2KZKA

Solution structure of alpha-mannosidase binding domain of atg34
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
103
structure length
103
Chain Sequence
b'NDPLLHVEVSNEDNSLHFILYNKTNIIIPGNCTFEFSSQISEVFSIKMGPHEIGIKGQKELWFFPSLPTPLSNYTMKVVNQDGETILVGKCADSNEITLKSPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein YOL083W
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
total genus 7
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzkA00
2KZKA 2KZBA
chains in the Genus database with same CATH superfamily
4Z7NE 5C08A 3MV9E 5I0ZA 4XNZB 5F7AA 5HGBA 2VSDA 4A66A 2YXFA 3F7YB 1N7MH 2XFGB 3K46A 2FUQA 3KYMB 1MRDH 2ZTBA 4EUPH 4OCWL 3LXUX 3US0A 1C5BL 1CL7I 1IGYA 2IDTA 3NACL 3P3UA 2WBXA 2X1PA 3BJ91 4L9LB 1M3JA 2HFEA 1HEJC 43C9B 2XBDA 3BEWB 1FLRH 4NZFA 1M05B 3L9RB 5CJQH 3TESA 1QSFA 1I82A 1R5IB 2MTPA 2MH4A 1G9ML 3O81A 3MRFB 3OG6B 1EZVY 1F8TH 2XQBL 3FQTB 5F1IB 4L3EE 4L3AA 4NFDA 2VDKB 5IMOA 1EMTL 5ACZB 3BT2L 3NIFE 1IAIH 5FW8A 5IROA 3P77B 2MCG1 4ZX4A 2FDBP 1RFDL 2EIZA 4LEOA 2WANA 4MAZA 4XMTA 1KEGH 1H6FA 5H37G 4HWEH 5C08B 4RDQG 4WV1C 3WIIH 1ZTXH 4XC1H 5J1TC 1T7WA 1GYWA 1TVHA 4U1JA 4OJCA 4EOWL 4OI7A 4WFHE 3L4UA 4QWWC 2XWEA 3MRJA 4F33B 4HULB 2EDBA 4M48H 5B4MC 1JIBA 1DBML 5SX5K 5L9DH 1CTMA 5IUSA 5ERWB 1N59B 1O9ZA 3C6SB 1QMUA 1WFIA 4FF9A 4P3CL 4PBXA 1KMGA 1MJ7L 1RZ7H 3CDZA 3MJ9H 4PSRA 3V0IA 1SBSL 4JO4H 1DUYA 4N8VG 4WI3A 3TVMD 1ULVA 4FQLL 1AQ8A 5ICYA 2P7TA 3MNVB 4G43A 3UPRA 2DMKA 1UACH 4L3ED 1FAIH 5LUMA 5IB5B 4OCNC 1OT4A 3LJ3A 5T1DH 4IJ3B 1Q94B 4HIPA 5IVXB 4I9WE 2MQ0A 3L4VA 1AGBA 3ISWA 1MCBA 4X0KB 3LXBA 3WO4C 3RX5A 5ALBH 4Y4KA 1A6TB 4YDJB 3DDGA 3BQUB 4HOZA 1MEXL 2Z31C 3CXDH 3U9WA 2FO1A 2GTQA 3AXHA 5AAMC 1U91A 1W6LA 3LCYA 4DO6A 3RFZA 4ODXA 4N8CH 3VCLA 1WA1X 3L1GA 1T66D 5MEOA 1MFVA 1AJ7L 7FABH 3VA2C 4GAGH 1KGWA 1GGTA 5B7MA 4YXKH 2XN0A 3D25A 4N1HB 5CUSL 2WY3B 1Z3RA 1INEH 1BFVL 5I30H 2KQNA 2BHZA 4X8JB 4NYLA 4Z3JA 1NAKH 2CH8A 1P6FA 2G3XA 2XG4B 1CYWA 2UWEE 4XBPA 1HSAA 2V33A 4HKJA 5JPMA 4HJTA 2Y2WA 1KGJA 4IDJH 1PTZA 2VABB 3LNDA 4XCCL 5EN2B 1GSMA 4PJ9C 2O26U 1P1ZA 3KGTA 5CHNA 4UDTA 5ETUB 1W0VA 3O4LD 4RMVA 3CFKB 5CEXA 4GG8B 4QCIB 3LHAA 3T0WA 4WJKB 3BP4A 3BPOC 1G0DA 1CD1B 1MUJA 4O51B 2PCXA 5D7LE 4AYBA 4F8LA 5I15H 5DYFA 1ZKAA 4L29A 5I9QC 5E8OA 5I8OH 5L0QB 3QIBB 4KQ3L 5DJ0B 3Q2NA 1K6QH 3IDGB 3GBEA 4TNWK 2AJVL 5CF3A 2J1WA 3CMOL 5F7WC 2E6PA 3U4EB 5D1QC 5C09D 4C83B 5DC9B 5HPMB 4PRIA 2R29A 4FA8A 3K6NA 1PJ9A 5I75B 5C6TH 2AK4D 4PGDA 4GBXA 1JWMA 3I6KB 4E41A 1SHSA 1TQTA 4FL4C 4K5NA 3QC5X 5A2AA 1MI5A 5D7JD 1H3XA 1AQKL 3IDJA 2YD8A 2ZP8A 4BBWA 4ORGA 3CH8A 4AQEB 3BIKA 3Q6FB 3QEHB 4P5TA 3TN0C 2O4EA 4QRAA 2CR6A 1D5ZB 1FNSL 4FRWA 1OM3L 4MJ6A 2WJ7A 1VF5C 4NQDD 2A6DB 1I8MB 2XY2A 4NO0B 4BCZA 2NY4D 1QG3A 5J12C 4J3SA 3RVTD 1NAKL 4J1UB 1TZAA 2VW7A 1CI3M 3OXRB 1BAWA 1V54B 2J20A 4QHMA 4R7DB 1A0QH 4HDIA 2W1NA 5FUZL 4EIUA 2Z0UA 1W0WA 3MLRH 2WMPA 2YPVL 4G8GD 2AK1L 5FECB 4X7EC 4L0ZA 1MXDA 4IEFA 2VGLM 4BDVA 2VISB 1DTUA 1ZANH 4MXWL 3FN9A 3PAYA 2OMUA 3F6JA 3NSDA 3APDA 4XRCA 3FTVA 1A3QA 2JH2A 5F0JB 3UACA 3FPXA 4TOYH 1FNEA 5CFHA 3HLAA 4OIBA 3K91A 3OPZH 3TPUB 4CBPA 5F9OH 3UG3A 5DVKA 3JV6B 4BQ6A 2PP7A 4EIGB 4Q9RL 4J4PD 5F3FA 3RP1A 4UYQA 1WWBX 2OJ1A 1W72A 1BVKB 4O2FA 3DO7B 4BD4A 4WNSA 3QIWB 2IWKA 5I30L 4APQD 1RAMA 1U8MA 3II1A 2Q7NA 4ALAC 1JDCA 4JY4A 4R2GD 5GGSY 1NGPH 2JJSA 3WXWL 2W88A 1WFJA 3SKJL 3TO4C 5KVGH 4B50A 5ESAB 2YN3A 4XNYH 2W59A 3DHPA 5E7BA 4D9LL 4HIXH 4PRIB 4ANUA 1B3IA 2YSSB 4PTTB 1KZQA 2HX7A 4PJHB 4FZ8H 4BRJA 1E3XA 1EFXB 3K2MC 2NY1C 4TSCL 2FGWL 2YLKA 4YK4B 3KPPA 3JTBA 4KO5A 3GF8A 1YSOA 2JKTM 5AFAA 1UFUA 2AJVH 3NZHH 3OHXA 5D1XE 3WMPA 4AKPA 3LQAC 1MFDH 1GZPA 4XB3A 1F3JA 3HAEB 3CSBA 3DK0A 1BZ7B 4J8RA 1J05B 3MLSH 2E8YA 4U1NB 5C6TL 4A2MA 1VFBA 3D6GA 1NCDH 4W6WB 4YHIA 1GS8A 3LY6A 1T5XB 4PJ5E 2B4CH 2BVPA 5AW0B 2K9FB 3PWPD 4Z3FA 3KH3A 5AW7B 5D7IF 1CE6B 1S3KL 4NUJB 5GRVK 4GQRA 3NQKA 2X4PB 5GZNA 3B43A 3CZLA 2R7EB 4WCYL 3UTZA 5KYXA 3WNLA 3NPSB 5A40E 4ZNEE 3H2PA 4XMPH 4ZSOE 2OW7A 5IMMB 5DHEA 4L5FL 5T1LD 4XXWC 4AYSA 3V0JA 1E6JL 5JDJA 1HKLH 1BAGA 3MLWH 3PNRB 4QNPF 1M1XB 4JVWA 4L4TA 3I6SA 1IC7H 2WXGA 3PYCA 2IPUK 4IBLT 2W81C 3V6FB 3NA4A 3D39E 4G1MA 4R7XA 4FQ2H 1RZKC 1CGVA 5F9AC 2ZUVA 3Q48A 1RUPL 4OQTL 3BQVA 4X9YA 5IB5A 5A1AA 1Q90A 5INCA 4H20L 5DQDL 2XT1B 4DKAA 4EZMA 5ADOH 4WUUA 3VGFA 3FU7A 4N8VB 1M7XA 1SXZA 1B4JH 3VXUA 3Q44A 4IYKA 5DFWH 4HUUA 3HI6L 4IOIA 1F4YH 4DKFL 3T6QC 3FQ4A 4AK1A 2IWEA 4WFGE 4YJZL 5C0ND 4RETB 3ARTA 2YJQA 2WO2B 4KVCL 5AVTB 3GIVA 4ZFZA 1BGXH 1S9WA 1T0MB 2OM5A 5MEND 3DKHA 4FA6A 5I26A 4CMHB 3RWIB 4GRWH 5J3HD 4KZEL 1MRCH 2KH2B 2YEZB 3DSFL 4HMCA 5INDB 2QDWA 5GJTL 2MKLC 2EUXA 4KY2A 3CNKA 2DIEA 1QP1A 4X9IA 4ZFOA 2OXGB 1BAFL 5SWZD 2VR6A 1FO0B 1D6EA 1NEZB 2BFVH 3O2VL 4LMQI 3QHFH 4TQHA 2GB2A 3WU1A 5PAZA 4N0UE 1P9MC 1NDTA 3MLZL 2JB6A 3UTSE 2RCSH 3PFUA 4BINA 3LS4L 1JGVL 3RPKA 1MCEA 5I1DA 4M02A 4L3CA 2A6KA 2B3RA 4NQDA 5IB3A 2H41A 4PJ5D 3HCVA 2LE9A 2IV9A 3KD4A 5E00A 5L2KA 4IBVA 1KY7A 3QYNA 4AL8L 3QUZB 3HE6C 1WBXA 3SYAA 3O3UN 1R46A 4ICWA 1AVAA 2IANE 3UCRA 1KTDA 2MPAL 4N8UA 2DEWX 1A7QH 4GUCA 4WVRA 3W39A 1KTCA 5I1JH 1IC5L 2F5BH 3S2AA 4E41D 4TSAH 4O5LH 4HPYH 1HDMA 1D7FA 1OCZB 1VGEL 5HDWA 1Z2KA 3W0WB 1F8TL 2XQBH 5AW6B 4CMMB 5IZ7A 1E4XI 2WVTA 3N1PC 4J3WA 5IMKB 1DN2A 1RIUH 1NAMH 3GMOB 2Q7YB 4ETYA 5JPNB 1CXHA 5CGYD 3AAZB 5EG6C 4UTAH 3HI6H 3PXHA 3TCXA 5HHQB 3TX4A 3T4AA 1M1SA 3KL5A 5AW8B 43CAA 1B4TA 2BERA 3I84A 4R26L 1C1EL 1Q9WA 3GI9L 5KVEE 2A9ML 3THMH 3OL2A 4LLMA 4W9DC 1T1ZA 1F4AA 3WJJC 4GIOA 2CJ3A 2PYEB 2H26A 5CN3A 4DP1X 4NQSA 1Q1PA 4NZJA 1KB5L 1SBSH 2DM7A 3S8WA 1ORQB 2B0SH 4R2GC 1EAPB 3AU1B 2Q6WB 4M7ZC 4PWHA 2YSTA 4YO0B 5B7EA 4YHML 4LLVA 5F8QC 4I18A 2J1XA 4QTIH 1VFUA 1SXNA 4DUVA 4OY9A 1KBKA 1LO4L 1LK2A 3LXAA 3MRHA 2OSYA 3H0TA 2DQFB 4N2EA 4N6RB 5EOTA 4Y5YC 4GMTL 3RI5K 3VUAA 1LWHA 4ORZC 3GXIA 4J3BA 4RWYL 1XQ4A 5F3HB 5DK0A 3F3HA 2X6UA 1NKOA 1S78C 1YEHH 4J6IA 2YD2A 2YKKA 1BIHA 2FWLB 1UG9A 4OLYH 3TEXA 3QORC 1NDMA 1VRSA 4GKNA 5CD3A 2PO6B 2PWGA 1MEXH 3DSFH 5AW3B 1QFWM 2JCWA 1X4ZA 2OK0H 1E4WH 5DRNB 1IAKB 4Q0XL 5EU4B 3TV3L 3ZYZA 4FQXB 4UI2A 7FABL 4PRAA 3KDMA 4YDVA 3EXJA 1ZVSB 2GG1A 3B2UD 3EH2A 4PSPA 1AFVL 3K2IA 5IJVB 1D3CA 1W8NA 2CHDA 3O3AA 1YYLH 5I1HH 4GQ9L 4MAYD 3N50A 5CSBA 4DFIA 4YFEA 3RNKA 4B9YA 5D1XC 3ZDZB 4G9DB 5J0BA 1FORL 2WJ5A 2HLFC 1J1PH 3HFML 4XXCC 2DYRB 2J5LC 5JYMA 2WCSA 1AC6A 2XKUA 1BHGA 1KXHA 3BHBA 3HZMA 1E9PA 1KF9B 4DVBA 5T1MB 1USZA 2W9EH 3CFJB 2CJUH 3AGWA 4ZFOL 1BQHG 4JX0A 3D69B 2Q9OA 1CZ8L 1AHWC 5A2IH 2FT8A 3CFCL 3GKWH 1ZLVH 4PBWD 3D51A 3O3DA 4OBRA 2CO7A 4Z5RA 4NPJA 3OHMB 3QEUA 4G3YL 3JUZA 3N85H 4O2CB 5H4YA 3ZY7A 4MNQE 1WWAX 1L9MA 3DPBB 3ZZSA 4ZI8A 2X9XA 4A7QA 2QFPA 1LXMA 1MJUH 1RK0A 1WJ3A 2D0GA 3QULA 3OD3A 1TLKA 3DI3B 3OKMA 2NR6D 1P7BA 1L7TH 2Y7QB 3O2WL 4IMLB 5ESVA 3UG5A 3P4OA 4FQJL 1L5GB 3THML 1EXUB 3RNQB 4DPBX 3SDYL 3SQRA 2JXMA 4N9GA 4NN5C 3T1FA 3MV8A 3TN0D 3SQBA 3BAWA 4MZIA 2DRUA 2X40A 2F8VA 3T0ED 3QUXD 5KYWA 4YSRA 3FB5B 4XP4H 4ZDHB 2ZCLH 5I1CH 3AACA 3H0TB 1S7WA 1QHQA 1WUNT 3C60C 3LYRA 3QQ4A 1PG7W 2QGDA 4ATTA 1QA9A 4XE5B 1IB5A 2Y1AA 1BX2A 3MGTA 4D9RE 1KT2B 1SXCA 1S7VA 2VLKB 3KPRB 1I8LA 2FK9A 4LSUH 4DESA 2VITB 3CE1A 2VXQH 4GXUN 4DP2X 3MRBB 2D0FA 3DX0A 5GIRA 3ARWA 2B77A 3ZHNA 3GKWL 2I9LB 3L3JA 1FNGB 1OLZA 4YSQA 1R3HB 3CFUA 3H3BC 4KKAD 5EOCJ 3HI1B 4U6HB 4TUJA 4MXWH 4BFIA 3VGBA 4EE2A 2HRLA 2BP0A 4WWNA 4NSKA 3BH9B 4FG4A 2E9IA 3VYOA 4F93B 1DDTA 2Y1ZA 2RB8A 1ZTXL 3LN9A 4U2YA 5EO0A 5BS0E 2ZKWA 2YBGA 4AIZB 1NL0L 1KGCD 4OFDA 4WU7A 2EXWC 4M93B 2PPFA 3M88A 3RURA 3QQDB 1U8LA 4MAYA 3WNJA 4HCRL 1C5DB 4KTYA 1ED3A 2VR8A 3UBXI 3VFRB 3UBHA 2WXMA 1T89A 5BS0B 4L48A 4ZXBA 3HZVB 3WFBL 3ULSB 1BFTA 1JPSH 1P4LB 5D8JL 2ZSVA 3BEWA 2ZOKA 4PW9A 1DVFC 5C0BE 1OT1A 4OCXL 1JXDA 4YLQT 1MCWM 2R69A 4FZ8L 4ZMNA 2ZG1A 1IKFH 1JPFA 1MFBH 2AJZA 2COVD 3VDBA 2L7JA 4AG4H 5JOFA 3PWNA 2VL5A 3X11B 5E2JA 5HHOA 2J4WL 3X3FL 1AO7D 2TSAA 4OV5A 5BO1H 2JKXA 5SWSB 2XRAL 5D7LB 1L7IL 1A1MA 4BZ2A 4JPIA 3B9KC 4I7ZC 5F96L 3D18A 1J5DA 1KENH 3CD4A 4JFUA 3W9EB 1NFIA 4LASL 1FDLL 3T2PA 5KYYA 4P2QE 3V6OE 1ZEAL 2Z3FA 3MUY1 3UJJH 4DO5A 4ZFZB 4JZJA 3V6OA 1WISA 4ZW7A 1JMXA 1IZKA 3UIYA 1UXSA 2YA0A 4Q8BA 4Z7OB 5TFSL 4HUWA 3SGKA 1Q0XL 4R0LB 2PW2B 3DPDA 1A6WH 1EV2E 3BDXA 3NP4A 2DAVA 4WW2B 4Q9CA 1JVOA 2AGJL 4PY8J 3OWEA 2XIDA 5KVDL 1YPZF 2P1YA 3IF1A 5AVYB 3DRTA 2ZF9A 3DGGB 5E70A 2GIXA 5B22A 4JHVA 5CIPH 4Y2DC 1XGZA 1MHCA 4G5ZL 4JKPL 3FB6B 1M7IA 3DMMC 3WHXB 4GXVH 3BEVA 2I9TB 5ID1B 2H0JA 4NP4L 3L95A 4OGAC 1QYGH 4Y8AA 2EIBA 5I1AB 4TPRH 2YIHA 2A3TA 2HSIA 4WRLA 3RWCA 5DZ9A 2QVFB 1F6LL 3HRZB 2G60H 2Q8AH 4U1SA 4F24A 2G3ZA 1BXUA 4DKTA 2NYZA 3G5VA 4OZGA 2D3JA 1BQHB 1CLOL 1FL6B 3DIFB 3MBED 2W5PA 5E2VH 2BRRL 2X4PA 4Y4HA 2BP3A 4RFEB 1NINA 1LL1A 3AROA 1I53A 2FBOJ 2JFCA 4H20H 5DQDH 1KLUB 5ADOL 1N3NB 2AEPL 4XNXL 1NGZB 2FZ3A 1GMIA 2G4GA 2BP8A 3IGUA 3ZRCC 2J3SA 4POUB 2XC8A 2BNQD 4JGUA 1BLNA 1QRKA 1LO5A 2NW3B 2QHRL 1F3DJ 4EF3A 4PVBA 2JF1A 4RGND 2JK5A 2MQCA 2QQNH 3QFDA 3TBSB 2IEPA 3FT4B 3FQNA 2ORBH 4KH2A 4PRHD 5IWLC 4HWZB 3EGXB 1PKQB 1RHFA 3KLSA 2OLDA 3OZ9L 2PWHA 4HPOH 4OCMC 4OZHE 3FONA 5J13B 4S1DC 2CJSA 3F7VA 1NICA 3ECVA 4LSPH 2K9UA 4ETQA 4FERA 5D7IB 2UZYA 3QHFL 5JOPD 3LNEA 4Z77B 5SX4H 3S36H 3O0LA 3GSUA 3U2SB 5E8NB 5FYLH 2NY2B 2UXGA 2R1XB 5D71L 3VDAA 1LEGB 1QW9A 4Z7VE 1PQZB 4EI5D 2GSIA 1DJHA 1E9QA 1XH0A 4AYID 1KWKA 5CBEA 2YS4A 1BYPA 5F9JB 2I5YH 1S8DA 2D03H 5D1QE 3UJTH 4R7VA 4EVNB 3OF6D 4H25A 1KTLB 3F64A 1N70A 3ZYOA 1V7NL 1P7KB 2GAZA 5D1QA 4F7PA 1IJNA 2MCPL 1IT9H 5SX4I 2NY6B 3S3PA 4AE1A 1XF2B 2KZWA 3FDWA 3KR3H 2MTAA 3MVSA 4L8SA 2R0WL 4RNRB 3RZWA 4AENB 4ZMOA 5IGXL 5C70A 3OC5A 2Y06L 4XMZA 1EERB 3MRPA 3ZSSA 3RYMA 3HRPA 4GQQA 1SGKA 3U30C 4RAVB 4E9LA 3B9KA 3KCPA 4LDEB 4IKLA 4CVUA 3QUMH 4P3DA 3BN3B 4I3GA 4PD4K 1J9SA 4XAWH 1IKNA 3F5WA 3NQIA 4Q9RH 1LGVA 5D4HA 4BHUI 4ERSL 1CBJA 1U95B 5JQ6H 2E7MA 2J43A 1FNEB 3EDEA 3GPSA 2X4UB 4N20A 1IIIA 4AT6B 3L9EA 1OP9A 5HI5C 3TF7C 2WQAA 5GRUH 3ZL4H 2C1OB 2CO4A 4P2OD 3K71A 3EFFA 4RAHA 1UD3A 4NAMA 3ZJAA 4BH7A 4S0HA 2G0KA 3Q2WA 1G6VK 1U6AH 4TPRL 3UAJD 1SUJA 4QHKI 4AY0A 3K71B 4FJYA 4WI9A 1E4XL 1ZHBA 3P3RA 3AFLA 1XH1A 4XO9A 3F7PC 2YD5A 3K72B 4MB5A 1H0DA 1QTPA 4P2QA 1AGCB 1FUNA 1PBYA 4JY5L 1XF3B 1ZLUH 2Y5TB 4KK8D 1NBCA 3WEOA 2CO3A 4X99B 5EF3A 5EOQL 4P3DB 2PNDA 3PABB 1LEIA 2XKNA 3H7BA 2FIRT 3RY4A 4FNLH 1QPPA 4AXWA 1BZ9B 1ZVNA 5KANI 3LVTA 4AQEA 3QUZD 4PJGF 3GMQB 1MFDL 2XIBA 4UQEA 1RURH 3IDJB 1XF4A 4A2HA 1JF1A 3UROR 4R7LA 3W2DH 5AB9A 2VUKA 3OKNB 3QUMB 3I6KA 2BSTA 1SYSA 1J18A 3JYCA 5I74B 2EYTB 4FZEH 2DMBA 1I85C 4GEIA 1BVOA 4LB8A 4QHUA 2QVIA 1OB1A 3IDIB 1WD9A 3QXAB 4GS7B 2OX5B 3QJSB 4JY6A 4OF3A 4PLJC 3RHWF 3EADA 1BZQK 3EJSA 3T3PF 2QADC 3ULUC 3IDGA 3GSNL 3RJQB 3SDAA 3CFBA 1TUPA 5DXWA 1A1NA 3CZFA 1AS8A 1OAQH 5EFIA 1N8OE 4ZW8A 1QR1B 4GUOA 1HTYA 4X4ZA 3KPNA 4NENA 4CADB 2ZWLT 3AUWB 2WAQA 3ESUF 5JHLL 4D8PA 3VFMB 1VPOL 2X1XR 2A7BA 2BWDA 4FQHB 2FSDA 3EYFA 5FDWB 4IRSD 4ABUA 4RISH 4JR9H 1JHKL 4PJEB 3GTTA 3A4FA 2R0WH 5C9JB 1CICB 3I6GA 3TZVC 2EE6A 3N1GC 1NGXB 1P69B 3K2UH 5E6ZA 2NUTB 3FCGA 2X4NB 4MD4A 4OGQC 4H44C 3GMNA 2XA3A 4MCZB 3WGUB 4DP7X 3RLSA 3N40F 2YD6A 2ZX8A 2EUWA 1F58L 1TLMA 3DYPA 5CKGA 4MQXC 4PJ6A 3T04D 5B1JA 1GOGA 4BH8A 5FW7A 1UZ8A 5IG7B 4G8IA 2G3NA 4ZTPH 4R97B 5DWUH 4HBQA 2YFOA 1AGEB 3HHMA 4L1DA 4PHXA 2UV3A 2HT2C 2PLTA 1QI4A 2GI0A 3TO2B 1NBZB 2VO5A 2CNZA 2J57A 4Z7VA 3VI4B 4TNVF 5L8KB 3CLEH 1SFDA 2H2SD 4LCYB 3R4DA 3TEZA 2FO4B 4AI7A 2GUOA 4Y2OA 5DJXB 2QMJA 4LPVA 2VC2B 1MDAA 4TSBL 1W8EA 3ULVD 1SJEB 3QNXB 3MLTB 4S1DD 1NJ9A 2H8PB 4N2CA 2IMNA 1L6XA 3MBWA 2I27N 2CA4A 1ZRUA 4FLRA 4H2CA 3VB9A 4DEUA 2FNBA 1DE4B 3FT0A 4ANKA 1YEDB 4MQSB 1A7PH 4PJ7B 1XX9C 1MLBA 3D2UA 2PCFA 2R4RH 1N59A 3QUHA 1MCKA 3P9LB 3SDCA 4QRRD 1XBDA 4P8QA 1HXMB 3EG9B 3UOAB 4AMKL 2PWEA 3FT2B 1KC5L 1UM5L 3FFDA 3IKCB 3F12A 4P23D 1DBJL 4EN3A 5BUGA 2HG0A 2PCYA 5D5MB 1U8CB 4NM4L 1GIGH 1T3FA 1QEXA 5FO7B 4BXVA 1IFGA 5L7XH 4MLIA 4W1TA 1MFNA 1ZVYA 1MCDA 2WQWA 5JDSB 1AR1C 4OF5A 5GSVA 5I6LA 1RIHH 4LCWA 3V9FA 4M62H 5GGSB 3UTPD 3BGMA 5LQBL 1ZLSH 1RERA 3TZVD 2HFTA 1RJYB 3C8KA 4TMPA 2OYKA 4DGIL 4A38A 1FGVL 3QXTA 4ECNA 4Y0GA 2UZIL 4LNRA 3UEQA 3O6MH 3QDJA 1E4JA 5BZDB 2V5YA 1U8CA 1R5VA 2EECA 2P5WE 4EN3B 1N12A 5A6LA 5LBGA 5KG9A 4LOVA 2R1WA 2OXHB 4P2OB 2FVNA 4U7MA 4QHLA 4AG4L 3QISA 3IXTB 5CMAA 3KWWB 5K1VA 3DX1A 4NIYE 1QFUH 4TUJB 1OL0A 1UZ6F 3LD8B 3IMWA 4AQ1B 1YJDL 3RDTA 1ACYL 3GBML 2C4XA 2HT4D 3ZDXB 4F3FB 4R4NC 4W81A 4K2UL 2YPLE 5IT2L 1KULA 3T2NH 1T1WA 2NY4C 3RVTC 3BZ4A 5IJBC 2A9NH 2AK4A 2JI3A 1N68A 1JNLH 4W70A 5B1JC 1QFWL 1ZGLB 5TDNA 2NY2D 3V6OC 3VFVB 1EEQA 3ABGA 1CVSC 3U48A 1KDJA 2UZPA 4RX4A 4U0RC 3FZUD 4QKTA 4PVMA 1BLIA 4M7JH 5DVLA 4F15C 4PRPA 3C5SA 3MJ8A 3UZQA 2YARA 2GT9A 5BRPA 5I1HL 2ZPKH 1A9EA 1LP9F 1BM3L 4U6YA 3EDKA 2V2XB 1J1PL 1V8HA 1V55B 2VDML 3JT2A 4XCEB 3VA6A 5FB8B 5LB1A 1BQ5A 2P8PA 2A74A 3I02A 1A7NL 1IQWH 2ESVE 3L1OL 2QBWA 4DOHE 4XZUA 3D50A 2ZONA 4U3SB 1R3IL 1YQVL 4TVPL 4H1LB 4YEFA 3DX6A 2XHNA 4FFVC 1KJMB 3PPSA 2FJFB 3EH1A 1Z5HA 1TJGH 5B38A 4CL7A 4FE9A 1DHKA 4TQEH 2GY5A 4HH8A 5ISZB 3GK8H 2Y24A 4JKNA 4W6XB 4JW3A 3NSJA 3DO4A 3MKKA 4LCWE 4HLEA 4WWKA 4PVLA 1CTOA 4G6AD 1XCTB 3DX9B 2DIJA 1UOVA 1L9NA 5DZPA 1LM8V 2OMZA 3WBDA 4Z3IA 2BXZA 4LDOB 5BRZA 1WHPA 1U8PB 5GRWA 5T3XH 4NKMB 5CP7B 3QRGL 4XWGL 3NN8B 1B4RA 3JWDH 4HYTB 3U36B 3LEXB 4MMXB 2UZIH 3ESPA 3NA9L 2P4AB 4NZTL 4KGLA 3JWOC 1T21A 3BH8B 4M43L 1ZVSA 2WUBL 5L4IA 5I1KH 3UEZA 3TO4B 1CDHA 3PPEA 3ASNB 3KGUA 2XBTA 2A77H 4NQUA 1JN6A 4GAYA 1U9KA 3ARVA 2QVMA 3QZWA 5LAXA 1YJDH 3QDMD 4U3SA 5H4ZA 4ELME 1Z6JT 5KYNA 2DKUA 3ZO9A 5L8LB 1O9VA 3HG1D 3L3OA 2XFXB 3H4FA 5DHVA 2K70A 1JZ6A 2FX8H 2C5DC 2BVYA 2DWDA 2AQ1A 5LDSA 4EI5B 1HHKA 3DXAA 4PRNB 1BA9A 1JV2A 3MV7D 2A5UA 1EHLL 2WWOA 3NVQA 4Q6YA 3DXAE 4G8EA 2WQXA 1D5IH 1SYVA 3O8XC 4U31A 3VACA 1WCBA 5DMKB 3PP4L 4QTHB 3QJZA 1HH6B 3OQRA 3B8SA 2W0FB 1ORQA 5EPMB 2JV6A 1UXMA 3BDYL 3HI5H 3KLKA 1ASOA 4B3VA 5I82A 5KN5A 4LLYA 3PF2A 4V1DE 3HZKB 5BZZA 1ZGLA 3GHPA 2P52A 2E7CA 5ICXB 3RL1A 3IGLA 4G7VH 4P2RE 5FOBA 3LV3B 1M7DA 3I9IA 2XWBB 1U6AL 4QXGL 1ITBB 3RVWC 2A6JB 4PJCF 3KYNA 5IM7A 2ERJC 3SDCC 2KT6A 3K8KA 3PS6A 2HB0A 3FUKA 4LO9A 5D7EA 4YGVA 2FT6A 3KYOA 5HHQA 1ROCA 4LE8A 1M2VB 3U6RB 3G7TA 1H9DA 4HBCH 2EDOA 2C4FU 5DEGA 5KSVB 2C9PA 5BRZE 2GSMB 2J4WH 5LGJB 1ET5A 2FR4B 5BO1L 6PCYA 3FKUS 5JXAH 4BE5A 7TAAA 5EU7C 3PV6B 5IB1B 3NJLA 1HHGB 4IKIA 1WFMA 2CJTA 1MCQA 2E4TA 3HZ3A 4PJDA 5T5NF 5E5UB 4Y2DD 3A4EA 5EBLB 2HJKB 1TJHH 3TCLB 2EO7A 4JFEB 4ZAKA 1E2WA 1LK3L 4F8OA 1DQDL 3W11C 5IESL 4FFZL 1JZFA 1NCTA 2FCBA 4FXTA 2HT4C 1O0VA 5B1BB 2X6AA 3ARFD 3SDAC 2A83B 3C2SA 4XN4A 3KEDA 5I8CA 1ID2A 3HUJE 3VMNA 2QR0A 3C6LD 3MV7B 1T2JA 3QQ9C 1MWAA 2GIYA 3SQOH 3HLKA 3LB6D 2A6IA 1DVTA 2ESVA 1B0IA 5KAQF 4XP5H 5AVVB 3U7AA 4X7TB 5EH1A 4HT1L 1PLBA 4HWZA 1PLGH 3I9PA 3VWJB 1SVZA 1NDGB 4X9GA 4ZFFB 1J12A 3K74B 5ENWA 1I7UA 4XVTH 4LVHC 2DQHH 2FIKA 1ETB1 4HGWB 5HYJE 2HAZA 3TZVA 3W0WE 4JO5A 4PYHA 5ENWB 3UTSD 4N5ED 3SGEI 3D0LA 2J8OA 3D3VA 1Z5LB 4GT0A 5TE6L 5LGKA 4MAUH 1MIMH 3Q9PA 1FYTB 2R0LL 4W9LC 1JHKH 1X5GA 3L3HA 1ZJBA 3PL6A 3N43F 4JDTL 2B59B 4YHPB 4G42B 2IMMA 4URKA 3VXME 3HB3B 3HE7C 3GEWB 3VI4F 4DQAA 2H8PA 2UWEB 5MENE 4PV8A 1YUHB 1JS4A 4DGYL 6FABL 4W9GC 2J21A 2WXKA 4JFEA 1KV7A 4Y4FD 2MOQA 5EBGA 4O02H 5KW9L 5EBLA 5DO8A 5C0AA 3GRGA 5DMIH 2BM3A 4AKOA 4J27A 3VI3E 4D7BA 1LK3H 4KDTC 3MHZA 4DO4A 4ZUTA 5F7HA 2H2SC 4ZPVA 5LGJA 1DVFD 3D8MA 3SKUD 1BQSA 2EDDA 2HRPL 3OC8A 3ULVC 1HQ4B 4P9HC 1M2VA 3P11H 1CD8A 1SMAA 3AS3A 5D2LE 4WAFA 4ZUVB 4ZFQA 4Z7VF 1H5BB 4HUWB 2CBMA 4M6OH 3U0WH 4BRVA 3OZLA 5C3TA 4F8PA 4ZMQA 5BW7C 5FYLL 3X1FA 1T4WA 2F54E 4Y5XC 1HL4A 5D5MF 4RH4A 2L8AA 2A9CA 5KZCB 3DARA 3QHZL 1Z5LA 1Z1WA 1N2RB 3V5HB 1J05A 3Q43A 2WIIA 3DV6A 5DYOA 1AYOA 2R15A 3I3DA 4TLTA 3UTPE 3HR5B 4E9YA 2H32H 5SWZB 3QDHA 4G70B 1N5AA 2DJ4A 4G6KL 1C7SA 3VWJA 2FYYA 4S0TD 1H3VA 2ZNWA 5A2LH 1U3ZA 2IXQA 5I23A 2BIIA 3KBPA 4CGUB 3Q5YA 4W9IC 1HSBB 6FABH 4AV0A 4Q14A 1CLYL 2HP4A 2YD0A 4JG0H 2ED9A 4WHDA 1AP2A 1SY6A 2A73B 4Y1AD 3SDAB 3V7AG 1RMFL 1JPEA 5D4JA 5IJKA 1CXEA 4JY6B 4KK8C 1JCVA 3CFEB 1QHPA 4KNTA 4U1HB 2M1KA 3S48A 2AJYL 3I6LE 1Q0EA 4BGDA 5J8OA 2P49B 3BIAX 4LMQE 4PJBB 2ATAA 1G9NL 3IJYA 3S5LA 3KLHD 2AI0H 4L8SC 1HHIB 3LKQB 4JM2A 3L5IA 3DDFA 1XZWA 4Z7WA 3VD5A 1T22A 2V8MA 4YQXL 2RAMA 1HOEA 2NR6C 2Q20A 4O2FB 1SM3L 5F7BA 3RVUC 1R24A 4XT1C 1T20B 3GS7A 1VCAA 3BH8A 5CXPA 4LSTH 4AYMC 5A3ID 2X2UA 1W2KT 4JFEE 2QZ5A 2DQIL 1MPAH 2VDRB 4NHCL 4WTXA 1D6VH 2BS9A 4PS4H 1C16B 1XB6A 3GO1H 3SBWC 3T0EC 5BZXA 1Q9LA 1UA3A 4PLJD 5CR1A 5KEZA 2AQSA 4FFYA 1UJ3B 5KW9H 3O45A 3C60D 2GJJA 5HGDA 5A2BA 1EGJH 1GZHC 5J57B 3K1DA 5L88L 5DFVC 5DMJB 1K8DA 3PNWA 4Z0XB 3W57A 1X6NA 2K1MA 3HN8A 3AUVA 1T1YA 5J6HB 3E8UL 2HYMA 1BP3B 2G5BB 3P73B 3Q2CA 4KBPA 1VHPA 3L2MA 3M07A 4NQCA 1VACA 4ZPTB 4HSCX 3P11L 3ABKB 1HIMH 4KDTA 4KK5C 4KUCF 1D9KC 3WNNA 3DMMB 3BP7B 3RU8L 4ZW6A 3U1PA 1I9JL 3CUPB 3ZE2B 4HLZH 4EI5C 2EVIA 5KVMC 3ELAT 3DIDA 3WSQL 2DIBA 4ZXBC 3TFKC 2M8XA 3SD5A 4AEIL 4J3VA 5IW1B 1FFRA 3QDAA 4CKVX 3TBBA 4I2XA 5MENB 5KBPA 1ZHKB 3ULUH 1KCLA 2AV1B 3FB7B 3JTSB 3O9WD 3QNYB 1JWMB 1UB5B 2ICWB 1MF2L 1R17A 3CPLB 4PJ7F 5AZUA 1AZUA 3TH2T 2VDNH 4F7PB 4GSDH 3UO1L 4FFVD 1CPUA 1KIQB 2V7NB 3N1QC 3KZ8A 4NAQA 3WIIL 4N9OB 2AXJA 1OTTC 2Z4QA 1KCRH 2BIOA 3RWDB 2X0VA 3FQUA 1TFHA 5CD5C 4K4KA 1E50A 3K2UL 2DQIH 3G04A 1S5IH 3LNGA 4FTVD 3TO4A 1E9OB 4JO8A 4XBEL 3H2WA 1RZPA 3RVVC 3EYSL 3QIUC 1YEIL 2X10A 3GSUB 2NYYC 3QIWD 5CZKA 4HWUA 3BUYA 5C09E 4X4YA 4OJFL 4KMQA 3DTDA 4U33A 1I9EA 1LEKA 3FTZA 2X0WA 4PBVC 1P1ZB 4DGVH 1GGIH 5I5JA 3FQNB 5T3XL 1DVFB 2WVVA 1R19A 1QD0A 3LVEA 1FVDB 3FQXA 5G5DB 1XR9B 5LVEA 1E6OH 1L0XA 4DP6X 4C56B 2OTWB 3PLYA 4YQXH 3TVMC 1J0HA 4UTBL 2VM9A 3D33A 4KUZL 1D7CA 1JP5A 2EDKA 3FBKA 2GEQA 4TQ8A 3I9GL 4XMKH 2IFFL 1U92A 2ZNXA 1GAFL 4ZX3A 2D2CC 3GZPA 4YOKA 2A77L 4BA0A 3BOVA 3NG5A 3VXUD 3L1EA 2X4OB 3AVEA 1L0QA 4BK4A 5DA4A 4K7FB 4L0YA 3VJ6B 5EU6B 1BQUA 4QRRB 4PW4A 1ODUA 2Y07L 1ILSA 5FHBH 5EBMB 5DHYA 1Q0YH 1TQBC 4L37B 1HE8A 2DLTA 2IG2L 1GA2A 5AOZA 4PIBA 2EP6A 5GSRA 1VFAB 5FC9A 3LXCA 4GI6A 2QLYA 3GNML 1WFUA 3OMNB 4IBTA 5E9DA 3L4YA 4FXGC 1JWUB 1DJWA 3CBJB 4I4WB 1KB5B 5E4EB 3RHWK 2D73A 3PHQA 1FFPB 1OTUC 4IRJA 3U0TA 2Z35B 2QKIB 5T33L 1XZ0A 2H3NA 2OR9L 4PR5B 5AWNL 4M7KH 4R0LA 4NM8L 2PCFB 1IEAB 2E27L 2ZOLB 3BDYH 5DLMH 3TH3T 2P8MA 1AO7E 4HWBH 4S1RH 3FPYA 1FL5A 3A21A 4M1GL 4HV8A 2OP4L 4TNWF 4HFWA 1MDTA 2CBQA 4OCRH 5TDPA 5KYYB 4JFTA 4MKMA 3TOPA 1FGVH 2QKSA 3RDTB 5D1ZC 4B9KC 43CAB 2FLMA 2ZAGA 4WI7A 1SDDB 4ZUWB 1AIFB 2VDLH 4PWEA 1W6WA 3U0TB 2QPEB 4JG5A 4K9EL 1A9BA 2ZWZA 2WK2A 4TUKL 5LG6A 4JFDD 3MBEC 2DWEB 3AB0B 5H37H 4L1BA 2ARJB 2YA1A 3BRDA 1PY0A 2CKBH 5FKPA 4HG4K 1NBZA 2PYEE 4JRLA 1JYWA 2OL3A 3GBLA 4YDIL 2RHEA 1BF5A 4L37A 2CLRA 4OD2A 4N22A 4CNIA 1EFQA 4I48B 2OSWA 3RX8A 3FQWB 3HJ0A 4G5AA 4JFOB 1DFXA 3DVNA 1JNLL 1DVUA 3FJTA 3NFSH 4AQ8C 2FH6A 5GZND 2VWEE 3BVVA 1HINL 3PWUA 1DEDA 3ZTCC 3DOSB 1TEGA 1VB9A 2VQ1B 1YG9A 2IPKB 3N9GH 4NGHH 1UM6L 4Z18A 1ADQA 4MB4A 3SQOL 2NY3D 4M7LL 4GW5A 3INOA 5IBLC 2CKNA 2RH0A 5B8CB 3VI3B 2G9HB 1ANUA 4MA8H 3K0WA 3ARYA 5I0VA 2CK0L 3HG1E 3CZJA 3AM8C 3QDME 3ZUNC 1YMME 1R3HA 3D2UB 4MNGA 3BKJL 1A7NH 2XVGA 5DRWB 1PPIA 2PXYD 4EPSA 5JW5A 4ZMXA 5A6MA 1EUUA 4C4KO 4M3HA 1YNLL 2VLKD 5ILTL 2B1HL 1MFMA 3SY6A 5FUOL 4DN4H 4UM8B 3O11B 3MMEB 4UOJA 3OMIB 3SGDH 3N40P 4N2NA 3TJHD 5DC0A 1PL3A 1EGJA 1DZBA 3EJYC 5J9PB 1AXSB 5C2UB 1PZ3A 1XGRA 3BW9B 3ME0B 4OD1L 4H88L 4FTVA 5AEAA 3TO4D 1QBAA 1AR1D 2HVJA 2Z64C 5DSCB 1XF5A 2VAAB 2LTQC 2FL5A 4G9FB 3WIFB 4P5KB 2XA8H 3CC5A 4CC4C 1M1XA 4M1CD 3A3YB 2LTQB 1QABA 1RZGB 4NEHB 3RVVD 3VFWB 3IN0A 1K72A 1GGCH 2KI6A 5FKAA 2NYYD 4KX7A 4R2GB 2ICWI 3X12B 1TKWB 2VSKB 3ZKND 4Q6IC 2VN7A 3TT3H 5BVJA 2JE8A 4K7PL 5DJ8A 1DBAL 3TT1H 3MBEB 3HC4H 1WDAA 4IRJC 2CD0A 5C08E 5I1GH 4Z7OF 4Q6KA 1TQCC 5HHPA 1BMWA 4QAMB 1YYCA 4LXFA 5EC2B 4N2BA 4BSJA 1YEKH 2WZPD 2VRQA 3O6FA 2MRYA 1F42A 2IAMD 5C0BD 2NY5L 4I18C 5FGRA 5TK4A 1AJ7H 4D0CA 4JMXA 1JXFA 1IQDB 4G8GB 1TENA 5I6PA 3OG4B 3UXFA 2AFNA 5F7FA 1UWGL 4Y9FA 3S34L 1E9PB 3R8BB 1LO3H 2EC9U 4QHKJ 3VWKD 3LHPL 2HFFB 4HKZA 5EEUA 3ZKXC 4G1EA 2VT0A 4TL5A 2EYSB 3KPSD 4GO6B 1NC2B 1MCJA 4HEME 3C6LA 4UQ2B 2Y3AA 1ZTXE 3ATEA 3ARFA 2OI9B 2WN3A 5HTSA 2AQ3A 3T6WA 2EE0A 2J6EL 4K8RC 1CLYH 4KTEH 1IM9A 2WBJA 1S7QB 3DX3A 2WBKA 1OB1B 3IDIA 4AV4A 1L9OA 4IOSA 2YR3A 1GS7A 5DF0A 4J8QA 4Q52A 3HG5A 3NCJL 2BW4A 1S9YA 5BCAA 1RUML 3QFJA 4BKLA 1M57B 1NC2A 1S7TA 3VM5A 1F11B 3QJVB 3ZDXF 4K94L 3ULVL 3ZT7A 5C09A 1ZT1B 5JHAA 2KERA 2HFFA 2VW6A 4M8QB 3WN6A 3RVUD 3O6LL 2YZ8A 3TJHC 3BZFB 2CHXA 1J5HA 2OMVA 2CDFB 1T21B 3K7UA 5IF0A 3EJPA 4KDWA 1QPXA 1WPCA 4N6RA 5EOTB 2BHUA 3MLUH 5CJOH 2HT3C 3OJ2C 4RGOL 4B60A 4CA4A 3K6SA 3MRHB 1FH5L 5F7EH 2WW8A 3TF4A 2QVTA 3STZA 2NY5H 3NIGE 4OTXL 1OP5K 3VFPA 3BAYA 3O6FB 3AY4C 5D1ZI 3GO1L 1X5LA 3CGTA 5JXAL 1XFPA 2G3MA 4XOBA 1MFCH 4HUVB 3HNTL 2BHFA 2NW3A 4MA1B 4K94C 5C08D 4AMWA 1F6AB 1FRGH 4A2GA 3ZVVA 4UDUA 1IGFL 3WKYA 3JWOL 2ZYHA 4NI6A 1YYMH 3TBWA 5CGMA 4XO4A 2AXGA 3UJIL 4U0QB 5K1JA 4N2GA 5HHPB 4EZJA 3MJ7A 4R5TA 1TTCA 4MJ6B 2ZUYA 1TQBB 2PR4L 4XBMA 2IOIA 2X2HA 4MHHG 1SHXA 2F7QA 3ECWA 3ORJA 4QRRE 3FQ2A 4G8FB 4OU3A 4JRXA 2VM4A 1MLCB 1N6QH 5HDQH 2OMYB 3BZEB 3HRZA 5KUMA 3D39A 1S7SA 4E41B 3TIDA 3KVQA 1CI5A 5GRXG 3CVHL 3O11A 2VLJA 3D09A 2YMXL 3IGFA 2ENQA 5L6YL 2I9TA 3EIFA 1ZS2A 4BFBD 1MWAH 1BYNA 2WCPA 5CBEB 1MHCB 1VZIA 1FV1B 2NY5C 2VDNL 4FQCH 1M42A 4M5YL 3MLUL 3BPCB 3FQYA 1BBJA 2KZBA 1YEGH 2XQYK 2ZOTA 2VZSA 3EJZC 2EEBA 5CEZE 3M45A 1FE8H 3CXFA 1K5WA 1ES0A 2PXYC 4OR1A 4CU7A 3BWAA 2P8LA 5EIIA 1ZT4B 3ERXA 5IWLA 3M46A 3IDXL 3O3EB 4F7CB 4XOEA 4H1LG 5DGQA 2DBLH 2X42A 4IMKC 2JB6B 4PLOB 2EEDA 3QZMA 3BE1L 3NIFF 2GJZA 4YK4C 4TTDD 4RA3A 2WTRA 3FQRA 4UDTB 4X7TA 3T8XA 1ZA3A 3DRQB 5MERB 4QRPE 3KNBA 2CO2A 1J8SA 4DUXA 3UTSA 1PY9A 1RZQA 2Q0ZX 2E59A 2PYFA 4OV5B 5I1LA 4WTZG 1TTBA 4G7QB 2IO5A 2A83A 2WAHA 5D2LF 3V0EA 5DGRA 1A4BA 4P9ML 4FQ1H 5E5MB 1IGJB 2R39A 2G2RB 4Z78A 3HMWL 5TE7H 1QBML 1TFPA 1QUPA 3MOAL 1KLFB 3B9DA 4NZRH 2P26A 4K7PX 1J8HD 1IILE 2IOOA 2V3DA 4N68A 4OCSH 1NSNL 5D2NE 1ET8A 1HYSD 2NZ9C 1A6PA 5INCB 4OLYL 4E5XG 4BA8A 4OZGB 1RUAH 4K7PY 4OTXH 2FR4A 2FWSA 2VQTA 1CT8A 1NFDF 3WUWG 3IDYB 1P84J 5GSVB 4KJYA 3WIAA 2VJ0A 3QQDA 4MAYB 2DLIA 4IQHA 4IBUA 4KKLD 4UTAA 4MA3B 3TV3H 1XSKA 3ALPA 2WYZA 3UFIA 3II2A 1AY1L 3WDIA 3BEVB 1DCEA 1URLA 4J39A 4LL4A 3ZE0F 1WV7T 2F58L 1J1OL 3FUEA 4PJIF 3ZZQA 4YDKH 2BIPA 1KJ3H 4XP1H 1U8JB 3NCCB 4ZUUB 2BP0B 3VX0A 5HGHA 1OGSA 4BFIB 1MRFL 4G43B 3MLWL 4I2XE 3AZUA 2IADA 1H6TA 3QYMA 3NSXA 5CBAB 3HAEH 2ICES 4NRXA 1B9KA 2FQGA 3I2CL 5HDQL 3C6SA 2ZJSH 2P48B 1BZOA 1RPQA 5DLML 3EGDA 3VFPB 4MDJA 4PW3A 4YHIB 3D18B 1RZFL 2ICWJ 1E5UI 5D7SL 3DC0A 5CCJA 5FYLD 3VD2A 1BQKA 4MASA 5D7LA 4PWFA 4FX5A 1AZRA 4MX7B 4X0NA 1JF6A 3IAGC 5D70L 4A2EA 1QNIA 1VZGA 2ADJB 1DQQA 1QO3A 4FQCL 2ROXA 4I3RH 4M5YH 5ALBL 3S3CB 5I16A 1JZ2A 3OAYK 3CU1A 1XF1A 2C26A 3L7FB 4IU2B 4OH2A 5JORA 4PUBH 1I3UA 2BSEA 1YZZA 3ALXA 5F1OB 5IMOB 2HRHA 4KMTL 4KZEH 1RXLA 4M6ML 2NMSA 3MRFA 1A6AB 2OL3H 3HG3A 5AL0A 5CJXC 5GGUB 3WFEL 4A67A 1QWNA 5C0FB 3BUQA 4YDIH 1QSFE 2E7HA 5KUKA 1FIEA 4I0PC 4GMSH 1B0WA 1JGVH 4ZXBD 2GJ6A 4JO3L 2W9DH 5KOVC 1KYDA 3M1BB 1SJXA 1NCCL 3O9WC 3EH4B 3EOTH 4JN2A 3PGFH 3FUFA 4NJAH 3SJVB 35C8H 3AXLB 4K71C 3L13A 2XY1A 1LO2L 1KYAA 1I9JH 3WGVB 5MI0B 3PJLA 4OCSL 1A3RH 1FVDA 1KCSH 1CGXA 5CJBA 1P4IH 2OA9A 2YQGA 3N41B 4TSAL 4ZMPA 3RUGA 3VXPB 2PP9A 2OZ4H 4Y9BA 5E95B 5GHWL 5AZ2H 3G04B 1X5JA 4G6FB 4JN1L 4MB3A 1GZHA 4EIBA 1I1FB 5DQJB 1SHWA 2PPCA 2AJSL 1K6QL 4GRMA 4ONHA 3TNNB 4PGZA 2Z31B 1IFHH 4BQ8A 2BC4A 1AGDB 1CXFA 1OIOA 3F65A 5MENA 4PJEF 1S5IL 2HUHA 4Q7DA 5E99L 1XBRA 1QSEA 4HS8L 1IAKA 4LSVL 2LU4A 1TO4A 4YDLB 5CR8A 4GYBA 5D96B 1MRFH 2E9JA 3GQFA 1TTFA 4I88A 4Z7UA 3MYZA 4IJ3C 1PMYA 3UPAA 1OOAA 4X8CA 3DMMA 4NN5B 1UB5A 2ICWA 5G4NA 4WDIA 4KXBA 4ZPTA 1FBIH 5ID0B 3O41B 2DICA 3M6DA 3OJMB 1S9XA 5KWYC 4JRYB 1V3MA 5HHMB 3VXRA 4PGDB 1YMMD 2Y5EA 3VFSB 2YWYA 4JHBA 1QRND 2Z31A 3VNYA 3MLYH 1MH5B 3CN3A 1JDAA 1EO5A 3NACH 5A3IC 5TJWK 2G0LA 3O45B 1JAEA 5EZOL 1NZRA 4U6VH 4YO0A 3U2JA 5DRWA 3SE4A 3SBPA 3VXOB 4O2CA 5ES4B 1K2DB 3VXPA 4HKBB 1WEJH 4V2BA 4WV1B 3UJJL 1JGEB 1T6VN 3V79C 1M6UA 3B5HA 4CN1A 1PD0A 4ANWA 3G6JA 1XGQA 4IBYA 5KVFH 2JCCF 2E9BA 2CUIA 3WOVA 4PJAA 5F6IC 2XV3A 5D1XB 2WSPA 2V17L 1LMKA 3GXUB 2IPKA 3GMMB 4ADIA 3WJLC 1AQDB 5K39A 3AADB 3ILPB 4HKJB 1A22B 1OM9A 2CM6A 3APNA 4KK5D 3GMOA 2R69H 5K1NA 3T65A 2VXVH 1IBBA 3QO0A 2Q76A 4KY1H 4LIQL 1E8WA 1T20A 2YMOA 4WFEE 3SPIA 5LLIC 4MAYC 2E7BA 5DRXA 3QWOA 3IDYC 3P4LA 3MLRL 2QDVA 4X80L 2VXTL 1HXYA 4N0RA 2G60L 4IGBA 5C0FA 4XNZC 1JGUL 4DSYA 2ED7A 3FH7A 4CSSA 1OPGL 5DDHA 2B3IA 5DZJA 1A6ZB 2NUPA 2VLRD 1DQVA 4RSYA 3E3QC 1G9MH 1BQLH 4HC1L 4Z76B 4X6BB 5F7MC 5GHWH 5AZ2L 4BQCA 3L4TA 3FXIC 4CBZA 4WUUE 4X83A 3QJXA 1TQSA 1ZLEA 1KEGL 4Y4FC 3VRJB 4XN2A 5DMYA 1QLEB 1JNHA 2CXKA 1HSBA 3SDCB 4HMEA 1N2RA 2VZVA 3TA4D 3CIAA 5KS9E 3T08A 1A4AA 1J87A 2PTVA 3H9HA 4DP8X 5AYUL 4EXPX 4OZIF 3HE7D 1QI3A 1FO0A 3MRCA 2VDQB 3F12B 4Q56A 4P23A 2X09A 2P8MB 4NWTH 2IAND 3T3PB 2UXFA 1JCKA 2YEZA 1THCA 4G6MH 1DR9A 1S7RB 3SJVE 3E0GA 4L8CA 1XMWA 1CLVA 5I1CL 3L08A 1S4IA 1EXHA 2XYBA 4B9IA 1BJMA 3WJMA 3U0PA 1HZLA 5BUAA 1KCUH 2K3HA 1TCMA 3BLBA 4BUGA 4FXKC 1FAIL 4HUUB 1CE1L 1H8OA 2F15A 3AWGA 3HC0A 4QDGA 4QXTB 1MQKL 3H9SE 4PJ8C 1I1AD 5E0FA 1U2YA 1NJ9B 2WQUA 1AE6H 5DK3A 2O30A 1IBZA 1SJEA 2WSDA 3MOBH 4PB0H 4JPWL 4RMBA 4LOFA 1I7TA 1QVOB 1E0OB 1VADB 2P80D 2XZQH 4K5LA 3SZ6A 2RFXB 2NNAB 4ZW5A 3P4MB 4EI6B 1OTSD 2UWEA 4X7SH 5C6PB 2Z91B 2Y06H 5I0WA 4QXTA 5FYJE 1YECH 4U1LA 4NUQA 2GK0B 3GSQB 2HVKA 3NZUA 1DANT 1WBXB 4LVNB 5IMMA 5HBBA 4GW4A 3TWCH 4D9RD 2IGTA 2VSMB 4Z0BL 2V5RA 5BQ7B 2VTFA 4F15B 3BH4A 5L2KB 2QSTA 4WI5A 1RY7B 1CFTB 1SLXA 4G6AC 3GXTA 3KM2A 3REWA 4NN6C 5C97A 3KMDA 3MTRA 5BOJA 5HPOA 4C56A 1I8UA 1INEL 1BFVH 3HBPA 4FG6D 4RDQF 5CU9A 3VDCA 5C2BH 5A2FA 4ODWB 2EE9A 4KH9A 4W68A 5KJ4A 3CX2A 4H2AA 1DVFA 1S9KC 2YKLL 1MFAH 3QW9A 3MRCB 2V3FA 3Q06A 2BVPB 4XNUL 1NTDA 2XWTA 4WHYH 1D5BB 4KC3B 1GH7A 2H5UA 3SD2A 4FHBD 4CJ1A 5H35A 4JKWA 4LBAA 5EFIB 2FJGA 1SDAB 1OPGH 4PP1D 4B9FA 2IQAB 5INDA 3V5DA 3CCHA 3OKLA 3QUXB 3BWAB 3MTXA 2QJDA 1T0MA 2CDFA 1YPZB 4D8PB 4JO2H 5EUOB 1EDYA 3CFIC 2X1OA 1EZSA 1LVEA 1K4CA 3BPCA 3QXAA 3II3A 3NH7L 3UC0H 2WWMC 1GZQA 1JPFB 3U79A 1ZT1A 4NNPH 4Y7MA 4YSUA 3DJTA 2VH5L 3L54A 4MCYB 2BSTB 3K2KA 4AL8H 3CZFB 4TVPD 3WEXA 4XNAA 5IB1A 5GGRB 5T3ZD 1I1CA 4HGKC 3NK3A 4PCKA 4PRDB 4PQXA 1U8KA 2Y25A 4LASH 2X88A 2Y23A 2FHFA 1ED3B 3B9KD 4OIFA 3S37L 1XVSA 2XWJB 5DD6B 3CK0L 5E03A 2EH8L 4BUQA 2WBWB 3KYOB 3UGXA 3L3GB 5KVDE 3QK0A 4DFHA 1BPLB 1CIUA 4UTAL 2GTZA 3V9EA 3A0OA 1B9ZA 5HHXH 1E27A 3P0GB 2AXFB 3EBHA 3EYVA 3HPLA 4I8DA 4NO3A 4NSKB 1RULL 3DBSA 1NUNB 3I50L 4M6NL 4R26H 5FW6A 1Q8MA 4IOFC 3RL1B 3CVHB 1AE6L 1JPTH 4GRWE 3ASOB 3KCWA 1DSWA 3PNWB 4LQ1A 3BYTA 3OKEA 2JIXD 3VXTA 3ZTDC 3PV7A 2CR3A 4CVXA 2X7LB 2F54B 4OZFA 4YNYA 2IDSA 2AZUA 4IRZA 4CRPA 2XPZA 3UBGA 1CFSA 1NA8A 4PJ8B 3NIFB 3RGHA 1XGUB 4AOFA 5B3SB 4HAKA 4QTHA 1M7DB 2YD4A 5KS9B 4UT7L 4V1DB 4JCWA 2YPKB 4J4PC 3MRMB 3QWRD 1R3KA 1JG9A 1IVTA 5LHDA 3G08B 1VGEH 3GMPB 1X9UA 4YPGA 2ZCKH 4ZBJA 4J2XA 3I6LD 3TWCL 4QMEA 2GC4C 3X12A 4PJCA 4YBQD 4HLJA 3UAAA 5C09B 1F11A 1QNZH 5IB2A 1T7XA 5FFOA 3UAFA 4MJHA 2WQVA 2VZTA 4N2KA 4NNYB 1N6VA 2XWJA 3DVGA 4GAJL 2VDRL 5DD6A 4JPVL 1O6SB 1WBYA 2Y7MA 2WXQA 2XFXA 5DHVB 2LLGA 1ZMYA 2YSSA 4PTTA 5K9JL 3ARFC 5ESVB 4QJ5B 4J3OF 2JJVA 3KYKH 3SKNB 2DQTL 5CINL 2DBJA 5F3BB 5HHNA 4PP2A 5CLYA 3FH8A 1GGYA 1AFVH 2EYSA 5LXVA 3CQPA 5E6IB 1EK3A 1JWSB 8FABA 3SGJC 4NKMA 4FQIH 5DUJA 2CGZA 3LKRB 4LVEA 4NPYB 2IQ9L 4PRIE 2P24A 4JEGB 1CICC 1A4CA 3EOTL 4ZSOA 3FRPB 1A7PL 3DV6B 3IETA 1WITA 4Y5VA 2VR5A 4F2EA 4R4FH 4WWKB 5DS1A 3PQYE 5ISZA 1IKNC 2Q87A 5CHNB 4OFVA 4E36A 1YA5A 5HP5A 3FT4A 2YXVA 5HHME 2R0KL 1WP6A 3OR6A 4Z95L 2ZCKL 2AV7A 2KLTA 3QUML 2VLJD 2BCMA 1H5BA 4M03A 1JF5A 3OGCA 4PJIE 3WXVH 1T6BX 2LR4A 2R59A 3BI9X 3G5VB 5LWYH 5ELIA 5L7XL 2YUZA 4LCCC 5IOPA 5CLWA 3LRKA 4QRPD 4CSPA 1H19A 3TGXA 4U3XA 1JDDA 1XCQB 3CFNA 4N90D 2K6ZA 4Y2DA 4KZ0A 3DJ9A 5C0GB 5E6ID 2LGNA 1JZDC 3GJFB 5ID1A 1G9EA 2V5TA 5HGAB 1OTUD 4YE0A 2R8SL 2NXYC 3C5SB 3GBNL 1IC7L 3MJ8B 3BQUA 4QXUH 3A6BL 4P5SA 3Q2VA 1DYZA 2ZP9A 5C0DB 2YRLA 1XAKA 2ILLA 3ENEA 4FQ2L 3LS4H 4GBXB 4ODTL 1VEPA 4EBQL 3F58H 4HVBA 5LBSH 3S36X 1I75A 1PYWA 2GITB 5DJCA 3UZQB 4AEFA 3L4ZA 1Q94A 4MWFB 2IQ9H 3ZQ9A 2VZ3A 1HHHA 4MMZC 3D0VB 4HUMB 3WIHL 3X14A 3HBQA 3JV0A 3TBTB 5I0YA 5I1JL 1UOKA 2XQYG 3ZL2A 1ZCRA 1SPDA 4FZEL 4WHYG 4ZUUA 4G80A 2QKIC 4IK6A 2BY3A 1QFWH 2VDQH 5G4MA 3DSNA 1OSEA 3CSPA 5DR5H 1NFIB 2CUMA 4XHJD 2X70B 3WXVL 4ELMA 3T4AB 4YHZH 1I8KB 3H3PH 1TVHB 5C9KA 1QLEH 1HOCB 1JNHB 1U8QB 5SV4A 3HNSL 4AYDC 2QR0B 1KWGA 5DZAA 1CDIA 3T4YB 2R2CA 2UUDK 4AK2A 3HZVA 5CJXA 5K9QI 3PWNB 3BGMB 1BREA 3NDZE 3JSSA 4J3OC 5DT1L 2X12A 3VFRA 2HLAB 3HUJF 5IFJA 4BFKA 3FU9A 4ZO7A 1LILA 4JM2C 3V4VA 1KBWA 2OSLB 5CZXC 5IV2A 1XMEB 4QHPA 1KPVA 2F74A 1GHFH 1QTSA 3QUYD 3KVPA 3LKSA 2C9UA 3ZU8A 1JHTB 2ARJA 1CGSH 4I0CC 4KZDH 4HPYL 2EDWA 4TUOA 5DJYB 2BNRA 5LBSL 5I1LB 1B2WH 1SEQH 2GI7A 4XTRD 5K9QG 4WU7B 1XIWD 3L4WA 2X2JA 3MLXH 4YGVB 2UY6A 5BOZG 1CFNA 1OARH 4WU5A 2WTRB 4N3TA 4GW1B 5FO9B 2OMXB 4KRNA 1VCBC 4MJJA 1OSZA 1R33A 5G2NA 3ARPA 1EBPA 5EHFA 2H3XC 2C3VB 4LSSH 1HNYA 4L5FE 3BH9A 2QPSA 1V3LA 4F7CA 5GS2H 3M1CA 3OAWA 1CJYA 2F7IA 3NABH 2YBRB 1SOKA 1S7VB 2VLKA 3AXIA 3KGSA 2EXSA 4OW6A 4DW2L 2DL2A 1AQHA 4JFDB 3ROOB 4CU6A 5KBKA 1YQ2A 4QXUL 3L3JB 1A47A 2D9QB 1A6WL 3QQ4B 2FBRA 2LHAA 2Z7UA 3MRBA 5GIRB 5J3HC 2V7HB 4ZO8A 1UB6B 5FHAL 1A3ZA 1CVRA 1WCBB 1MH5A 3KS0H 2GBAA 4NC2B 3MRJB 4AIEA 2WZAA 1BJ8A 2XSKA 1U4EA 2I7OA 4P5TC 3X17A 5CEZD 1MW0A 2V0AA 3KPMB 3M17A 3MYJB 5FIEA 3VXRB 1NPNA 3N6YA 3UBXG 4I2XB 1FJ1A 1S9XB 1G7QB 1T0NA 1XH2A 4NQVA 3NCXA 2Y3NA 4O02B 4OD3H 1R34A 5AW5B 5B3NA 3BZEA 4QRRA 4XC3L 4G8IB 3ARDA 4XCYB 3SPVB 1NCBH 3B37A 3D2UD 2EO1A 4OLWH 3UPCA 3FQTA 5F1IA 2CRZA 2XTJD 3BP7A 3HNVL 2WZ6A 4K23H 4L1LA 2QT6A 1N4XL 3MRIB 4TUUA 4FQQB 1U92B 4NQCB 1PZ5B 2KPNA 4EVNA 1MWOA 1GMEA 4K8RD 4LAJH 3P73A 1ASPA 3CTTA 3S5LG 1XO8A 5C07A 5C0BA 1PZBA 1N19A 1RZKL 3BYYA 5FO8A 4KJWC 4OCLC 5IVNA 15C8H 3VWKC 2V2WA 5IQ7H 1MHHB 3FS9A 5DZNA 4L1SA 3WFHB 4J3UA 5I71B 2H47C 1YNKH 3SHSA 1ZLSL 4M48L 1I1AB 4XMXA 3ZHDA 4K3EL 4I5BA 3KPNB 4G7VL 1DQJB 1WBZB 3RUGB 1U93A 1FA4A 4FYSA 4DGIH 3P40A 3LTVA 4B27A 4AQOA 3KWXA 4FQHA 4M8UA 4XNYL 4AJ0A 4HIXL 3V4PH 3MR9B 3POCA 1NANI 2W95A 4H8UA 5BV7H 4NAJA 5TF0A 4ZTOL 1F13A 1AS7A 2AJXH 3VFGH 4PRAB 4G3YH 5CN2A 1CLOH 1EXGA 3QP3A 4N85A 3RQ3A 1CD9B 5B7FA 2EE2A 2OQJB 4PJBA 3C09C 5DS2A 3EHBD 1CR9H 1HL5A 4AZUA 4O2EA 4PI2A 1U21A 5E51A 1T5WA 1LE9B 2F1EA 1MJUL 1BOYA 1BECA 1BQRA 1XF4B 2B7DT 2IWFA 2VXQL 3CPLA 3RI5F 3SDCD 3UCQA 4KPHL 5IK3B 4QHUB 3EOAB 2M83A 4LSDA 4JDZB 4M6AA 2NY7H 4YAQB 5F70A 1PLAA 3MFFA 2H6UA 4PLKC 5FPIA 1FFNA 5AVUB 4YXLH 4MA7L 3WTXA 4AEHL 3IJ8A 3TEYA 3QNZA 5B3JE 3WLBB 1AGCA 4XP4L 2I69A 3GXFA 1N5AB 4EMZA 3FBQA 1EIBA 3AY4A 4CU8A 3FZUC 4OIAA 4XB7A 4HT1H 1P7HL 3OLIA 3PABA 5E8EA 5FF6A 1EAJA 1KOAA 4Z0XA 5TDNB 4CVZB 1G6RB 4IRZL 4Y5XA 3NAAH 3T2LA 4BZ1A 4LEEA 5DUML 4OLVL 4JHWH 4MJ2A 2JJTC 2H7WA 1N0LA 3F7KA 4J5VA 2VDPH 3PGDA 3WKNA 1MAMH 2RQEA 4ALAL 1EHXA 3STLA 1U36A 3DURA 5EU6D 3GRWL 3FB8A 3V8OA 4WJ5B 2DF3A 2J1ZA 2BIMA 1P4BL 3BFOA 1HQ4A 1MFBL 4NRYB 4C56E 4TQEL 3ZTJG 3TTYA 2P47B 2AXFA 2WLJA 4AT6A 4X4MA 1JXGA 2BOBA 3IBOA 5ANHA 4XAWL 4MXVE 2FEJA 4C56D 1RURL 2CDGB 3HUJB 2Y2TA 1E30A 4WI0B 5JPNA 3TNMB 1QSED 3G5YA 5AYUH 2GSIB 2IPTH 3BW9A 3ME0A 2WLYA 1WRFA 2P45B 4C55A 4PJFE 1X5HA 2R1XA 2H6OA 4UU9B 1FHNA 1MAJA 5E2UH 3K0YA 3ZKMD 2OZNA 3MSPA 1VEOA 3W39B 4MRBA 3ZE2F 5FK9B 4YC2C 1BAFH 1CGWA 2BFVL 2J1YA 4DOHB 2IXQB 4WFHD 1FWXA 4C58B 3MGAA 3KXFA 2NY3C 2E8ZA 1LEGA 4HOMA 1LMIA 1D6EB 1JXKA 1NEZA 3S35L 1HNFA 4EUPB 4HK3N 5HVGB 2YC1B 4AM0A 2X9WA 4L3CB 3W5NA 2FIKB 5FLUA 2J88H 1W72L 2WINB 3MOBL 4MJIE 5CGTA 1RPUA 1CLZH 3CHOA 1OQXA 1X5AA 3UBXB 2Z31D 4E9XA 4KKQA 5FYKU 5LNDA 4X7FC 2UY7A 3T4AC 3WKML 2G4EA 2NZIA 3IJSB 2R56H 2VABA 3W2DL 3G9AB 2NNRA 2NX5D 2OXGA 2JNZA 2VQ1A 3O3EA 4LIQE 2CGYA 2BRRH 4WUUB 5FYJD 1H3UA 1HI6B 2VM3A 2VW4A 3N91A 4FNTA 4J3OG 3D1MC 1IX2A 4L1HA 3RZCD 2CR0A 2CRMA 4GP5B 1MVFA 1OCCB 3DMMD 5FYKH 1DVYA 3MKGA 4OKVA 1RSYA 1FFTB 1MW1A 2BY1A 3A4AA 3QYCA 4LQFL 4I48A 4DETA 4G1MB 4P49A 4CC4A 1ZLDA 2DWYA 2AAAA 2N3JA 2XWZA 2CLRB 2NTFA 2W0KA 2GK0A 4HPHA 3HI5L 1A7RH 1QLFA 3KLAB 2OS7A 3F7QA 3ABZA 4AEEA 2B08A 2CO6A 3LQAL 2OV0A 2GHWB 4RFNB 1AG0A 1QRNA 2WWMD 3H42L 5CSZA 2CALA 2D7PA 4F7KA 1FNHA 3NRQA 4NS0A 1YN7B 2EXWD 4RWHA 1JYXA 1UC6A 3GBNH 1ILUA 3MLVL 2F19L 2NNXA 3CZEA 3N0PB 4RISL 2PW2A 4F7MB 4Q89A 4X6CF 4Y5YB 4F7TA 2ALWA 4NUJA 3ZDXE 1DBBL 3HC0B 1TEYA 3WIHA 25C8L 2AJUH 3EOBA 2Z0BA 4JANB 3GHBL 1FL5B 1IC4H 2WXPA 3N06B 4P04A 4A7SA 4FG2A 2VDLB 4GINA 1X9LA 1CLZL 2UUDH 3EYQC 1BZ7A 1JZHA 1V7NH 4M4RB 4TLKA 4U1NA 5HHOD 2XIIA 4DK5A 4EAEA 5FEBA 1DUYB 5CM1A 1PG7H 1C8QA 2Z93B 2P5WB 1ND0B 3OAUH 3VFMA 2CKBB 2K3TA 4XHJC 5E2UL 2WINA 1MVUA 3F01A 3FW6A 5A16B 4MCNA 1DBKH 4RQQA 5AOJA 2YEVB 3JTTB 3FSAA 3SDAD 4LQFH 3HAEA 4LEBA 1IM3D 1JBJA 1R47A 1TU2B 3MUZ1 2RQ8A 4TSBH 2FSEA 2WVSA 2WKOA 2VXUH 4ODHH 3AC0A 3HC3L 4WK0B 3W38A 1S7TB 3C2AH 3V4VH 5AKSA 1KTRL 2CWRA 4LARL 4IGBB 4KHTH 4LLUA 2LLLA 1OTSC 1SY6L 1XH3A 2ENYA 3MLVH 2F19H 2P3YA 3WKMH 2APBA 3QUYB 4JY5H 4YX2H 3SPHA 4X50A 3CHQA 3FTSA 1R3JB 1Y6NR 3NJNA 3QZPA 4HKXB 4QWWD 4Y4KD 3VXUE 5DD3H 4G6FD 5CU5A 1E43A 4LAQH 4OQTH 3FQXB 1WZMA 3ULVE 3TFKD 4MDIA 4KZDL 1MI5D 3OHXC 5K39B 1DCLA 3HLAB 1YHPA 1UM5H 5TH2A 3NZ8A 3ZR6A 5F1NA 1R5WB 4A55A 2XN9E 2I32A 2WNXA 1B0GB 4PJAB 4QTFA 1J1XL 1GCFA 4NO5A 2L4OA 2OMZB 3QXWA 4GXFA 4IEFB 2EVFA 2NNFA 4BWTA 1YY8A 4PH8A 4DK3A 1MIEH 2RIKA 3DBXB 1BX2B 4MTMA 3WCYA 3MRKA 4U6XA 1L0YA 3KEHA 3BVNA 4XVJL 3QUKB 4HX1A 1FSKB 1OALA 4JRWA 4XCFH 4BZ1L 3BLPX 4U49A 2WXOA 4P9HL 3MRDB 4N5UA 2DQUH 3BC9A 1S7WB 1KBGL 1P5UB 3EFDL 3QO1B 2XQYA 1ACZA 1TEFA 3DX6B 2X6CA 1W9XA 4WI2A 3U0WL 2J8UA 5BV7B 2BRQA 3K4AA 3CDGB 3MBEA 4FJ6A 4O4YH 1D7BA 1PZCA 3CFTA 3FB7A 3QNYA 2YD3A 2VIRB 2XETA 4JRXD 4AW7A 1A2YA 2P5EB 3HC3H 4P59L 1IC4L 5C0AE 2HUEA 3NIGB 2O93L 3C5XA 5CILH 4ZDHA 2WVUA 2DQCH 1RP8A 2WXJA 2ZP0T 2VDNB 1L3NA 1XCXA 4Y1TA 4EUPG 4DT2A 1DQTA 3Q6FA 3EJJX 1E8ZA 3QEHA 4XN1A 3ZDZF 4HZLB 3OMAB 5E2TH 1LJMA 2ZUUA 3OKKA 4MLSA 2YRBA 4R96B 4WUKL 1AOHA 1LP9E 4L8BA 5IVOA 3MMEA 4XB8A 1AH1A 3LPFA 2TSBA 4R83A 2E74C 2X2IA 4H0IA 4YSDA 2GC7C 1IGTA 2RMNA 4JQXA 2HZHA 1P7QD 4PD4J 1FG9C 4FABH 5J06A 1LLAA 5JPMC 1MXGA 5DWUL 5AWNH 1MQ8A 2ATPB 2E27H 1J5OH 2FATH 2ZSWA 1YNKL 1E2ZA 4AQ1A 4C4KT 2CO7B 4Z5RB 3KJ6H 4PGEA 1KSRA 4LFHD 2W65A 2AI0L 2AQQA 4QHLB 5F7LB 3E6HB 1P4UA 3CLEL 4LHUD 2C34A 1J7VR 1PU0A 4X8JA 3FU8A 3S3SA 4LNVA 5D1ZD 5T1MA 2BP8B 3WFHA 4FA7B 3KLHC 3L1OH 4P2OC 4DZBA 1IBFA 4PB9L 1OZTG 3F58L 4X6CB 3RNKB 1DJYA 4BCXA 2DS4A 5HDBB 1N64H 1WT5C 5D7JC 3RWJB 1FL6A 3DIFA 1JZJA 3SB3A 3IE9A 4AC4A 4LBEB 1Z9OA 2W0LA 3BVDB 3GHEL 2ATKB 4GRLA 4S10A 1UEYA 3RL2A 3FRUB 3I02B 1ZK5A 3WIHH 4ZOAA 5E24E 3APMA 2R2BA 2A73A 5DEFA 1L7IH 4QR7A 1CBVL 4M5TA 5IQNA 3CDFA 1CFVL 3FTUA 3EYQD 5CCHE 5FR3A 1G7QA 1T0NB 1FZKA 3IJEB 3SCMB 1DBJH 3IMSA 1H15A 4B9PA 4LLVB 3KPMA 3GZOA 3M17B 3FFDB 2ADJA 3DRTB 3PDDA 4UNIA 1UYWH 4PY8I 4WZ9A 1NUGA 4TNEA 4APXA 2WWKO 3K8MA 1UB6A 3CN0A 3OR7A 1J0YA 1PDKA 4UT6A 3OQ3B 1YNTA 1KTJA 2OR7A 3RY5A 5E8DL 1BWWA 5I8KH 5FGBC 1FORH 4IRZH 5KYUA 3VI4E 4H8QA 1EEYA 4KDVA 2VLME 3W9EA 3E80A 2KS0A 4FNQA 3T2QA 1EHAA 4JFWA 2W9EL 3L3IA 3TC9A 3WS6A 1Y0LB 2CA3A 1CFNB 1ZD6A 1U8JA 3NZ8B 3JV4B 4WU5B 1C5CH 3CSGA 3U9PH 4AYEC 4U3HA 2F54D 1WS8A 5KG9B 2CCVA 3SY0B 3P77A 1IVLA 1GY1A 2MHAA 2OTUA 4BELD 5ACZA 1B2WL 1SEQL 5JA9A 5E2VL 1PD6A 4KRPB 4DGWC 2K78A 3E3QE 4H88H 3QB7C 5AW9B 4DQOH 5H8DA 4D0DB 4DZ8B 4TUOB 5DJYA 1KEMH 3B1UA 1ADQL 3QIUD 4WWKD 4XMLH 1J88A 1OAYH 2V4LA 2VXSL 4RGNE 4M1CC 4UAHA 5EORH 3UX9B 5SWQB 3S96A 5IV2B 1G84A 1YUHA 3ZKMC 4DGVL 1A8ZA 1DN0B 1IGYB 4ZAKC 3AT8A 3T9WA 3KJ6L 1JK8A 1HILA 2IBGA 3QG7H 4ZFGH 4DW2H 4MB1A 5EUOE 4I0PA 2C9VA 3QDJD 4BK5C 1KLFA 3N44F 1A9VA 3QCUL 2BY0A 3NZSA 2O61B 2ZCLL 2OJZH 3VSVA 1DZ0A 3REVB 1HOCA 4E5XA 1GAFH 5ABZA 5ACMA 3TM6A 4I85A 4OLZH 4RA0C 3TZVB 3O6FD 2PYFB 5A6IA 5AYTA 1SUHA 1BMZA 2YGNA 4PGBA 2V3EA 3QWRA 4JFZH 5DD1H 8PAZA 1XSIA 3VXSE 3HI1A 4U6HA 4ZQKB 2Y7SA 3QDGE 3QDMA 5F88A 1CYXA 2I9LA 2OCCB 1M6OB 3DTXB 1KTKE 5ALCH 4K3HA 3EO1A 5IT2H 1YRKA 4NQEE 2IH3A 1MWAB 3GT6A 1T7YA 4N8VA 2DMHA 2P8LB 3HNVH 1G5AA 4IU3B 2HTLC 1TJHL 4EDXA 5IHZA 2CMRL 3I3EA 4KOBA 4ZUSA 3DJSA 3F62A 2VLJE 5CSGA 3FCSA 2XWXA 1IBYA 1HKFA 4MBRA 4X8XA 5CP3H 4ZAKB 4CC1A 4PFEA 3QG6A 1IC0A 1ADQH 4XMLL 3VI4A 1F18A 2EDYA 4FFWC 4M7KL 2YA2A 1XAUA 1T1XA 1D9KA 1F3DH 4JZNA 4ISVB 3TBYB 3V0WH 1OGAB 1K3IA 1DVQA 5GGVL 2D7NA 2A1WH 3PWJB 4M5ZL 3ULUF 2PTTB 2NX5E 4QRUB 4MNQD 3NDYE 1RHHA 2K45A 3G5ZA 4YBQC 2EIKB 3FSOA 5JW4N 3FMGH 2D31B 3V4PL 2ZOWA 4S1QH 3SIKA 3V95A 5C0NC 4MAUL 3RL2B 5I1KL 2LFGA 2OJEB 1URIA 1TO5A 4GAAA 1TG8A 1CK0H 2KZ1B 2DLHA 1NGXA 2X3BA 1HN1A 3VI3F 2HWZL 2ZIDA 2GBVA 2XCMC 3CG8A 5C7ZA 3VFUB 3F83A 1BD2E 1DVZA 1K9TA 2C3WA 5DS8B 4Y16A 3M7OA 5FDWA 5JNYA 3S37X 5IHUH 1KEML 3UTQA 5KBLA 1E4KC 1ZV2A 1A1OB 4KPHH 3GSWB 2KC0A 2ISDA 5C0CB 3VWKA 4X7DC 4PJ9B 4BK5A 5M94B 4WY7H 4KNQA 3AREB 2PWFA 1EZVX 3IPEA 2BWIA 1HINH 4NUPA 4CC0A 4LHJB 1JUFB 3PWLB 5T1LA 3WEBA 1XSOA 3FL7A 4K3GA 3CFBB 2P5EE 2HRPH 2JKNA 2WPGA 3DHUA 1R24B 2IPUG 2I25N 5KVDH 1J9CT 1RKRA 4BWWA 5AB2A 2WUBH 1TF4A 3WNKA 2YEQA 4Z3GA 1SOXA 5F7NC 3UDWA 4UV4L 3TBCA 5E4IA 1KTLA 2O6PA 4JFZL 2NY6C 1S8DB 1TTAA 1I8IA 2B2XH 3NAAL 4JY4B 4ZW3A 5CO1A 5EF1A 1MCSA 2QL1A 4Y88A 4Q58C 1NIAA 4PEEA 1UURA 3JVFC 4GP8B 4AV5A 3T6XA 1QBBA 3VXNA 4KK9D 5IB2B 1S2EA 4I77H 1Y7VA 4JFVA 1B0RA 1UD8A 4MS8C 1EO8H 3CFQA 1E90A 3RAJH 2BFGA 1LNUB 1FE8L 5EC1A 2J6WA 3IN2A 3FOLA 3RZCA 3EGXA 5GGTL 4J3TA 2CIKB 4CN6A 3ETBJ 4KQ0A 1XGTA 2QV4A 1A6UL 5J13C 2EDLA 1KJ2H 2BXYA 2JQAA 4OKDA 4UIMB 5SWZA 2CZNA 5K9OB 4JFFB 5TPWH 5A7EA 3J07A 1L9RA 3K8LA 1FZMB 1VGKB 1N8ZB 1Z0NA 3MRRA 5C0CA 4OZIA 5L88H 4JKLA 5JO5B 5AAWA 4JMNA 4Z7WE 3G3LA 4OZIB 1MZYA 4TKWA 4HQQH 3ZGIA 2D0HA 3OZ9H 2UXVA 3MV9A 4HPOL 2XPGA 2A0LC 3QEQE 4ZUVA 4E41E 3AU0A 4W9JC 3WHE1 2L7UA 5FOJA 4HDIB 3FOLB 1ZLUK 4NQEA 1JE6A 3BUBA 3T0VA 4UV4H 1JFQH 2YQ2A 3V0VA 3FUMA 3X1BA 1TZGH 4NRZB 1HYSC 5EUKB 3SCMC 1Q38A 4X5XA 3TASA 2DI7A 4AENA 1I8MA 4XVTL 2A6DA 3VU1A 4Y19B 2GJ6E 5EULV 5I5RA 1KXQA 3NCYP 3WNOA 4WQOA 1M7IB 1HT6A 3GJEA 3WIFA 2F8IA 3NTCH 3VM7A 1G6RH 5DUPL 4QRQA 4PS3A 2XWDA 1EO8L 3X2QB 4EZLA 5AB1A 5GGRA 1UQSB 1R75A 2CXGA 1I8IB 4BKTC 5AVZB 3MQIA 3EDFA 5E2TL 4FG6C 5HHVL 3TJEH 4MNGE 4HSAC 4YSSA 4PREB 1UXSB 1UT2A 5HI3D 2BSSB 2HN7A 4PLNC 4HSQA 2F5AL 5F7KC 5FX3A 3LS5L 2HTLD 4JQXC 3RGVA 3Q8BA 3GTVA 4MGXA 4QEGA 4F91B 3C5ZA 4W6YB 2FEEL 4LKCA 3CHSA 4JHZA 4JE0A 3FTGA 3KPOB 5ANMA 3JTTA 1LYQA 4OLXH 5E8OB 1T80A 1FZOA 3Q5OA 4KK9C 3Q2LA 2JKLA 1IE5A 3DETC 4G7YL 2BZ7A 3ILEA 1A3LL 4ANXA 1KXVA 4HUNB 4NYLB 1MJJA 4P57B 2JJWA 3ULUL 1VENA 1MCRA 3CDYA 4C57C 2MJWA 1VEMA 5JNYB 2R0LH 3CMGA 2XZAL 1DO6A 3GZQA 1TZIB 4JDTH 1G7LB 2CHNA 2LAGB 3P54A 3P3YA 1RJYA 3C8KB 3FFCA 2AJUL 3P02A 5ESQB 2QFRA 4XBGA 5I8EA 1VKXB 3VTTA 3ILDA 4X9BA 1BZEA 2YZ1A 1YEIH 4WO4C 2WTPA 4F7TB 4OD2B 5JW3L 1KDIA 1CL7H 3P0YH 2AJ3B 5D7KE 3WY3A 4HXBH 2PUQT 4KROB 3LNFA 1PAZA 4IHOB 4PMFA 3RFRA 4X6FA 4I1NB 1QR4A 2DMCA 2A9NL 2W9DL 1QRNB 4A63A 3O8XA 4HQQL 1WFTA 5E2WH 1UD4A 3L9YA 1BOGA 4ODVL 2EDEA 2JCCE 1A5FL 4DTGL 1AIFA 4JG9A 3IRZA 3BFWA 2EIDA 2N0KA 3QZOA 5ICYB 3WUWB 3HG2A 4F57L 4ZJ9A 1CE6A 3BCFA 1AGBB 1P5UC 1IBDA 2A6JA 4MXQD 3WJMB 1F1AA 4DPCX 1I8LC 2E56A 4XMKL 3VVWA 5I1EL 1FGNH 1MCFA 1FQ9C 5E1AA 3LPWA 3RY6C 1HESA 1T5XA 1GY2A 2HX8A 3MJWA 4TNFA 1YMMA 3MCKA 3V4VL 2C3XA 1E28B 4NT6B 1VPOH 2H32A 3IXAA 4U0RB 5KN5B 2N1KA 3IJSA 2JTYA 3B9EA 2OMXA 1TJMA 3PHQB 5HI3C 4Y2OB 4I4WA 4MXVF 1T83C 3FF7A 2C1PB 1UA6L 4LCYA 1R3IH 1D5XB 1YQVH 4TVPH 4BQ9A 1MCOL 3QDJE 4APXB 2PKDA 2KHAA 5I6MA 4N5EC 2EDTA 1VSCA 3ECBB 3O2DL 2KLRA 3IPFA 1NWOA 3B2PA 4LSVH 4U1JB 3BWSA 4TVUA 5ANME 2ITCA 3AT0A 1EFXA 1P6AB 4H5SA 4N26A 1HHKB 4PRNA 5E08H 3BE1H 4ODUA 4LEXL 4PJHA 2OTPA 4BZ2H 2YGPA 2KYIA 3TA3B 1Z9NA 1H3WM 2ZUWA 4NJ9L 4E2OA 5LGYA 3KHOA 4HWBA 2NXZC 1RK0B 3QZWB 5LAXB 1JNNL 3EFOA 1UM4H 3WUZA 5I2IA 1M2OA 2NZ1A 5KBMA 4W4OC 1TJXA 4ZFGL 5DVMA 5EO0B 3UAJA 5EEXA 1NCAL 1OE1A 5L2JA 4FQ1L 2D3NA 1UH2A 3MLYL 3H4HA 4JPKH 3D08A 1CICD 5EZOH 4A2FA 1ZWIB 2HMID 1BFSA 2QV2A 1Y18A 4WO4A 1WC7A 1H3PH 2O5NA 4YGAB 5MEQB 2HXAA 1S7XB 3CXDL 4X42A 3NRPA 5DRZA 4XNBA 2BJML 2DJUA 3ZQXA 2VE6B 5LGHH 2BNUB 4WI4A 1GOFA 3BKJH 4UM9B 4O9HL 1A4KB 4FYTA 2E86A 4XX1E 4MSWA 2B9BA 3D0VA 4U1IB 4YC2B 3VQMA 4HXBL 1U8HA 3CZNA 2ODHA 4MWFA 1E9OA 1TR7A 4LP8A 1J10A 1FVCB 1RZIA 4Q4IA 3HPJB 2EXYC 1CUOA 4L8BB 3Q3GB 3FO2A 5AG8A 5EIIG 1ZDSA 1QTYT 5ICZA 4PRHE 3T2OA 4H1LH 4H1LA 3LSOB 3LH9A 3VXQA 4FYRA 1K3ZA 1P0SE 2QEJA 3BO8A 2PO6C 3WSQH 3KPRD 4E9VA 5HGAA 3ABMB 2A74B 3HS9A 4GAFB 1I4FB 5AZEH 2XV0A 3SDXE 3VXMA 5KVGE 1G1OA 1TTUA 2CDEA 2VUYA 3FO9A 1QFHA 3QR1A 3OKMB 4GKSB