2KZGA

A transient and low populated protein folding intermediate at atomic resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
WNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A transient and low-populated protein-folding intermediate at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Pre-mRNA-processing factor 40 homolog A
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kzgA00
2KFDA 1UZCA 2B7EA 2DOFA 2K85A 2KIQA 2JUCA 2KZGA 2KISA 2DODA 2L9VA 2DOEA 4FQGA 2LKSA 2E71A 2CQNA
chains in the Genus database with same CATH superfamily
4F93B 2JUGA 3RQIA 1D5YA 4XKWA 4PK4A 2QGUA 3EPZA 3GZ5A 5J1UA 2QEXI 4RAYA 4OAYA 2D1VA 5D8KB 1MNDA 3V7RA 2AQEA 4KN7X 4E7IA 1X2NA 3DPUA 2Y75A 2UV1A 1QBJA 1ETKA 2Z9OA 1WJEA 4FT8A 2M30A 2KJCA 4L5IA 2LK2A 1O3TA 1KYWA 3FXMA 2PJPA 5GPAA 3KLOA 1SMYF 4ZZLA 1Z1DA 2HFHA 3ZRGA 3MVPA 1IZ1A 5F6FA 2GZWA 1RPWA 4IO9F 3DKYA 2A61A 2ZSIB 3MEXA 2K40A 5K7FA 3GWZA 3F21A 3CO7C 1W5TA 4ZC3A 2DMQA 3FXJA 4CSWA 2FJ1A 1CF7A 4OU0A 2ZJRF 2UZKA 1TWCJ 2PQ8A 3IRRA 4LB6B 5BOXA 2KIMA 1LVKA 1S6LA 1PUFA 2KIUA 1U9NA 2QZ8A 2MYSA 4EEFG 4ZYGA 2GBYA 2WAQA 2IGMA 1LUJB 1F43A 4BGDA 4HX4A 1VQPI 4W1UA 1E3OC 2NVYJ 2BZTA 3IC7A 2R7VA 4NQWA 3WTZA 1Y0NA 5F64A 3RTRA 4ENKA 2RVCA 1UHMA 1I5ZA 1V5EA 3GFJA 3H5RA 2XB0X 3O3KA 4YRVA 1LJ9A 1FOWA 1YJNI 2HQRA 3S2DJ 5IT3A 2ZMEB 1BJZA 1OYIA 3L7WA 4CGZA 2OTJI 2R7RA 5J47A 3ML6A 2IJLA 1ZR4A 1OISA 4N9HA 2HZTA 2OU2A 3KZIC 2CW7A 3MKWB 2FF4A 2CFOA 1IXSB 5E1XA 5J8CA 3S8PA 3W2AA 4HNTA 1IV8A 4AVZA 5E20A 2ZKZA 1G3TA 1MIJA 2DA1A 1JI8A 4N0BA 3EUKL 2M8GX 1UFMA 3JR9A 1IGNA 1YO5C 3A1YA 1IO2A 2QF7A 3OYCA 1J59A 5F1JA 1FPQA 4M6YA 3OYIA 3ZPLA 4BHPA 4XBFA 3I55I 2KZGA 2ZXJA 1ACIA 4BKXA 3BG5A 4AU7A 5KK1A 3RKQA 2FUG2 2RNJA 1FTTA 3A0HC 1T8IA 1K7AA 3BOQA 1TWAJ 4CO8A 2OCCH 3OV8A 3LAPA 1QRYA 3K70C 2QUFA 4YELA 4A6EA 1YJWI 1RETA 3OMYA 2VXDA 1X1PA 3DPLC 2ETHA 3S3MA 2HWVA 5JFRA 2VPRA 3MZ8A 2DO7A 4CCOA 2YU3A 1B59A 2VOOA 1LVAA 2HQNA 3L2QA 3V8JA 4JYKA 3BR2A 1TP4A 2F6CA 2JVHA 4ZDOA 2HI3A 2YR2A 3BP8A 3J81K 4ZTJA 1PDNC 1QZZA 2D2WA 2ISYA 3CLOA 1FTZA 1JUPA 2JK3A 4RB3C 1YOVB 3ABMH 2OCEA 3ERED 3RSNA 2ECBA 2BXYA 2IA0A 2EV0A 4UVCA 3WHCA 2KPMA 4BEHA 2O7OA 2QM3A 3KETA 4MEXF 1NK3P 2LDUA 4AC0A 4DBQA 1GXPA 3I4MJ 4A3LJ 1SFOJ 1XN7A 3CMAI 3JTGA 1FBQA 2ELHA 1BIBA 3DLLF 2EIKH 1X19A 1JJ6C 1XCVA 2MH2A 1E3HA 2ZBKA 2JA6J 3GTKJ 4YEJA 3I3LA 3K10A 2L3DA 3KCCA 3I58A 1B72B 5LEJA 3H0GJ 2W84A 2GA1A 3BCAA 1R1VA 1V5GA 2FBKA 2VUMJ 2XAFA 1ODDA 2RAEA 3GF2A 3HUGA 4KIBA 4NHJA 2V9VA 1IRZA 3RQ4A 1SFEA 2BV6A 3H5AA 4G94A 4DW6A 4KITB 1R71A 1JT0A 1MNEA 1VTNC 4IRHA 3ZQIA 3KLNA 5D5UB 4LITA 4LK1F 3JRBA 4IHTA 2VL8A 1YX5A 2M0CA 3DKXA 2NS8A 3OYMA 1Z77A 5HDKA 3GCMA 3MQ0A 2VOPA 2VLAA 3FBIB 4CA0A 3V8KA 1T98A 1XGOA 1SD5A 1ZKGA 5JI6A 1TL8A 1LFBA 2DMPA 5D5WB 3W3CA 2LBFB 2JT1A 2LBFA 1A6QA 2P7VB 1Z91A 2L7FP 5DUKA 2Y2ZA 2M4GA 4G7HF 3MZHA 1B9NA 4DQ2A 3LA2A 3RKYA 4EJVA 5DDGA 3L9FA 2ZJQF 2DA2A 1BI2A 3OIPA 1Z7UA 2XAGA 2CQXA 1T6SA 3JRCA 2NOGA 1QHGA 2RQPA 4IEJA 3GYHX 5D6EA 5B5EC 1N25A 2COBA 1UAAA 2QKMB 5F0CA 5L3DA 4FASD 3HOYJ 1JGSA 2XAQA 3RPQA 2AXLA 2E35A 2FRHA 3PNYA 4GO1A 1TNSA 3DP7A 2NVUB 3HUGB 4E7KA 3L2CA 2R7FA 3LSIA 3WTVC 2FA5A 2HDCA 2LYCA 4HX7A 1RUNA 2G0EA 1WJBA 2QQ8A 1JKOC 4IHSA 4BHBA 1ZLJA 3TP0A 1DU6A 1YI2I 3HRMA 3ZXSA 1P92A 5LEKA 2JWTA 4OIRF 2EV6A 4FE4A 2MABA 4MGRA 1IXCA 2VJIA 1KZHA 1OCTC 3LSHA 5M3MJ 4M9XA 5C3EJ 2KLOA 2GIZA 5B3SH 2HTJA 2YX7A 3JSOA 5FB2A 2ZO4A 3S2WA 1YW9A 2EJRA 4ZJZA 3GTGJ 5E8IA 1DGRM 2JVGA 1Y1VJ 2IBDA 4NDLA 2ZFWA 2XRLA 1RNLA 4M3FA 4J00A 3DKWA 4YFXF 2DBBA 1TW3A 5CVVA 3SEZA 1FX7A 1LPQA 3CF2A 1RUOA 5CQEA 4G12A 4RB2C 2DA4A 2GLOA 3SJMA 3R6SA 1HDDC 1HDPA 4M9ZA 2H8WA 3E5QA 2A5YB 1NH3A 2IEKA 1LFPA 2LVSA 4EATA 1TC3C 4JBAA 1VFCA 2CG4A 1SFKA 2LTPA 3PQJA 3WE2A 1BW5A 4E6KG 4IQJA 2JQ7A 2OUMA 2Y0MA 1ON2A 5F27A 3P9CA 1ZAOA 1XDUA 4EVIA 1X1CA 2A5WA 2DXIA 5AONA 1WJ5A 1ZQ3P 3C1DA 3LSJA 3OR1C 2COMA 4P5OA 1HCRA 2LNBA 3F6VA 2QKLB 1FSEA 2LKPA 4RS8A 1VF9A 1YFHA 3E6MA 4HF0A 1Z3YA 3HOSA 1NHAA 4BJ6C 2HYJA 3EUHC 3JCUC 4B48A 1MH4A 5HOOA 4BBSJ 4XONA 3KYDB 3GTPJ 2LLKA 3FIWA 2K4BA 3MWMA 2M34A 3ZMZA 3ZOBA 2WAQN 2Q1ZB 2X0LA 3BZKA 3Q5FA 4RGSA 1HW5A 4XKVA 3CC2I 5EYRA 2P5VA 2CH0A 3DTKA 4UNOA 2HXIA 3MKZA 1BC7C 3DLAA 2QA4I 2ZMEA 4XN0A 1MNMC 2XAUA 5JHUA 5DEQA 2F5DA 3FM5A 3IKVA 1U5TB 2K7LA 1ENHA 3H9GA 3I64A 4M9SA 3BR5A 1K6OA 2R7TA 1WCMJ 4BY1J 2EINH 2FBHA 1K4SA 4ZDPA 4IRGA 3F3XA 1ZRDA 3FXLA 3HRTA 4X1EA 5IYCJ 1F1ZA 2BHYA 2JPBA 2E7WA 2BY0A 4M3BA 1JE8A 4YFNF 3HZJA 3OYFA 2NNYA 3S1QJ 3K1NA 1CF7B 3G3ZA 3JW4A 4FHTA 3RYRA 4KFCA 4G6QA 3FXUA 2QBYA 2R7SA 2QQBA 5FLMJ 3CD6I 1JXSA 2VJ5A 3H0DA 1YTYA 1BN5A 3HSRA 1T2KA 5J1YA 1D0ZA 2Z3YA 1O7FA 1QNTA 4RLFA 3CUOA 1FWZA 4AUXA 4AIJA 1YITI 1FYLA 1GUUA 3A0BC 3DQVC 1VI0A 3I9V2 1R9TJ 2BYVE 4MFEA 2Z33A 5D4SA 1J0RA 1YQAA 1BW6A 1D0YA 5IP9J 2PMZN 5HVQC 1OCRH 3CCVI 1P6RA 1VQNI 1XG1A 3LQRA 2VBYA 3K1MA 3NWTA 1MJ9A 3BG9A 4UUSB 2EILH 4A3MJ 4JOMA 1AKHB 2JA7J 1OFCX 1ETWA 3S1RJ 4A93J 1KU3A 3VSLA 1R4NB 4XNFA 4C2UA 2DMUA 4RM2A 2DDBA 4Z6YA 2V7FA 2DT7B 3VOEA 3JSPA 4WF2A 3H3ZA 2LKSA 1BI1A 2VC1A 1SMTA 2X6WA 4L0YB 5LHHA 2CQKA 4I76A 5IPAA 1MSFC 1OLTA 5IP6A 3F8MA 3TP3A 1HC8A 5CVRA 2VKVA 2ELJA 1UG2A 2PBIA 3JAMZ 3MCZA 3ERMA 4C3JJ 5ICFA 2EBIA 4DJAA 4KT6A 1XMXA 5EEHA 3SXYA 3RZDJ 1YJ9I 2UXNA 4G7ZF 4CCMA 4II3A 2BHZA 3O6BB 4CYCB 4XRSA 2XF5A 3HOZJ 4A2UA 2PMHA 5D4RA 2LY1A 2CRGA 5DV5A 4DOZA 3A01B 4G6DA 2ME0A 3TO6A 4DGWB 4I09A 1U9OA 1W4MA 3KP2A 5LGTA 3PL8A 3OS2A 4BNCA 5LLQA 1I3AA 1RKTA 4DYRA 3JRAA 3ZP5A 4Y33A 4LIUA 2M45A 4WX9A 1IRGA 1ETXA 4XR6A 1XSDA 1IN5A 4IHVA 4BYYA 2G7UA 4EMSA 2HOTA 3HPGA 3K69A 4GCVA 3LSPA 3P9KA 3E6BA 2R7QA 5FRNA 2ZJ2A 3RIRA 2IP2A 2V1UA 3CQZJ 2L0KA 3FM3A 3M4OJ 3R4KA 1QU3A 2ZNYA 1YS6A 1YW8A 3O8HA 3FK7A 3BR3A 4LFUA 1R7JA 4I02A 4ENMA 1FP2A 4XRMA 1APLC 4O6JA 1B9MA 3LOCA 4JK1X 4MIMA 1DPRA 2BVLA 1JTYA 1MBFA 1OCCH 3K9TA 5BNGA 3JREA 3HOUJ 1AA7A 1S8NA 1R4MB 3P5JA 1H89C 2O3FA 3QAHA 3C2HA 2H09A 4G6TB 4ZZDA 1PVEA 2GIVA 4KT5C 4D1QA 4BU2A 1JKRC 2EV5A 1MD0A 2WY7Q 1PUEE 1LEBA 3HGYA 1BM9A 1X2MA 3H1CA 3CMYA 1U3EM 3TDZC 4HQEA 3OSFA 5DD4A 1T56A 3H3VK 3H3UA 1Q1HA 4JQFA 3OSGA 3V42A 1N75A 1PP7U 3DEWA 3V7CA 1MSEC 1OYYA 1ZG3A 1PP8F 1VQ6I 2XRNA 4XLFA 1TT0A 4GGGA 2FX0A 1KU9A 2EA4A 1BBYA 1W7PD 1VQMI 3GTMJ 1BJAA 4NC6A 3V8LA 2CMPA 4BBRJ 2WV1A 4F3QA 3GLXA 1XSXA 5L3CA 3IAM2 3X2QH 3CCLI 3QOPA 2WV0A 1USTA 4G7OF 3ABTA 2CFXA 1G3SA 5DUIA 1F9NA 3OYBA 1U0JA 4D0PA 5HNHA 4DZPA 1ZELA 5GP9A 5TISC 1ZR2A 4Q48A 2ACJA 1JKPC 2LOOA 5JHFA 3EYIA 3JRHA 5IT9Z 4EM2A 5L3FA 3SYTA 3S15J 1BR2A 4NC7A 3BTIA 2X1EA 4Q4ZF 4LIVA 2XUBA 4D7NA 4LK0F 3W6VA 2GAUA 2CU7A 1BR1A 3PIOF 1D5VA 4HX8A 3P9IA 5LGUA 3ABUA 4L9TA 1Z05A 1HKTA 2NS0A 2XASA 3E7LA 1XMKA 4M3GA 3I5UA 2M4KA 2RV8A 1LDJA 1B72A 3BT9A 2FXAA 4UUVA 5TJJA 1POGA 4HSTA 4CUGA 3GW2A 5ICCA 3BLYA 4LG0B 2XGEA 2M7AA 1E2XA 1ZLKA 5AIQA 3L2WA 2RGVA 4BJTA 3HXLA 4ABZA 5LBQA 2E2JJ 1KQ0A 3ASOH 1TT5B 1GVDA 2RN7A 1T39A 2DJIA 1SD4A 1FBSA 2F4MB 5GAEJ 2HKOA 3J7AO 1R1TA 1W5SA 2OZUA 3ABLH 2BBYA 3FISA 4PJMA 3ISPA 2IA1A 2FEZA 3K0LA 3QU6A 3Q0WA 3OYAA 1X3UA 1J2XA 1AHDP 1P4XA 2PG4A 4GYIA 3VDXA 4Y3OA 5K7ZA 2X1DA 3ZQQA 3UKGA 2A3SA 4AD9A 5IOYA 4DBRA 2E71A 1VQOI 1T95A 2ZNZA 3CUQB 3W2VA 5KNLA 3SZPA 1LKXA 2R5ZB 4WXCA 2XKPA 3WGIA 3I59B 2YS9A 3M07A 3GFIA 2E36A 1G59A 4PDKA 1X4PA 5IY5H 3DPTA 3HOWJ 1P2FA 1DGWY 4FQGA 1FMWA 4BXFA 2E2HJ 2HVRA 3HSFA 5CVIA 5EZHA 4OAZA 2F5VA 2HPMA 2W7NA 2HNHA 3GTJJ 2WAEA 1AOYA 4OIOF 3ZCOA 5KVRA 2F4IA 1MH3A 4XORA 5K5OA 4BQNA 2O61A 5BPIA 5M5WJ 3QP6A 3G1LA 3SZTA 2XC7A 3O8GA 1ERDA 1WWXA 2BW3A 3BY6A 4IL6C 3CESA 1BIAA 1D1BA 1Z7LA 2BXZA 3ZMTA 2HR3A 2XPWA 2PLYA 5IYDJ 1I3QJ 3W2WA 1DDNA 4IHYA 3LQQA 5TGTA 1R36A 2AXTC 2RNGA 2DI3A 3TMOA 1X58A 3H35A 1YLFA 3BZCA 1DP3A 1FSHA 3IWZA 4NQWB 4X0GA 3AG4H 1Y1WJ 2VODA 2VASA 3GVAA 4XRSG 2VT3A 1YYVA 1EJ9A 2XDVA 4LOCA 1W0UA 3RI4A 2E1OA 1RI7A 2GM4A 2VE9A 4XLCA 1G2HA 1DU0A 2KJBA 5LD2C 2E7XA 1ETVA 3C7JA 3VFZA 5DM7F 3M1CA 4B1RA 2VI6A 2JA5J 4PFPA 3NEUA 2PN6A 1MDMA 2V6CA 3CC4I 2CYYA 3SZGA 4KDPA 1T33A 1I39A 5LGNA 1WH5A 1P4AA 2VT2A 1Z9CA 2DOAA 4NB5A 1YE9A 3IUOA 4S0HB 3H9QA 5K5QA 1LB2A 5F08A 4Y17A 2X48A 2LSOA 2X85A 4GXOA 3B6CA 3GZ6A 1R1UA 1MKMA 3FXKA 5C44J 2Q0OA 4NBQA 4BACA 1FC3A 2VBWA 3HC7A 3CCSI 1I27A 3U1KA 2CUEA 2K9NA 2R4GA 5FKOA 4J01A 4ASNA 2ESNA 5ED4A 1P7IA 1QVTA 2LMDA 1IV6A 3HIFA 2P6SA 3SDGA 5L3GA 2EK5A 3A03A 3IWFA 3K4MA 1N77A 2I10A 3E6CC 3Q9SA 1G6NA 1A5JA 3JAMK 2NYXA 5FKKA 1P7JA 3ELKA 1SC7A 3GFLA 3BJOA 4CCLA 1DPUA 1K6YA 4MFDA 2JN6A 2VBXA 3K7AJ 3FX3A 3P7NA 2LC2A 3KZZA 3TOAA 2ME6A 3OS1A 3N97A 2HVQA 3BR1A 4L5EA 2W24A 3IH4A 3VSKA 2HDDA 3DTEA 3FWEA 3FZVA 3NARA 3VWBA 1RRJA 1FIAA 1Z6TA 3DV8A 2CSOA 2KQRA 2E34A 1IRFA 1BI3A 2MFZA 2PJRA 1JUSA 3CCJI 1A04A 3FKJA 5FD6A 3RKWA 2L7KA 2GXBA 4A3GJ 5HLTA 1MMAA 3Q9VA 2G9WA 1YG2A 2HDWA 2F5EA 1FBUA 3OWTA 3KYLA 2GXAA 3QRFF 2X9DA 2MG4A 3CMEI 4OMYA 2A68F 3DWLE 1IDZA 2JSPA 2HS5A 3NAUA 2OF7A 5HS8A 3E5XA 5ILVA 1BOAA 3BROA 1O3SA 4P9UA 4ON0A 1KONA 4UVBA 4QPOA 4ESJA 1BC8C 1OQYA 4ENJA 2B9SA 1ITYA 4PFOA 5GAGJ 2AQFA 2IS6A 2DT6A 4C2TA 1NG6A 2ELKA 4N4OB 3WGGA 3QODA 2WBMA 4M74A 3FMRA 3BTCA 3I54A 5IOZA 3AG1H 1XS9A 2H8RA 2R7OA 4PJJA 4BDZA 2FNPA 1FOXA 2XF7A 2KIFA 3U2RA 2XROA 2CWEA 3GXOA 3KEQA 5DM6F 2VKHA 2DFFA 1BOBA 4H4KC 4IX7A 3G71I 4D9JA 4R79A 4BUPA 2L4MA 2HPIA 2MLGA 5CYVA 3PSIA 3HPHA 1EV7A 2FD5A 1S72I 4FCYA 2DPUA 1OR7C 4DYQA 2R0QC 3LNQA 1L3LA 5HODA 3WHBA 1EF4A 3CDIA 5ICGA 2ZSHB 1V4RA 2NXNB 5J6XA 1OKRA 3F8BA 3TO9A 5GTIC 1VNDA 2VXZA 1XGMA 2MD0A 2O8XA 2P0WA 3TGNA 2E1NA 3CJQB 4BXXJ 2HU9A 2HTSA 4UHTA 3DBLB 2V1DA 1LE8A 1UZCA 1WJCA 2O0YA 4HEA2 1JHHA 2HOSA 3K4LA 2HXOA 3VPRA 3SDBA 4BAYA 1ZH5A 2FE3A 3R0AA 3SFIA 4HRIA 3G2BA 1SVMA 1G3WA 2JJ7A 4HOBA 5HLHA 3PQKA 2CV2A 3EUAA 3OYJA 3EQLF 4CHUA 2HZDA 3SHFA 4DNCA 1HSTA 2L9RA 4PJLA 2PMUA 4Y52J 1GLNA 1H0MA 2QWWA 1YRNB 2DDAA 2W48A 5K5RA 1I6HJ 3FXRA 3BG6A 2CV0A 4BQAA 1FOKA 1ZRFA 2QSGX 3CJNA 3I0TA 1WGXA 1U8BA 4OINF 3GZNB 2Q2EA 4EM1A 2LR8A 2O8KA 2DYRH 3L2RA 5EEAA 1XX5A 2K9SA 4MHGA 1UELB 2IGKA 3J7YJ 5FROA 2F5FA 3FHZA 3S3OA 2DOFA 1KU2A 2DTRA 2KL4A 3LA7A 3WG7H 2R7XA 4XOTA 2DODA 4PJ0C 5C4JJ 2R7WA 1FEXA 1B8IA 2P8TA 4XKCA 4XM3A 4GDFA 1PJRA 3G6EI 4ZYEA 3AG3H 1YX3A 2BY1A 1TW2A 3TKYA 2F4OB 4LLGF 2R93J 1TNTA 4D5FA 4DIQA 2Y30A 4L0ZB 1GXQA 3FKIJ 1A31A 4JP0A 4A3DJ 4BE2A 4K2EA 1X4OA 5FKLA 2EPFA 1K61A 3O2PE 4E7ZA 1GHCA 1B1BA 1ORKA 1CGPA 4BQQA 2DW4A 4CZZA 4DYCA 2E19A 4G9YA 4ZDLA 2V9KA 2NVTJ 4KIGA 2E1MC 2E5ZA 1MJAA 5FRMA 2M7BA 1W7PA 2PMZA 2E5NA 1VQ7I 1T0FC 3BWGA 3CJRB 3D0SA 5TRDA 3WTSC 1MGTA 2N8GA 4ETSA 1OPCA 1WI3A 2ZCWA 4M6VA 1TWGJ 2GWRA 3KE2A 4NC8A 5DCMB 2XGDA 1K4TA 2FOKA 3GTQJ 2KRFA 1V54H 1M1EB 4XSZF 3L00A 1EH8A 3I71A 3AFHA 1SD6A 3WU1B 2EQRA 2LY9A 3EYYA 1D8KA 4IOAF 2WAFA 1SEUA 1UB9A 1T0FA 1SFXA 1U6GA 4CDGA 3V4GA 4LMYA 3KPHA 2ZXHA 5FFXA 2KRCA 4C9YA 4XLEA 3ZQLA 3D1NI 1RKWA 4PGHA 2ZXWH 4A3BJ 4KMFA 2OC6A 4P1WA 3MAJA 4YIRX 2L4AA 2EZLA 2DFHA 1JHFA 3RCOA 1UJ8A 2VJJA 3HL2A 1MZBA 1PYVA 5FLXZ 3TW7A 3GX4X 3WTYC 1KGSA 2Y0SA 3BTJA 2F5CA 4XOPA 2EFNA 2VQLA 3BCBA 2XSJC 3I53A 5KAFC 5JVGF 1HLVA 5FLVA 4A3EJ 2LF8A 2CUFA 6PAXA 4A3JJ 3GTLJ 2CO5A 2VONA 2H1LA 1BR4A 1Y56A 2BW3B 3J7ZI 1VQ9I 1XCBA 1OJLA 3CP8A 2R7UA 2NRAC 4IRIA 1I50J 2DMTA 1O57A 2OJED 4FX0A 3ZMDA 1D1CA 1K78A 3BR0A 5FJ8J 1LFUP 3OL4A 3U9GA 2IPQX 3OYLA 1IDYA 1O3RA 2C6YA 1YS7A 2RQQA 4LG3A 1DQUA 4A6DA 4RA2A 1FT9A 1V55H 4A0XA 5GPCA 3OS0A 1E0EA 4HZFA 3FMSA 1E3PA 2OTLI 1VZ0A 2MC4A 3OYDA 3WTWC 5HDGA 2DOEA 2A6EF 2Y31A 2EB7A 5H6QA 2IGOA 2RREA 2BOLA 4ZH4F 1DUXC 1WI9A 2K3PA 2QVOA 3CMMA 2R5ZA 3TOBA 4Y13A 4WCGA 4QTRA 3FXQA 2M2EA 2DLLA 3KP7A 4DZJA 4U7DA 3E5UA 5ILSA 2H6CA 1J09A 3F8FA 3Q3SA 4KUMA 3FDYA 5HS9A 3RDIA 2NOJB 2Z99A 2WC2A 3ASNH 1OCPA 3PNVA 2YU9J 4U88A 4TV7A 3DEEA 4HPQA 1H88C 4U0VA 3OL3A 2HEOA 1QGPA 1W0TA 2CGPA 3RKXA 2M0MA 2EZIA 2XPUA 3QPLA 4P55A 4I0AA 3HG9A 5DCMA 2ZJPF 5H20A 1LDKB 5FLXK 2LRDA 5ERIA 5J3LA 3CDHA 3K1PA 2R5YB 3U21A 3WG9A 4B3AA 5LHGA 2QCOA 4U0WA 3EETA 3WTTC 2LKXA 2ID3A 1QA6A 3DXJF 2ISZA 2JTVA 1GV2A 3CUQC 3QYEA 1A35A 2IS1A 2K5CA 3PM1A 2P6TA 4MO7A 3VYTB 2D5VA 3HTSB 1Z67A 2EFOA 3WTUC 3PUBA 4XL9A 1Z6RA 2IRFG 5EEGA 4JX4A 4FX4A 2DPDA 2KDZA 2AO9A 4PZJA 3ZGKA 3LAJA 3ZMSA 3I4PA 5F1RA 2IS2A 1D8JA 1B8IB 1U8RA 2DTZA 1VQ4I 1QPIA 5FGMA 4BL0B 2OQRA 3MKLA 2X6YA 3WTXC 3PIPF 1AWCA 1ZG5A 2DU9A 4JX5A 1J9IA 2ECCA 1MBEA 2JRTA 2L7MP 1YW7A 3HYIA 1IW7F 2Q2EB 2PEXA 3IV5A 2CW8A 1MMSA 2KHMA 2V6EA 4B43A 1EH7A 2NS7A 3CCEI 1TTYA 4ENNA 4XLNF 3E97A 1XDSA 3M8JA 1YRNA 4MNUA 4IOCF 1R5HA 2W85A 4II2A 2QQAA 2KRHA 3HKZN 1IXRC 1WHUA 1MMDA 1IG7A 3D5SC 5FO5A 2RC4A 2MH9A 4BE0A 4ZTFA 2X1CA 2BVMA 2XIGA 3DFGA 1YHQI 4HBLA 1VQKI 4I6ZA 3K4BA 3TL4X 4U0YA 5LRRA 4CICA 5DS9A 3I4NJ 3BDDA 4I98B 4B4CA 1UCRA 3KP6A 5DD8A 3C18A 2IGNA 5B1AH 3BJ6A 1X3WB 4PSXA 2XGCA 4A0YA 3HB9A 1J75A 1RR7A 1X3ZB 3FXOA 3E0JB 4MQ9F 4FTHA 2BY3A 4FISA 3PO2J 3J7AY 3D5RC 5KHDA 1K83J 1ZARA 2R5YA 1IJWC 5JR3A 2PX9A 3DBHB 3HJEA 2GXGA 3IL2A 1RR8C 1Y0UA 1CQTA 3ROUA 2Z2SB 4AIKA 5IT9K 1P9QC 2CV1A 1I1GA 5DCFA 2VBZA 4HYEA 2DAOA 2DCEA 4OIPF 4BH9A 4YG2F 3S93A 3LA3A 4XK4A 4V19K 2E60A 2ZB9A 1W36D 3K4CA 3QYFA 3RPUD 5CKTA 4BS9A 2GOMA 3IH3A 4U7BA 2LG4A 4RDUA 2FQ4A 3K70D 3T5XA 5FD5A 4RB1A 2Y69H 4EJWA 1W5CC 1XSVA 2JA2A 1OCZH 2W1OA 2M9HA 1S7EA 3KFWX 4KISA 2L5QA 3GTOJ 1MMNA 2ZC2A 3ZQFA 5FKMA 2V1XA 3K2AA 4F7ZA 3K4KA 1VQ8I 2KIQA 2HGCA 3J81Z 4I2OA 4EQQA 3OYKA 3OYGA 1JTXA 4L18B 3QP5A 3M1EA 4EJTA 1UMQA 2XKOA 1U5TC 3PUFA 1A36A 1K78B 3KX2A 2FMLA 3I56I 3WGHA 1O3QA 5E79C 1KU7A 9ANTA 4MEYF 2W4SA 3F8CA 3V7SA 5CLSA 2UUZA 4LGWA 4HW0A 2O6GE 2XAJA 1S7AA 3DTIA 4CCNA 2LH9A 3A01A 1E17A 1OCOH 1QZYA 3MKYB 1R6RA 2HVSA 1IAWA 1IN4A 3AKZA 3VEPA 2KT0A 2XGXA 1ZGWA 1KQ9A 2EFWA 2ZFUA 5E3OA 3F72A 3CJTB 3ZN1A 1K79A 3QPHA 1EKEA 1QPMA 3HOXJ 3DF8A 1TQMA 2X4HA 1D0XA 4KIFA 1ZHFA 1G4DA 3MZYA 3OOUA 3S32A 2QLZA 4ZYHA 3G73A 3CCQI 3A4CA 3ECOA 4E7LA 3BZ6A 3K2ZA 2VN2A 2KDOA 1F4KA 2X51A 2DFIA 4ESFA 1GDTA 4NUBA 3F23A 1F36A 5E17F 2FU4A 4I7HA 1H8AC 1TBXA 2YSRA 4I0BA 5LFAA 1A6IA 4RAZA 1AKHA 5M3FJ 1TZLA 3QOEA 4O5VA 2YX4A 1H9TA 4C2MJ 3B6AA 1W7PB 1HW1A 1Y6IA 3JTHA 2GOXB 1BA5A 2W00A 5GAHJ 2G7HA 3BQYA 4A69C 5J4YA 4A5MA 1LEAA 2TDXA 2OBPA 1R00A 4FETA 4V2GA 3J80K 1I6XA 3AG2H 2VQCA 4UV8A 1SANA 3ZN0A 3PO3J 3C3WA 2P5LC 3CDLA 3CLQA 2VPLA 2WA0A 2ZMEC 4IF4A 1MDMB 3JRGA 4RAGA 4KNYA 3HDDA 2QBYB 3KZYA 4B8XA 4IHWA 2JSCA 3ZQGA 3CCUI 3LSGA 3QPTA 3S14J 1BI0A 3WE3A 1ULYA 1XMAA 1ZTRA 3TW6A 5IYBJ 4E70A 2NVQJ 4GYGA 4HA8A 5IP7J 1XPXA 3DU5A 2VC0A 3BG7A 2E1MB 2XPVA 2H94A 5LHIA 1SAXA 2AHQA 3G1OA 2FBIA 3ZQHA 3S1MJ 3H5NA 2D1HA 1MBJA 2ESHA 3GLLA 5K7HA 1KQ8A 4LLNA 4F92B 3B73A 1IC8A 3S16J 2AS5F 4MTDA 5HNFA 1U5TA 3LMMA 3OR2C 4P9FA 2EIMH 3T0YA 1XGSA 2MA3A 3VYUB 3LSMA 3OY9A 2L01A 3BG3A 3GO5A 2MGQA 1HOMA 2DMNA 2NVXJ 4M3DA 4UV9A 4I01A 1P4WA 4C3IJ 5E18F 1FYKA 1TLHB 1WSUA 2DFEA 1QO0D 1IN8A 4HV6A 1WZ2A 3J80Z 2LREA 3F22A 4Q5SF 3L09A 1XTAA 2IXSA 2OAZA 1RZ4A 2EIJH 1ZRCA 5D5VB 2MSYA 2BEOA 4QSHA 2OA4A 3PFIA 2BE5F 1DP7P 3NQOA 3ABKH 1ZYRF 3COAC 2LD5A 5E1ZB 4XIDA 2GA2A 4RBOA 3IHUA 1LE8B 2B7EA 1XGNA 2DQRA 3L2VA 4I99C 1J7KA 4YFKF 3KEYA 3R0JA 3CCYA 3CO6C 3TO7A 4ZYAA 3PFYA 4S04A 2VKEA 3RJPA 4EM0B 4MTEA 4RB0A 3EUHA 1S9HA 3UR3C 1G8XA 2V1NA 1FMVA 5CJ9A 3IKTA 5DYMA 4Z2YA 1R23A 3C2GA 2V4JC 3CUQA 2VQGA 3LSTA 2H1KA 4C3HJ 1FY7A 4A5NA 3IRQA 2EWNA 4KN4X 3FK6A 1ZN2A 2V79A 4IHXA 2EFQA 1MBHA 1XB4A 4AM3A 1UG0A 2WY8Q 2IW5A 4HLXA 1WPKA 4WK8F 4CCJA 2IT0A 2DYSH 4PJNA 4F55A 2MLKA 2M1BA 5F0HA 4HQMA 2A05A 3CCRI 1V5FA 1ON1A 5CQGA 2M87A 2XHKA 4HV5A 4XICA 5FFZA 3F0CA 4Y4RA 2P7CB 2P5KA 5CVUA 1HF0A 1R49A 3LSKA 3BQZA 2OZ6A 3FF5A 4ANJA 3BC8A 4KA4A 1WRJA 4R8HA 4B3XA 4LG0A 5D8LB 1B6AA 3R61A 1ZREA 4XN3A 3RYPA 5JVTA 3AL0C 1ZGJA 4HF2A 3QPSA 3HHHA 3OYHA 2NNNA 3KP3A 4AVPA 5J40A 3OOPA 1SFUA 1ETQA 1VQ5I 2PI0A 1XD7A 5LRSA 1BL0A 2FNAA 1STZA 2ZXIA 2FQ3A 2FOWA 2B63J 1JGGA 1D1AA 4L9VA 4BHCA 1X1DA 4YIIA 2PJRB 5D6FA 2EFPA 2R3SA 3ZQ7A 4KMUX 3T1BA 3KP5A 3KEOA 1ETOA 2QENA 3FMQA 4YIFA 2Y48A 1IN7A 1OMIA 3K6GA 4D5CA 3RPUA 1NTCA 3KIOA 4EJOA 3SEQA 2XSDC 3M8FA 3REOA 2P4WA 2DK8A 5EZGA 2ID6A 3VODA 5E1WA 4IJAA 5ICEA 3DCFA 4Q47A 4L5JA 4M73A 3CTAA 2UXXA 4J19A 3R60A 2K27A 3CP2A 5B1BH 2KZVA 3K4JA 3M3YJ 1OR7A 4H0EA 2BY2A 4XKBA 2H27A 4LB5A 5BS6A 3GBGA 4G8XA 1ONVA 1FP1D 3GFMA 3QWLA 2A6TA 3G1MA 2IAIA 2KP6A 4BXUA 4XRFA 1JUMA 3Q0VA 3OYNA 4X6AJ 1MMGA 3E6DA 1S5LC 1Z0XA 3CF5F 1T38A 3HKZA 2L02A 3IAS2 3UNGC 3DBRB 4A0ZA 5E8GA 3BJAA 1SD7A 1ETYA 2X6OA 2QSFX 2JPCA 1GT0C 4A3IJ 5ILUA 1TWFJ 5J4VA 2K3FA 4XQFA 3NRVA 3F8NA 2Q8KA 2PFBA 2DQLA 5EDNA 1MBKA 4A3CJ 5E3NA 2LF7A 4C30A 3ZMVA 4PUSA 3ZQCA 4BEHB 1LQ1A 1VQLI 3JRFA 2HOEA 5BQTA 4AYBN 1Y39A 2VKDA 1W36C 2HOAA 4CZCA 3BPXA 3RZOJ 4E7SA 2LFBA 3QYBA 1HQCA 3SFZA 3E1SA 5F04A 2CUJA 2DK5A 2WADA 1MW7A 2CS3A 3BTLA 4HF1A 2L7ZA 3PSFA 1SVOA 4BDYA 1C0WA 2QQ9A 3MD2A 1FYMA 1B4AA 5B66C 2WWYA 2CW0F 4E4HA 3G4SI 1N78A 2VIXA 2WB1N 3HGGA 1U2WA 3S3NA 1IF1A 4UXNA 1Z21A 4IQ4A 3IP4B 5J1RA 2HYFA 1GV5A 2W25A 3WODF 3TEDA 4IKFA 3NWSA 4MQVA 5KCMA 1QZEA 1USSA 1AU7A 2OD5A 2OV7A 3HHGA 5L3EA 1RC9A 5JLWA 4BQOA 4E7JA 4LD5A 1YIOA 2R7ZJ 4IXAA 3WU2C 2K85A 2VJ4A 3HTUA 4HDVA 4AYBA 1JJ8C 4KICA 1SVLA 2CJJA 4A12A 3M7GA 2I5UA 2DN0A 5M5XJ 2XB5A 2XAHA 4IZZA 4OOIA 4MLOA 3OIOA 3FBNB 2JRMA 3U1DA 4GRIA 4XLAA 1REPC 2UWMA 2KKOA 4M6XA 4A3FJ 2HQAA 2W82A 2TRTA 3S1NJ 2IS4A 4RGRA 3HOTA 2EZHA 1FZPB 1MBGA 1ZK8A 3A02A 2OQGA 2VB6A 4UY8I 1L0OC 1WVRA 1X1AA 3N05A 4F91B 3S17J 4RM3A 1WJFA 3Q0UA 3HOVJ 2CUZA 5CPRB 1IUFA 1WJAA 3M9AA 2E2IJ 2QYOA 3B02A 4OIQF 2F48A 1HSJA 5AIPA 3LFUA 1QHHD 4QLCU 2F2EA 3I59A 2K4JA 2K86A 3HRSA 4RGXA 4EV0A 4HG2A 4BJ5C 1WH7A 2O5RA 3TDUC 2MC3A 1RESA 4B47A 5GADJ 4EGYA 4PGGA 3LFKA 4PSWA 4CYDA 4B09A 2B0LA 2CQQA 4Y7NJ 4ZYDA 3VYSB 2I8DA 2L9SA 4BY7J 4UUSA 4CCKA 2Y0SN 1PUFB 2L9NA 2J5PA 3WU0A 2JA8J 2XVCA 1FJLA 2JZYA 2L54A 2ADUA 4WXDA 3PNTA 3H9JA 4UUTA 3ECHA 4QWQA 3ZMUA 3H36A 1O4XA 1J5YA 4RAFA 2WTEA 4XMYA 2HKXA 2LY2A 2X6XA 2CQ7A 2VE8A 2Z16A 3QU3A 4ITVA 5A2QZ 1MJBA 2JMWA 4IPAA 4Y15A 3CC7I 1R22A 2W57A 4UB6C 4HSRA 3ULQB 4L9NA 3MN2A 1TQIA 3H92A 5F0FA 2R92J 3HBLA 2K9QA 4QIWN 5CVJA 4ESBA 2RDPA 1WFXA 1GVJA 4WXHA 5JLXA 5L3BA 4UVAA 1RIOH 4WWCA 1ZGAA 4W97A 2HYGD 3KP4A 3K4NA 2ICWG 2TCTA 2K02A 4M72A 2M5WA 3S2HJ 5EJCA 2MW8A 2WB1A 4LJZF 3DU6A 5D5XB 3JRDA 3IH2A 4XLHA 3LL7A 2XV4S 4CH7A 1QQIA 1IUYA 4PCQA 1I1SA 3ZR8X 2MBFA 1HXDA 4CXFA 3SQNA 1U78A 1TQPA 1S29A 1HKSA 2A69F 2A07F 4BE1A 4RLQA 1UHSA 3N4MA 2DA3A 4OWRB 5EG0B 4RMNA 2K9MA 3KYCB 3L1PA 1W1WE 1OYWA 4V2FA 2D45A 1EA3A 1SAUA 5H6RA 3CZ6A 2BGCA 4LLLA 2EZKA 2Y9ZA 1YIJI 5C4XJ 1Y8QB 2HQ5A 3BR6A 1R58A 5EGOA 2V26A 2EH3A 1R5GA 1T08B 1IRXA 4A3KJ 2M8EA 3F6OA 5BMZA 4KJZA 4U87A 1O7LA 2VQHA 5K1YA 4EGZA 4E7HA 4HAMA 3ONQA 5A2QK 1LDDA 3L2UA 1D3YA 3W6KB 3FHNA 3F9KA 1H9GA 3BPVA 1QVUA 5BPDA 4XSXF 4O3MA 1IN6A 4AIDA 3MFKA 3OYEA 4B44A 4NNJA 2EA2A 1WKMA 2CQNA 3E3VA 1Z3XA 5HS7A 1LNWA 5H2FC 4HNVA 1FLIA 5J8FA 3HEFA 2FSWA 3OIQA 1Q1VA 5HDNA 2P81A 5DTDA 1Y8RB 2RKHA 2KMUA 1FNNA 1X1BA 2M3AA 4M3EA 2MD5A 2GQQA 4EJUA 4QPQA 3GUDA 5EF6A 3DEUA 4KYWA 2L2OA 3JRIA 1XC5A 3VYRB 4L9JA 1JKQC 2NAZA 4GFBA 2DT5A 4HNUA 2STTA 3AL0B 1G3YA 2DA6A 2V9PA 3VB2A 3CCMI 1KYZA 3M8EA 1FOYA 4R1HA 2XF6A 2H6BA 3HRUA 2IA2A 5GTHC 5FKNA 2KISA 1EH6A 5HLIA 4N9IA 4P96A 1V3FA 1UHWA 4IVNA 4M71A 4D7MA 5E3MA 2J5OA 3T8TA 3EDPA 4S05A 1WJDA 2DA5A 2JUCA 2Z5UA 3W6JB 5KAIC 1NG7A 2L9VA 4FE7A 2OPTA 1FIPA 2DA7A 4UB8C 3A2KA 3HSEA 3AAFA 2QSHX 1TWHJ 4HLYA 2A6HF 2IVMA 2O03A 3C2BA 1S7OA 3PJRA 4XLPF 3TBIA 3GEZA 1NK2P 1HKQA 2FMYA 1KA8A 5M5YJ 1HBXG 1S3JA 5E3LA 2O9LA 2KFDA 4AIHA 5EGOB 1F5TA 2DJNA 4CYCA 3MMYB 3HM5A 3ESWB 3QQAA 4HDUA 1HA8A 4RGUA 4F52A 3TQNA 2YPRA 1ZG1A 3D5LA 1R5ID 3LSRA 4OMZA 5EG0A 2STWA 1JT6A 2LP0A 1WQ2A 1HW2A 2R7DA 2YUSA 5HLGA 4AWXB 3LWFA 4JX6A 2Z1DA 3GMEA 2E1CA 3T8RA 2K9LA 4N4NB 2Y9YA
chains in the Genus database with same CATH topology
2KFDA 1UZCA 2B7EA 2DOFA 2K85A 2KIQA 2JUCA 2KZGA 2KISA 2DODA 2L9VA 2DOEA 4FQGA 2LKSA 2E71A 2CQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KFD A;  1UZC A;  2B7E A;  2DOF A;  2K85 A;  2KIQ A;  2JUC A;  2KZG A;  2KIS A;  2DOD A;  2L9V A;  2DOE A;  4FQG A;  2LKS A;  2E71 A;  2CQN A; 
#chains in the Genus database with same CATH topology
 4F93 B;  2JUG A;  3RQI A;  1D5Y A;  4XKW A;  4PK4 A;  2QGU A;  3EPZ A;  3GZ5 A;  5J1U A;  2QEX I;  4RAY A;  4OAY A;  2D1V A;  5D8K B;  1MND A;  3V7R A;  2AQE A;  4KN7 X;  4E7I A;  1X2N A;  3DPU A;  2Y75 A;  2UV1 A;  1QBJ A;  1ETK A;  2Z9O A;  1WJE A;  4FT8 A;  2M30 A;  2KJC A;  4L5I A;  2LK2 A;  1O3T A;  1KYW A;  3FXM A;  2PJP A;  5GPA A;  3KLO A;  1SMY F;  4ZZL A;  1Z1D A;  2HFH A;  3ZRG A;  3MVP A;  1IZ1 A;  5F6F A;  2GZW A;  1RPW A;  4IO9 F;  3DKY A;  2A61 A;  2ZSI B;  3MEX A;  2K40 A;  5K7F A;  3GWZ A;  3F21 A;  3CO7 C;  1W5T A;  4ZC3 A;  2DMQ A;  3FXJ A;  4CSW A;  2FJ1 A;  1CF7 A;  4OU0 A;  2ZJR F;  2UZK A;  1TWC J;  2PQ8 A;  3IRR A;  4LB6 B;  5BOX A;  2KIM A;  1LVK A;  1S6L A;  1PUF A;  2KIU A;  1U9N A;  2QZ8 A;  2MYS A;  4EEF G;  4ZYG A;  2GBY A;  2WAQ A;  2IGM A;  1LUJ B;  1F43 A;  4BGD A;  4HX4 A;  1VQP I;  4W1U A;  1E3O C;  2NVY J;  2BZT A;  3IC7 A;  2R7V A;  4NQW A;  3WTZ A;  1Y0N A;  5F64 A;  3RTR A;  4ENK A;  2RVC A;  1UHM A;  1I5Z A;  1V5E A;  3GFJ A;  3H5R A;  2XB0 X;  3O3K A;  4YRV A;  1LJ9 A;  1FOW A;  1YJN I;  2HQR A;  3S2D J;  5IT3 A;  2ZME B;  1BJZ A;  1OYI A;  3L7W A;  4CGZ A;  2OTJ I;  2R7R A;  5J47 A;  3ML6 A;  2IJL A;  1ZR4 A;  1OIS A;  4N9H A;  2HZT A;  2OU2 A;  3KZI C;  2CW7 A;  3MKW B;  2FF4 A;  2CFO A;  1IXS B;  5E1X A;  5J8C A;  3S8P A;  3W2A A;  4HNT A;  1IV8 A;  4AVZ A;  5E20 A;  2ZKZ A;  1G3T A;  1MIJ A;  2DA1 A;  1JI8 A;  4N0B A;  3EUK L;  2M8G X;  1UFM A;  3JR9 A;  1IGN A;  1YO5 C;  3A1Y A;  1IO2 A;  2QF7 A;  3OYC A;  1J59 A;  5F1J A;  1FPQ A;  4M6Y A;  3OYI A;  3ZPL A;  4BHP A;  4XBF A;  3I55 I;  2KZG A;  2ZXJ A;  1ACI A;  4BKX A;  3BG5 A;  4AU7 A;  5KK1 A;  3RKQ A;  2FUG 2;  2RNJ A;  1FTT A;  3A0H C;  1T8I A;  1K7A A;  3BOQ A;  1TWA J;  4CO8 A;  2OCC H;  3OV8 A;  3LAP A;  1QRY A;  3K70 C;  2QUF A;  4YEL A;  4A6E A;  1YJW I;  1RET A;  3OMY A;  2VXD A;  1X1P A;  3DPL C;  2ETH A;  3S3M A;  2HWV A;  5JFR A;  2VPR A;  3MZ8 A;  2DO7 A;  4CCO A;  2YU3 A;  1B59 A;  2VOO A;  1LVA A;  2HQN A;  3L2Q A;  3V8J A;  4JYK A;  3BR2 A;  1TP4 A;  2F6C A;  2JVH A;  4ZDO A;  2HI3 A;  2YR2 A;  3BP8 A;  3J81 K;  4ZTJ A;  1PDN C;  1QZZ A;  2D2W A;  2ISY A;  3CLO A;  1FTZ A;  1JUP A;  2JK3 A;  4RB3 C;  1YOV B;  3ABM H;  2OCE A;  3ERE D;  3RSN A;  2ECB A;  2BXY A;  2IA0 A;  2EV0 A;  4UVC A;  3WHC A;  2KPM A;  4BEH A;  2O7O A;  2QM3 A;  3KET A;  4MEX F;  1NK3 P;  2LDU A;  4AC0 A;  4DBQ A;  1GXP A;  3I4M J;  4A3L J;  1SFO J;  1XN7 A;  3CMA I;  3JTG A;  1FBQ A;  2ELH A;  1BIB A;  3DLL F;  2EIK H;  1X19 A;  1JJ6 C;  1XCV A;  2MH2 A;  1E3H A;  2ZBK A;  2JA6 J;  3GTK J;  4YEJ A;  3I3L A;  3K10 A;  2L3D A;  3KCC A;  3I58 A;  1B72 B;  5LEJ A;  3H0G J;  2W84 A;  2GA1 A;  3BCA A;  1R1V A;  1V5G A;  2FBK A;  2VUM J;  2XAF A;  1ODD A;  2RAE A;  3GF2 A;  3HUG A;  4KIB A;  4NHJ A;  2V9V A;  1IRZ A;  3RQ4 A;  1SFE A;  2BV6 A;  3H5A A;  4G94 A;  4DW6 A;  4KIT B;  1R71 A;  1JT0 A;  1MNE A;  1VTN C;  4IRH A;  3ZQI A;  3KLN A;  5D5U B;  4LIT A;  4LK1 F;  3JRB A;  4IHT A;  2VL8 A;  1YX5 A;  2M0C A;  3DKX A;  2NS8 A;  3OYM A;  1Z77 A;  5HDK A;  3GCM A;  3MQ0 A;  2VOP A;  2VLA A;  3FBI B;  4CA0 A;  3V8K A;  1T98 A;  1XGO A;  1SD5 A;  1ZKG A;  5JI6 A;  1TL8 A;  1LFB A;  2DMP A;  5D5W B;  3W3C A;  2LBF B;  2JT1 A;  2LBF A;  1A6Q A;  2P7V B;  1Z91 A;  2L7F P;  5DUK A;  2Y2Z A;  2M4G A;  4G7H F;  3MZH A;  1B9N A;  4DQ2 A;  3LA2 A;  3RKY A;  4EJV A;  5DDG A;  3L9F A;  2ZJQ F;  2DA2 A;  1BI2 A;  3OIP A;  1Z7U A;  2XAG A;  2CQX A;  1T6S A;  3JRC A;  2NOG A;  1QHG A;  2RQP A;  4IEJ A;  3GYH X;  5D6E A;  5B5E C;  1N25 A;  2COB A;  1UAA A;  2QKM B;  5F0C A;  5L3D A;  4FAS D;  3HOY J;  1JGS A;  2XAQ A;  3RPQ A;  2AXL A;  2E35 A;  2FRH A;  3PNY A;  4GO1 A;  1TNS A;  3DP7 A;  2NVU B;  3HUG B;  4E7K A;  3L2C A;  2R7F A;  3LSI A;  3WTV C;  2FA5 A;  2HDC A;  2LYC A;  4HX7 A;  1RUN A;  2G0E A;  1WJB A;  2QQ8 A;  1JKO C;  4IHS A;  4BHB A;  1ZLJ A;  3TP0 A;  1DU6 A;  1YI2 I;  3HRM A;  3ZXS A;  1P92 A;  5LEK A;  2JWT A;  4OIR F;  2EV6 A;  4FE4 A;  2MAB A;  4MGR A;  1IXC A;  2VJI A;  1KZH A;  1OCT C;  3LSH A;  5M3M J;  4M9X A;  5C3E J;  2KLO A;  2GIZ A;  5B3S H;  2HTJ A;  2YX7 A;  3JSO A;  5FB2 A;  2ZO4 A;  3S2W A;  1YW9 A;  2EJR A;  4ZJZ A;  3GTG J;  5E8I A;  1DGR M;  2JVG A;  1Y1V J;  2IBD A;  4NDL A;  2ZFW A;  2XRL A;  1RNL A;  4M3F A;  4J00 A;  3DKW A;  4YFX F;  2DBB A;  1TW3 A;  5CVV A;  3SEZ A;  1FX7 A;  1LPQ A;  3CF2 A;  1RUO A;  5CQE A;  4G12 A;  4RB2 C;  2DA4 A;  2GLO A;  3SJM A;  3R6S A;  1HDD C;  1HDP A;  4M9Z A;  2H8W A;  3E5Q A;  2A5Y B;  1NH3 A;  2IEK A;  1LFP A;  2LVS A;  4EAT A;  1TC3 C;  4JBA A;  1VFC A;  2CG4 A;  1SFK A;  2LTP A;  3PQJ A;  3WE2 A;  1BW5 A;  4E6K G;  4IQJ A;  2JQ7 A;  2OUM A;  2Y0M A;  1ON2 A;  5F27 A;  3P9C A;  1ZAO A;  1XDU A;  4EVI A;  1X1C A;  2A5W A;  2DXI A;  5AON A;  1WJ5 A;  1ZQ3 P;  3C1D A;  3LSJ A;  3OR1 C;  2COM A;  4P5O A;  1HCR A;  2LNB A;  3F6V A;  2QKL B;  1FSE A;  2LKP A;  4RS8 A;  1VF9 A;  1YFH A;  3E6M A;  4HF0 A;  1Z3Y A;  3HOS A;  1NHA A;  4BJ6 C;  2HYJ A;  3EUH C;  3JCU C;  4B48 A;  1MH4 A;  5HOO A;  4BBS J;  4XON A;  3KYD B;  3GTP J;  2LLK A;  3FIW A;  2K4B A;  3MWM A;  2M34 A;  3ZMZ A;  3ZOB A;  2WAQ N;  2Q1Z B;  2X0L A;  3BZK A;  3Q5F A;  4RGS A;  1HW5 A;  4XKV A;  3CC2 I;  5EYR A;  2P5V A;  2CH0 A;  3DTK A;  4UNO A;  2HXI A;  3MKZ A;  1BC7 C;  3DLA A;  2QA4 I;  2ZME A;  4XN0 A;  1MNM C;  2XAU A;  5JHU A;  5DEQ A;  2F5D A;  3FM5 A;  3IKV A;  1U5T B;  2K7L A;  1ENH A;  3H9G A;  3I64 A;  4M9S A;  3BR5 A;  1K6O A;  2R7T A;  1WCM J;  4BY1 J;  2EIN H;  2FBH A;  1K4S A;  4ZDP A;  4IRG A;  3F3X A;  1ZRD A;  3FXL A;  3HRT A;  4X1E A;  5IYC J;  1F1Z A;  2BHY A;  2JPB A;  2E7W A;  2BY0 A;  4M3B A;  1JE8 A;  4YFN F;  3HZJ A;  3OYF A;  2NNY A;  3S1Q J;  3K1N A;  1CF7 B;  3G3Z A;  3JW4 A;  4FHT A;  3RYR A;  4KFC A;  4G6Q A;  3FXU A;  2QBY A;  2R7S A;  2QQB A;  5FLM J;  3CD6 I;  1JXS A;  2VJ5 A;  3H0D A;  1YTY A;  1BN5 A;  3HSR A;  1T2K A;  5J1Y A;  1D0Z A;  2Z3Y A;  1O7F A;  1QNT A;  4RLF A;  3CUO A;  1FWZ A;  4AUX A;  4AIJ A;  1YIT I;  1FYL A;  1GUU A;  3A0B C;  3DQV C;  1VI0 A;  3I9V 2;  1R9T J;  2BYV E;  4MFE A;  2Z33 A;  5D4S A;  1J0R A;  1YQA A;  1BW6 A;  1D0Y A;  5IP9 J;  2PMZ N;  5HVQ C;  1OCR H;  3CCV I;  1P6R A;  1VQN I;  1XG1 A;  3LQR A;  2VBY A;  3K1M A;  3NWT A;  1MJ9 A;  3BG9 A;  4UUS B;  2EIL H;  4A3M J;  4JOM A;  1AKH B;  2JA7 J;  1OFC X;  1ETW A;  3S1R J;  4A93 J;  1KU3 A;  3VSL A;  1R4N B;  4XNF A;  4C2U A;  2DMU A;  4RM2 A;  2DDB A;  4Z6Y A;  2V7F A;  2DT7 B;  3VOE A;  3JSP A;  4WF2 A;  3H3Z A;  2LKS A;  1BI1 A;  2VC1 A;  1SMT A;  2X6W A;  4L0Y B;  5LHH A;  2CQK A;  4I76 A;  5IPA A;  1MSF C;  1OLT A;  5IP6 A;  3F8M A;  3TP3 A;  1HC8 A;  5CVR A;  2VKV A;  2ELJ A;  1UG2 A;  2PBI A;  3JAM Z;  3MCZ A;  3ERM A;  4C3J J;  5ICF A;  2EBI A;  4DJA A;  4KT6 A;  1XMX A;  5EEH A;  3SXY A;  3RZD J;  1YJ9 I;  2UXN A;  4G7Z F;  4CCM A;  4II3 A;  2BHZ A;  3O6B B;  4CYC B;  4XRS A;  2XF5 A;  3HOZ J;  4A2U A;  2PMH A;  5D4R A;  2LY1 A;  2CRG A;  5DV5 A;  4DOZ A;  3A01 B;  4G6D A;  2ME0 A;  3TO6 A;  4DGW B;  4I09 A;  1U9O A;  1W4M A;  3KP2 A;  5LGT A;  3PL8 A;  3OS2 A;  4BNC A;  5LLQ A;  1I3A A;  1RKT A;  4DYR A;  3JRA A;  3ZP5 A;  4Y33 A;  4LIU A;  2M45 A;  4WX9 A;  1IRG A;  1ETX A;  4XR6 A;  1XSD A;  1IN5 A;  4IHV A;  4BYY A;  2G7U A;  4EMS A;  2HOT A;  3HPG A;  3K69 A;  4GCV A;  3LSP A;  3P9K A;  3E6B A;  2R7Q A;  5FRN A;  2ZJ2 A;  3RIR A;  2IP2 A;  2V1U A;  3CQZ J;  2L0K A;  3FM3 A;  3M4O J;  3R4K A;  1QU3 A;  2ZNY A;  1YS6 A;  1YW8 A;  3O8H A;  3FK7 A;  3BR3 A;  4LFU A;  1R7J A;  4I02 A;  4ENM A;  1FP2 A;  4XRM A;  1APL C;  4O6J A;  1B9M A;  3LOC A;  4JK1 X;  4MIM A;  1DPR A;  2BVL A;  1JTY A;  1MBF A;  1OCC H;  3K9T A;  5BNG A;  3JRE A;  3HOU J;  1AA7 A;  1S8N A;  1R4M B;  3P5J A;  1H89 C;  2O3F A;  3QAH A;  3C2H A;  2H09 A;  4G6T B;  4ZZD A;  1PVE A;  2GIV A;  4KT5 C;  4D1Q A;  4BU2 A;  1JKR C;  2EV5 A;  1MD0 A;  2WY7 Q;  1PUE E;  1LEB A;  3HGY A;  1BM9 A;  1X2M A;  3H1C A;  3CMY A;  1U3E M;  3TDZ C;  4HQE A;  3OSF A;  5DD4 A;  1T56 A;  3H3V K;  3H3U A;  1Q1H A;  4JQF A;  3OSG A;  3V42 A;  1N75 A;  1PP7 U;  3DEW A;  3V7C A;  1MSE C;  1OYY A;  1ZG3 A;  1PP8 F;  1VQ6 I;  2XRN A;  4XLF A;  1TT0 A;  4GGG A;  2FX0 A;  1KU9 A;  2EA4 A;  1BBY A;  1W7P D;  1VQM I;  3GTM J;  1BJA A;  4NC6 A;  3V8L A;  2CMP A;  4BBR J;  2WV1 A;  4F3Q A;  3GLX A;  1XSX A;  5L3C A;  3IAM 2;  3X2Q H;  3CCL I;  3QOP A;  2WV0 A;  1UST A;  4G7O F;  3ABT A;  2CFX A;  1G3S A;  5DUI A;  1F9N A;  3OYB A;  1U0J A;  4D0P A;  5HNH A;  4DZP A;  1ZEL A;  5GP9 A;  5TIS C;  1ZR2 A;  4Q48 A;  2ACJ A;  1JKP C;  2LOO A;  5JHF A;  3EYI A;  3JRH A;  5IT9 Z;  4EM2 A;  5L3F A;  3SYT A;  3S15 J;  1BR2 A;  4NC7 A;  3BTI A;  2X1E A;  4Q4Z F;  4LIV A;  2XUB A;  4D7N A;  4LK0 F;  3W6V A;  2GAU A;  2CU7 A;  1BR1 A;  3PIO F;  1D5V A;  4HX8 A;  3P9I A;  5LGU A;  3ABU A;  4L9T A;  1Z05 A;  1HKT A;  2NS0 A;  2XAS A;  3E7L A;  1XMK A;  4M3G A;  3I5U A;  2M4K A;  2RV8 A;  1LDJ A;  1B72 A;  3BT9 A;  2FXA A;  4UUV A;  5TJJ A;  1POG A;  4HST A;  4CUG A;  3GW2 A;  5ICC A;  3BLY A;  4LG0 B;  2XGE A;  2M7A A;  1E2X A;  1ZLK A;  5AIQ A;  3L2W A;  2RGV A;  4BJT A;  3HXL A;  4ABZ A;  5LBQ A;  2E2J J;  1KQ0 A;  3ASO H;  1TT5 B;  1GVD A;  2RN7 A;  1T39 A;  2DJI A;  1SD4 A;  1FBS A;  2F4M B;  5GAE J;  2HKO A;  3J7A O;  1R1T A;  1W5S A;  2OZU A;  3ABL H;  2BBY A;  3FIS A;  4PJM A;  3ISP A;  2IA1 A;  2FEZ A;  3K0L A;  3QU6 A;  3Q0W A;  3OYA A;  1X3U A;  1J2X A;  1AHD P;  1P4X A;  2PG4 A;  4GYI A;  3VDX A;  4Y3O A;  5K7Z A;  2X1D A;  3ZQQ A;  3UKG A;  2A3S A;  4AD9 A;  5IOY A;  4DBR A;  2E71 A;  1VQO I;  1T95 A;  2ZNZ A;  3CUQ B;  3W2V A;  5KNL A;  3SZP A;  1LKX A;  2R5Z B;  4WXC A;  2XKP A;  3WGI A;  3I59 B;  2YS9 A;  3M07 A;  3GFI A;  2E36 A;  1G59 A;  4PDK A;  1X4P A;  5IY5 H;  3DPT A;  3HOW J;  1P2F A;  1DGW Y;  4FQG A;  1FMW A;  4BXF A;  2E2H J;  2HVR A;  3HSF A;  5CVI A;  5EZH A;  4OAZ A;  2F5V A;  2HPM A;  2W7N A;  2HNH A;  3GTJ J;  2WAE A;  1AOY A;  4OIO F;  3ZCO A;  5KVR A;  2F4I A;  1MH3 A;  4XOR A;  5K5O A;  4BQN A;  2O61 A;  5BPI A;  5M5W J;  3QP6 A;  3G1L A;  3SZT A;  2XC7 A;  3O8G A;  1ERD A;  1WWX A;  2BW3 A;  3BY6 A;  4IL6 C;  3CES A;  1BIA A;  1D1B A;  1Z7L A;  2BXZ A;  3ZMT A;  2HR3 A;  2XPW A;  2PLY A;  5IYD J;  1I3Q J;  3W2W A;  1DDN A;  4IHY A;  3LQQ A;  5TGT A;  1R36 A;  2AXT C;  2RNG A;  2DI3 A;  3TMO A;  1X58 A;  3H35 A;  1YLF A;  3BZC A;  1DP3 A;  1FSH A;  3IWZ A;  4NQW B;  4X0G A;  3AG4 H;  1Y1W J;  2VOD A;  2VAS A;  3GVA A;  4XRS G;  2VT3 A;  1YYV A;  1EJ9 A;  2XDV A;  4LOC A;  1W0U A;  3RI4 A;  2E1O A;  1RI7 A;  2GM4 A;  2VE9 A;  4XLC A;  1G2H A;  1DU0 A;  2KJB A;  5LD2 C;  2E7X A;  1ETV A;  3C7J A;  3VFZ A;  5DM7 F;  3M1C A;  4B1R A;  2VI6 A;  2JA5 J;  4PFP A;  3NEU A;  2PN6 A;  1MDM A;  2V6C A;  3CC4 I;  2CYY A;  3SZG A;  4KDP A;  1T33 A;  1I39 A;  5LGN A;  1WH5 A;  1P4A A;  2VT2 A;  1Z9C A;  2DOA A;  4NB5 A;  1YE9 A;  3IUO A;  4S0H B;  3H9Q A;  5K5Q A;  1LB2 A;  5F08 A;  4Y17 A;  2X48 A;  2LSO A;  2X85 A;  4GXO A;  3B6C A;  3GZ6 A;  1R1U A;  1MKM A;  3FXK A;  5C44 J;  2Q0O A;  4NBQ A;  4BAC A;  1FC3 A;  2VBW A;  3HC7 A;  3CCS I;  1I27 A;  3U1K A;  2CUE A;  2K9N A;  2R4G A;  5FKO A;  4J01 A;  4ASN A;  2ESN A;  5ED4 A;  1P7I A;  1QVT A;  2LMD A;  1IV6 A;  3HIF A;  2P6S A;  3SDG A;  5L3G A;  2EK5 A;  3A03 A;  3IWF A;  3K4M A;  1N77 A;  2I10 A;  3E6C C;  3Q9S A;  1G6N A;  1A5J A;  3JAM K;  2NYX A;  5FKK A;  1P7J A;  3ELK A;  1SC7 A;  3GFL A;  3BJO A;  4CCL A;  1DPU A;  1K6Y A;  4MFD A;  2JN6 A;  2VBX A;  3K7A J;  3FX3 A;  3P7N A;  2LC2 A;  3KZZ A;  3TOA A;  2ME6 A;  3OS1 A;  3N97 A;  2HVQ A;  3BR1 A;  4L5E A;  2W24 A;  3IH4 A;  3VSK A;  2HDD A;  3DTE A;  3FWE A;  3FZV A;  3NAR A;  3VWB A;  1RRJ A;  1FIA A;  1Z6T A;  3DV8 A;  2CSO A;  2KQR A;  2E34 A;  1IRF A;  1BI3 A;  2MFZ A;  2PJR A;  1JUS A;  3CCJ I;  1A04 A;  3FKJ A;  5FD6 A;  3RKW A;  2L7K A;  2GXB A;  4A3G J;  5HLT A;  1MMA A;  3Q9V A;  2G9W A;  1YG2 A;  2HDW A;  2F5E A;  1FBU A;  3OWT A;  3KYL A;  2GXA A;  3QRF F;  2X9D A;  2MG4 A;  3CME I;  4OMY A;  2A68 F;  3DWL E;  1IDZ A;  2JSP A;  2HS5 A;  3NAU A;  2OF7 A;  5HS8 A;  3E5X A;  5ILV A;  1BOA A;  3BRO A;  1O3S A;  4P9U A;  4ON0 A;  1KON A;  4UVB A;  4QPO A;  4ESJ A;  1BC8 C;  1OQY A;  4ENJ A;  2B9S A;  1ITY A;  4PFO A;  5GAG J;  2AQF A;  2IS6 A;  2DT6 A;  4C2T A;  1NG6 A;  2ELK A;  4N4O B;  3WGG A;  3QOD A;  2WBM A;  4M74 A;  3FMR A;  3BTC A;  3I54 A;  5IOZ A;  3AG1 H;  1XS9 A;  2H8R A;  2R7O A;  4PJJ A;  4BDZ A;  2FNP A;  1FOX A;  2XF7 A;  2KIF A;  3U2R A;  2XRO A;  2CWE A;  3GXO A;  3KEQ A;  5DM6 F;  2VKH A;  2DFF A;  1BOB A;  4H4K C;  4IX7 A;  3G71 I;  4D9J A;  4R79 A;  4BUP A;  2L4M A;  2HPI A;  2MLG A;  5CYV A;  3PSI A;  3HPH A;  1EV7 A;  2FD5 A;  1S72 I;  4FCY A;  2DPU A;  1OR7 C;  4DYQ A;  2R0Q C;  3LNQ A;  1L3L A;  5HOD A;  3WHB A;  1EF4 A;  3CDI A;  5ICG A;  2ZSH B;  1V4R A;  2NXN B;  5J6X A;  1OKR A;  3F8B A;  3TO9 A;  5GTI C;  1VND A;  2VXZ A;  1XGM A;  2MD0 A;  2O8X A;  2P0W A;  3TGN A;  2E1N A;  3CJQ B;  4BXX J;  2HU9 A;  2HTS A;  4UHT A;  3DBL B;  2V1D A;  1LE8 A;  1UZC A;  1WJC A;  2O0Y A;  4HEA 2;  1JHH A;  2HOS A;  3K4L A;  2HXO A;  3VPR A;  3SDB A;  4BAY A;  1ZH5 A;  2FE3 A;  3R0A A;  3SFI A;  4HRI A;  3G2B A;  1SVM A;  1G3W A;  2JJ7 A;  4HOB A;  5HLH A;  3PQK A;  2CV2 A;  3EUA A;  3OYJ A;  3EQL F;  4CHU A;  2HZD A;  3SHF A;  4DNC A;  1HST A;  2L9R A;  4PJL A;  2PMU A;  4Y52 J;  1GLN A;  1H0M A;  2QWW A;  1YRN B;  2DDA A;  2W48 A;  5K5R A;  1I6H J;  3FXR A;  3BG6 A;  2CV0 A;  4BQA A;  1FOK A;  1ZRF A;  2QSG X;  3CJN A;  3I0T A;  1WGX A;  1U8B A;  4OIN F;  3GZN B;  2Q2E A;  4EM1 A;  2LR8 A;  2O8K A;  2DYR H;  3L2R A;  5EEA A;  1XX5 A;  2K9S A;  4MHG A;  1UEL B;  2IGK A;  3J7Y J;  5FRO A;  2F5F A;  3FHZ A;  3S3O A;  2DOF A;  1KU2 A;  2DTR A;  2KL4 A;  3LA7 A;  3WG7 H;  2R7X A;  4XOT A;  2DOD A;  4PJ0 C;  5C4J J;  2R7W A;  1FEX A;  1B8I A;  2P8T A;  4XKC A;  4XM3 A;  4GDF A;  1PJR A;  3G6E I;  4ZYE A;  3AG3 H;  1YX3 A;  2BY1 A;  1TW2 A;  3TKY A;  2F4O B;  4LLG F;  2R93 J;  1TNT A;  4D5F A;  4DIQ A;  2Y30 A;  4L0Z B;  1GXQ A;  3FKI J;  1A31 A;  4JP0 A;  4A3D J;  4BE2 A;  4K2E A;  1X4O A;  5FKL A;  2EPF A;  1K61 A;  3O2P E;  4E7Z A;  1GHC A;  1B1B A;  1ORK A;  1CGP A;  4BQQ A;  2DW4 A;  4CZZ A;  4DYC A;  2E19 A;  4G9Y A;  4ZDL A;  2V9K A;  2NVT J;  4KIG A;  2E1M C;  2E5Z A;  1MJA A;  5FRM A;  2M7B A;  1W7P A;  2PMZ A;  2E5N A;  1VQ7 I;  1T0F C;  3BWG A;  3CJR B;  3D0S A;  5TRD A;  3WTS C;  1MGT A;  2N8G A;  4ETS A;  1OPC A;  1WI3 A;  2ZCW A;  4M6V A;  1TWG J;  2GWR A;  3KE2 A;  4NC8 A;  5DCM B;  2XGD A;  1K4T A;  2FOK A;  3GTQ J;  2KRF A;  1V54 H;  1M1E B;  4XSZ F;  3L00 A;  1EH8 A;  3I71 A;  3AFH A;  1SD6 A;  3WU1 B;  2EQR A;  2LY9 A;  3EYY A;  1D8K A;  4IOA F;  2WAF A;  1SEU A;  1UB9 A;  1T0F A;  1SFX A;  1U6G A;  4CDG A;  3V4G A;  4LMY A;  3KPH A;  2ZXH A;  5FFX A;  2KRC A;  4C9Y A;  4XLE A;  3ZQL A;  3D1N I;  1RKW A;  4PGH A;  2ZXW H;  4A3B J;  4KMF A;  2OC6 A;  4P1W A;  3MAJ A;  4YIR X;  2L4A A;  2EZL A;  2DFH A;  1JHF A;  3RCO A;  1UJ8 A;  2VJJ A;  3HL2 A;  1MZB A;  1PYV A;  5FLX Z;  3TW7 A;  3GX4 X;  3WTY C;  1KGS A;  2Y0S A;  3BTJ A;  2F5C A;  4XOP A;  2EFN A;  2VQL A;  3BCB A;  2XSJ C;  3I53 A;  5KAF C;  5JVG F;  1HLV A;  5FLV A;  4A3E J;  2LF8 A;  2CUF A;  6PAX A;  4A3J J;  3GTL J;  2CO5 A;  2VON A;  2H1L A;  1BR4 A;  1Y56 A;  2BW3 B;  3J7Z I;  1VQ9 I;  1XCB A;  1OJL A;  3CP8 A;  2R7U A;  2NRA C;  4IRI A;  1I50 J;  2DMT A;  1O57 A;  2OJE D;  4FX0 A;  3ZMD A;  1D1C A;  1K78 A;  3BR0 A;  5FJ8 J;  1LFU P;  3OL4 A;  3U9G A;  2IPQ X;  3OYL A;  1IDY A;  1O3R A;  2C6Y A;  1YS7 A;  2RQQ A;  4LG3 A;  1DQU A;  4A6D A;  4RA2 A;  1FT9 A;  1V55 H;  4A0X A;  5GPC A;  3OS0 A;  1E0E A;  4HZF A;  3FMS A;  1E3P A;  2OTL I;  1VZ0 A;  2MC4 A;  3OYD A;  3WTW C;  5HDG A;  2DOE A;  2A6E F;  2Y31 A;  2EB7 A;  5H6Q A;  2IGO A;  2RRE A;  2BOL A;  4ZH4 F;  1DUX C;  1WI9 A;  2K3P A;  2QVO A;  3CMM A;  2R5Z A;  3TOB A;  4Y13 A;  4WCG A;  4QTR A;  3FXQ A;  2M2E A;  2DLL A;  3KP7 A;  4DZJ A;  4U7D A;  3E5U A;  5ILS A;  2H6C A;  1J09 A;  3F8F A;  3Q3S A;  4KUM A;  3FDY A;  5HS9 A;  3RDI A;  2NOJ B;  2Z99 A;  2WC2 A;  3ASN H;  1OCP A;  3PNV A;  2YU9 J;  4U88 A;  4TV7 A;  3DEE A;  4HPQ A;  1H88 C;  4U0V A;  3OL3 A;  2HEO A;  1QGP A;  1W0T A;  2CGP A;  3RKX A;  2M0M A;  2EZI A;  2XPU A;  3QPL A;  4P55 A;  4I0A A;  3HG9 A;  5DCM A;  2ZJP F;  5H20 A;  1LDK B;  5FLX K;  2LRD A;  5ERI A;  5J3L A;  3CDH A;  3K1P A;  2R5Y B;  3U21 A;  3WG9 A;  4B3A A;  5LHG A;  2QCO A;  4U0W A;  3EET A;  3WTT C;  2LKX A;  2ID3 A;  1QA6 A;  3DXJ F;  2ISZ A;  2JTV A;  1GV2 A;  3CUQ C;  3QYE A;  1A35 A;  2IS1 A;  2K5C A;  3PM1 A;  2P6T A;  4MO7 A;  3VYT B;  2D5V A;  3HTS B;  1Z67 A;  2EFO A;  3WTU C;  3PUB A;  4XL9 A;  1Z6R A;  2IRF G;  5EEG A;  4JX4 A;  4FX4 A;  2DPD A;  2KDZ A;  2AO9 A;  4PZJ A;  3ZGK A;  3LAJ A;  3ZMS A;  3I4P A;  5F1R A;  2IS2 A;  1D8J A;  1B8I B;  1U8R A;  2DTZ A;  1VQ4 I;  1QPI A;  5FGM A;  4BL0 B;  2OQR A;  3MKL A;  2X6Y A;  3WTX C;  3PIP F;  1AWC A;  1ZG5 A;  2DU9 A;  4JX5 A;  1J9I A;  2ECC A;  1MBE A;  2JRT A;  2L7M P;  1YW7 A;  3HYI A;  1IW7 F;  2Q2E B;  2PEX A;  3IV5 A;  2CW8 A;  1MMS A;  2KHM A;  2V6E A;  4B43 A;  1EH7 A;  2NS7 A;  3CCE I;  1TTY A;  4ENN A;  4XLN F;  3E97 A;  1XDS A;  3M8J A;  1YRN A;  4MNU A;  4IOC F;  1R5H A;  2W85 A;  4II2 A;  2QQA A;  2KRH A;  3HKZ N;  1IXR C;  1WHU A;  1MMD A;  1IG7 A;  3D5S C;  5FO5 A;  2RC4 A;  2MH9 A;  4BE0 A;  4ZTF A;  2X1C A;  2BVM A;  2XIG A;  3DFG A;  1YHQ I;  4HBL A;  1VQK I;  4I6Z A;  3K4B A;  3TL4 X;  4U0Y A;  5LRR A;  4CIC A;  5DS9 A;  3I4N J;  3BDD A;  4I98 B;  4B4C A;  1UCR A;  3KP6 A;  5DD8 A;  3C18 A;  2IGN A;  5B1A H;  3BJ6 A;  1X3W B;  4PSX A;  2XGC A;  4A0Y A;  3HB9 A;  1J75 A;  1RR7 A;  1X3Z B;  3FXO A;  3E0J B;  4MQ9 F;  4FTH A;  2BY3 A;  4FIS A;  3PO2 J;  3J7A Y;  3D5R C;  5KHD A;  1K83 J;  1ZAR A;  2R5Y A;  1IJW C;  5JR3 A;  2PX9 A;  3DBH B;  3HJE A;  2GXG A;  3IL2 A;  1RR8 C;  1Y0U A;  1CQT A;  3ROU A;  2Z2S B;  4AIK A;  5IT9 K;  1P9Q C;  2CV1 A;  1I1G A;  5DCF A;  2VBZ A;  4HYE A;  2DAO A;  2DCE A;  4OIP F;  4BH9 A;  4YG2 F;  3S93 A;  3LA3 A;  4XK4 A;  4V19 K;  2E60 A;  2ZB9 A;  1W36 D;  3K4C A;  3QYF A;  3RPU D;  5CKT A;  4BS9 A;  2GOM A;  3IH3 A;  4U7B A;  2LG4 A;  4RDU A;  2FQ4 A;  3K70 D;  3T5X A;  5FD5 A;  4RB1 A;  2Y69 H;  4EJW A;  1W5C C;  1XSV A;  2JA2 A;  1OCZ H;  2W1O A;  2M9H A;  1S7E A;  3KFW X;  4KIS A;  2L5Q A;  3GTO J;  1MMN A;  2ZC2 A;  3ZQF A;  5FKM A;  2V1X A;  3K2A A;  4F7Z A;  3K4K A;  1VQ8 I;  2KIQ A;  2HGC A;  3J81 Z;  4I2O A;  4EQQ A;  3OYK A;  3OYG A;  1JTX A;  4L18 B;  3QP5 A;  3M1E A;  4EJT A;  1UMQ A;  2XKO A;  1U5T C;  3PUF A;  1A36 A;  1K78 B;  3KX2 A;  2FML A;  3I56 I;  3WGH A;  1O3Q A;  5E79 C;  1KU7 A;  9ANT A;  4MEY F;  2W4S A;  3F8C A;  3V7S A;  5CLS A;  2UUZ A;  4LGW A;  4HW0 A;  2O6G E;  2XAJ A;  1S7A A;  3DTI A;  4CCN A;  2LH9 A;  3A01 A;  1E17 A;  1OCO H;  1QZY A;  3MKY B;  1R6R A;  2HVS A;  1IAW A;  1IN4 A;  3AKZ A;  3VEP A;  2KT0 A;  2XGX A;  1ZGW A;  1KQ9 A;  2EFW A;  2ZFU A;  5E3O A;  3F72 A;  3CJT B;  3ZN1 A;  1K79 A;  3QPH A;  1EKE A;  1QPM A;  3HOX J;  3DF8 A;  1TQM A;  2X4H A;  1D0X A;  4KIF A;  1ZHF A;  1G4D A;  3MZY A;  3OOU A;  3S32 A;  2QLZ A;  4ZYH A;  3G73 A;  3CCQ I;  3A4C A;  3ECO A;  4E7L A;  3BZ6 A;  3K2Z A;  2VN2 A;  2KDO A;  1F4K A;  2X51 A;  2DFI A;  4ESF A;  1GDT A;  4NUB A;  3F23 A;  1F36 A;  5E17 F;  2FU4 A;  4I7H A;  1H8A C;  1TBX A;  2YSR A;  4I0B A;  5LFA A;  1A6I A;  4RAZ A;  1AKH A;  5M3F J;  1TZL A;  3QOE A;  4O5V A;  2YX4 A;  1H9T A;  4C2M J;  3B6A A;  1W7P B;  1HW1 A;  1Y6I A;  3JTH A;  2GOX B;  1BA5 A;  2W00 A;  5GAH J;  2G7H A;  3BQY A;  4A69 C;  5J4Y A;  4A5M A;  1LEA A;  2TDX A;  2OBP A;  1R00 A;  4FET A;  4V2G A;  3J80 K;  1I6X A;  3AG2 H;  2VQC A;  4UV8 A;  1SAN A;  3ZN0 A;  3PO3 J;  3C3W A;  2P5L C;  3CDL A;  3CLQ A;  2VPL A;  2WA0 A;  2ZME C;  4IF4 A;  1MDM B;  3JRG A;  4RAG A;  4KNY A;  3HDD A;  2QBY B;  3KZY A;  4B8X A;  4IHW A;  2JSC A;  3ZQG A;  3CCU I;  3LSG A;  3QPT A;  3S14 J;  1BI0 A;  3WE3 A;  1ULY A;  1XMA A;  1ZTR A;  3TW6 A;  5IYB J;  4E70 A;  2NVQ J;  4GYG A;  4HA8 A;  5IP7 J;  1XPX A;  3DU5 A;  2VC0 A;  3BG7 A;  2E1M B;  2XPV A;  2H94 A;  5LHI A;  1SAX A;  2AHQ A;  3G1O A;  2FBI A;  3ZQH A;  3S1M J;  3H5N A;  2D1H A;  1MBJ A;  2ESH A;  3GLL A;  5K7H A;  1KQ8 A;  4LLN A;  4F92 B;  3B73 A;  1IC8 A;  3S16 J;  2AS5 F;  4MTD A;  5HNF A;  1U5T A;  3LMM A;  3OR2 C;  4P9F A;  2EIM H;  3T0Y A;  1XGS A;  2MA3 A;  3VYU B;  3LSM A;  3OY9 A;  2L01 A;  3BG3 A;  3GO5 A;  2MGQ A;  1HOM A;  2DMN A;  2NVX J;  4M3D A;  4UV9 A;  4I01 A;  1P4W A;  4C3I J;  5E18 F;  1FYK A;  1TLH B;  1WSU A;  2DFE A;  1QO0 D;  1IN8 A;  4HV6 A;  1WZ2 A;  3J80 Z;  2LRE A;  3F22 A;  4Q5S F;  3L09 A;  1XTA A;  2IXS A;  2OAZ A;  1RZ4 A;  2EIJ H;  1ZRC A;  5D5V B;  2MSY A;  2BEO A;  4QSH A;  2OA4 A;  3PFI A;  2BE5 F;  1DP7 P;  3NQO A;  3ABK H;  1ZYR F;  3COA C;  2LD5 A;  5E1Z B;  4XID A;  2GA2 A;  4RBO A;  3IHU A;  1LE8 B;  2B7E A;  1XGN A;  2DQR A;  3L2V A;  4I99 C;  1J7K A;  4YFK F;  3KEY A;  3R0J A;  3CCY A;  3CO6 C;  3TO7 A;  4ZYA A;  3PFY A;  4S04 A;  2VKE A;  3RJP A;  4EM0 B;  4MTE A;  4RB0 A;  3EUH A;  1S9H A;  3UR3 C;  1G8X A;  2V1N A;  1FMV A;  5CJ9 A;  3IKT A;  5DYM A;  4Z2Y A;  1R23 A;  3C2G A;  2V4J C;  3CUQ A;  2VQG A;  3LST A;  2H1K A;  4C3H J;  1FY7 A;  4A5N A;  3IRQ A;  2EWN A;  4KN4 X;  3FK6 A;  1ZN2 A;  2V79 A;  4IHX A;  2EFQ A;  1MBH A;  1XB4 A;  4AM3 A;  1UG0 A;  2WY8 Q;  2IW5 A;  4HLX A;  1WPK A;  4WK8 F;  4CCJ A;  2IT0 A;  2DYS H;  4PJN A;  4F55 A;  2MLK A;  2M1B A;  5F0H A;  4HQM A;  2A05 A;  3CCR I;  1V5F A;  1ON1 A;  5CQG A;  2M87 A;  2XHK A;  4HV5 A;  4XIC A;  5FFZ A;  3F0C A;  4Y4R A;  2P7C B;  2P5K A;  5CVU A;  1HF0 A;  1R49 A;  3LSK A;  3BQZ A;  2OZ6 A;  3FF5 A;  4ANJ A;  3BC8 A;  4KA4 A;  1WRJ A;  4R8H A;  4B3X A;  4LG0 A;  5D8L B;  1B6A A;  3R61 A;  1ZRE A;  4XN3 A;  3RYP A;  5JVT A;  3AL0 C;  1ZGJ A;  4HF2 A;  3QPS A;  3HHH A;  3OYH A;  2NNN A;  3KP3 A;  4AVP A;  5J40 A;  3OOP A;  1SFU A;  1ETQ A;  1VQ5 I;  2PI0 A;  1XD7 A;  5LRS A;  1BL0 A;  2FNA A;  1STZ A;  2ZXI A;  2FQ3 A;  2FOW A;  2B63 J;  1JGG A;  1D1A A;  4L9V A;  4BHC A;  1X1D A;  4YII A;  2PJR B;  5D6F A;  2EFP A;  2R3S A;  3ZQ7 A;  4KMU X;  3T1B A;  3KP5 A;  3KEO A;  1ETO A;  2QEN A;  3FMQ A;  4YIF A;  2Y48 A;  1IN7 A;  1OMI A;  3K6G A;  4D5C A;  3RPU A;  1NTC A;  3KIO A;  4EJO A;  3SEQ A;  2XSD C;  3M8F A;  3REO A;  2P4W A;  2DK8 A;  5EZG A;  2ID6 A;  3VOD A;  5E1W A;  4IJA A;  5ICE A;  3DCF A;  4Q47 A;  4L5J A;  4M73 A;  3CTA A;  2UXX A;  4J19 A;  3R60 A;  2K27 A;  3CP2 A;  5B1B H;  2KZV A;  3K4J A;  3M3Y J;  1OR7 A;  4H0E A;  2BY2 A;  4XKB A;  2H27 A;  4LB5 A;  5BS6 A;  3GBG A;  4G8X A;  1ONV A;  1FP1 D;  3GFM A;  3QWL A;  2A6T A;  3G1M A;  2IAI A;  2KP6 A;  4BXU A;  4XRF A;  1JUM A;  3Q0V A;  3OYN A;  4X6A J;  1MMG A;  3E6D A;  1S5L C;  1Z0X A;  3CF5 F;  1T38 A;  3HKZ A;  2L02 A;  3IAS 2;  3UNG C;  3DBR B;  4A0Z A;  5E8G A;  3BJA A;  1SD7 A;  1ETY A;  2X6O A;  2QSF X;  2JPC A;  1GT0 C;  4A3I J;  5ILU A;  1TWF J;  5J4V A;  2K3F A;  4XQF A;  3NRV A;  3F8N A;  2Q8K A;  2PFB A;  2DQL A;  5EDN A;  1MBK A;  4A3C J;  5E3N A;  2LF7 A;  4C30 A;  3ZMV A;  4PUS A;  3ZQC A;  4BEH B;  1LQ1 A;  1VQL I;  3JRF A;  2HOE A;  5BQT A;  4AYB N;  1Y39 A;  2VKD A;  1W36 C;  2HOA A;  4CZC A;  3BPX A;  3RZO J;  4E7S A;  2LFB A;  3QYB A;  1HQC A;  3SFZ A;  3E1S A;  5F04 A;  2CUJ A;  2DK5 A;  2WAD A;  1MW7 A;  2CS3 A;  3BTL A;  4HF1 A;  2L7Z A;  3PSF A;  1SVO A;  4BDY A;  1C0W A;  2QQ9 A;  3MD2 A;  1FYM A;  1B4A A;  5B66 C;  2WWY A;  2CW0 F;  4E4H A;  3G4S I;  1N78 A;  2VIX A;  2WB1 N;  3HGG A;  1U2W A;  3S3N A;  1IF1 A;  4UXN A;  1Z21 A;  4IQ4 A;  3IP4 B;  5J1R A;  2HYF A;  1GV5 A;  2W25 A;  3WOD F;  3TED A;  4IKF A;  3NWS A;  4MQV A;  5KCM A;  1QZE A;  1USS A;  1AU7 A;  2OD5 A;  2OV7 A;  3HHG A;  5L3E A;  1RC9 A;  5JLW A;  4BQO A;  4E7J A;  4LD5 A;  1YIO A;  2R7Z J;  4IXA A;  3WU2 C;  2K85 A;  2VJ4 A;  3HTU A;  4HDV A;  4AYB A;  1JJ8 C;  4KIC A;  1SVL A;  2CJJ A;  4A12 A;  3M7G A;  2I5U A;  2DN0 A;  5M5X J;  2XB5 A;  2XAH A;  4IZZ A;  4OOI A;  4MLO A;  3OIO A;  3FBN B;  2JRM A;  3U1D A;  4GRI A;  4XLA A;  1REP C;  2UWM A;  2KKO A;  4M6X A;  4A3F J;  2HQA A;  2W82 A;  2TRT A;  3S1N J;  2IS4 A;  4RGR A;  3HOT A;  2EZH A;  1FZP B;  1MBG A;  1ZK8 A;  3A02 A;  2OQG A;  2VB6 A;  4UY8 I;  1L0O C;  1WVR A;  1X1A A;  3N05 A;  4F91 B;  3S17 J;  4RM3 A;  1WJF A;  3Q0U A;  3HOV J;  2CUZ A;  5CPR B;  1IUF A;  1WJA A;  3M9A A;  2E2I J;  2QYO A;  3B02 A;  4OIQ F;  2F48 A;  1HSJ A;  5AIP A;  3LFU A;  1QHH D;  4QLC U;  2F2E A;  3I59 A;  2K4J A;  2K86 A;  3HRS A;  4RGX A;  4EV0 A;  4HG2 A;  4BJ5 C;  1WH7 A;  2O5R A;  3TDU C;  2MC3 A;  1RES A;  4B47 A;  5GAD J;  4EGY A;  4PGG A;  3LFK A;  4PSW A;  4CYD A;  4B09 A;  2B0L A;  2CQQ A;  4Y7N J;  4ZYD A;  3VYS B;  2I8D A;  2L9S A;  4BY7 J;  4UUS A;  4CCK A;  2Y0S N;  1PUF B;  2L9N A;  2J5P A;  3WU0 A;  2JA8 J;  2XVC A;  1FJL A;  2JZY A;  2L54 A;  2ADU A;  4WXD A;  3PNT A;  3H9J A;  4UUT A;  3ECH A;  4QWQ A;  3ZMU A;  3H36 A;  1O4X A;  1J5Y A;  4RAF A;  2WTE A;  4XMY A;  2HKX A;  2LY2 A;  2X6X A;  2CQ7 A;  2VE8 A;  2Z16 A;  3QU3 A;  4ITV A;  5A2Q Z;  1MJB A;  2JMW A;  4IPA A;  4Y15 A;  3CC7 I;  1R22 A;  2W57 A;  4UB6 C;  4HSR A;  3ULQ B;  4L9N A;  3MN2 A;  1TQI A;  3H92 A;  5F0F A;  2R92 J;  3HBL A;  2K9Q A;  4QIW N;  5CVJ A;  4ESB A;  2RDP A;  1WFX A;  1GVJ A;  4WXH A;  5JLX A;  5L3B A;  4UVA A;  1RIO H;  4WWC A;  1ZGA A;  4W97 A;  2HYG D;  3KP4 A;  3K4N A;  2ICW G;  2TCT A;  2K02 A;  4M72 A;  2M5W A;  3S2H J;  5EJC A;  2MW8 A;  2WB1 A;  4LJZ F;  3DU6 A;  5D5X B;  3JRD A;  3IH2 A;  4XLH A;  3LL7 A;  2XV4 S;  4CH7 A;  1QQI A;  1IUY A;  4PCQ A;  1I1S A;  3ZR8 X;  2MBF A;  1HXD A;  4CXF A;  3SQN A;  1U78 A;  1TQP A;  1S29 A;  1HKS A;  2A69 F;  2A07 F;  4BE1 A;  4RLQ A;  1UHS A;  3N4M A;  2DA3 A;  4OWR B;  5EG0 B;  4RMN A;  2K9M A;  3KYC B;  3L1P A;  1W1W E;  1OYW A;  4V2F A;  2D45 A;  1EA3 A;  1SAU A;  5H6R A;  3CZ6 A;  2BGC A;  4LLL A;  2EZK A;  2Y9Z A;  1YIJ I;  5C4X J;  1Y8Q B;  2HQ5 A;  3BR6 A;  1R58 A;  5EGO A;  2V26 A;  2EH3 A;  1R5G A;  1T08 B;  1IRX A;  4A3K J;  2M8E A;  3F6O A;  5BMZ A;  4KJZ A;  4U87 A;  1O7L A;  2VQH A;  5K1Y A;  4EGZ A;  4E7H A;  4HAM A;  3ONQ A;  5A2Q K;  1LDD A;  3L2U A;  1D3Y A;  3W6K B;  3FHN A;  3F9K A;  1H9G A;  3BPV A;  1QVU A;  5BPD A;  4XSX F;  4O3M A;  1IN6 A;  4AID A;  3MFK A;  3OYE A;  4B44 A;  4NNJ A;  2EA2 A;  1WKM A;  2CQN A;  3E3V A;  1Z3X A;  5HS7 A;  1LNW A;  5H2F C;  4HNV A;  1FLI A;  5J8F A;  3HEF A;  2FSW A;  3OIQ A;  1Q1V A;  5HDN A;  2P81 A;  5DTD A;  1Y8R B;  2RKH A;  2KMU A;  1FNN A;  1X1B A;  2M3A A;  4M3E A;  2MD5 A;  2GQQ A;  4EJU A;  4QPQ A;  3GUD A;  5EF6 A;  3DEU A;  4KYW A;  2L2O A;  3JRI A;  1XC5 A;  3VYR B;  4L9J A;  1JKQ C;  2NAZ A;  4GFB A;  2DT5 A;  4HNU A;  2STT A;  3AL0 B;  1G3Y A;  2DA6 A;  2V9P A;  3VB2 A;  3CCM I;  1KYZ A;  3M8E A;  1FOY A;  4R1H A;  2XF6 A;  2H6B A;  3HRU A;  2IA2 A;  5GTH C;  5FKN A;  2KIS A;  1EH6 A;  5HLI A;  4N9I A;  4P96 A;  1V3F A;  1UHW A;  4IVN A;  4M71 A;  4D7M A;  5E3M A;  2J5O A;  3T8T A;  3EDP A;  4S05 A;  1WJD A;  2DA5 A;  2JUC A;  2Z5U A;  3W6J B;  5KAI C;  1NG7 A;  2L9V A;  4FE7 A;  2OPT A;  1FIP A;  2DA7 A;  4UB8 C;  3A2K A;  3HSE A;  3AAF A;  2QSH X;  1TWH J;  4HLY A;  2A6H F;  2IVM A;  2O03 A;  3C2B A;  1S7O A;  3PJR A;  4XLP F;  3TBI A;  3GEZ A;  1NK2 P;  1HKQ A;  2FMY A;  1KA8 A;  5M5Y J;  1HBX G;  1S3J A;  5E3L A;  2O9L A;  2KFD A;  4AIH A;  5EGO B;  1F5T A;  2DJN A;  4CYC A;  3MMY B;  3HM5 A;  3ESW B;  3QQA A;  4HDU A;  1HA8 A;  4RGU A;  4F52 A;  3TQN A;  2YPR A;  1ZG1 A;  3D5L A;  1R5I D;  3LSR A;  4OMZ A;  5EG0 A;  2STW A;  1JT6 A;  2LP0 A;  1WQ2 A;  1HW2 A;  2R7D A;  2YUS A;  5HLG A;  4AWX B;  3LWF A;  4JX6 A;  2Z1D A;  3GME A;  2E1C A;  3T8R A;  2K9L A;  4N4N B;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 2KFD A;  1UZC A;  2B7E A;  2DOF A;  2K85 A;  2KIQ A;  2JUC A;  2KZG A;  2KIS A;  2DOD A;  2L9V A;  2DOE A;  4FQG A;  2LKS A;  2E71 A;  2CQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...