2KZGA

A transient and low populated protein folding intermediate at atomic resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
56
structure length
56
Chain Sequence
WNTKEEAKQAFKELLKEKRVPSNASWEQAMKMIINDPRYSALAKLSEKKQAFNAYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-processing factor 40 homolog A
publication title A transient and low-populated protein-folding intermediate at atomic resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 16
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2010-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kzgA00
2E71A 2KFDA 2KIQA 2LKSA 4FQGA 2DODA 2CQNA 2DOEA 2DOFA 2B7EA 2KZGA 2L9VA 2K85A 2JUCA 1UZCA 2KISA
chains in the Genus database with same CATH superfamily
4ZDOA 4UVAA 3LQRA 1OR7C 5LRSA 5D5VB 2VBZA 5F1JA 3ZP5A 1EH8A 1R36A 2K4JA 3LSJA 1LE8B 1S9HA 3Q9VA 4F55A 4IRGA 3CTAA 3J7YJ 3BR5A 4BJ5C 1ON2A 4KMFA 1X3ZB 3PIOF 1WPKA 2ZC2A 3GFIA 4PFPA 2LYCA 3CCUI 2VUMJ 1Q1VA 3HYIA 4NNJA 2DMNA 5K7ZA 4D5CA 3JRCA 1FTZA 2PLYA 2Y9ZA 1IN4A 1I1GA 5LBQA 3PNVA 1SAUA 2VXZA 4NUBA 3SQNA 2KFDA 4FX0A 1JKOC 2JVGA 2LDUA 3T0YA 2HQRA 4RLQA 3EYIA 3NRVA 3ECOA 3ZXSA 1KQ0A 1XGMA 3MKWB 1B9NA 2DA4A 5EZHA 4Y7NJ 3ZMVA 3X2QH 4BQNA 3V42A 2AXLA 4IHTA 1MBHA 4BYYA 2E2JJ 2QBYA 5IT9K 2XUBA 4FETA 2OTLI 4MFDA 3K4BA 3M8JA 5GADJ 1BR1A 1HDDC 2K27A 4D7NA 3K4KA 4DBRA 1ZGJA 1XPXA 3G3ZA 3AFHA 2PEXA 2Y31A 3G4SI 4QPQA 1ZR4A 1IXSB 3LSHA 3QOEA 4P9UA 4ZH4F 3F8MA 2JSPA 1MDMA 3BDDA 1TZLA 2F6CA 3E6BA 1TWHJ 2LMDA 4XR6A 4A3CJ 4BEHA 4ZYEA 2EIKH 4JBAA 3L00A 3E5XA 5DCMB 3FDYA 1LVAA 2ID6A 3DP7A 1HSTA 2WV0A 2ZMEC 2M30A 1UB9A 2E1MB 2K3FA 5BMZA 1OLTA 3FK6A 2LG4A 1HW5A 1FSEA 3T8RA 5GTHC 3SJMA 4L5IA 2Z33A 1U9NA 3I58A 4Y4RA 3W3CA 1XS9A 1ZTRA 2IP2A 2P81A 1ZRFA 5DUKA 5F64A 3OYJA 3QP5A 3JRFA 4IRHA 4OWRB 3QQAA 1GVJA 2WAFA 4A3IJ 2Y9YA 2V9KA 2KIQA 3C7JA 4QWQA 2H94A 2K3PA 1T8IA 1C0WA 1FNNA 2FEZA 1L0OC 2LR8A 4RM2A 2DXIA 1MJBA 3V7SA 3CMMA 4QPOA 3ZPLA 3RZOJ 4PJNA 4M3GA 4HX7A 1RZ4A 2B63J 4WXCA 1Z67A 4MEYF 4ENKA 2H27A 4XLHA 3T5XA 1QZYA 4Y3OA 4RA2A 3RTRA 2OZUA 4NBQA 5AIQA 2MH9A 1XN7A 4PJLA 3BQZA 1S6LA 3KP2A 4IJAA 1LNWA 3DEUA 3HOZJ 3DU5A 1IV8A 4BHBA 2HDCA 3B6CA 4L9JA 1TTYA 1BI0A 4H4KC 3I71A 4YEJA 1TW3A 1U8BA 2DFIA 2ELKA 3FWEA 2DFHA 5M5WJ 1QPMA 3V4GA 3VEPA 2NAZA 4BQOA 1J75A 1LE8A 4BXFA 2OV7A 3GEZA 4BBSJ 3FMQA 1FYMA 1FSHA 2R7TA 1XDUA 1WKMA 3CDLA 1P92A 3WHCA 3ZRGA 4E7JA 1H8AC 2BZTA 5CVIA 2K02A 2DA5A 1Z7LA 5JLXA 5L3GA 3N4MA 2ACJA 1U3EM 2EFOA 4OIQF 1UG0A 1UELB 1EF4A 3DPUA 1TC3C 2M2EA 3T8TA 4RAFA 2D45A 4KYWA 1Z1DA 2NOJB 4L5EA 3TO6A 2XGDA 5FLXK 2V9PA 4HA8A 2E7XA 3C3WA 1JTYA 2E36A 3REOA 1APLC 2EFPA 3HZJA 4MFEA 3K2ZA 4RGRA 4D5FA 2G9WA 2BY2A 2XIGA 3IUOA 4IX7A 1ONVA 1V4RA 2JT1A 3RZDJ 2K9MA 4U87A 2WB1A 3OY9A 3A01B 2VKDA 2NVQJ 1UHSA 3RCOA 1I1SA 3MWMA 5GP9A 5CYVA 1HW2A 2JPCA 4YIRX 3VB2A 3U1KA 1O7LA 1UHMA 2GBYA 4C3IJ 3HKZA 1YLFA 1PUFB 2A6HF 2W1OA 2Z2SB 1D0XA 3OYCA 1W0TA 3CC2I 1NHAA 2OTJI 3GZ6A 1NK2P 1KQ9A 1ZARA 3FXJA 5J4YA 3ABTA 4E7KA 2FBHA 3HIFA 1L3LA 4YIIA 4HX8A 5H6QA 1E17A 2BY1A 2LY1A 2VPRA 3LWFA 2DCEA 4XL9A 5DCMA 5K5RA 1SFOJ 3OS1A 2Q2EB 3IAS2 1P4WA 4G6QA 3KEQA 3QODA 3TDUC 1IN7A 2B7EA 2EFWA 2EA4A 2GA2A 3OYAA 2A6EF 5LLQA 2IGKA 2LC2A 4S04A 3HRTA 2EV5A 5ILUA 1WJBA 3NQOA 4CCNA 2A6TA 5LHHA 5F27A 1A35A 2LK2A 1PJRA 2DT5A 2NS0A 5HVQC 1JHHA 5J8CA 2XGEA 3LSIA 2W85A 2WY7Q 4BGDA 4Y15A 5J1YA 4BQQA 2WB1N 3J7AO 2CQ7A 3LOCA 3E5UA 2M3AA 2HXIA 3WTXC 3CF5F 1QO0D 3TGNA 2M4GA 4JX5A 5B1BH 2QENA 3HKZN 2IJLA 2F5CA 2VXDA 4HBLA 3LAPA 1R1TA 4AWXB 1ZELA 4ZJZA 2LSOA 1BR2A 2X1EA 2XKPA 4HAMA 5F0CA 2MC3A 1ZN2A 5J1RA 3WTUC 4XLAA 3PSIA 4HDVA 3V8KA 1YFHA 5LFAA 2KHMA 3KP3A 2VQHA 2VQGA 4UV8A 3I9V2 1OYIA 4XKBA 2VJJA 3K9TA 4L9VA 4HF2A 4AUXA 3L9FA 2RN7A 5JVGF 1WCMJ 1VQ5I 1RRJA 2CFOA 2LF7A 3LFKA 2EBIA 4A3JJ 2HYGD 5DM7F 5CJ9A 1BA5A 4M72A 1WJ5A 5M5XJ 2R5YB 1REPC 3MZYA 5CVUA 1WGXA 2DU9A 4EJVA 1P4XA 3W6VA 1MH3A 1WZ2A 1MD0A 3CJRB 2JA6J 4RAYA 4UVBA 4XSZF 4II3A 2LLKA 1U5TB 3IH4A 2RREA 1JT6A 4ENMA 2YSRA 3JREA 2QYOA 1QU3A 3OS2A 1GVDA 4CO8A 2MFZA 2DI3A 4F52A 1QZEA 1D5VA 5L3BA 2R7ZJ 3PL8A 2FJ1A 3IWZA 3SZTA 1MIJA 4PGGA 2ELJA 3GLXA 3S1QJ 2P7VB 1Z0XA 1R4MB 2H6CA 4HG2A 3R61A 4QTRA 4IHXA 2CG4A 2CW0F 5E3OA 1EH7A 2BE5F 3E6DA 5FRNA 3LMMA 1TW2A 3PFYA 2RQPA 2KLOA 4KUMA 4D1QA 2VC1A 2F2EA 3BOQA 3A01A 1AWCA 1FZPB 1N78A 3H5AA 5EEGA 2L9VA 1DQUA 1YE9A 2NVUB 1X1BA 2KMUA 2HFHA 1B6AA 4XQFA 2V6EA 2DODA 1X1AA 5HNHA 5F1RA 3I5UA 1LB2A 4W1UA 1TWCJ 3R6SA 3DTIA 2L4AA 4DGWB 5D5UB 4NQWB 1ZG5A 1JKQC 3BT9A 5E1ZB 3TQNA 2YPRA 3LA7A 3ZMTA 4HQMA 2JZYA 1BIBA 2LTPA 3V7RA 4M9XA 5AONA 1HQCA 4XN3A 3VYRB 3F0CA 4S0HB 3B6AA 3QAHA 2D1HA 2PJRB 1ETKA 2GM4A 1FBQA 2EPFA 2Q2EA 2KJCA 2OPTA 4EM0B 4FISA 1G3SA 5BQTA 2EB7A 1UAAA 3OSFA 2I8DA 2P6TA 4M3BA 3ZQHA 5HS9A 2RVCA 3GLLA 2K9NA 2LNBA 1XSVA 2MD5A 1XCVA 1N75A 1ZRDA 1JE8A 2X9DA 1W7PD 4CUGA 2CMPA 3GTPJ 1I6HJ 2XASA 2EV6A 3QYBA 4A0YA 2VODA 1W36C 3ESWB 2X6XA 3CP8A 1ODDA 3ABUA 5FJ8J 1ETVA 3MFKA 2ECCA 2CUZA 1MNDA 5ICGA 2PMZN 1XMKA 4IOCF 3Q0VA 1MBGA 3I64A 3ZMDA 5HDNA 1B9MA 4A6EA 1Z21A 5GAGJ 3PJRA 5FO5A 3HOXJ 3V8LA 3K4CA 3M1EA 4HYEA 5HNFA 3OYEA 4QLCU 1FY7A 2HPMA 4EJTA 4CICA 4GYGA 3J7AY 2LFBA 1NG7A 1J09A 3MEXA 2FXAA 2JRTA 1R49A 3C2GA 1I27A 4UUSB 3F8CA 2EZKA 2JJ7A 1Y1WJ 2JTVA 2XC7A 2CYYA 1HXDA 4V2GA 3LA3A 2M8GX 2KKOA 1KONA 4UNOA 2JA5J 3RQ4A 4G9YA 3L2WA 3IRQA 1MBJA 2E5ZA 3LA2A 3G6EI 4BAYA 4C2TA 1I50J 4LFUA 3S15J 4ZTFA 1IW7F 1DPRA 2NYXA 5K5QA 5ILVA 3S2HJ 3CUQC 3JTGA 1VQ7I 3RSNA 3UNGC 2R5YA 4BE2A 4KJZA 1BJAA 3C2BA 1GXQA 1QA6A 3QU6A 1K7AA 3CCMI 3K6GA 2RAEA 4E4HA 4ENNA 1W7PB 2IW5A 2JVHA 5ICFA 4CZCA 1U5TA 5GTIC 2O6GE 2UZKA 1J0RA 1MMDA 1Y8QB 4CYDA 3K10A 2R7RA 1IRZA 1FLIA 4IHWA 2ESNA 3HPGA 1SC7A 3K1PA 1YJWI 3FXQA 4ZDPA 3FKIJ 1S7EA 1QNTA 2KISA 1D0ZA 1YHQI 3U2RA 4DQ2A 1BR4A 1JGGA 1CGPA 2E34A 4ZC3A 5JI6A 2R7UA 3KEYA 1RPWA 2FA5A 4DYRA 1DGRM 2QEXI 3H5RA 3HL2A 2C6YA 2DW4A 2VONA 5DD4A 2OA4A 2DFEA 1SFKA 5FKMA 4LIUA 5IYBJ 2XF6A 2K9SA 2F5VA 3DKYA 2NS8A 3KEOA 1X4OA 2EH3A 3OSGA 5C4XJ 2FX0A 1PP8F 1BI1A 5ERIA 3BR6A 4MQVA 3JSOA 2ZMEB 1W4MA 3GTQJ 3HPHA 2XDVA 3CQZJ 5K5OA 4NQWA 4KISA 4FE4A 1FWZA 3KE2A 2EFQA 4E7ZA 1VTNC 2HOAA 4ESFA 3DV8A 4G7OF 4RB3C 1OQYA 3AG2H 4XRMA 2L7KA 3HOVJ 1TQMA 4EQQA 2PJRA 1LDKB 3H1CA 4GRIA 2BHZA 3EYYA 4IHYA 3M8EA 1U6GA 1IGNA 1SAXA 5HDKA 2PJPA 3BZ6A 1EH6A 3G2BA 5FD5A 2BEOA 1OISA 1FPQA 1FT9A 2XPWA 2QCOA 2L54A 3I4PA 4P96A 2DTZA 1G3WA 1JT0A 3CJTB 2DA1A 3GFLA 3OYNA 1VQKI 1WJEA 1U78A 3CLOA 2IGMA 3M9AA 3W6KB 2JUGA 2OQGA 3OL4A 4HOBA 4PDKA 1K79A 2IA2A 2L2OA 1BL0A 1VQ9I 2M5WA 2STWA 2E2HJ 1TWGJ 3M4OJ 2M8EA 4KIGA 4XK4A 2J5PA 1I6XA 1WWXA 4XN0A 2OJED 3RDIA 3T1BA 2KZGA 2M7AA 3D1NI 1AHDP 3P7NA 1OR7A 4IZZA 2E19A 5FROA 2PG4A 1X3UA 3DCFA 3DBRB 4XLCA 5KVRA 1ZLKA 1I3QJ 4IOAF 5IYDJ 2CV2A 3I0TA 4UUSA 2WAEA 3KX2A 3E6MA 1X19A 5DDGA 3WTTC 5D4SA 2K40A 2CRGA 2EIMH 4R79A 3BZKA 2EIJH 4PJMA 4IPAA 3GBGA 2M34A 4F92B 3FHZA 2EZHA 2W24A 5CKTA 4RDUA 4BY1J 4N9IA 4GFBA 1GUUA 1QQIA 5JHUA 2LD5A 3L09A 3BR3A 4MTDA 1YI2I 1W7PA 3KIOA 1HSJA 2OQRA 4Y52J 3L2UA 1X1PA 1G8XA 1XGOA 3HGYA 3G1LA 3OR2C 1T2KA 1K4TA 1XG1A 3LSTA 1ZAOA 5HOOA 1F4KA 3LSMA 2COMA 2DLLA 1R22A 2X0LA 4II2A 2QSHX 2VE8A 1VQ6I 5E1XA 3MCZA 1ZG1A 3IV5A 2X1DA 1NH3A 3VWBA 1Y0NA 2TRTA 4QSHA 3SFZA 4I99C 2FQ4A 4AU7A 4V19K 3LSPA 5CVRA 2BW3B 2DJNA 1R5GA 1FX7A 4A69C 2JWTA 4AYBA 2FF4A 2QZ8A 3OL3A 5E8GA 5KAFC 2A3SA 4GDFA 2LOOA 1W5TA 2LBFB 3IKTA 4CCLA 4PUSA 5FKKA 2P5LC 2HR3A 5TJJA 1WJAA 1YX5A 4NC7A 4BE1A 3BG7A 2RDPA 2HKXA 2O3FA 3BY6A 2ZMEA 3Q5FA 2RNJA 4MGRA 1RNLA 1LFBA 3CMAI 3SZPA 1O57A 3PQKA 3PO3J 2W82A 2IGOA 2NXNB 2WAQA 3VODA 3KETA 1BOAA 1HA8A 5CVJA 5F04A 4A3FJ 1SVMA 5L3EA 4EV0A 5DCFA 2LREA 3H5NA 3K0LA 4DYQA 2YS9A 4A12A 1MBEA 1P7IA 1I3AA 3HOUJ 1X1CA 2HZDA 2RKHA 4BACA 1PYVA 4I0AA 3C18A 1RI7A 2XB0X 4C9YA 1TWAJ 1JUPA 4J19A 4Q4ZF 2OF7A 2KDOA 2FD5A 1IN6A 1R7JA 3V8JA 2Z99A 2MG4A 1IN8A 4AVZA 4PJ0C 4UY8I 2DBBA 2ZSHB 4ANJA 2MW8A 5LGUA 4A0XA 2KDZA 2FUG2 1OCPA 5M3MJ 1O3RA 2D1VA 3BJAA 5E18F 3D5RC 2LH9A 3QPLA 3BCAA 2P6SA 2RC4A 5IT3A 1HF0A 4KT5C 5J40A 3ZN1A 3QPSA 3SFIA 4KT6A 2DMTA 3VSLA 2R7SA 3MZ8A 3F8NA 2QKLB 1B72B 3BTIA 1VFCA 1KU7A 3ERMA 1OJLA 1FOYA 1Y8RB 3E7LA 5EGOB 1QRYA 4C2UA 3WE3A 3S1RJ 4JOMA 3F6VA 1ZREA 2GXBA 3Q9SA 1FMVA 2BVMA 3OIPA 2WAQN 2CSOA 1JXSA 4EGZA 3FBIB 4G94A 3OR1C 2LP0A 3S8PA 3ISPA 2GXGA 2KIFA 3W2AA 1IUYA 2CJJA 2O8KA 5LGTA 1YW7A 4U0WA 4PGHA 4LOCA 2XB5A 3GW2A 2HOTA 3EETA 3DBLB 2KT0A 5ILSA 1FYKA 2Z9OA 2XSDC 5KAIC 1AOYA 1OCZH 3CF2A 3JR9A 3PO2J 2VKVA 4Q5SF 1G3YA 2AQFA 3CC4I 1OCRH 2WADA 3FZVA 4LJZF 3IH3A 3WU2C 4HF1A 4WF2A 1YQAA 4JP0A 1POGA 3OYIA 1K4SA 4MQ9F 4HDUA 3TO7A 1MMGA 3F23A 1W36D 1SANA 4OIPF 4MO7A 5DS9A 3FBNB 1RUNA 1MSEC 2XGXA 3FISA 3WTWC 3EUHC 2G7UA 1Z7UA 1USSA 2VJ4A 3DF8A 3A0HC 3M1CA 2E7WA 1SD7A 3JRAA 1W1WE 4RS8A 4CHUA 5IP6A 2BW3A 4HLXA 3ULQB 3JAMZ 2VBWA 4IVNA 2XPVA 3OYMA 2DAOA 4HSTA 3BTCA 3PIPF 1X2NA 5H20A 2CS3A 2LBFA 3OV8A 1BJZA 3O6BB 3J80Z 1BN5A 2CUFA 2XAUA 5F0HA 4KICA 2DJIA 2ID3A 3CJQB 4UUVA 3FF5A 1D1CA 2YX7A 1BOBA 2IPQX 1W0UA 1X58A 1YS6A 3FXUA 3KP4A 3RQIA 3MD2A 4BU2A 3S32A 2L4MA 2XPUA 1YYVA 1O4XA 1BIAA 1JGSA 4M6YA 2HTSA 4OMYA 2M87A 2AO9A 2KQRA 1A5JA 2XAQA 1IDZA 3DLAA 4G8XA 1H0MA 1V55H 1BM9A 1YIOA 5E20A 3RKWA 5E8IA 4M74A 3SXYA 3HSEA 4F7ZA 1VF9A 2JUCA 2V9VA 3HUGB 1VI0A 4M71A 4WXHA 1WFXA 4LLNA 3WTVC 4CXFA 3FXRA 1D8KA 2HQAA 2CW7A 4LLGF 2K9QA 4S05A 1E3OC 4I02A 4R1HA 2ZXHA 1XGSA 5FKNA 2VIXA 1MMNA 1T0FA 2L9RA 1HKQA 1W5CC 1Y0UA 1T98A 2KIUA 4U7BA 3BP8A 6PAXA 3HM5A 4ESJA 3SHFA 4B48A 2OC6A 5C4JJ 2CV1A 2DN0A 1SD4A 2V7FA 2W4SA 4E70A 4LIVA 1FTTA 1SEUA 1DP3A 2FOKA 3J81K 3JRGA 1H9TA 4EGYA 1SMTA 2X6YA 3IC7A 4P9FA 4C3HJ 5C44J 5CVVA 1B72A 3FIWA 1Y56A 5EGOA 1I39A 4RM3A 1ENHA 3L1PA 1RESA 3BC8A 5HLIA 3S3NA 2FU4A 1BW5A 5D6EA 2F4MB 3H0DA 5JLWA 3CUQB 5TISC 3GXOA 3EUAA 5IOYA 2IS2A 4OIRF 3GO5A 1ZK8A 3A0BC 4UHTA 1Q1HA 2QA4I 4U0YA 2L0KA 3FXMA 1QHGA 4LG0B 3QU3A 3S93A 3FKJA 3HTUA 4J01A 5EDNA 2P7CB 3AL0C 3JSPA 3Q3SA 1D8JA 1XX5A 4DIQA 3RKYA 3VDXA 2X4HA 1GV2A 1O3TA 4NB5A 2Z16A 4PK4A 4A5NA 5DYMA 4A2UA 4UB8C 1W5SA 2X1CA 1M1EB 1T0FC 4BDYA 5IT9Z 2GIZA 4O3MA 2O0YA 5EG0B 3GZ5A 1ZGWA 5H6RA 5HS8A 5EEAA 2O9LA 1OCCH 4PJJA 1NTCA 3JTHA 4BE0A 2JMWA 1DP7P 1P6RA 3O2PE 4XM3A 3ZOBA 1AKHB 1JJ6C 3NWSA 4E7LA 1V5FA 2FNAA 3ZQGA 2AS5F 2NVTJ 1YOVB 2NS7A 1YW8A 1V5GA 3E6CC 2ELHA 2E71A 4UB6C 4RAGA 1DU6A 1S8NA 2BV6A 1DUXC 4YFXF 3GF2A 4BNCA 3SZGA 5HDGA 1O3QA 4F91B 3HGGA 3RPQA 3I3LA 3O8HA 3PSFA 4IO9F 1KU2A 1J59A 3BR0A 4GYIA 5EZGA 2ZNYA 4RGXA 3IAM2 3UKGA 4HV5A 1ITYA 4G6TB 3RJPA 4XMYA 1PP7U 4A0ZA 1P4AA 1HLVA 2O7OA 5J1UA 3F9KA 3KYDB 3DQVC 3CCVI 2KZVA 4U0VA 4CA0A 3NWTA 3GFMA 3JCUC 5LHIA 3W2VA 3HUGA 4KIFA 4YFKF 2QSGX 2CWEA 1J9IA 3CMYA 2W57A 2V1XA 3DU6A 3I54A 2L9NA 1TNTA 3MVPA 1D0YA 2H6BA 4FTHA 4LD5A 1TT5B 2UV1A 5FRMA 3S1MJ 2LF8A 2W00A 3EPZA 5FFZA 2VJ5A 3W6JB 2DDBA 3KLNA 4GO1A 1PUFA 4HRIA 1YS7A 1D1BA 1U8RA 2Y48A 4QIWN 1E0EA 1R5ID 3DFGA 3BTJA 4XOTA 2ME0A 3K1MA 5B66C 2EJRA 1WJDA 2WC2A 1V5EA 1B59A 1IN5A 2XRLA 3QRFF 2YR2A 3TBIA 3JRHA 1TLHB 4G12A 4ESBA 4WX9A 5A2QK 2R7VA 1YG2A 3KZYA 3ERED 1T6SA 2A05A 4OMZA 2V79A 3H9QA 2HTJA 3PFIA 5KCMA 4XIDA 4CGZA 1UG2A 1VQNI 3KFWX 2L5QA 1BW6A 4Q47A 1A36A 3PNYA 1T38A 4GXOA 4B1RA 3N05A 1DGWY 2ZXJA 4IHVA 1K6OA 4AIHA 3CD6I 1ZG3A 3CUQA 3PM1A 1N77A 2HPIA 4KNYA 3P9KA 2R3SA 5D6FA 5FFXA 3QP6A 2LKXA 3I53A 3WU1B 2CUEA 1D5YA 2ZBKA 5DV5A 3HOYJ 2UXNA 4LG0A 5FLXZ 4C30A 2UXXA 9ANTA 4MEXF 2JA8J 5J3LA 1TQIA 1O3SA 2FMYA 3SEZA 1OYYA 5E3MA 2HOEA 2UUZA 2VLAA 2VOPA 3OOPA 1IG7A 2CQQA 1GHCA 2ZFWA 4W97A 1LUJB 3BROA 4PZJA 3VSKA 3CLQA 5DUIA 2HDDA 2DTRA 2F5DA 1D3YA 4EVIA 2HNHA 2HDWA 2LY2A 1HC8A 4RB2C 1LPQA 5ICEA 2W7NA 3LQQA 2F4IA 5EG0A 2DA3A 3KP7A 1Z3XA 4Y33A 1ETQA 1FMWA 2FE3A 3WHBA 2ISZA 4BY7J 1UMQA 1AKHA 3LAJA 4UUTA 4Z2YA 5C3EJ 2VPLA 2QSFX 2FBKA 2CQKA 2BVLA 2QQ9A 3KCCA 3OYGA 3TEDA 4IQJA 5K7HA 3JRDA 1MBKA 3BJ6A 1STZA 2WBMA 3K4LA 4B3XA 4IRIA 2VC0A 3J81Z 1OMIA 2W84A 2O5RA 1OKRA 4OIOF 2AHQA 4GGGA 2MD0A 3OYBA 2XHKA 3VFZA 4FX4A 2DDAA 4XKWA 4KN7X 2EZIA 3B02A 3QYFA 4I09A 5FKOA 5GAEJ 3NAUA 4AD9A 5KHDA 4XSXF 4CDGA 2DA6A 2Z3YA 1VQOI 3F6OA 4OAZA 3OIOA 2GQQA 5JR3A 2H1LA 4IF4A 2ZB9A 2QUFA 5D8LB 3BG5A 3DLLF 4JX4A 4V2FA 2DOFA 2IS6A 3E1SA 4XLNF 1UJ8A 5JFRA 1VQ4I 3S2WA 5J47A 2HVRA 5LD2C 3QYEA 2CH0A 3CZ6A 4B09A 1IJWC 2V26A 3ZQCA 2CQXA 1H89C 5HODA 1CF7B 3CESA 2ZXWH 2DO7A 2M0MA 2IS4A 1J2XA 2HOSA 3H3VK 4P55A 3KYLA 4XKVA 1MH4A 4UV9A 3VOEA 1IV6A 2BBYA 2F4OB 3E5QA 4RMNA 3TOBA 3F22A 4FT8A 4NDLA 1ZHFA 3GTMJ 2NVYJ 3WU0A 2XGCA 1TQPA 3BG9A 4HNTA 1FBSA 1XGNA 1KA8A 3DBHB 4M9ZA 4M9SA 3U21A 2W48A 1E3HA 1D1AA 3U9GA 1JKPC 2R7FA 1KYZA 3CMEI 2B0LA 3HHHA 5L3FA 1R00A 1LKXA 2ZJ2A 3SDBA 2I5UA 2ZFUA 2R7DA 3HG9A 5K1YA 3DKWA 4HZFA 1Y6IA 1FYLA 4ZYGA 4BJTA 5AIPA 2LKPA 3H9GA 2O61A 2HVQA 1MNMC 4ZDLA 3IWFA 4CH7A 4Z6YA 4ZZLA 3CC7I 3CO6C 4AVPA 2F5FA 2QBYB 2IXSA 4K2EA 4IL6C 4I2OA 4OU0A 1T33A 2L01A 1FEXA 2OZ6A 4LLLA 2IA0A 2ZKZA 1F36A 3BTLA 2NVXJ 1UHWA 1XB4A 1WQ2A 3DWLE 2HQNA 1MMAA 1QVTA 2ESHA 1DDNA 1OCOH 1S7AA 1XSXA 2TCTA 3CDIA 3FMRA 4M73A 1Z91A 4O5VA 3WGHA 2JK3A 4EJOA 5D8KB 3IHUA 4OAYA 5IP9J 3KLOA 2CUJA 2IT0A 2NRAC 5DTDA 3GCMA 5EEHA 3FK7A 5D4RA 4NHJA 1NG6A 1N25A 2EQRA 2V1NA 2P5KA 3DPTA 4B4CA 2DK5A 2OCEA 1X3WB 3BG3A 4P5OA 4EEFG 3ECHA 4HQEA 4UVCA 1VQLI 4HPQA 1X4PA 2E2IJ 2Y30A 4FASD 4ZYDA 4XLPF 1VZ0A 2XF5A 3MQ0A 3I56I 3F8FA 2DYRH 4E7HA 4DJAA 2GOMA 3HSRA 2GAUA 5IPAA 4XRSG 3M7GA 3FMSA 3ELKA 1Z77A 1ZRCA 2X85A 3R0JA 4UXNA 1IXRC 5BOXA 3S17J 2DOEA 4HF0A 3ZCOA 1IUFA 1CF7A 2JSCA 1Y39A 2AQEA 3EQLF 2ZJPF 3DTKA 5HLGA 3HSFA 2DPUA 2Z5UA 1ACIA 3JRBA 1YW9A 3HRUA 4CSWA 1P7JA 2E5NA 4OINF 3CJNA 3Q0UA 2DMUA 1G59A 4X1EA 3HOSA 2IA1A 3L7WA 1LEAA 5E79C 2DMQA 3HRSA 4M3FA 3PUBA 3H92A 3RYRA 3QOPA 2HI3A 2ZJQF 1TBXA 1ZH5A 3ABKH 1TT0A 3ABMH 1BI3A 2QKMB 1MJAA 2VB6A 2BOLA 1YX3A 3FXOA 5LRRA 3TMOA 4NC6A 4AIDA 4Y13A 3IP4B 4I7HA 1HKTA 1RETA 4LK1F 4XONA 4IXAA 4XBFA 3DXJF 1RR7A 1EV7A 2OBPA 2DMPA 3AL0B 4DZJA 3GTLJ 4L9NA 1MZBA 3TDZC 1VQ8I 4LK0F 2LVSA 1BI2A 2Q1ZB 3LL7A 3RYPA 1PDNC 2FBIA 4C2MJ 1BBYA 4HSRA 4F93B 5M5YJ 1T08B 1WVRA 1FIPA 1V3FA 5B3SH 3ZR8X 2VBYA 1NK3P 4AYBN 3L2QA 2HU9A 4XLEA 3K69A 3BR2A 1F1ZA 1WJCA 2V4JC 2KRHA 5J8FA 3EUHA 3ZMUA 2EFNA 2G0EA 1Z05A 5TGTA 1A6IA 3IH2A 3DEEA 4IKFA 3G73A 3JW4A 4XNFA 4WCGA 2VE9A 3M07A 4XOPA 1IRGA 1IDYA 3U1DA 3TW7A 1MBFA 2YU3A 5FB2A 2X48A 3R4KA 3MMYB 1ETYA 2DT6A 1K6YA 2MSYA 3WTSC 4BQAA 2GA1A 1S29A 3EDPA 2AXTC 1WJFA 1UFMA 2V1DA 5J4VA 1MNEA 1XC5A 3OMYA 3COAC 2R7OA 3W2WA 1T95A 1JTXA 3I55I 2EWNA 4ZYAA 3DTEA 5K7FA 2CO5A 1SMYF 1GLNA 2Y2ZA 2EA2A 3FHNA 1WH5A 1UZCA 2VOOA 3BLYA 4ASNA 4DW6A 3RKXA 3K70C 1MMSA 1A04A 2K5CA 3CO7C 5BS6A 4KIBA 3HEFA 1Z6RA 4RAZA 4DBQA 1T39A 3GX4X 3AKZA 4HEA2 5L3DA 3I59B 2D2WA 2Q8KA 2K85A 2X6WA 1G4DA 1MSFC 4BXXJ 2FQ3A 2QQBA 4B3AA 2E1CA 1PVEA 2CU7A 2MA3A 4BKXA 2ZCWA 2ZXIA 2X6OA 4D0PA 2L7ZA 3BZCA 1OCTC 1FOKA 2LKSA 1LEBA 3H9JA 5ICCA 1FP2A 1WRJA 4XRSA 1R1UA 1YJ9I 4IQ4A 2YUSA 4WWCA 4KN4X 3CUOA 1USTA 3WE2A 3FX3A 2WWYA 2K4BA 1ZYRF 5JHFA 4FCYA 4L9TA 2CV0A 3K4JA 4L18B 1DPUA 4CCMA 2XAFA 3FM3A 5CQGA 1B1BA 4P1WA 1DU0A 4JK1X 5KK1A 2ZO4A 3NARA 5HLHA 1S72I 1GT0C 4BHPA 2XVCA 1JHFA 5FLVA 3MZHA 3N97A 1IRFA 2VT2A 5IYCJ 3CCYA 2EK5A 2GXAA 3OYKA 4HNVA 2R7WA 4M3DA 1R9TJ 5IOZA 3E0JB 2MGQA 3ZQIA 4AIKA 4EATA 1GDTA 4PCQA 4BHCA 2FNPA 2XAHA 3LSGA 2BXZA 1MJ9A 3QPHA 1VNDA 4O6JA 2LY9A 4A3KJ 4JX6A 4KA4A 2R7QA 1SFUA 1ZR2A 2V1UA 2VKHA 2R4GA 3BCBA 3R0AA 4RBOA 4ITVA 4U88A 1ETWA 2HGCA 3C2HA 2HYJA 4L5JA 3CCRI 5CLSA 4XLFA 4LB6B 2F5EA 4X6AJ 2PMHA 4H0EA 3K4MA 1U2WA 2KIMA 5BPIA 4A5MA 4CZZA 3ZGKA 2XV4S 1JUSA 4ABZA 3LFUA 4B8XA 4A3MJ 4DYCA 1IXCA 1RKTA 2PN6A 3R60A 3OIQA 3KP5A 1IF1A 3S1NJ 1F9NA 1R58A 2A61A 4Q48A 4BH9A 4FE7A 3H36A 1AU7A 2MH2A 1R4NB 1K78B 3FM5A 1R1VA 4LB5A 1P2FA 2K86A 4BXUA 5HLTA 2A5YB 3CDHA 2P5VA 1R5HA 4YFNF 2HYFA 2VL8A 2DQRA 5J6XA 1YRNB 4LITA 5DEQA 2FSWA 5FD6A 5LEKA 3A1YA 2RNGA 2E60A 2J5OA 3HDDA 1XMXA 2HEOA 2OAZA 2RQQA 2ECBA 3OYFA 2GIVA 4BL0B 2QLZA 1MKMA 2Y75A 3H3ZA 2BXYA 2VASA 4N4OB 1JKRC 3RIRA 5H2FC 1MW7A 3KP6A 2OUMA 5D5XB 5IP7J 2X51A 1MGTA 2N8GA 4JQFA 1RKWA 4YELA 4CCKA 2WTEA 3I59A 3K1NA 2KRCA 4ETSA 2QVOA 1EA3A 3PUFA 2VT3A 3KYCB 2F48A 4N4NB 3RKQA 2FOWA 3ROUA 5F08A 1K61A 4XRFA 3WGIA 4LMYA 4ON0A 3GTGJ 3TOAA 3HC7A 5DD8A 3L2RA 2MLKA 3GFJA 1E2XA 2JPBA 2NNYA 4D9JA 3AG1H 3ABLH 2XAJA 2IAIA 2BHYA 2KRFA 3ASOH 3F21A 2XSJC 2BY3A 3WG7H 2DT7B 5LGNA 2HWVA 3O8GA 3WTYC 1J5YA 1R23A 2KL4A 3SYTA 4C3JJ 4E7IA 4N0BA 3WTZA 3Q0WA 4RLFA 3L2VA 2ISYA 4CYCB 1HW1A 2HQ5A 1V54H 3OOUA 4XICA 3MAJA 2JRMA 2QQ8A 1Y1VJ 3TKYA 3P5JA 4B44A 1SD6A 1VQMI 2Y0MA 2E1NA 3BR1A 2EV0A 3GZNB 3ZN0A 2P0WA 3A02A 4EM1A 2HVSA 3GTOJ 1UCRA 3IKVA 3MKLA 1LDJA 2E1MC 3HXLA 4G7ZF 3BPVA 2PQ8A 3A2KA 1KU9A 4AC0A 2ZJRF 4PFOA 5E3NA 2GOXB 3TP3A 4BDZA 5BPDA 1IO2A 2VBXA 1XDSA 1TP4A 4G7HF 1OPCA 3UR3C 4HV6A 2NOGA 5GPCA 3G1MA 3FXLA 4MIMA 2A69F 2CQNA 4DNCA 1WI3A 5E1WA 4RB1A 3RPUD 3ZQ7A 1XCBA 2CGPA 1G6NA 3MN2A 1IC8A 3BPXA 3L2CA 4E6KG 5E17F 1XMAA 1YIJI 2I10A 1KU3A 4Y17A 2IRFG 3D5LA 2HXOA 1FOWA 1ULYA 2JA7J 1ZKGA 2QWWA 1WHUA 3ASNH 3OS0A 3OYHA 1HCRA 2L7MP 5GPAA 4RGSA 1HDPA 1OFCX 1T56A 5HS7A 2L3DA 3CCEI 3DKXA 3D5SC 4MNUA 4TV7A 2CW8A 2O03A 2K7LA 1FJLA 2PMZA 3QWLA 1S3JA 3C1DA 1S5LC 1VQPI 1FIAA 3AG3H 3BWGA 1SFEA 3MKZA 4BJ6C 3DEWA 3CP2A 2R5ZB 4J00A 4PSXA 4YRVA 2Y0SA 2L02A 1LQ1A 4LGWA 1K78A 1I5ZA 5EF6A 4U7DA 2BYVE 2DOAA 2P4WA 3NEUA 2KJBA 2G7HA 1IZ1A 2IS1A 3MKYB 1LJ9A 3BQYA 3G71I 2EINH 1IRXA 1YRNA 3GWZA 4CCJA 1YO5C 3ZQFA 3P9IA 3WGGA 2Y69H 2H8RA 2QF7A 3E97A 2R0QC 1SFXA 2HZTA 3PNTA 1SD5A 2IEKA 3M8FA 2ZSIB 4I0BA 4M6VA 4G6DA 2D5VA 2H09A 5FKLA 1R71A 1ETXA 2W25A 1EJ9A 3E3VA 2E35A 2ETHA 2QQAA 3CCJI 5LHGA 2A07F 2DFFA 3SDGA 2ICWG 5DM6F 2PI0A 3I4NJ 4XORA 1FC3A 1Z9CA 4L0YB 2M0CA 1QZZA 1TWFJ 2MYSA 2COBA 2VI6A 2XF7A 1E3PA 3CCQI 1P9QC 3FXKA 2LRDA 5CPRB 5B5EC 4XKCA 1G3TA 2IVMA 4ENJA 4RGUA 1ZQ3P 3HTSB 3F72A 3WODF 3ML6A 2MBFA 2WV1A 3TO9A 3DPLC 1BC8C 2JQ7A 4EJUA 3GVAA 2XKOA 4KDPA 1AA7A 3S2DJ 1O7FA 4KITB 1Z3YA 4BUPA 1RC9A 4A3BJ 2MC4A 2OCCH 1X1DA 2Y0SN 1YJNI 2QM3A 1YTYA 2PMUA 4N9HA 3AG4H 5M3FJ 4DOZA 1HBXG 1U0JA 2EZLA 3D0SA 1GV5A 2PFBA 2DK8A 4CYCA 2MLGA 4EJWA 4RB0A 2L9SA 5TRDA 1QPIA 2ZNZA 2DA2A 1U9OA 3K70D 1ZGAA 4MLOA 4A3GJ 2BY0A 2VJIA 5L3CA 3ZMSA 2GLOA 3HRMA 4FQGA 3F3XA 2VQCA 4M3EA 4HLYA 3O3KA 2VQLA 5F0FA 2UWMA 2XROA 2PX9A 3K2AA 4I6ZA 2RV8A 1B8IB 2R7XA 3HOTA 4WXDA 2M4KA 4EM2A 3S3MA 4R8HA 1TL8A 4B43A 2K9LA 5EJCA 1LFUP 2A68F 1LFPA 3ZMZA 3K4NA 1OYWA 5FLMJ 1LVKA 3GMEA 3S3OA 2FRHA 2JN6A 1G2HA 1J7KA 4A3EJ 1HKSA 2OU2A 1XD7A 3LSRA 2V6CA 3KZZA 2KPMA 1FP1D 5GAHJ 3KPHA 2XRNA 1LDDA 2DA7A 4D7MA 4HNUA 3RI4A 1CQTA 2JA2A 3WG9A 2E1OA 3HJEA 1KYWA 3H0GJ 1A31A 2R92J 1ON1A 2GWRA 2WA0A 3A03A 4HW0A 5KNLA 4OOIA 2RGVA 3V7CA 2O8XA 2HS5A 2MABA 3J7ZI 2R5ZA 4YIFA 4I76A 1FBUA 4A3LJ 4X0GA 3HOWJ 5E3LA 1WI9A 3AAFA 2HKOA 3S14J 4LG3A 4MHGA 3ONQA 3S16J 2WY8Q 3LSKA 3HBLA 1KQ8A 2EILH 1SVLA 4I01A 2VN2A 3LNQA 4L0ZB 2M45A 1QBJA 4AM3A 3B73A 4ZTJA 3EUKL 4ZYHA 1U5TC 2Q0OA 1HOMA 3JRIA 2GZWA 3IL2A 4A93J 3P9CA 4KFCA 1GXPA 2OD5A 3RPUA 2DQLA 3TP0A 4IHSA 5IY5H 1F5TA 1QVUA 1IAWA 3VYTB 4E7SA 3OYLA 3BJOA 4JYKA 1Z6TA 5CQEA 4MTEA 2STTA 5D5WB 3H35A 2YU9J 3TW6A 4A3DJ 1QHHD 1SVOA 2B9SA 2H1KA 4I98B 2CFXA 2A5WA 3H3UA 3JAMK 2IBDA 3OYDA 5JVTA 2M1BA 1RUOA 1MDMB 2TDXA 2R93J 3I4MJ 2M9HA 3J80K 5EYRA 4BEHB 2PBIA 3ZQLA 1ZLJA 3VYSB 1H9GA 3VPRA 3GTJJ 5B1AH 3GYHX 1RIOH 5BNGA 4NC8A 5F6FA 4EMSA 5A2QZ 2H8WA 4KMUX 2Z1DA 1JI8A 1QGPA 5LEJA 3BG6A 3HB9A 4GCVA 1WSUA 3CCSI 3A4CA 4DZPA 1XSDA 2M7BA 5ED4A 2YX4A 3ZQQA 4M6XA 1H88C 1X2MA 3K7AJ 1XTAA 2FMLA 2DPDA 1ERDA 3KZIC 1B4AA 3F8BA 2ME6A 1A6QA 3HHGA 1JJ8C 1BC7C 3GTKJ 3G1OA 4F3QA 1K83J 5FGMA 1WH7A 1KGSA 3CCLI 3M3YJ 1ORKA 2P8TA 4B47A 2ADUA 1EKEA 1F43A 3OWTA 2BGCA 4FHTA 4A6DA 1B8IA 3TL4X 3IRRA 3SEQA 3QPTA 3VYUB 2KP6A 4WK8F 1YITI 3PQJA 4HX4A 2L7FP 4AIJA 1PUEE 1ETOA 1RR8C 1FOXA 1S7OA 1TNSA 2NNNA 4ZZDA 3GUDA 4CCOA 2QGUA 4IEJA 1KZHA 4YG2F 2XAGA 1R6RA 2VKEA 4PSWA 1JUMA 2IGNA 4BS9A 2DYSH 4BBRJ
chains in the Genus database with same CATH topology
2E71A 2KFDA 2KIQA 2LKSA 4FQGA 2DODA 2CQNA 2DOEA 2DOFA 2B7EA 2KZGA 2L9VA 2K85A 2JUCA 1UZCA 2KISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E71 A;  2KFD A;  2KIQ A;  2LKS A;  4FQG A;  2DOD A;  2CQN A;  2DOE A;  2DOF A;  2B7E A;  2KZG A;  2L9V A;  2K85 A;  2JUC A;  1UZC A;  2KIS A; 
#chains in the Genus database with same CATH topology
 4ZDO A;  4UVA A;  3LQR A;  1OR7 C;  5LRS A;  5D5V B;  2VBZ A;  5F1J A;  3ZP5 A;  1EH8 A;  1R36 A;  2K4J A;  3LSJ A;  1LE8 B;  1S9H A;  3Q9V A;  4F55 A;  4IRG A;  3CTA A;  3J7Y J;  3BR5 A;  4BJ5 C;  1ON2 A;  4KMF A;  1X3Z B;  3PIO F;  1WPK A;  2ZC2 A;  3GFI A;  4PFP A;  2LYC A;  3CCU I;  2VUM J;  1Q1V A;  3HYI A;  4NNJ A;  2DMN A;  5K7Z A;  4D5C A;  3JRC A;  1FTZ A;  2PLY A;  2Y9Z A;  1IN4 A;  1I1G A;  5LBQ A;  3PNV A;  1SAU A;  2VXZ A;  4NUB A;  3SQN A;  2KFD A;  4FX0 A;  1JKO C;  2JVG A;  2LDU A;  3T0Y A;  2HQR A;  4RLQ A;  3EYI A;  3NRV A;  3ECO A;  3ZXS A;  1KQ0 A;  1XGM A;  3MKW B;  1B9N A;  2DA4 A;  5EZH A;  4Y7N J;  3ZMV A;  3X2Q H;  4BQN A;  3V42 A;  2AXL A;  4IHT A;  1MBH A;  4BYY A;  2E2J J;  2QBY A;  5IT9 K;  2XUB A;  4FET A;  2OTL I;  4MFD A;  3K4B A;  3M8J A;  5GAD J;  1BR1 A;  1HDD C;  2K27 A;  4D7N A;  3K4K A;  4DBR A;  1ZGJ A;  1XPX A;  3G3Z A;  3AFH A;  2PEX A;  2Y31 A;  3G4S I;  4QPQ A;  1ZR4 A;  1IXS B;  3LSH A;  3QOE A;  4P9U A;  4ZH4 F;  3F8M A;  2JSP A;  1MDM A;  3BDD A;  1TZL A;  2F6C A;  3E6B A;  1TWH J;  2LMD A;  4XR6 A;  4A3C J;  4BEH A;  4ZYE A;  2EIK H;  4JBA A;  3L00 A;  3E5X A;  5DCM B;  3FDY A;  1LVA A;  2ID6 A;  3DP7 A;  1HST A;  2WV0 A;  2ZME C;  2M30 A;  1UB9 A;  2E1M B;  2K3F A;  5BMZ A;  1OLT A;  3FK6 A;  2LG4 A;  1HW5 A;  1FSE A;  3T8R A;  5GTH C;  3SJM A;  4L5I A;  2Z33 A;  1U9N A;  3I58 A;  4Y4R A;  3W3C A;  1XS9 A;  1ZTR A;  2IP2 A;  2P81 A;  1ZRF A;  5DUK A;  5F64 A;  3OYJ A;  3QP5 A;  3JRF A;  4IRH A;  4OWR B;  3QQA A;  1GVJ A;  2WAF A;  4A3I J;  2Y9Y A;  2V9K A;  2KIQ A;  3C7J A;  4QWQ A;  2H94 A;  2K3P A;  1T8I A;  1C0W A;  1FNN A;  2FEZ A;  1L0O C;  2LR8 A;  4RM2 A;  2DXI A;  1MJB A;  3V7S A;  3CMM A;  4QPO A;  3ZPL A;  3RZO J;  4PJN A;  4M3G A;  4HX7 A;  1RZ4 A;  2B63 J;  4WXC A;  1Z67 A;  4MEY F;  4ENK A;  2H27 A;  4XLH A;  3T5X A;  1QZY A;  4Y3O A;  4RA2 A;  3RTR A;  2OZU A;  4NBQ A;  5AIQ A;  2MH9 A;  1XN7 A;  4PJL A;  3BQZ A;  1S6L A;  3KP2 A;  4IJA A;  1LNW A;  3DEU A;  3HOZ J;  3DU5 A;  1IV8 A;  4BHB A;  2HDC A;  3B6C A;  4L9J A;  1TTY A;  1BI0 A;  4H4K C;  3I71 A;  4YEJ A;  1TW3 A;  1U8B A;  2DFI A;  2ELK A;  3FWE A;  2DFH A;  5M5W J;  1QPM A;  3V4G A;  3VEP A;  2NAZ A;  4BQO A;  1J75 A;  1LE8 A;  4BXF A;  2OV7 A;  3GEZ A;  4BBS J;  3FMQ A;  1FYM A;  1FSH A;  2R7T A;  1XDU A;  1WKM A;  3CDL A;  1P92 A;  3WHC A;  3ZRG A;  4E7J A;  1H8A C;  2BZT A;  5CVI A;  2K02 A;  2DA5 A;  1Z7L A;  5JLX A;  5L3G A;  3N4M A;  2ACJ A;  1U3E M;  2EFO A;  4OIQ F;  1UG0 A;  1UEL B;  1EF4 A;  3DPU A;  1TC3 C;  2M2E A;  3T8T A;  4RAF A;  2D45 A;  4KYW A;  1Z1D A;  2NOJ B;  4L5E A;  3TO6 A;  2XGD A;  5FLX K;  2V9P A;  4HA8 A;  2E7X A;  3C3W A;  1JTY A;  2E36 A;  3REO A;  1APL C;  2EFP A;  3HZJ A;  4MFE A;  3K2Z A;  4RGR A;  4D5F A;  2G9W A;  2BY2 A;  2XIG A;  3IUO A;  4IX7 A;  1ONV A;  1V4R A;  2JT1 A;  3RZD J;  2K9M A;  4U87 A;  2WB1 A;  3OY9 A;  3A01 B;  2VKD A;  2NVQ J;  1UHS A;  3RCO A;  1I1S A;  3MWM A;  5GP9 A;  5CYV A;  1HW2 A;  2JPC A;  4YIR X;  3VB2 A;  3U1K A;  1O7L A;  1UHM A;  2GBY A;  4C3I J;  3HKZ A;  1YLF A;  1PUF B;  2A6H F;  2W1O A;  2Z2S B;  1D0X A;  3OYC A;  1W0T A;  3CC2 I;  1NHA A;  2OTJ I;  3GZ6 A;  1NK2 P;  1KQ9 A;  1ZAR A;  3FXJ A;  5J4Y A;  3ABT A;  4E7K A;  2FBH A;  3HIF A;  1L3L A;  4YII A;  4HX8 A;  5H6Q A;  1E17 A;  2BY1 A;  2LY1 A;  2VPR A;  3LWF A;  2DCE A;  4XL9 A;  5DCM A;  5K5R A;  1SFO J;  3OS1 A;  2Q2E B;  3IAS 2;  1P4W A;  4G6Q A;  3KEQ A;  3QOD A;  3TDU C;  1IN7 A;  2B7E A;  2EFW A;  2EA4 A;  2GA2 A;  3OYA A;  2A6E F;  5LLQ A;  2IGK A;  2LC2 A;  4S04 A;  3HRT A;  2EV5 A;  5ILU A;  1WJB A;  3NQO A;  4CCN A;  2A6T A;  5LHH A;  5F27 A;  1A35 A;  2LK2 A;  1PJR A;  2DT5 A;  2NS0 A;  5HVQ C;  1JHH A;  5J8C A;  2XGE A;  3LSI A;  2W85 A;  2WY7 Q;  4BGD A;  4Y15 A;  5J1Y A;  4BQQ A;  2WB1 N;  3J7A O;  2CQ7 A;  3LOC A;  3E5U A;  2M3A A;  2HXI A;  3WTX C;  3CF5 F;  1QO0 D;  3TGN A;  2M4G A;  4JX5 A;  5B1B H;  2QEN A;  3HKZ N;  2IJL A;  2F5C A;  2VXD A;  4HBL A;  3LAP A;  1R1T A;  4AWX B;  1ZEL A;  4ZJZ A;  2LSO A;  1BR2 A;  2X1E A;  2XKP A;  4HAM A;  5F0C A;  2MC3 A;  1ZN2 A;  5J1R A;  3WTU C;  4XLA A;  3PSI A;  4HDV A;  3V8K A;  1YFH A;  5LFA A;  2KHM A;  3KP3 A;  2VQH A;  2VQG A;  4UV8 A;  3I9V 2;  1OYI A;  4XKB A;  2VJJ A;  3K9T A;  4L9V A;  4HF2 A;  4AUX A;  3L9F A;  2RN7 A;  5JVG F;  1WCM J;  1VQ5 I;  1RRJ A;  2CFO A;  2LF7 A;  3LFK A;  2EBI A;  4A3J J;  2HYG D;  5DM7 F;  5CJ9 A;  1BA5 A;  4M72 A;  1WJ5 A;  5M5X J;  2R5Y B;  1REP C;  3MZY A;  5CVU A;  1WGX A;  2DU9 A;  4EJV A;  1P4X A;  3W6V A;  1MH3 A;  1WZ2 A;  1MD0 A;  3CJR B;  2JA6 J;  4RAY A;  4UVB A;  4XSZ F;  4II3 A;  2LLK A;  1U5T B;  3IH4 A;  2RRE A;  1JT6 A;  4ENM A;  2YSR A;  3JRE A;  2QYO A;  1QU3 A;  3OS2 A;  1GVD A;  4CO8 A;  2MFZ A;  2DI3 A;  4F52 A;  1QZE A;  1D5V A;  5L3B A;  2R7Z J;  3PL8 A;  2FJ1 A;  3IWZ A;  3SZT A;  1MIJ A;  4PGG A;  2ELJ A;  3GLX A;  3S1Q J;  2P7V B;  1Z0X A;  1R4M B;  2H6C A;  4HG2 A;  3R61 A;  4QTR A;  4IHX A;  2CG4 A;  2CW0 F;  5E3O A;  1EH7 A;  2BE5 F;  3E6D A;  5FRN A;  3LMM A;  1TW2 A;  3PFY A;  2RQP A;  2KLO A;  4KUM A;  4D1Q A;  2VC1 A;  2F2E A;  3BOQ A;  3A01 A;  1AWC A;  1FZP B;  1N78 A;  3H5A A;  5EEG A;  2L9V A;  1DQU A;  1YE9 A;  2NVU B;  1X1B A;  2KMU A;  2HFH A;  1B6A A;  4XQF A;  2V6E A;  2DOD A;  1X1A A;  5HNH A;  5F1R A;  3I5U A;  1LB2 A;  4W1U A;  1TWC J;  3R6S A;  3DTI A;  2L4A A;  4DGW B;  5D5U B;  4NQW B;  1ZG5 A;  1JKQ C;  3BT9 A;  5E1Z B;  3TQN A;  2YPR A;  3LA7 A;  3ZMT A;  4HQM A;  2JZY A;  1BIB A;  2LTP A;  3V7R A;  4M9X A;  5AON A;  1HQC A;  4XN3 A;  3VYR B;  3F0C A;  4S0H B;  3B6A A;  3QAH A;  2D1H A;  2PJR B;  1ETK A;  2GM4 A;  1FBQ A;  2EPF A;  2Q2E A;  2KJC A;  2OPT A;  4EM0 B;  4FIS A;  1G3S A;  5BQT A;  2EB7 A;  1UAA A;  3OSF A;  2I8D A;  2P6T A;  4M3B A;  3ZQH A;  5HS9 A;  2RVC A;  3GLL A;  2K9N A;  2LNB A;  1XSV A;  2MD5 A;  1XCV A;  1N75 A;  1ZRD A;  1JE8 A;  2X9D A;  1W7P D;  4CUG A;  2CMP A;  3GTP J;  1I6H J;  2XAS A;  2EV6 A;  3QYB A;  4A0Y A;  2VOD A;  1W36 C;  3ESW B;  2X6X A;  3CP8 A;  1ODD A;  3ABU A;  5FJ8 J;  1ETV A;  3MFK A;  2ECC A;  2CUZ A;  1MND A;  5ICG A;  2PMZ N;  1XMK A;  4IOC F;  3Q0V A;  1MBG A;  3I64 A;  3ZMD A;  5HDN A;  1B9M A;  4A6E A;  1Z21 A;  5GAG J;  3PJR A;  5FO5 A;  3HOX J;  3V8L A;  3K4C A;  3M1E A;  4HYE A;  5HNF A;  3OYE A;  4QLC U;  1FY7 A;  2HPM A;  4EJT A;  4CIC A;  4GYG A;  3J7A Y;  2LFB A;  1NG7 A;  1J09 A;  3MEX A;  2FXA A;  2JRT A;  1R49 A;  3C2G A;  1I27 A;  4UUS B;  3F8C A;  2EZK A;  2JJ7 A;  1Y1W J;  2JTV A;  2XC7 A;  2CYY A;  1HXD A;  4V2G A;  3LA3 A;  2M8G X;  2KKO A;  1KON A;  4UNO A;  2JA5 J;  3RQ4 A;  4G9Y A;  3L2W A;  3IRQ A;  1MBJ A;  2E5Z A;  3LA2 A;  3G6E I;  4BAY A;  4C2T A;  1I50 J;  4LFU A;  3S15 J;  4ZTF A;  1IW7 F;  1DPR A;  2NYX A;  5K5Q A;  5ILV A;  3S2H J;  3CUQ C;  3JTG A;  1VQ7 I;  3RSN A;  3UNG C;  2R5Y A;  4BE2 A;  4KJZ A;  1BJA A;  3C2B A;  1GXQ A;  1QA6 A;  3QU6 A;  1K7A A;  3CCM I;  3K6G A;  2RAE A;  4E4H A;  4ENN A;  1W7P B;  2IW5 A;  2JVH A;  5ICF A;  4CZC A;  1U5T A;  5GTI C;  2O6G E;  2UZK A;  1J0R A;  1MMD A;  1Y8Q B;  4CYD A;  3K10 A;  2R7R A;  1IRZ A;  1FLI A;  4IHW A;  2ESN A;  3HPG A;  1SC7 A;  3K1P A;  1YJW I;  3FXQ A;  4ZDP A;  3FKI J;  1S7E A;  1QNT A;  2KIS A;  1D0Z A;  1YHQ I;  3U2R A;  4DQ2 A;  1BR4 A;  1JGG A;  1CGP A;  2E34 A;  4ZC3 A;  5JI6 A;  2R7U A;  3KEY A;  1RPW A;  2FA5 A;  4DYR A;  1DGR M;  2QEX I;  3H5R A;  3HL2 A;  2C6Y A;  2DW4 A;  2VON A;  5DD4 A;  2OA4 A;  2DFE A;  1SFK A;  5FKM A;  4LIU A;  5IYB J;  2XF6 A;  2K9S A;  2F5V A;  3DKY A;  2NS8 A;  3KEO A;  1X4O A;  2EH3 A;  3OSG A;  5C4X J;  2FX0 A;  1PP8 F;  1BI1 A;  5ERI A;  3BR6 A;  4MQV A;  3JSO A;  2ZME B;  1W4M A;  3GTQ J;  3HPH A;  2XDV A;  3CQZ J;  5K5O A;  4NQW A;  4KIS A;  4FE4 A;  1FWZ A;  3KE2 A;  2EFQ A;  4E7Z A;  1VTN C;  2HOA A;  4ESF A;  3DV8 A;  4G7O F;  4RB3 C;  1OQY A;  3AG2 H;  4XRM A;  2L7K A;  3HOV J;  1TQM A;  4EQQ A;  2PJR A;  1LDK B;  3H1C A;  4GRI A;  2BHZ A;  3EYY A;  4IHY A;  3M8E A;  1U6G A;  1IGN A;  1SAX A;  5HDK A;  2PJP A;  3BZ6 A;  1EH6 A;  3G2B A;  5FD5 A;  2BEO A;  1OIS A;  1FPQ A;  1FT9 A;  2XPW A;  2QCO A;  2L54 A;  3I4P A;  4P96 A;  2DTZ A;  1G3W A;  1JT0 A;  3CJT B;  2DA1 A;  3GFL A;  3OYN A;  1VQK I;  1WJE A;  1U78 A;  3CLO A;  2IGM A;  3M9A A;  3W6K B;  2JUG A;  2OQG A;  3OL4 A;  4HOB A;  4PDK A;  1K79 A;  2IA2 A;  2L2O A;  1BL0 A;  1VQ9 I;  2M5W A;  2STW A;  2E2H J;  1TWG J;  3M4O J;  2M8E A;  4KIG A;  4XK4 A;  2J5P A;  1I6X A;  1WWX A;  4XN0 A;  2OJE D;  3RDI A;  3T1B A;  2KZG A;  2M7A A;  3D1N I;  1AHD P;  3P7N A;  1OR7 A;  4IZZ A;  2E19 A;  5FRO A;  2PG4 A;  1X3U A;  3DCF A;  3DBR B;  4XLC A;  5KVR A;  1ZLK A;  1I3Q J;  4IOA F;  5IYD J;  2CV2 A;  3I0T A;  4UUS A;  2WAE A;  3KX2 A;  3E6M A;  1X19 A;  5DDG A;  3WTT C;  5D4S A;  2K40 A;  2CRG A;  2EIM H;  4R79 A;  3BZK A;  2EIJ H;  4PJM A;  4IPA A;  3GBG A;  2M34 A;  4F92 B;  3FHZ A;  2EZH A;  2W24 A;  5CKT A;  4RDU A;  4BY1 J;  4N9I A;  4GFB A;  1GUU A;  1QQI A;  5JHU A;  2LD5 A;  3L09 A;  3BR3 A;  4MTD A;  1YI2 I;  1W7P A;  3KIO A;  1HSJ A;  2OQR A;  4Y52 J;  3L2U A;  1X1P A;  1G8X A;  1XGO A;  3HGY A;  3G1L A;  3OR2 C;  1T2K A;  1K4T A;  1XG1 A;  3LST A;  1ZAO A;  5HOO A;  1F4K A;  3LSM A;  2COM A;  2DLL A;  1R22 A;  2X0L A;  4II2 A;  2QSH X;  2VE8 A;  1VQ6 I;  5E1X A;  3MCZ A;  1ZG1 A;  3IV5 A;  2X1D A;  1NH3 A;  3VWB A;  1Y0N A;  2TRT A;  4QSH A;  3SFZ A;  4I99 C;  2FQ4 A;  4AU7 A;  4V19 K;  3LSP A;  5CVR A;  2BW3 B;  2DJN A;  1R5G A;  1FX7 A;  4A69 C;  2JWT A;  4AYB A;  2FF4 A;  2QZ8 A;  3OL3 A;  5E8G A;  5KAF C;  2A3S A;  4GDF A;  2LOO A;  1W5T A;  2LBF B;  3IKT A;  4CCL A;  4PUS A;  5FKK A;  2P5L C;  2HR3 A;  5TJJ A;  1WJA A;  1YX5 A;  4NC7 A;  4BE1 A;  3BG7 A;  2RDP A;  2HKX A;  2O3F A;  3BY6 A;  2ZME A;  3Q5F A;  2RNJ A;  4MGR A;  1RNL A;  1LFB A;  3CMA I;  3SZP A;  1O57 A;  3PQK A;  3PO3 J;  2W82 A;  2IGO A;  2NXN B;  2WAQ A;  3VOD A;  3KET A;  1BOA A;  1HA8 A;  5CVJ A;  5F04 A;  4A3F J;  1SVM A;  5L3E A;  4EV0 A;  5DCF A;  2LRE A;  3H5N A;  3K0L A;  4DYQ A;  2YS9 A;  4A12 A;  1MBE A;  1P7I A;  1I3A A;  3HOU J;  1X1C A;  2HZD A;  2RKH A;  4BAC A;  1PYV A;  4I0A A;  3C18 A;  1RI7 A;  2XB0 X;  4C9Y A;  1TWA J;  1JUP A;  4J19 A;  4Q4Z F;  2OF7 A;  2KDO A;  2FD5 A;  1IN6 A;  1R7J A;  3V8J A;  2Z99 A;  2MG4 A;  1IN8 A;  4AVZ A;  4PJ0 C;  4UY8 I;  2DBB A;  2ZSH B;  4ANJ A;  2MW8 A;  5LGU A;  4A0X A;  2KDZ A;  2FUG 2;  1OCP A;  5M3M J;  1O3R A;  2D1V A;  3BJA A;  5E18 F;  3D5R C;  2LH9 A;  3QPL A;  3BCA A;  2P6S A;  2RC4 A;  5IT3 A;  1HF0 A;  4KT5 C;  5J40 A;  3ZN1 A;  3QPS A;  3SFI A;  4KT6 A;  2DMT A;  3VSL A;  2R7S A;  3MZ8 A;  3F8N A;  2QKL B;  1B72 B;  3BTI A;  1VFC A;  1KU7 A;  3ERM A;  1OJL A;  1FOY A;  1Y8R B;  3E7L A;  5EGO B;  1QRY A;  4C2U A;  3WE3 A;  3S1R J;  4JOM A;  3F6V A;  1ZRE A;  2GXB A;  3Q9S A;  1FMV A;  2BVM A;  3OIP A;  2WAQ N;  2CSO A;  1JXS A;  4EGZ A;  3FBI B;  4G94 A;  3OR1 C;  2LP0 A;  3S8P A;  3ISP A;  2GXG A;  2KIF A;  3W2A A;  1IUY A;  2CJJ A;  2O8K A;  5LGT A;  1YW7 A;  4U0W A;  4PGH A;  4LOC A;  2XB5 A;  3GW2 A;  2HOT A;  3EET A;  3DBL B;  2KT0 A;  5ILS A;  1FYK A;  2Z9O A;  2XSD C;  5KAI C;  1AOY A;  1OCZ H;  3CF2 A;  3JR9 A;  3PO2 J;  2VKV A;  4Q5S F;  1G3Y A;  2AQF A;  3CC4 I;  1OCR H;  2WAD A;  3FZV A;  4LJZ F;  3IH3 A;  3WU2 C;  4HF1 A;  4WF2 A;  1YQA A;  4JP0 A;  1POG A;  3OYI A;  1K4S A;  4MQ9 F;  4HDU A;  3TO7 A;  1MMG A;  3F23 A;  1W36 D;  1SAN A;  4OIP F;  4MO7 A;  5DS9 A;  3FBN B;  1RUN A;  1MSE C;  2XGX A;  3FIS A;  3WTW C;  3EUH C;  2G7U A;  1Z7U A;  1USS A;  2VJ4 A;  3DF8 A;  3A0H C;  3M1C A;  2E7W A;  1SD7 A;  3JRA A;  1W1W E;  4RS8 A;  4CHU A;  5IP6 A;  2BW3 A;  4HLX A;  3ULQ B;  3JAM Z;  2VBW A;  4IVN A;  2XPV A;  3OYM A;  2DAO A;  4HST A;  3BTC A;  3PIP F;  1X2N A;  5H20 A;  2CS3 A;  2LBF A;  3OV8 A;  1BJZ A;  3O6B B;  3J80 Z;  1BN5 A;  2CUF A;  2XAU A;  5F0H A;  4KIC A;  2DJI A;  2ID3 A;  3CJQ B;  4UUV A;  3FF5 A;  1D1C A;  2YX7 A;  1BOB A;  2IPQ X;  1W0U A;  1X58 A;  1YS6 A;  3FXU A;  3KP4 A;  3RQI A;  3MD2 A;  4BU2 A;  3S32 A;  2L4M A;  2XPU A;  1YYV A;  1O4X A;  1BIA A;  1JGS A;  4M6Y A;  2HTS A;  4OMY A;  2M87 A;  2AO9 A;  2KQR A;  1A5J A;  2XAQ A;  1IDZ A;  3DLA A;  4G8X A;  1H0M A;  1V55 H;  1BM9 A;  1YIO A;  5E20 A;  3RKW A;  5E8I A;  4M74 A;  3SXY A;  3HSE A;  4F7Z A;  1VF9 A;  2JUC A;  2V9V A;  3HUG B;  1VI0 A;  4M71 A;  4WXH A;  1WFX A;  4LLN A;  3WTV C;  4CXF A;  3FXR A;  1D8K A;  2HQA A;  2CW7 A;  4LLG F;  2K9Q A;  4S05 A;  1E3O C;  4I02 A;  4R1H A;  2ZXH A;  1XGS A;  5FKN A;  2VIX A;  1MMN A;  1T0F A;  2L9R A;  1HKQ A;  1W5C C;  1Y0U A;  1T98 A;  2KIU A;  4U7B A;  3BP8 A;  6PAX A;  3HM5 A;  4ESJ A;  3SHF A;  4B48 A;  2OC6 A;  5C4J J;  2CV1 A;  2DN0 A;  1SD4 A;  2V7F A;  2W4S A;  4E70 A;  4LIV A;  1FTT A;  1SEU A;  1DP3 A;  2FOK A;  3J81 K;  3JRG A;  1H9T A;  4EGY A;  1SMT A;  2X6Y A;  3IC7 A;  4P9F A;  4C3H J;  5C44 J;  5CVV A;  1B72 A;  3FIW A;  1Y56 A;  5EGO A;  1I39 A;  4RM3 A;  1ENH A;  3L1P A;  1RES A;  3BC8 A;  5HLI A;  3S3N A;  2FU4 A;  1BW5 A;  5D6E A;  2F4M B;  3H0D A;  5JLW A;  3CUQ B;  5TIS C;  3GXO A;  3EUA A;  5IOY A;  2IS2 A;  4OIR F;  3GO5 A;  1ZK8 A;  3A0B C;  4UHT A;  1Q1H A;  2QA4 I;  4U0Y A;  2L0K A;  3FXM A;  1QHG A;  4LG0 B;  3QU3 A;  3S93 A;  3FKJ A;  3HTU A;  4J01 A;  5EDN A;  2P7C B;  3AL0 C;  3JSP A;  3Q3S A;  1D8J A;  1XX5 A;  4DIQ A;  3RKY A;  3VDX A;  2X4H A;  1GV2 A;  1O3T A;  4NB5 A;  2Z16 A;  4PK4 A;  4A5N A;  5DYM A;  4A2U A;  4UB8 C;  1W5S A;  2X1C A;  1M1E B;  1T0F C;  4BDY A;  5IT9 Z;  2GIZ A;  4O3M A;  2O0Y A;  5EG0 B;  3GZ5 A;  1ZGW A;  5H6R A;  5HS8 A;  5EEA A;  2O9L A;  1OCC H;  4PJJ A;  1NTC A;  3JTH A;  4BE0 A;  2JMW A;  1DP7 P;  1P6R A;  3O2P E;  4XM3 A;  3ZOB A;  1AKH B;  1JJ6 C;  3NWS A;  4E7L A;  1V5F A;  2FNA A;  3ZQG A;  2AS5 F;  2NVT J;  1YOV B;  2NS7 A;  1YW8 A;  1V5G A;  3E6C C;  2ELH A;  2E71 A;  4UB6 C;  4RAG A;  1DU6 A;  1S8N A;  2BV6 A;  1DUX C;  4YFX F;  3GF2 A;  4BNC A;  3SZG A;  5HDG A;  1O3Q A;  4F91 B;  3HGG A;  3RPQ A;  3I3L A;  3O8H A;  3PSF A;  4IO9 F;  1KU2 A;  1J59 A;  3BR0 A;  4GYI A;  5EZG A;  2ZNY A;  4RGX A;  3IAM 2;  3UKG A;  4HV5 A;  1ITY A;  4G6T B;  3RJP A;  4XMY A;  1PP7 U;  4A0Z A;  1P4A A;  1HLV A;  2O7O A;  5J1U A;  3F9K A;  3KYD B;  3DQV C;  3CCV I;  2KZV A;  4U0V A;  4CA0 A;  3NWT A;  3GFM A;  3JCU C;  5LHI A;  3W2V A;  3HUG A;  4KIF A;  4YFK F;  2QSG X;  2CWE A;  1J9I A;  3CMY A;  2W57 A;  2V1X A;  3DU6 A;  3I54 A;  2L9N A;  1TNT A;  3MVP A;  1D0Y A;  2H6B A;  4FTH A;  4LD5 A;  1TT5 B;  2UV1 A;  5FRM A;  3S1M J;  2LF8 A;  2W00 A;  3EPZ A;  5FFZ A;  2VJ5 A;  3W6J B;  2DDB A;  3KLN A;  4GO1 A;  1PUF A;  4HRI A;  1YS7 A;  1D1B A;  1U8R A;  2Y48 A;  4QIW N;  1E0E A;  1R5I D;  3DFG A;  3BTJ A;  4XOT A;  2ME0 A;  3K1M A;  5B66 C;  2EJR A;  1WJD A;  2WC2 A;  1V5E A;  1B59 A;  1IN5 A;  2XRL A;  3QRF F;  2YR2 A;  3TBI A;  3JRH A;  1TLH B;  4G12 A;  4ESB A;  4WX9 A;  5A2Q K;  2R7V A;  1YG2 A;  3KZY A;  3ERE D;  1T6S A;  2A05 A;  4OMZ A;  2V79 A;  3H9Q A;  2HTJ A;  3PFI A;  5KCM A;  4XID A;  4CGZ A;  1UG2 A;  1VQN I;  3KFW X;  2L5Q A;  1BW6 A;  4Q47 A;  1A36 A;  3PNY A;  1T38 A;  4GXO A;  4B1R A;  3N05 A;  1DGW Y;  2ZXJ A;  4IHV A;  1K6O A;  4AIH A;  3CD6 I;  1ZG3 A;  3CUQ A;  3PM1 A;  1N77 A;  2HPI A;  4KNY A;  3P9K A;  2R3S A;  5D6F A;  5FFX A;  3QP6 A;  2LKX A;  3I53 A;  3WU1 B;  2CUE A;  1D5Y A;  2ZBK A;  5DV5 A;  3HOY J;  2UXN A;  4LG0 A;  5FLX Z;  4C30 A;  2UXX A;  9ANT A;  4MEX F;  2JA8 J;  5J3L A;  1TQI A;  1O3S A;  2FMY A;  3SEZ A;  1OYY A;  5E3M A;  2HOE A;  2UUZ A;  2VLA A;  2VOP A;  3OOP A;  1IG7 A;  2CQQ A;  1GHC A;  2ZFW A;  4W97 A;  1LUJ B;  3BRO A;  4PZJ A;  3VSK A;  3CLQ A;  5DUI A;  2HDD A;  2DTR A;  2F5D A;  1D3Y A;  4EVI A;  2HNH A;  2HDW A;  2LY2 A;  1HC8 A;  4RB2 C;  1LPQ A;  5ICE A;  2W7N A;  3LQQ A;  2F4I A;  5EG0 A;  2DA3 A;  3KP7 A;  1Z3X A;  4Y33 A;  1ETQ A;  1FMW A;  2FE3 A;  3WHB A;  2ISZ A;  4BY7 J;  1UMQ A;  1AKH A;  3LAJ A;  4UUT A;  4Z2Y A;  5C3E J;  2VPL A;  2QSF X;  2FBK A;  2CQK A;  2BVL A;  2QQ9 A;  3KCC A;  3OYG A;  3TED A;  4IQJ A;  5K7H A;  3JRD A;  1MBK A;  3BJ6 A;  1STZ A;  2WBM A;  3K4L A;  4B3X A;  4IRI A;  2VC0 A;  3J81 Z;  1OMI A;  2W84 A;  2O5R A;  1OKR A;  4OIO F;  2AHQ A;  4GGG A;  2MD0 A;  3OYB A;  2XHK A;  3VFZ A;  4FX4 A;  2DDA A;  4XKW A;  4KN7 X;  2EZI A;  3B02 A;  3QYF A;  4I09 A;  5FKO A;  5GAE J;  3NAU A;  4AD9 A;  5KHD A;  4XSX F;  4CDG A;  2DA6 A;  2Z3Y A;  1VQO I;  3F6O A;  4OAZ A;  3OIO A;  2GQQ A;  5JR3 A;  2H1L A;  4IF4 A;  2ZB9 A;  2QUF A;  5D8L B;  3BG5 A;  3DLL F;  4JX4 A;  4V2F A;  2DOF A;  2IS6 A;  3E1S A;  4XLN F;  1UJ8 A;  5JFR A;  1VQ4 I;  3S2W A;  5J47 A;  2HVR A;  5LD2 C;  3QYE A;  2CH0 A;  3CZ6 A;  4B09 A;  1IJW C;  2V26 A;  3ZQC A;  2CQX A;  1H89 C;  5HOD A;  1CF7 B;  3CES A;  2ZXW H;  2DO7 A;  2M0M A;  2IS4 A;  1J2X A;  2HOS A;  3H3V K;  4P55 A;  3KYL A;  4XKV A;  1MH4 A;  4UV9 A;  3VOE A;  1IV6 A;  2BBY A;  2F4O B;  3E5Q A;  4RMN A;  3TOB A;  3F22 A;  4FT8 A;  4NDL A;  1ZHF A;  3GTM J;  2NVY J;  3WU0 A;  2XGC A;  1TQP A;  3BG9 A;  4HNT A;  1FBS A;  1XGN A;  1KA8 A;  3DBH B;  4M9Z A;  4M9S A;  3U21 A;  2W48 A;  1E3H A;  1D1A A;  3U9G A;  1JKP C;  2R7F A;  1KYZ A;  3CME I;  2B0L A;  3HHH A;  5L3F A;  1R00 A;  1LKX A;  2ZJ2 A;  3SDB A;  2I5U A;  2ZFU A;  2R7D A;  3HG9 A;  5K1Y A;  3DKW A;  4HZF A;  1Y6I A;  1FYL A;  4ZYG A;  4BJT A;  5AIP A;  2LKP A;  3H9G A;  2O61 A;  2HVQ A;  1MNM C;  4ZDL A;  3IWF A;  4CH7 A;  4Z6Y A;  4ZZL A;  3CC7 I;  3CO6 C;  4AVP A;  2F5F A;  2QBY B;  2IXS A;  4K2E A;  4IL6 C;  4I2O A;  4OU0 A;  1T33 A;  2L01 A;  1FEX A;  2OZ6 A;  4LLL A;  2IA0 A;  2ZKZ A;  1F36 A;  3BTL A;  2NVX J;  1UHW A;  1XB4 A;  1WQ2 A;  3DWL E;  2HQN A;  1MMA A;  1QVT A;  2ESH A;  1DDN A;  1OCO H;  1S7A A;  1XSX A;  2TCT A;  3CDI A;  3FMR A;  4M73 A;  1Z91 A;  4O5V A;  3WGH A;  2JK3 A;  4EJO A;  5D8K B;  3IHU A;  4OAY A;  5IP9 J;  3KLO A;  2CUJ A;  2IT0 A;  2NRA C;  5DTD A;  3GCM A;  5EEH A;  3FK7 A;  5D4R A;  4NHJ A;  1NG6 A;  1N25 A;  2EQR A;  2V1N A;  2P5K A;  3DPT A;  4B4C A;  2DK5 A;  2OCE A;  1X3W B;  3BG3 A;  4P5O A;  4EEF G;  3ECH A;  4HQE A;  4UVC A;  1VQL I;  4HPQ A;  1X4P A;  2E2I J;  2Y30 A;  4FAS D;  4ZYD A;  4XLP F;  1VZ0 A;  2XF5 A;  3MQ0 A;  3I56 I;  3F8F A;  2DYR H;  4E7H A;  4DJA A;  2GOM A;  3HSR A;  2GAU A;  5IPA A;  4XRS G;  3M7G A;  3FMS A;  3ELK A;  1Z77 A;  1ZRC A;  2X85 A;  3R0J A;  4UXN A;  1IXR C;  5BOX A;  3S17 J;  2DOE A;  4HF0 A;  3ZCO A;  1IUF A;  1CF7 A;  2JSC A;  1Y39 A;  2AQE A;  3EQL F;  2ZJP F;  3DTK A;  5HLG A;  3HSF A;  2DPU A;  2Z5U A;  1ACI A;  3JRB A;  1YW9 A;  3HRU A;  4CSW A;  1P7J A;  2E5N A;  4OIN F;  3CJN A;  3Q0U A;  2DMU A;  1G59 A;  4X1E A;  3HOS A;  2IA1 A;  3L7W A;  1LEA A;  5E79 C;  2DMQ A;  3HRS A;  4M3F A;  3PUB A;  3H92 A;  3RYR A;  3QOP A;  2HI3 A;  2ZJQ F;  1TBX A;  1ZH5 A;  3ABK H;  1TT0 A;  3ABM H;  1BI3 A;  2QKM B;  1MJA A;  2VB6 A;  2BOL A;  1YX3 A;  3FXO A;  5LRR A;  3TMO A;  4NC6 A;  4AID A;  4Y13 A;  3IP4 B;  4I7H A;  1HKT A;  1RET A;  4LK1 F;  4XON A;  4IXA A;  4XBF A;  3DXJ F;  1RR7 A;  1EV7 A;  2OBP A;  2DMP A;  3AL0 B;  4DZJ A;  3GTL J;  4L9N A;  1MZB A;  3TDZ C;  1VQ8 I;  4LK0 F;  2LVS A;  1BI2 A;  2Q1Z B;  3LL7 A;  3RYP A;  1PDN C;  2FBI A;  4C2M J;  1BBY A;  4HSR A;  4F93 B;  5M5Y J;  1T08 B;  1WVR A;  1FIP A;  1V3F A;  5B3S H;  3ZR8 X;  2VBY A;  1NK3 P;  4AYB N;  3L2Q A;  2HU9 A;  4XLE A;  3K69 A;  3BR2 A;  1F1Z A;  1WJC A;  2V4J C;  2KRH A;  5J8F A;  3EUH A;  3ZMU A;  2EFN A;  2G0E A;  1Z05 A;  5TGT A;  1A6I A;  3IH2 A;  3DEE A;  4IKF A;  3G73 A;  3JW4 A;  4XNF A;  4WCG A;  2VE9 A;  3M07 A;  4XOP A;  1IRG A;  1IDY A;  3U1D A;  3TW7 A;  1MBF A;  2YU3 A;  5FB2 A;  2X48 A;  3R4K A;  3MMY B;  1ETY A;  2DT6 A;  1K6Y A;  2MSY A;  3WTS C;  4BQA A;  2GA1 A;  1S29 A;  3EDP A;  2AXT C;  1WJF A;  1UFM A;  2V1D A;  5J4V A;  1MNE A;  1XC5 A;  3OMY A;  3COA C;  2R7O A;  3W2W A;  1T95 A;  1JTX A;  3I55 I;  2EWN A;  4ZYA A;  3DTE A;  5K7F A;  2CO5 A;  1SMY F;  1GLN A;  2Y2Z A;  2EA2 A;  3FHN A;  1WH5 A;  1UZC A;  2VOO A;  3BLY A;  4ASN A;  4DW6 A;  3RKX A;  3K70 C;  1MMS A;  1A04 A;  2K5C A;  3CO7 C;  5BS6 A;  4KIB A;  3HEF A;  1Z6R A;  4RAZ A;  4DBQ A;  1T39 A;  3GX4 X;  3AKZ A;  4HEA 2;  5L3D A;  3I59 B;  2D2W A;  2Q8K A;  2K85 A;  2X6W A;  1G4D A;  1MSF C;  4BXX J;  2FQ3 A;  2QQB A;  4B3A A;  2E1C A;  1PVE A;  2CU7 A;  2MA3 A;  4BKX A;  2ZCW A;  2ZXI A;  2X6O A;  4D0P A;  2L7Z A;  3BZC A;  1OCT C;  1FOK A;  2LKS A;  1LEB A;  3H9J A;  5ICC A;  1FP2 A;  1WRJ A;  4XRS A;  1R1U A;  1YJ9 I;  4IQ4 A;  2YUS A;  4WWC A;  4KN4 X;  3CUO A;  1UST A;  3WE2 A;  3FX3 A;  2WWY A;  2K4B A;  1ZYR F;  5JHF A;  4FCY A;  4L9T A;  2CV0 A;  3K4J A;  4L18 B;  1DPU A;  4CCM A;  2XAF A;  3FM3 A;  5CQG A;  1B1B A;  4P1W A;  1DU0 A;  4JK1 X;  5KK1 A;  2ZO4 A;  3NAR A;  5HLH A;  1S72 I;  1GT0 C;  4BHP A;  2XVC A;  1JHF A;  5FLV A;  3MZH A;  3N97 A;  1IRF A;  2VT2 A;  5IYC J;  3CCY A;  2EK5 A;  2GXA A;  3OYK A;  4HNV A;  2R7W A;  4M3D A;  1R9T J;  5IOZ A;  3E0J B;  2MGQ A;  3ZQI A;  4AIK A;  4EAT A;  1GDT A;  4PCQ A;  4BHC A;  2FNP A;  2XAH A;  3LSG A;  2BXZ A;  1MJ9 A;  3QPH A;  1VND A;  4O6J A;  2LY9 A;  4A3K J;  4JX6 A;  4KA4 A;  2R7Q A;  1SFU A;  1ZR2 A;  2V1U A;  2VKH A;  2R4G A;  3BCB A;  3R0A A;  4RBO A;  4ITV A;  4U88 A;  1ETW A;  2HGC A;  3C2H A;  2HYJ A;  4L5J A;  3CCR I;  5CLS A;  4XLF A;  4LB6 B;  2F5E A;  4X6A J;  2PMH A;  4H0E A;  3K4M A;  1U2W A;  2KIM A;  5BPI A;  4A5M A;  4CZZ A;  3ZGK A;  2XV4 S;  1JUS A;  4ABZ A;  3LFU A;  4B8X A;  4A3M J;  4DYC A;  1IXC A;  1RKT A;  2PN6 A;  3R60 A;  3OIQ A;  3KP5 A;  1IF1 A;  3S1N J;  1F9N A;  1R58 A;  2A61 A;  4Q48 A;  4BH9 A;  4FE7 A;  3H36 A;  1AU7 A;  2MH2 A;  1R4N B;  1K78 B;  3FM5 A;  1R1V A;  4LB5 A;  1P2F A;  2K86 A;  4BXU A;  5HLT A;  2A5Y B;  3CDH A;  2P5V A;  1R5H A;  4YFN F;  2HYF A;  2VL8 A;  2DQR A;  5J6X A;  1YRN B;  4LIT A;  5DEQ A;  2FSW A;  5FD6 A;  5LEK A;  3A1Y A;  2RNG A;  2E60 A;  2J5O A;  3HDD A;  1XMX A;  2HEO A;  2OAZ A;  2RQQ A;  2ECB A;  3OYF A;  2GIV A;  4BL0 B;  2QLZ A;  1MKM A;  2Y75 A;  3H3Z A;  2BXY A;  2VAS A;  4N4O B;  1JKR C;  3RIR A;  5H2F C;  1MW7 A;  3KP6 A;  2OUM A;  5D5X B;  5IP7 J;  2X51 A;  1MGT A;  2N8G A;  4JQF A;  1RKW A;  4YEL A;  4CCK A;  2WTE A;  3I59 A;  3K1N A;  2KRC A;  4ETS A;  2QVO A;  1EA3 A;  3PUF A;  2VT3 A;  3KYC B;  2F48 A;  4N4N B;  3RKQ A;  2FOW A;  3ROU A;  5F08 A;  1K61 A;  4XRF A;  3WGI A;  4LMY A;  4ON0 A;  3GTG J;  3TOA A;  3HC7 A;  5DD8 A;  3L2R A;  2MLK A;  3GFJ A;  1E2X A;  2JPB A;  2NNY A;  4D9J A;  3AG1 H;  3ABL H;  2XAJ A;  2IAI A;  2BHY A;  2KRF A;  3ASO H;  3F21 A;  2XSJ C;  2BY3 A;  3WG7 H;  2DT7 B;  5LGN A;  2HWV A;  3O8G A;  3WTY C;  1J5Y A;  1R23 A;  2KL4 A;  3SYT A;  4C3J J;  4E7I A;  4N0B A;  3WTZ A;  3Q0W A;  4RLF A;  3L2V A;  2ISY A;  4CYC B;  1HW1 A;  2HQ5 A;  1V54 H;  3OOU A;  4XIC A;  3MAJ A;  2JRM A;  2QQ8 A;  1Y1V J;  3TKY A;  3P5J A;  4B44 A;  1SD6 A;  1VQM I;  2Y0M A;  2E1N A;  3BR1 A;  2EV0 A;  3GZN B;  3ZN0 A;  2P0W A;  3A02 A;  4EM1 A;  2HVS A;  3GTO J;  1UCR A;  3IKV A;  3MKL A;  1LDJ A;  2E1M C;  3HXL A;  4G7Z F;  3BPV A;  2PQ8 A;  3A2K A;  1KU9 A;  4AC0 A;  2ZJR F;  4PFO A;  5E3N A;  2GOX B;  3TP3 A;  4BDZ A;  5BPD A;  1IO2 A;  2VBX A;  1XDS A;  1TP4 A;  4G7H F;  1OPC A;  3UR3 C;  4HV6 A;  2NOG A;  5GPC A;  3G1M A;  3FXL A;  4MIM A;  2A69 F;  2CQN A;  4DNC A;  1WI3 A;  5E1W A;  4RB1 A;  3RPU D;  3ZQ7 A;  1XCB A;  2CGP A;  1G6N A;  3MN2 A;  1IC8 A;  3BPX A;  3L2C A;  4E6K G;  5E17 F;  1XMA A;  1YIJ I;  2I10 A;  1KU3 A;  4Y17 A;  2IRF G;  3D5L A;  2HXO A;  1FOW A;  1ULY A;  2JA7 J;  1ZKG A;  2QWW A;  1WHU A;  3ASN H;  3OS0 A;  3OYH A;  1HCR A;  2L7M P;  5GPA A;  4RGS A;  1HDP A;  1OFC X;  1T56 A;  5HS7 A;  2L3D A;  3CCE I;  3DKX A;  3D5S C;  4MNU A;  4TV7 A;  2CW8 A;  2O03 A;  2K7L A;  1FJL A;  2PMZ A;  3QWL A;  1S3J A;  3C1D A;  1S5L C;  1VQP I;  1FIA A;  3AG3 H;  3BWG A;  1SFE A;  3MKZ A;  4BJ6 C;  3DEW A;  3CP2 A;  2R5Z B;  4J00 A;  4PSX A;  4YRV A;  2Y0S A;  2L02 A;  1LQ1 A;  4LGW A;  1K78 A;  1I5Z A;  5EF6 A;  4U7D A;  2BYV E;  2DOA A;  2P4W A;  3NEU A;  2KJB A;  2G7H A;  1IZ1 A;  2IS1 A;  3MKY B;  1LJ9 A;  3BQY A;  3G71 I;  2EIN H;  1IRX A;  1YRN A;  3GWZ A;  4CCJ A;  1YO5 C;  3ZQF A;  3P9I A;  3WGG A;  2Y69 H;  2H8R A;  2QF7 A;  3E97 A;  2R0Q C;  1SFX A;  2HZT A;  3PNT A;  1SD5 A;  2IEK A;  3M8F A;  2ZSI B;  4I0B A;  4M6V A;  4G6D A;  2D5V A;  2H09 A;  5FKL A;  1R71 A;  1ETX A;  2W25 A;  1EJ9 A;  3E3V A;  2E35 A;  2ETH A;  2QQA A;  3CCJ I;  5LHG A;  2A07 F;  2DFF A;  3SDG A;  2ICW G;  5DM6 F;  2PI0 A;  3I4N J;  4XOR A;  1FC3 A;  1Z9C A;  4L0Y B;  2M0C A;  1QZZ A;  1TWF J;  2MYS A;  2COB A;  2VI6 A;  2XF7 A;  1E3P A;  3CCQ I;  1P9Q C;  3FXK A;  2LRD A;  5CPR B;  5B5E C;  4XKC A;  1G3T A;  2IVM A;  4ENJ A;  4RGU A;  1ZQ3 P;  3HTS B;  3F72 A;  3WOD F;  3ML6 A;  2MBF A;  2WV1 A;  3TO9 A;  3DPL C;  1BC8 C;  2JQ7 A;  4EJU A;  3GVA A;  2XKO A;  4KDP A;  1AA7 A;  3S2D J;  1O7F A;  4KIT B;  1Z3Y A;  4BUP A;  1RC9 A;  4A3B J;  2MC4 A;  2OCC H;  1X1D A;  2Y0S N;  1YJN I;  2QM3 A;  1YTY A;  2PMU A;  4N9H A;  3AG4 H;  5M3F J;  4DOZ A;  1HBX G;  1U0J A;  2EZL A;  3D0S A;  1GV5 A;  2PFB A;  2DK8 A;  4CYC A;  2MLG A;  4EJW A;  4RB0 A;  2L9S A;  5TRD A;  1QPI A;  2ZNZ A;  2DA2 A;  1U9O A;  3K70 D;  1ZGA A;  4MLO A;  4A3G J;  2BY0 A;  2VJI A;  5L3C A;  3ZMS A;  2GLO A;  3HRM A;  4FQG A;  3F3X A;  2VQC A;  4M3E A;  4HLY A;  3O3K A;  2VQL A;  5F0F A;  2UWM A;  2XRO A;  2PX9 A;  3K2A A;  4I6Z A;  2RV8 A;  1B8I B;  2R7X A;  3HOT A;  4WXD A;  2M4K A;  4EM2 A;  3S3M A;  4R8H A;  1TL8 A;  4B43 A;  2K9L A;  5EJC A;  1LFU P;  2A68 F;  1LFP A;  3ZMZ A;  3K4N A;  1OYW A;  5FLM J;  1LVK A;  3GME A;  3S3O A;  2FRH A;  2JN6 A;  1G2H A;  1J7K A;  4A3E J;  1HKS A;  2OU2 A;  1XD7 A;  3LSR A;  2V6C A;  3KZZ A;  2KPM A;  1FP1 D;  5GAH J;  3KPH A;  2XRN A;  1LDD A;  2DA7 A;  4D7M A;  4HNU A;  3RI4 A;  1CQT A;  2JA2 A;  3WG9 A;  2E1O A;  3HJE A;  1KYW A;  3H0G J;  1A31 A;  2R92 J;  1ON1 A;  2GWR A;  2WA0 A;  3A03 A;  4HW0 A;  5KNL A;  4OOI A;  2RGV A;  3V7C A;  2O8X A;  2HS5 A;  2MAB A;  3J7Z I;  2R5Z A;  4YIF A;  4I76 A;  1FBU A;  4A3L J;  4X0G A;  3HOW J;  5E3L A;  1WI9 A;  3AAF A;  2HKO A;  3S14 J;  4LG3 A;  4MHG A;  3ONQ A;  3S16 J;  2WY8 Q;  3LSK A;  3HBL A;  1KQ8 A;  2EIL H;  1SVL A;  4I01 A;  2VN2 A;  3LNQ A;  4L0Z B;  2M45 A;  1QBJ A;  4AM3 A;  3B73 A;  4ZTJ A;  3EUK L;  4ZYH A;  1U5T C;  2Q0O A;  1HOM A;  3JRI A;  2GZW A;  3IL2 A;  4A93 J;  3P9C A;  4KFC A;  1GXP A;  2OD5 A;  3RPU A;  2DQL A;  3TP0 A;  4IHS A;  5IY5 H;  1F5T A;  1QVU A;  1IAW A;  3VYT B;  4E7S A;  3OYL A;  3BJO A;  4JYK A;  1Z6T A;  5CQE A;  4MTE A;  2STT A;  5D5W B;  3H35 A;  2YU9 J;  3TW6 A;  4A3D J;  1QHH D;  1SVO A;  2B9S A;  2H1K A;  4I98 B;  2CFX A;  2A5W A;  3H3U A;  3JAM K;  2IBD A;  3OYD A;  5JVT A;  2M1B A;  1RUO A;  1MDM B;  2TDX A;  2R93 J;  3I4M J;  2M9H A;  3J80 K;  5EYR A;  4BEH B;  2PBI A;  3ZQL A;  1ZLJ A;  3VYS B;  1H9G A;  3VPR A;  3GTJ J;  5B1A H;  3GYH X;  1RIO H;  5BNG A;  4NC8 A;  5F6F A;  4EMS A;  5A2Q Z;  2H8W A;  4KMU X;  2Z1D A;  1JI8 A;  1QGP A;  5LEJ A;  3BG6 A;  3HB9 A;  4GCV A;  1WSU A;  3CCS I;  3A4C A;  4DZP A;  1XSD A;  2M7B A;  5ED4 A;  2YX4 A;  3ZQQ A;  4M6X A;  1H88 C;  1X2M A;  3K7A J;  1XTA A;  2FML A;  2DPD A;  1ERD A;  3KZI C;  1B4A A;  3F8B A;  2ME6 A;  1A6Q A;  3HHG A;  1JJ8 C;  1BC7 C;  3GTK J;  3G1O A;  4F3Q A;  1K83 J;  5FGM A;  1WH7 A;  1KGS A;  3CCL I;  3M3Y J;  1ORK A;  2P8T A;  4B47 A;  2ADU A;  1EKE A;  1F43 A;  3OWT A;  2BGC A;  4FHT A;  4A6D A;  1B8I A;  3TL4 X;  3IRR A;  3SEQ A;  3QPT A;  3VYU B;  2KP6 A;  4WK8 F;  1YIT I;  3PQJ A;  4HX4 A;  2L7F P;  4AIJ A;  1PUE E;  1ETO A;  1RR8 C;  1FOX A;  1S7O A;  1TNS A;  2NNN A;  4ZZD A;  3GUD A;  4CCO A;  2QGU A;  4IEJ A;  1KZH A;  4YG2 F;  2XAG A;  1R6R A;  2VKE A;  4PSW A;  1JUM A;  2IGN A;  4BS9 A;  2DYS H;  4BBR J; 
#chains in the Genus database with same CATH homology
 2E71 A;  2KFD A;  2KIQ A;  2LKS A;  4FQG A;  2DOD A;  2CQN A;  2DOE A;  2DOF A;  2B7E A;  2KZG A;  2L9V A;  2K85 A;  2JUC A;  1UZC A;  2KIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...