1XH 5K33A 2H32A 2VXSH 3U7WL 4FFWC 4JB9L 5E6YA 1LE9B 1D7FA 4KNUA 1MWOA 3KLLA 3OMIB 3VXSE 4F5CA 4QEGA 2LFGA 1D2PA 3F64A 1MPAH 4OFDA 4YDKL 2Y1VA 4JFFB 1IC0A 4P9ML 4AL8H 2BRRH 3HRZA 3OKMA 1X5AA 3LRLA 3VXSA 1AKJB 3HG1D 4ONGH 3MNWA 3DSNA 5CJXA 4PW4A 2JIXB 2EDOA 4JB9H 3LXBA 3QUGA 5EPMA 4D0DB 1A6AA 4FYTA 4F3FA 3EDEA 3R19A 2QBWA 4LLDB 1E5CA 1KGCD 4YDKH 1IKNC 3GBLA 1DDHB 4P9MH 4QHNB 2EDYA 2I85A 4WGKA 2Q2EB 4XNZC 3K0WA 4XN8A 4FD0A 3AQXA 5B1JC 4I9WE 3ARGA 4UBDC 3QUZC 5I82A 2D7PA 4J3UA 2ID5A 4MDIA 5A16A 2N0KA 2ZCHL 1PG7L 1W15A 3FOLA 3G5VB 1QQDB 2B4CC 3ME0B 3Q0HA 2YBRB 2Q8AL 1Y6KR 2OQJB 1M1SA 3ULVD 4X5XB 3K0YA 1A7NH 1CFVL 1UWGL 3FQYA 1BREA 2Y22A 3F7PC 2O5ZH 3NFSL 4KKRA 3W39A 3PHSA 5JW4Q 4MNGA 4PVMA 3D4YA 3QZWB 2C3XA 4MRBA 4WTWA 3FRPG 3O6MH 2ZCHH 1XL4A 4GW1A 1IEBA 2ERJB 3H56A 4UAHA 2Q8AH 5IVXE 1FDLH 2ZWSA 2YPLE 1G7PA 2TSAA 4KTGA 1F45A 1CFVH 1UWGH 2GSGA 1JP5A 1T6WA 3NFSH 4NZJA 3NPSB 4Z3GA 3BPCA 4UM8B 5IVXA 5IHZA 3WIHL 2YPLA 5B39G 3QQXA 2FK9A 4ELMA 1OCRB 3RU8L 5HD8C 5HGAA 3Q8BA 5KAQF 1HU8A 4I4WA 1FL5B 4GIPD 4FXGA 4WSKA 4EDWL 4BH7A 2GT9A 5DJAB 1EJFA 2C1PA 5BZWA 3KPOB 3VRJA 3N41F 3WIHH 4H5SA 3FQRB 2TRHA 2EIEA 3SDXE 4LLYA 2GUOA 4YDLC 3V0DA 3RU8H 2AABL 6TAAA 4U1MB 1E0OB 1TTGA 1WC7A 4QHLB 3AGVA 5AWNL 3BZ4B 2PXYA 4EDWH 4NXKA 2JJVA 4GSXA 2EIKB 3SDXA 3U0TA 2PO6C 4KI5D 3CVBA 3BQUD 1K8DA 4ACPA 2A4CA 3VFNB 4E68A 1NC4D 4S1DD 2A74A 5AVXB 1U33A 4YXKL 4YIQA 4EUPH 2WXGA 4PRNB 2AABH 1RUPL 2FJHA 2QPUA 4P2YA 1KIQA 5AWNH 4IKIA 3VFOA 3GNML 1IGYA 3HNVH 1KC5H 4NO0A 5B3JE 1V27A 3DETC 2EDEA 2IVFC 4JFHD 2BP0A 5I1IL 5B3NA 1KWGA 2F08A 3FULA 3MKGA 4YXKH 1OP5K 2YBGA 3K81A 1RUPH 2R0KL 1V05A 4ANXA 2Z31B 3IMRA 3L3DA 3FUIA 5FUZL 2EINB 2ZYIA 1XMWA 2JKSA 2F8IA 3FBKA 3PFQA 2EYSA 1QI5A 1VCAA 3UTPE 4ZT1A 5I1IH 4E9SA 1OCWL 2DMBA 4KUZH 2ZQKA 4XCFL 5CU5A 5CEZL 1U93A 5JUEH 3JWDC 2R0KH 4JHBA 3VXUB 1YEDB 2H2SD 2AEQL 2DY2A 2RALA 4M61A 5FO8A 2G2PA 4O58L 3HLAA 2FRGP 5FUZH 3WTVA 2SEBB 1E9OB 3W9DA 4R0LA 4U7SA 4HJ1A 4N6RB 2KZKA 1G7HA 1J1OH 1A1OB 1ID2A 1OCWH 3AITA 4G8GD 1P9MA 1XV8A 3JZ7A 4KX9A 4XCFH 5CEZH 3RG1C 4ZAKA 3EYUH 2V6HA 4QF1B 1FVCB 2KZ1B 5C3LD 4MCYA 1XSOA 2DH3A 1I7UA 1LYQA 5IB4A 1QPPA 2B8OT 2B1HL 1I8LA 2UWEE 4O58H 4OZ4B 2BO0A 4IIQA 5CSGA 1HZHL 3PWPD 5I1LB 4UAOC 3L5WB 2XV6B 3O2VL 2ORBL 2FQDA 1M7DA 1HK6A 1QPXA 1V3KA 2ZIDA 1IAII 1WD9A 2UWEA 3BUQA 3IXTA 3LH2L 3NZHL 3AADB 3P0GB 1J87A 1GVIA 3T1FA 4I18A 1XGUB 4PG9B 5LDSA 2KLRA 1NFKA 1M7UA 5LUMA 1BZOA 3SB3A 3TJHC 2B1HH 4XXCA 1HZHH 1J8RA 4MMXA 3O2VH 4GLRH 2ORBH 4ZG1A 1NANH 3O11B 2YPVL 4KKBC 2M26A 1WIUA 3LH2H 2A6JB 3HE7D 4HUVB 1LO0H 1MI5E 2VDPB 4X4YA 4A39A 1R3LB 1OAUH 3ML9A 4KDVA 5FGBC 3WJLA 4EJ1C 5FYKL 1IL1B 2FIKA 1MI5A 4FE9A 2Y2TA 4N0CD 4AGOA 2YPVH 2WUBH 2J4WL 2GJ6B 4OFVA 4FKKA 4HGWA 4LPXA 2XTJD 3UJTL 1PZSA 2RB8A 2ZG2A 3LQMA 3MRLB 2Z34A 1R0AL 4M5SA 5FYKH 4F9LA 3AUWB 1GY1A 2LQRA 1BFVL 1QAWA 1H6FA 5A2LH 2R8SL 2J4WH 5CCJA 2M1KA 5D93C 3UJTH 1T2JA 5C70A 3IGAB 1T0NB 5EU6A 1NCOA 2ROYA 4Y7MA 5ITFB 5DZAA 3MV01 1U8QA 1IAIM 3PGCA 3KPRB 4OZHE 3HS0A 1IGCL 5IUSA 2OCFD 1JVOA 2A7BA 2CLZB 2C9PA 2OMTB 3ECBA 3MUZ1 2H8PA 3GMRA 1BFVH 3IKKA 5H35A 5ENWA 4OZHA 4PJXA 3S36X 3TC9A 5DCCA 1F3RB 2KHAA 2XQYK 3NJNA 4Y5VC 4JRYB 4HV8A 5GZNA 5E03A 2BNRB 4YVUA 2AVGA 4Z7OB 2ZG1A 3ATEA 3GS7A 1PD6A 1G9ML 1IGCH 5GIRA 5JHBA 3SEPA 3SOTA 1FFOB 2BVPB 4X50A 2Z1KA 4ZXBA 4PJHF 1IBHA 2V37A 4POUB 5D1QE 1IGJB 1TPXB 1Z32X 5T1LD 3WG7B 3L7FB 1M6OA 1DQVA 1KNOA 4QR7A 1I8AA 2E74C 4PJ9D 1OT2A 1CO1A 5SWQA 5D1QA 1G9MH 4D0CB 3WTSA 1U8CB 4U3CA 3BHBA 3EO1A 4ZFOA 3MFGB 4PEEA 5DMKB 4PV9A 3MGTA 1MAJA 3ALWA 1R3JB 1U8HA 3RFZC 2P80A 2IH3A 1ADQH 5CP7B 4A7SA 2XBDA 2WTRA 3LNDA 1Q8MA 3FUMA 2GHWB 1DVFA 2DQCH 3BN9C 1MHEB 3QIUC 1KPUB 3RJDA 3ZSSA 4Y2OA 3HAEH 1PZDA 3FCGA 1RH8A 4N87A 4H1LG 3LHAA 1A02N 4JO5A 4L2LA 3ZN6A 4N25A 3TIDA 4FG6C 4PJFB 3ISWA 3KYNA 3VTAA 1ZV5A 3VMPA 4X6FA 2XYCA 5C09E 2YRPA 3PDGA 2GIMA 3GQFA 3KDPB 4ZMTA 4PI0A 3FO2B 3MA7B 4UMGA 2UV3A 2DEWX 2O30A 4MSWB 4NN7C 43CAB 5GZOA 5MEPA 1IQWL 5C09A 3RVWC 1XF3B 3BD4A 3GS4A 3OR6B 2DQIL 5HVHB 3CFBB 2YAOA 2DOCA 1WBZB 1XR9B 3WDHA 3RY4A 1KMGA 2GITA 3QDMB 4FP8L 4UOZA 5F3BA 4K5LA 2MFNA 3DMMD 3ABMB 1IQWH 2VLME 1Y0LB 2BWQA 2NNAA 3EFDL 5DZJA 4LGSB 1CF8L 2DQIH 2ED6A 3MBED 4OAWB 5LLIC 4JY5L 2C9VA 3WN5A 2LT9A 5IROC 3GJEA 3V0HA 1IEAB 1D6VL 1ZTMA 4MX7B 4X6EA 3WDJA 2JJTA 1WD8A 3F12B 3LRSB 4FP8H 4G7VL 4P2CG 4EI5D 4PG2C 5I73B 5K1NA 3DJ9A 3ZZSA 5IGXL 4MNQB 1ZY9A 3DIVA 1Y1DA 4W4OC 5D7JA 5KSUB 5EIIA 1WHOA 5HDQL 3ISRA 4GLRI 5L2KB 1NANI 3EFDH 3X12A 2DLGA 1CF8H 1I85C 1TEYA 3FO1A 1T5KA 1EJ8A 3OZ9L 1A21A 3BGAA 1HILA 4JGJA 1P7KB 4AV4A 1D6VH 2BVOB 1WK0A 1AHWB 5D8JL 5E8PA 4G7VH 4PP1C 2QGBA 1DJWA 2P5PA 3O3AB 3L5JA 1RHFA 3VWJD 1SGKA 1TCMA 1FC2D 4FYQA 4U0RB 1SNRA 3SYOA 5HDQH 3N85H 2PWGA 4A2HA 4IOSD 4JDTH 5IW3A 2H26B 2YUWA 2C3VA 4M1CD 4X7FC 3LZFL 2Y7LA 5CJ8A 2GK0A 3GGWB 1EEQA 2WVVB 2Z91A 3QHZL 4N8CH 1BOYA 4F80A 5D8JH 2FB4L 1JZEA 2LHAA 3AT8A 1YJDL 5DJ2B 1OM9A 1XXFC 3ZDZF 9PCYA 1CGWA 4HU8A 4MB3A 3LZFH 5DRXA 1OANA 4WI4A 2Y9RT 3KEHA 1GYVA 1PCXA 2O93L 3AT9A 4Z18A 5I6KA 1AOZA 3QHZH 3UIYA 1KT2B 4WO4A 2FB4H 3OAUH 3Q43A 4L0PB 4AGNA 1YJDH 2R9HD 4MB4A 3VWKB 2MKLC 3I3EA 4B60A 4HJ0D 4AYFA 2J7LA 2EXYD 3LPPA 1DVYA 3P2BA 1SY6A 4BH8B 1DJZA 4HF5L 4X4XA 3QIWB 3RVUD 4WTXA 4OLUL 5ANMB 2DBJA 2NY4C 1N3NA 3BKML 1G84A 5G55A 1FN4B 1IRAY 4HFWB 5HI4D 4LOEA 1Q0XL 3RFRA 3TIEA 3WO3B 2VISA 1IBGL 4PRIE 2ZX5A 2JCCE 2R1WA 3H1ZA 2W5PA 3QGVA 2ZUYA 4TV3A 4AJWA 1MQKL 4HKJA 4HF5H 5CMAB 3SKJL 2JCCA 4OLUH 3UTSE 3BKMH 4XP9L 3HE6A 3KHOA 3N43B 4FYRA 1C9SA 3AMKA 1Q0XH 2N0MA 3IJYA 1FZKB 5DJZA 5L4MA 3CHPA 4BK8A 1CE1L 4K94L 1E8WA 4MQXD 3M45A 4Z1PA 2YEQA 4GSUA 1G0DA 2VL5A 2YD8A 1Q0EA 3NN8B 1MQKH 4OIIL 4ONHB 3NJFA 5IT2H 5I8EB 5KG9B 3SKJH 1A0QL 1U92B 2VDQL 3TZVB 3U36A 5B3SB 3CH8A 5E8NA 4IMKC 4XP9H 1I1RA 5CWSB 1W0WA 3KWVA 4RIRA 4F93B 5IJDC 1XF1A 5EORL 1MG2C 1CE1H 1RIHL 3C2AL 4K94H 4APQA 4NP9A 4QOKE 4NPKA 4B5ZA 1IBZA 2ZX9A 3C6SB 1CF1A 4KVPA 4OIIH 4D9RE 4BZYA 4JPKH 5JW4M 1A0QH 2VDQH 4WFHD 1QVOA 5EMYA 2EVJA 1T83C 3LKSB 5DMGC 1IM3B 5F0PB 2YEZB 1D9KB 2ZSWA 5HYSA 2ESVB 4LCUA 3L2NA 4WW2B 4L8BA 1INEL 4L5FE 1RIHH 3PXHA 1YCSA 2JVUA 3S2CA 2H3XC 3VXQA 2YWZA 4NSKB 1CICC 4YPGB 2J43A 2IF7A 2JKRM 2OTUB 4FNTA 5JPMB 4IRSB 4J3OD 3TVMA 1TEFA 4GBXA 4UQ3A 5T1KD 4YL4A 4OLZL 4AIZB 4HCFA 1INEH 1S7TB 3RRQA 3DUHA 3G04A 4YEFA 3MJ9L 3CNKA 2YK1H 3BDYL 3D69B 5I19L 3IMUA 1NBQA 2XFXA 5E1AB 1NGWB 1OVZA 3BD5A 4TM9A 4X9FA 3G3LA 1P4UA 1UT9A 2YWYA 3TYGL 1G7IB 2GYSA 2DWDB 1FZMA 4UQ9A 5CGTA 4X8JB 1S8DB 2H9GB 4JVWA 4OLZH 1YY8B 3K6SB 4XB7A 3MJ9H 5I0ZA 4DKEH 3S96A 3GSNB 2DYPD 3BDYH 4B9IA 5I19H 1BF2A 3RP1A 3N44B 1JK9A 2Y36L 3O9WB 4RGNC 3TYGH 3VSVA 2YMXL 3NZUA 2E7MA 2WYHA 1SBSH 4HDIA 2RHEA 2WLIB 5KYXB 1UQSB 1TVHA 1WTGT 2PXYD 2X9WA 3V0VB 4I0PB 1FSKC 4NO3B 1J12A 3O3EA 4H8QA 1UWXK 1BJMA 4ELDA 2K4WA 2XN9B 3VSUA 2Y36H 1NEUA 1RJZA 1U8MB 2YMXH 1U8OB 3LRMA 3QNYB 4PCSA 4Y5YA 3LPOA 2K7QA 1EO5A 2NY6C 1C08B 1UZ8B 5CN2A 1KPRA 2XZQL 4GSQA 4EVNB 3OLGA 4WO0A 2WN2A 4WUUE 4UIKL 5CD5C 3UGEA 4L8SB 1F3DJ 2FJFB 3EJYC 3M88A 3BP7A 4LE8A 1CFBA 2Q7NA 3EH3B 2H2PC 3VXTB 3CX2A 4UYPA 3OV6A 3ZE0E 1PQZA 1TZGL 4WUUA 3QP3A 3WIAA 3V7MA 4TSAL 2R56L 5F0LB 4W9CC 2OW6A 3S3BB 1BQSA 4G8EA 4Z7VB 2EVGA 5AL8A 2WZ6A 5GS0C 4XH2B 5IMLB 2XZQH 4GKNB 3X1FA 1KIUA 4E9WA 1CI5A 2VDKL 4UIKH 4NWUL 1MCRA 1ZVYA 4MD4B 4Y5XC 2DQGL 4N1HB 3D25A 3PP3K 3IDJA 2XOTA 4TSAH 2R56H 2XHNA 3FB8B 4JY6B 4EZMA 3VA2C 2P5EE 5BRZE 1ZANL 4HOXA 1FI8C 4LSQL 3OAZH 4G43B 4D0BA 3F7YB 2EDKA 3O4LD 4K3DH 1XZ0A 3QG6A 4YS4A 4NWUH 3S5YA 2VQ4A 5CJQL 4A38A 2P5EA 5BRZA 3TBCA 2DQGH 4ZUTB 5ADPL 4PGJA 5JDJA 4HIJA 1HC1A 1FVEA 3OJMB 4ZBJA 4ODHL 2ADJA 4LKCA 4N2DA 1KCRL 2ZUTA 3E3QC 2R51A