2KZKA

Solution structure of alpha-mannosidase binding domain of atg34
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
103
structure length
103
Chain Sequence
NDPLLHVEVSNEDNSLHFILYNKTNIIIPGNCTFEFSSQISEVFSIKMGPHEIGIKGQKELWFFPSLPTPLSNYTMKVVNQDGETILVGKCADSNEITLKSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein YOL083W
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 7
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzkA00
2KZBA 2KZKA
chains in the Genus database with same CATH superfamily
2DWDB 3W39B 5DQJB 4ZMWA 1CFMA 4P46B 4C4UA 2WXGA 1U9KA 3WS6A 2J4WL 3I02B 1NJ9B 3V52H 3O2VH 4E2OA 5JO5A 1PD1A 1KY7A 4N3TA 1IEBA 3RTQC 4Y4FA 4PJCB 4OLZH 5KBNC 1H3TA 1EJFA 1IEHA 1N68A 5HI5D 3V0FA 5HHVL 1RY7B 2BCKB 3SY0B 1OP3H 5JQIB 1WFOA 4DUWA 1YPZF 4Z3HA 1KB5B 4M6MH 1G7QB 4WI2A 4RRPM 2VR4A 2DQDH 4C55A 4AH2A 5AZUA 4CA4A 5DUBA 2JCCE 5A6IA 4OCRH 1SDAB 1EXUA 4APXA 4YFEA 3I75A 2HPTA 2YN5A 4LSSH 3V6OE 1UZ6E 1HHJA 5ABZA 3U9PH 5FKAB 1T4WA 4PMEA 2NT1A 3TZVB 4OM1H 4LPXA 3ZTEA 5FM8A 4LAJH 2HP4A 1CR9L 3JXAA 1JNHA 4PJXA 1J86A 2ITDB 5HGAB 5TH2B 5LXGL 4NM8H 1U8KA 4O02L 3D05A 4L8DA 4MD4A 2NY0B 3L1OL 3UG4A 2B3RA 3R4DA 1V3MA 4OZFG 2J88L 5TF1H 3CXHJ 4TTGA 1CDUA 4PJBE 1FGVL 4GLRI 1Q0EA 4MS8D 3VFGL 1PNDA 1ZGLA 4HKXA 1CD8A 1LO3H 4DN4L 1AGCA 1JRHL 4LPTA 2VDPL 4K8RH 4UOJA 4M1CC 4P23A 3KH4A 3APCA 4GQPH 1KG0B 5T1MA 4HDIB 3T0EC 1DBKL 3MRGA 5DJXA 1D7CA 2XZQL 1TSHA 4KKNA 2X7LB 5LN4A 1KB9J 4H88H 3GD1C 3X3GH 4M8UA 4FEIA 2NY3B 4AGPA 2ADJA 3AW5A 4NHUB 4KXDA 3GBNH 4KGJA 4X99A 3UCQA 1Y18B 2B4CH 7PCYA 4QJ3B 1CGVA 3EOAB 2VLRD 2B16A 2B5IC 2R2CA 2WCSA 3FJTA 3LNDA 4JN1H 4HEPA 1ZLVH 4WHDA 3HG1B 1VADA 1D5IL 2WCGA 1YMME 2OMYA 1TEGA 1SF5A 1JD7A 1FUNA 3IFPA 4EN3A 4RAVB 2UVEA 5CZXC 2A83A 3NGBC 3HE7C 3ARED 3BH9B 4Q8BA 4FQLL 4JHVA 1AGEB 2VSMB 3D18A 5AALA 5SX5K 1OAQH 3HNSL 4O02A 5E8OB 3BO8B 4V2CB 4ATWA 5IHUL 5IIEB 4OLUL 1U92A 5MEOB 2PO6C 3N06B 2WB7A 3BWUC 1ZSDB 4R7DA 4G5ZL 2MTPA 1FL3A 1D3CA 2NX5B 3ECQA 4RAUA 4NLHA 4DFIA 5IVNA 4ZJ9A 2EH8L 7CGTA 3WSQL 4JG0H 2E9GA 4P48A 2WLIA 1UEYA 4X0KB 2VITA 2XWXA 3KLKA 3PXJA 2BSTB 3DOSA 3JTSB 4FMFA 4PRPB 5HD8C 4GRLD 1MI5A 4X5LA 1FVDA 4K7PH 2C3VA 3N0PB 1QTPA 1YEGL 4UTCA 4XXCA 1XCQA 2EDWA 1KJMB 1JVLA 1AYRA 3TO4D 4OJFH 1FFTB 2QV4A 1JWUB 3QPXL 4TUKH 2QADB 4BFRA 3GMLA 4HF5H 1F8TH 1JGVL 2BVEA 1DZBA 1EJ6A 1QNZH 2Q0ZX 4L3ED 2P46B 4XPBH 4ELKA 2QKIC 5CJQL 2BS9A 3CHSA 1P9MA 1Z9PA 1OT2A 4OFYA 4KJWD 1UWEH 5CJ5A 1QATA 2X38A 3TJEH 1ZGLM 1IC5L 5C07E 1FO0H 4JRYD 1XR8B 4P4KB 3N85H 3LPGA 4PJEA 4S1DC 4IS6B 5B22A 1Q9OB 5IESH 1GOGA 4YHLH 3ZY7A 4NQVA 2XG5B 1UGKA 3FUIA 3RTLA 3NJMA 5D7LA 5TGBB 4LEOB 4YL9A 4L18A 1LGVA 3BVNB 5E6IC 3W1ZA 1HQ4A 4M4RA 5BS0D 2EDXA 4Z7UE 4Y4KB 4HT1L 1FE8L 2P49B 2HRPH 2VDNL 1EJOH 2CGZA 1D2OA 5CP3H 2P28B 4QXVA 5H4ZA 4I9XA 2MCMA 5BV7C 3CUPB 1QQDA 4V2BA 3S96A 1IGCH 3LKRB 3VSQA 2XIDA 4I2XA 3OKKB 3RUGB 1RUKL 1U95A 1QLEB 3NP3A 1RZGB 2EDBA 4PJ5B 4PG2A 5FA3B 2WHVA 2DIBA 2XTJD 3QPKA 4ZSOB 3DTDA 4JO4L 5SWQB 1E4XL 5EUOE 3P3RA 5D7IE 2YAPA 4Y5XC 4HIEB 2VERN 2BP8B 3QJSB 3U1SH 4F9PA 1MOEA 4WTZA 1EZSA 1SJEB 3BDYH 1QUNB 3ARXA 3BLBA 3QWOA 4XPFH 2LT9A 1T03L 1MAJA 1SN2A 4DAGL 3AVEA 5LBGA 1RU9H 2JKSA 4W70A 4BH8B 5T1DL 3T9WA 4KO7A 2ZKYA 1GY2A 3Q2NA 2C9XA 1JPSH 1MHHA 4K5NA 4L4TD 5IT2H 3SYCA 1DVQA 1EDHA 5CJBA 5H4YA 1NFAA 2EDOA 3HUJA 1DQQA 2Y6SC 4J3OC 4JQVC 1FFPB 2G30A 5T5FA 4D0CB 5B38B 2WWOA 4WGKA 3WG7B 3FQXB 4I18C 5BRPA 2O5ZH 1HHIA 4M43L 1AZCA 2ALWA 4HX1A 3SE8H 4QHNA 1T66D 5EZJB 1I8UA 2OL3L 1ANUA 1I8MA 2HTLD 1H8LA 2W60B 1P2CB 2FSDA 5DK0A 2VXUH 4AQAA 1YG9A 2VLRA 3QISA 5BVPL 1TDQA 5FA4B 3LN5A 2VDQL 4ZXBC 2I9LB 2EQDA 1R17A 4JFFD 2GVYA 4ODUA 3SDXF 3V6OC 1CURA 3L1FA 3NZ8A 1CLOL 2JJVA 2FHBA 4JRFA 2NDFA 4JDVB 3LEYH 2CJUH 2G0KA 3HTLX 3VXQB 5KSAB 3AREA 4HUNB 4XVSL 2FATL 1VFOA 1MF2H 3VFWA 4BHUI 1QSFE 1TETL 4IJ3B 4ZO9A 5D71L 4YEFA 4Z8FL 4MLSA 2F7IA 2YC1A 3RNKA 2GK0A 1AMXA 1EFXB 1XD1A 4LCYB 1ZS8B 1JNLL 2KL6A 3MXVL 1QEWB 3KPRB 1OZUA 3I9GL 2R4SL 4YBHA 5IB3A 1T1ZB 5L8LB 5AVXB 1LK3L 3GDBA 5ADPH 3SPHA 4GRLA 2WYHA 3BKCH 1U3HC 2BVTA 2OL3A 4LBEA 4KX7A 5ANHA 3VXRE 3O4OC 1JF1A 3TO4A 5F9AC 1F18A 4F8NA 2R1XA 1FVEB 4H20L 4HUUA 5CD5D 2GBAA 3INUH 5F1IB 4L3EA 4ZUTA 4RBPK 2XRAH 2ADIB 4ZD3L 4WW2B 1BF8A 4MAYC 4OIIH 1KJVB 3SCMB 5A16A 1XZWA 4KKBD 1UVQA 3GMQA 1A2YA 2DQMA 1EA9C 3MI6A 3QQ4A 4GYBA 4JRYA 2EKSA 4J3VA 4WUUE 4ZMOA 2ESVE 4JRXE 5JO5B 4X6DE 3D69A 4NM4L 1XF4A 1IEBB 1EEUA 4ZS7H 1VEPA 4Y4FB 1QFHA 4FQQA 4X9GA 4OV5A 1EV2E 5FV2A 5ABDE 4P59L 2VNCA 2XV0A 4X6CA 1DBAL 5T3ZD 2E47A 1FNEA 2NOYA 3OWRA 5E8DH 3UJJH 3D85A 4A37A 3B7RL 4OIAA 5CKAA 1H15A 3W2DH 5A2BA 3BJ91 5HXMA 4NJ9H 3UP1A 1MFUA 5GS0H 5E9AA 1S7RB 3ZGHA 2E9IA 2J8UE 4AH2B 4N68A 1GKOA 3QIWD 2AMUA 4G8GE 3D5OF 3O6LH 3JT0A 4HWBL 2FGZA 3EUDA 3WCYA 1EXUB 4APXB 1ECYA 2CD0A 3QUHA 2NNRA 3QDGE 3RY6A 2E7LA 1JPTL 4NAQA 5E8NA 1E90A 3G5ZB 2R83A 1HHJB 4KPHH 4V11A 1JZ6A 2YAMA 5E94A 4F8OA 4J3BA 1N9PA 3ASWA 3FHAA 2NYYD 4PJXB 4RFNB 1JNHB 3VGGA 1SN5A 1YAIA 3HJ0A 3MV9E 1U8KB 4NDMA 4XMUA 1Q94A 5FLVA 4L8DB 2CLVA 4MD4B 2LVEA 1P6FA 3GRBA 5D6CB 4YX2L 4BZ2L 4B9KC 3SGKA 1AS8A 2QHRH 5D1ZA 1ZGLB 2Q3XA 4KI5D 4L4TA 4HKXB 2ZOTA 1HNFA 3CXDL 3K6IA 1OSPL 3C60B 3IDYC 3VVWA 2EE6A 3P4OA 4PCTA 1GC1H 4Z1PA 5T3XH 5T1MB 1I3GL 1OK0A 2FQGA 5D5ME 1P6AB 3D4GA 4G1MA 1VGEL 5TF0A 2ADGA 5HDLA 3MZTA 4IHBA 4GO8A 2ADJB 4G2AA 4QOKE 4DTGH 4HWBA 4QCIA 4X99B 2H41A 5C3IA 1NANI 4L4VE 1PPIA 4IRZL 3SQRA 3B4NA 3UEZA 3WUZA 4B60A 2GBUA 2X2IA 4JMNA 1VADB 4X6BA 4ALAL 4JFFA 2OMYB 4WKZA 5I1IH 4UANA 4IDLA 2B15A 2IOIA 3F12A 2K3HA 3FU0A 3IFPB 3EDKA 4EN3B 5KVGL 1QG3A 3M1CA 3FU6A 1EAJA 2A83B 3FL7A 1RD6A 2K8MA 3B5GA 1JRHI 4TTDC 1TG8A 2BHYA 4MA1C 1WLHA 4QAMB 5FGRA 3D18B 4KDTC 4ZTOL 3GB7B 3OAZH 4O02B 2MQ0A 4WSGA 2WXNA 2N3JA 4ZPTA 1U92B 3GMPA 4BZ2A 4R7DB 3VJ6A 1FL3B 2F53D 2Z34A 4RAUB 2TRHA 3GM0A 3O6ML 1TZHB 3CPUA 4ABVA 1KIQA 4K7PX 4QXUH 5DJ8B 1RZKC 2M83A 2VDPB 4BSWA 1U21A 3WAJA 5DI8A 2XVGA 2VITB 4JFED 4Z7OF 5JHAA 3DOSB 2DKSA 1MI5B 1DANU 2C3VB 1VFUA 3VI3A 2K3TA 4ESKA 1PQZB 1QAWA 1XCQB 3RYMA 3VU1A 4CSZA 3HZVA 3S34H 1T0NA 2DLTA 4IRZA 3DJ9A 3FU9A 5BMFH 4AG4H 3RI5K 5C86A 1OEZW 4FKHA 4YHYB 1PFCA 4MNGE 4RDQF 5F7YC 1ZE3C 2NQDA 1N6QH 3CDCA 4EUPB 4TVPH 1FN4A 4JDZA 4AYID 2LVCA 2X9XA 1JPST 4M9PA 2YWYA 3BZEA 1VCAA 2E6JA 2APSA 3BPOC 5A2AA 3B9VA 5BZZA 4F20A 1SZNA 3G6JE 4DP1X 4NN5B 1CGSL 3EAKA 4PJEB 4YSTA 5GISL 1S9VA 2PWDA 5AZ2H 4UM8B 4NQVB 2DEYX 1YUKB 4KMTL 1KENH 3PP4L 3NCCB 1HQ4B 4M4RB 3MDJA 2HT3D 2FIKA 4CGTA 3UOAB 1EZLA 4GH7B 2X4TA 5KSBF 5L9DL 5F21B 1WWCA 3D33A 1AC6A 2K70A 4WFEE 3OAUH 3NFSL 1I8LA 3QIWA 1XIWC 2BJMH 2X5PA 5KTEL 3OR6A 4I2XB 4OZGE 1FORH 1RZ7L 1U95B 2Z1KA 5FUCE 4M7LH 4X4YA 3OXRA 1AZBA 4W1TA 4D8PA 4FJ6A 1OGAE 5D4IA 5DU7A 4YIQB 1JHKL 4P5TD 5EPMA 1NGPH 1E5ZA 4WI9A 4OZIB 2UVFA 2A9ML 5HHOD 4GIOA 3QDME 1FFQA 5CEZE 3HG3A 3TFKD 2E0PA 1EBPA 4Q6IA 4Q97A 3FF7A 2CHZA 4BFKA 5D2LE 1VKXA 2CRYA 3NQIA 4FC3E 1S5IH 1J8RA 2B20A 3DV6A 3ATAA 4KZ0A 3T2LA 1Q8MA 1E8ZA 5KYXA 4BWUA 1BOGB 3QW9A 3G04A 3HUJB 2VDNB 5TE7H 4K3DH 4B9JA 1GYWA 3PP3K 1HHIB 1E4XI 3O0RH 4HX1B 3D3VA 4QHNB 1G9NH 4KOBA 1C16A 1IAKA 4IW4C 3UG5A 1I8MB 3WIHH 5DK0B 1ZV2A 1Z0MA 4AQAB 2VLRB 1VIWA 3MLRL 3VXUE 3LN5B 2YEZA 2PNDA 3K91A 3QA3B 4GI9A 5AKRA 1MRFH 3IDGA 2XETA 4JVWA 2P47B 2V2TB 3FRPG 1FL6A 1S2EA 3HAEG 1H0DA 3HLAB 3NZ8B 2YUZA 4HV8A 4NC1E 1NCAL 1BQSA 1UXLA 2BSRA 1WBZA 4LPUA 4IHOA 1GTNA 3AREB 1OOAA 1EVTC 4NKIL 1YY9D 5I18H 4HFWA 1GW0A 4HSAC 4CAGA 2NY6C 2YC1B 1BAFL 5DGRA 3RNKB 2GK0B 2X88A 3RPIA 5JNYA 2MKLC 4PJ9D 2F53A 1Z0NA 1XTLA 2I60L 2P9RA 3AB0C 3HMXL 4MVBD 1RZFL 4HZLA 3OHXA 4KUZL 1OP4A 1KBVA 2WLHA 3QXDA 4J3OG 5IB3B 2FX7L 8PAZA 1TQVA 1KLUA 1EX0A 3LRHA 1DL7H 2K6ZA 4JFEA 2JJTA 2YUWA 4GRLB 3HMWL 4JKNA 3HI5L 1MREL 5D55A 4RZCA 2OL3B 4LBEB 3B2VL 2P5WE 1DQLL 3Q01A 5K9QI 3KPOA 2Z7ZA 3JWOH 1JF1B 2IWEA 3TO4B 4NRXA 4KFMA 5I1CL 1W72L 4WFGD 4HUUB 2EABA 4LLAA 5L8KB 3HLKA 2FWSA 4OBSA 3NJGA 3GMNA 4MGXA 4ACPA 5I23A 4L3EB 4ZUTB 5DHYA 1VJSA 4M1GL 3LZFH 3T4YA 1EWHA 1HL9A 5DRWB 5A16B 1J5IA 1S9WB 1UVQB 2VDOL 3GMQB 4ANXA 1A2YB 5D7JC 3SYAA 3QQ4B 1G1YA 3N42B 4NO2B 1VDGA 4JRYB 4WY7H 2R2HA 5DRZA 3D69B 4XRCA 5C09D 3TM6A 3ZKQD 1NFDE 4N2EA 3AG2B 1AZVA 1AI1H 3BCDA 4UDTB 3TH3T 5HP5A 2V5YA 4OV5B 3QCTH 3HMXA 3ZKMC 1RCYA 4OT1L 4FNLL 2UXGA 4X6CB 1CQYA 1FNEB 5BS0B 2YZ1A 1MLBA 4L0ZA 2AEIT 1BZ7A 2XPYA 4YHOH 5ALCH 1YECH 4XVJH 2BC4B 5JXAL 3EOTL 3NAAH 4ADGA 4BYHA 4KXAA 4RGMB 2BHZA 5EA0H 5IROD 4EOWL 4XP1L 5EWIL 1IGYA 5LUMA 1M71A 4K23L 2OXGB 3TGXA 3OPZL 4S1SH 5DD0H 2HMID 2EC9U 3T6QC 3L08A 2XG4A 3A4FA 3FULA 1W72A 5G2NA 1EJ8A 3H4HA 4JFYB 5E8NB 3S98A 2XTJB 5IKCA 4P5TA 4XP6H 1YQ2A 5E94B 4AKOA 3WFHA 5JPMC 4LLVA 5HHOA 4AYBA 2DMKA 3MPCA 5DGQA 2HXAA 4WI7A 2VDMH 5KVFE 4ZOEA 3SE3C 3HC3H 3QEHA 1Q94B 4PUBL 3IKCA 3VNZA 2CLVB 4LDEB 4NSKA 3VYNA 2ZKHL 2AK4A 4QRQB 5A43C 1MDTA 5B1JC 3LEVL 5E6YA 1NOLA 3E2HC 1SPDA 3VWJD 5L2KD 3LEXB 5HTSA 3E8VA 3AY4C 1U36A 2BZCA 4PRHE 3K2KA 3P4OB 4HQQL 1DVYA 5IJDC 4J4PC 1WAAE 1EMTH 4G1MB 4U7KA 4P04A 2DLFH 2IAMC 3AU0A 1P7KA 4HUCA 4NZUH 1JVOA 4QCIB 3SBPA 3V0AC 3C6EA 3HS0B 4I77H 4OCXL 4Y19E 1DR9A 2OR7A 1RIVH 4X6BB 5IFHL 4G7VH 4JFFB 2DQJL 4FFWD 3PAZA 4WKZB 3F12B 3T8MA 4XNQA 3BP7B 2NY4C 1OB1A 3D48R 3KJ4B 1R5VB 2JWYA 2QKSA 2CLRA 4P05A 1NUNB 4BFNA 1MCHA 4NNYA 1LDPH 4MJ2A 4W93A 3TONA 3QEQD 2FJFB 1S46A 2YPVH 3K80A 4ZPTB 4ACTA 1M1SA 3S88L 3GMPB 5B1CA 5CJOH 4MWFA 3VJ6B 2YPLE 1HEJC 3LZQA 1RZQA 3V4VL 4PJ9A 2X4PA 1KIQB 5I74C 2JI1A 5I8KH 5JDSA 4BSWB 4M7LT 5DI8B 3ETBF 3NQKA 5F72S 4DQOL 3ARBC 4TQHA 1BVKB 4DOHE 3SDYL 5DD1L 3VI3B 2AEOA 3T09A 5LBSL 4F33A 4OFPA 3GS0A 1KEML 3HC4L 2BMKA 4NP4H 1PZSA 3WKQA 3GSVA 2I07B 3ULVF 2P8MA 3B7TA 1V3LA 2J1YA 5BO1L 3R1GH 2HKAA 1WC7A 3CLEL 3FYIB 4K94H 3KLAA 1ACYL 1RK1A 5GJSL 4TOYH 5HYJB 4K5PA 4NC1C 4Y1AE 1KCVH 1FN4B 4JDZB 4Y7MA 1NCTA 5D7KE 2B3IA 4HWNA 3OZLA 3Q2VA 4N2MA 5D72H 1GTFA 5DUPL 3BSHA 3BZEB 1SHWA 2MCG1 1KXVA 3EGXA 2BVUA 2YN3A 3QT2A 3DC0A 4M8VA 3DUSA 3FH7A 3C8KA 2BY1A 4YXKH 1S9VB 2WW8A 4XBGA 5DMIL 3LV3A 5C6TL 5C09A 4GEIA 3CN2A 1NGYB 3V4VA 2ZXDA 1NAMH 4L1SA 4WNQA 3CE1A 3GBML 2A9CA 2FIKB 3PWJA 1JUFB 2V7HA 3M45A 4Z6AT 3LXAA 4HFUH 1QI5A 3OLDA 1UGNA 3OKYA 2X4TB 4DPAX 4C56B 4GAJL 1G0DA 4U6VH 2HKFH 1AE6H 1A7BA 1J9RA 4WEMB 1M05B 1O7DE 4I3RL 5IROA 3F83A 4FAAB 1UKTA 5LBSA 2VXSL 3QIWB 5FXCH 4OD2A 2H5UA 1JCKA 3G5YB 3OR6B 3E8UL 4QUOA 4FGMA 1IGJA 1XX9C 4D8PB 4MZ2A 1ZLWH 1BECA 4F58L 4DGIH 5IQ7L 1CYWA 4W9FC 1MJ7L 4PJDE 1IB5A 2DJMA 3NFPA 2ZOOA 3BPCB 4PVBA 4HJGB 3BP6B 4JUSA 3HZMB 5F7AA 4DPCX 3CAFA 2ZF8A 5KVDH 3OM3B 3ZDYF 1ML0A 2NR6C 2EADA 4JAMA 1KCWA 3K6NA 3FN3A 4Q6IB 1OP5H 3D06A 2WWMC 1ZEAL 4FRWA 1VKXB 4HAFA 1EHKB 1D5XA 2B1OA 5I9QB 3DV6B 4XN4A 5HGGS 2X2YA 2Y2YA 1IM3D 1YN6A 2I85A 5KYXB 3KLLA 3B1UA 4UQCA 1A3ZA 1FSKC 1LNUA 2V9TA 3D0VB 4KKLC 5LCVH 3VWJA 3G04B 1ADWA 2XSKA 1E3ZA 1M7IA 2C9SA 5L2KA 2O4EA 4L8CB 2WZPA 4UF7C 3PPEA 1U4EA 3H55A 4I1PA 2R56H 5KBKA 2D0HA 2WAHA 3LIZH 4NZDA 1RZIA 1XDTT 2UWEA 1M7DA 4V1DD 1C16B 4KK8D 3BWZA 4AMXA 1BMWA 4OIFA 2PCFA 2AP2A 3VGFA 5CCKH 1NDTA 2YEZB 1EEQA 2J12B 3AS0A 4MFHA 3LS4H 4ONHA 3ULSB 3UABA 3MFGB 4PW3A 3GXFA 1FL6B 3M1BA 4U05A 2BSRB 4F2EA 5IQ9A 2EDLA 4L29A 2ZUSA 4LSQL 4IHOB 4LESA 4F5CA 4UIKH 2A77H 3WIIH 3UGXA 2EC9T 5SV3A 1LP9F 3QEQA 1MLCA 3QIUB 1OVZA 1U8NA 1GH7A 5I71B 2NX5E 1INEL 2FX9L 3RPIB 1CD1A 3MHZA 3CFQA 2XLLA 4HZLB 4EVNA 3OHXB 4FS0A 2FECI 5AZEL 3QXDB 4XODA 4YAQA 1F11A 3IGKA 4OZHE 1KLUB 3LDBB 2Y7NA 5ECGA 1J5OH 1DJWA 2AJYH 4NQXA 4PGEA 5I6OA 1TJHL 1QACA 4RZCB 3IJHB 3B2DC 1SGKA 4DEPB 5KVEE 4NRXB 5E6SB 4XMTA 3OD3A 4ETQA 2FEDD 3H3BC 3BT2L 4QY8A 3GMNB 2QFRA 4OCMC 3PUCA 2DICA 3VI4A 5DHYB 4ZDHA 4AWJC 1S4IA 1P5UC 1GGUA 4FP8H 3T4YB 1ZANH 3IMUA 5L0QC 1SMAA 1C5BL 3I74A 4XCCL 4WEBH 4MXQC 1NMAL 4BQ6A 3VXTA 1BG1A 5DRZB 1LWJA 2WNWA 5KN5B 1XH1A 4R97B 2AQSA 3UDWA 2DQTH 4ANKA 1RURL 2GSGA 3QZWA 2EXWC 3PGFH 4NKOA 1N5YL 4GFXA 1WISA 3PG2A 2JQZA 2R4RL 4B7IA 2N0KA 2DH3A 3SJVD 4Z78A 4PJ8D 1KC5H 1BZ7B 3GIVA 1YUHA 2R27A 3NFNA 4ZTEA 3ZDZB 3PL6D 3ISYA 2RIKA 3BUBA 5DD5L 4KTDL 1WGOA 3WTYA 1M71B 3BIKA 3KPLA 4QRSA 1H9DA 4CN6A 4BCXA 5IWLA 4LCUA 4IU2A 2A74A 2WQWA 4PJ5E 2XG4B 3KVQA 4HULB 1NPJA 1W72B 2WKGA 2FQDA 4UQAA 2XA8H 35C8H 3RPKA 4AMKL 1MFEH 4PAZA 5IKCB 2DYPD 2XQYK 4OCWH 1CFTA 4P5TB 3NSJA 5TK4A 4PWEA 5C71A 1F02I 4LVHB 1KBPA 3E9TA 4P46C 3BKJH 3WFHB 1LQBC 1WZMA 3L4UA 2DQUL 4LLVB 4RGND 5HHOB 3RE0A 2CPUA 2QPUA 4G7YL 2VW7A 3QEHB 3IKCB 4NSKB 1E6OH 4QR7A 4GQ9L 5DZNA 1IC7L 2EP6A 3NEOA 3ARFC 3QFJD 5I0WA 3T3MF 1IM3A 2RD0A 2WIIA 1RMFL 4Y9BA 2F7PA 1FIEA 2K7PA 4K5OA 3W0WD 3VD7A 2IQ9L 3UPCA 3IF1A 5LBVA 1PYWA 3MLTB 5DZLA 3O11A 1O7DC 1PLAA 2EIEA 2KPWA 3G9AB 3RVTD 1THAA 5FYKD 1DN0A 3CVHL 2PR9A 3BIAX 3OJMB 4V1DA 5FHAH 3H0TA 1DLFH 4Z3FA 3GEFA 2E6QA 2DQIH 2X44D 3TT3L 5E8EA 3MREA 3VFRA 3L4CA 1I8KA 1C08A 5IOKA 1BSIA 1K72A 3U4BH 2IAAC 4IKNA 1MRCL 3CV5A 4LDCA 4FQJL 2G5RA 5DFAA 4Z7WA 5DR5H 4KHXH 1KCUL 1OB1B 4A6YH 1CBVH 5AW5B 4NQCE 2KBGA 2BS71 2CLRB 3FHQA 3MLSH 3V9EA 2NY0C 3W38A 3FFOA 4NNYB 4XCNA 3DX1A 4XX1E 3DSFH 1KYAA 4JX0A 4JB9H 3BN3B 3BAWA 3MOBL 5CXPA 3WU1A 4X5RA 4MWFB 4YH6A 2HLFD 2WUCH 4MDRA 4DWHA 4UTAL 4PJ9B 4PRNA 1EGJH 2FB4L 2X4PB 1N0LA 2CBOA 4Y88A 1WF5A 2AJUL 1UG9A 2ZYSA 4Z76A 3II2A 4E9VA 3X1GA 1FAKT 2R59A 2YKLL 3MCYA 2ZCLL 4R26L 4AQ1C 4PP1C 1GYCA 2AQPA 7FABH 1CPUA 1ZA3A 5AB1A 2WXKA 5ADOL 1JTOA 1J8KA 1F45A 3CVHA 4FKKA 3TH4T 4F33B 2H7WA 2BFVH 3ILDA 4KJQC 2BMKB 1YDPB 1YEKH 3GSVB 3OGOE 4QRBA 5CEYA 2P8MB 1PKQE 5DF0A 1WC7B 2B1HL 2CQVA 3IYLW 3F7LA 3KLAB 4NZRL 2WLZA 3MJGX 1V10A 1RK1B 1U8CA 3CSTA 3L4VA 2X4NA 1N67A 2G60H 1F56A 1QABA 5DHVA 3K6FA 4EQ2A 5FDWA 5J3HD 3GHEL 3EGXB 3SSGA 3DUSB 4MJID 3LHPL 1RPUA 1YEHL 4ZMVA 3KPSE 3QDJE 4FLHA 3HVDA 3QZLA 4XBGB 5FYJH 4XGZA 3LV3B 4GAGH 3B7YA 4KH2A 5C09B 2RALA 2AF2A 2IPUK 1XL6A 4UV7H 4UTAA 3DGGA 3V4VB 4N85A 1OPGH 3OMNB 3FNKA 3EJRA 4CJ0A 1KMGA 5LDSA 4BJLA 3PWJB 1NL0L 4XPTL 3SJVA 2R51A 4PJ8A 4PWGA 4X6FA 3CVIL 3WOVA 1JGEA 5GGSB 1UZ8A 4UM9D 2QGBA 1FG9C 5FYJU 5FDYA 3PL6A 3EJZD 1JWMA 5FYKL 3PWLB 3ZKSD 4UWQB 5EEYA 4X42A 3PGCA 4JFTA 2UZPA 1IKFL 4XHQA 5AEAA 2QADC 1TTCA 5LXVA 3B2PA 3CSGA 2Y2TA 4AVHA 1AO7E 1IGJB 2Z4QB 1D9KD 4I1NB 4XB3A 1BF5A 2QPDB 3KVPA 3WS3A 5MHSE 1GOFA 3VGAC 5BPPA 1DZ0A 1OAUH 1J9QA 2DYPA 4AJVA 2VZUA 4YLCA 4XOCA 1WDAA 2XICA 3DGCR 3NFPB 2VQ1B 4RMSA 3EBAA 5BQDA 1HSAA 4BUHA 1DVSA 4I9WD 2MRYA 2ENQA 2P5EE 3DTUB 1FVCA 3BXNA 4HLEA 4JAMB 5JW3L 3VFOA 3BLKA 3P40A 4ELMB 2ODIA 2X6AA 1F4YL 1AQMA 3AS1A 1MFCH 1D5XB 4PJGF 2E7MA 5F7HA 2DQEH 4G43B 4N2CA 4Y4KC 3NG5A 3QFJA 2YD7A 1LNUB 3VWJB 2AC0A 1CXFA 1URZA 3U0WL 5L2KB 1M7IB 4ZFFB 3W0WA 4KZDH 4N87A 4TQPA 5I26A 1YEJL 4ICWA 4J3OF 5JW4R 3B9KD 4NZTL 4FQ1H 4K3GA 5J1AA 4FLSA 1RZIB 1TEFA 2UWEB 2VLJD 4K8RD 5K9OA 3NCYS 1UFUA 2MEJB 5IUCA 2L8AA 1PW3A 4X5WA 1MCPL 1F00I 1PX8A 4XPGH 1BEYL 2PCFB 5CGBA 4U7MA 4JFHE 4ONHB 5JPNA 4WIQA 3OQ3B 4YXHH 2BZ7A 4ZFOL 1UEMA 1UZ6F 3MV7E 3M1BB 2F54B 1TJIH 4M62H 3K6DA 2H2PD 4J6RH 3SYOA 4CKQA 3M07A 4HXAL 5IQ9B 5F0LB 3NIDB 4L29B 3FB6A 5TJWK 3X3FL 1XXDC 4FQXD 2ZF9A 4R0LA 3P9LB 3RNQA 3QEQB 1MLCB 1CE6A 1FYTB 3HNTH 5KYYA 2CSPA 3L9YA 3MJ8A 4F92B 4W4OC 3R8BB 3TEZA 4PJBF 1VERA 2Z64C 3ZKXB 4FN0A 3KXFE 3V52L 1T2JA 4XN2A 3O2VL 4EVNB 2AKRA 4YAQB 4GW5A 1F11B 4CSTA 4LEEA 2P43B 4AVIA 1A6PA 5D7SH 5C08D 4NQXB 4PGEB 4AITA 2VH5L 1LO0L 3ZYIA 4P2OA 1HCZA 5I2IA 3A23A 1PLGH 4PWHA 1JPFA 4DP0X 4NN6B 5B1KA 1JGUL 3HZ3A 4PP2A 4OLXL 1Q1PA 3DK0A 3OR7B 4MA8H 2HH0H 3TEWA 4ETQB 4ENEC 4TL4A 4QY8B 2IDFA 3VI4B 3WMSA 3QZBA 4A2HA 4ZDHB 4FE9A 3FO2A 2VSKB 1BP3B 4ZFOA 3GXTA 2H1LM 2IBZX 2Y06H 1B4TA 4YVUA 4B9IA 4A7QA 2XY1A 1GIGH 4RMBA 2ZG2A 4Q52A 5AWNL 5SWSE 2DWEA 2WMPB 4MMYA 5CWSB 5E99L 5FGBA 4ZNEA 1FF5A 3GMOA 3QUYD 5DRXA 1ET8A 2AZUA 3U9PL 3VXTB 4MJIA 2OMXA 1M1XA 4E68A 2DF3A 5D7LE 4K71B 4J39A 4GSQA 3GJFH 4QHPA 2GSGB 4NKOB 3O3DA 1SYVA 4AQZA 2H0PA 1V5JA 2VR5A 5L4JA 3K72A 2AI0L 1YEWA 3G5VA 1UCTA 4GIPD 3QJOA 3GIVB 1E2VA 1YUHB 4KBPA 3NFNB 4UM9A 1MCLA 3PV7A 1IC4H 2F7OA 1QFWL 1OAXL 1LO3L 3OC5A 4ZW5A 3MRNB 3VRLF 4OB5H 2X0VA 3BIKB 3KPLB 5ETUA 3S5YA 3TCTA 4I2XE 4Z3JA 3IFLH 3ABMB 4KWUA 4LCUB 1KGXA 5EU3B 2A74B 5LLIC 1ULVA 3VAEA 5ACZA 4H88L 3X3GL 2OQJB 1D9KA 1ZT7B 1OO2A 1REIA 3GBNL 1DVFC 4OUUA 2B4CL 1CFTB 4H4NA 3M88A 2CXGA 4JN1L 1NMCB 3SDAD 4BFBD 3WS6C 3FSOA 2N7AA 4NLAA 4YDJA 2J1XA 5KW9H 4Y4FC 3VW3H 1KCBA 1BQHG 2BVYA 3Q9PA 1G7IA 2H9GA 5CLYA 3LH2H 1OAQL 4KKAD 1IM3B 2CG9X 2WIIB 3HUJE 3MO1A 5KYUB 4XAWH 1MCRA 1PNCA 4X9HA 4WEEA 5MEPA 4Z7UF 3ZOAA 2E8YA 3IF1B 1PYWB 1T6VN 1OZTG 3O11B 3A0OA 4WZ9A 4PGZA 1DEEA 1DN0B 2HA1A 3RVVC 2VLJA 4V1DB 3H0TB 3FK3A 2VLRE 2OCCB 5INCA 4RMQA 2W59A 5E8EB 3TWYA 3MREB 3VFRB 4F93B 5FECA 1I8KB 1C08B 3HS8A 4JKKA 5EBMA 2ZOLB 1UHVA 1OP5K 1U3JA 4OJFL 4Z7WB 2C7FA 3HC0A 4RFNC 4TSCH 4TUKL 1RSFA 4PBXA 1F8TL 4W9IC 1QNZL 1UASA 4YR6A 3QRBA 4FQXA 4UB0L 5D1XE 3TBYA 3LRLA 1BQKA 4XCNB 5DQDH 3F58L 5C97A 3FFDA 2D7MA 1ROWA 4RISH 1MIEH 4PIRF 5EC1A 4UQEA 1IT9L 1HWHB 4PJIA 4JZJA 1FA4A 4PRNB 2DZEA 1R3LA 4P23C 1N0LB 3GGWA 5CGTA 4Z76B 5ITBH 4O00A 3U7WH 2VB5A 4AGQA 2M26A 3NBNA 1MJ8H 2Y5QA 4Z7NE 3L4XA 3DGDA 1JSYA 1ZA3B 2DKMA 1SVCP 3NVQA 5HVWA 2VZSA 3ZIYA 4TQ8A 3L5WA 3MXWH 5D4QA 1EJOL 4HGMA 5E9NA 1ZHKA 2WOBA 1VEOA 5DTFA 1E67A 5FWQA 4AVKA 3FPXA 3NTCH 1RZJH 2HTKD 2X4UA 4D3CH 3L3HA 5L6YH 3IAQA 4EN3C 2WANA 4IJTA 1D2PA 1IGCL 1U8CB 1TQCB 4OLVL 2ZJSL 3W56A 3DHMA 4HMCA 4F2MA 3M17B 1WA2X 1TCMA 3GXUB 3OJ2C 1FCCA 1X44A 2HFGH 3TT1H 2EYTA 3H9HA 4B96A 3ESNA 3OKMA 4K3EL 5DHVB 5DS1A 5FC9A 5I1KH 3EHBC 3QUYA 1OIOA 3WKML 4PW9A 3U1SL 1KYDA 4XGZB 3II1A 2E7CA 1QFWM 3BDYL 4PJHE 2NSXA 5JUEH 5KG9A 5KS9F 4XPFL 5DURD 4DK5A 2AVGA 2NT0A 3CIQA 3DGGB 4I7ZC 4OD1L 1MCJA 4LVOB 1A3RH 5EZOL 1RU9L 1YC8A 4DP5X 1GGBL 4HIJA 5GRUL 3ZN6A 3L9RA 3SJVB 2NMSA 4PJ8B 2CO3A 1UZ8B 3PL6B 4TVSa 5DK3A 4D9LL 3D0AA 1JWMB 3OAYH 1QWUA 9CGTA 5GS1A 3PGCB 2D3VA 5IFAL 1QZ1A 1T6BX 1V8HA 2IEPA 5ILTL 4YHYC 5GS0D 4YPGA 4ES9A 4YBQD 3OKEA 4BE5A 2W92A 3SE8L 3ISWA 4WHTA 4CKVX 3WS3B 1K6QL 4FG2A 5DA4A 3CVCA 2DYPB 4OZFH 3O6KL 2VXUL 2DY2A 2FGWH 3SDAA 3L81A 1HSAB 4NN5C 2CUMA 4RGNB 3DO3A 1N4XH 1FVCB 4QTFA 1BD2E 4WV1C 5J8OA 3VFOB 3LKNA 2QQKH 3RIAF 1DJSA 3LEYL 4JY5H 4X6DF 3BKYL 4TS6A 5E2VH 4JM2D 1SYSB 4JGNA 4L4TE 5IVOA 3QFJB 4RSYA 2WJ5A 4PREA 4OF3A 2E4TA 3NCJH 2V9RA 3QAZC 1BAGA 5FFOA 4LLWA 3W0WB 5ISZD 3FT2A 4JFOA 1EO5A 1UKSA 1FNLA 1XF5A 2A6KA 2AGJH 3FUMA 1CGXA 2J8UF 3VX0A 1SMOA 2V3FA 4Y89A 1EFQA 4KUCD 4LEXL 1JZJA 4X5WB 4Z7VB 2PP9A 5T3XD 3RFRA 3B2UC 3ULUE 1C5DA 1SF3A 3BKCL 3QXWA 1LWHA 3TJHD 2IFGA 4Y2DD 2J2ZB 3ARVA 4KNTA 5JPNB 5J56B 4NFBA 4F9PC 2C9AA 4X5XA 3CD4A 1F13A 1I3RA 5JXEC 4PWIA 3TJPA 2FNWA 1YNTA 3FB6B 2VUKA 3INUL 4Q0XH 4BELD 5I5RA 2XVKA 4LKXA 2XRAL 4R0LB 4RNRA 2MSPA 4RVBA 1Q0XH 3RNQB 4NAJA 3N2JA 4HP5A 4XOEA 1CE6B 3UJIH 2A9NL 3W82A 3QPQC 4N2FA 4RMUA 2BHUA 1I9IH 1DQMH 1HAWA 4HH9A 1AY1L 5J6GA 2AKRB 1OCRB 4GSRA 1UOLA 3G08A 4ZS7L 1A0QL 1YYLH 2CMRH 4I89A 2LTQB 2QFPA 4OGYH 3DURB 4MCZA 3UJJL 1MG3C 5E8DL 5D5MF 5I2IB 4OJCA 3W2DL 1WE5A 3FFCA 3ML8A 2UY7A 5EDXA 2OA9A 4OLWH 4PP2B 4NJ9L 3Q06A 2DEWX 1W0VA 5AOKA 2NUTB 4H5SA 3T2OA 4HOZA 2D0FA 2EE2A 4MSWA 4AQ8C 3DUHA 1ED3A 4ZFOB 1U42A 3AREC 1ZIBA 4BDVA 1JYXA 3C75A 4JKPL 2DWXA 2GQHA 3D6GA 2DWEB 1BZ9A 4MMYB 4XP4H 5DRXB 4I0CC 4TVPD 3GDCA 3H42L 2VLKE 4MJIB 1QBML 2OMXB 1OY3B 5IF0A 1M1XB 2J25A 1VESA 2P8PA 1BG9A 3K46A 2O30A 2D3LA 3D2TA 4XPHH 4ENZA 2JK5A 3FQNB 1H3PH 3AXLB 4XP5H 3O3DB 3QR0A 3GI9L 3ATBA 3TBWA 3ULVH 3K72B 2NXZD 1I1YA 4OVUA 3G5VB 1T1YA 3BVDB 3QSKB 5L7XH 2XYCA 4WK0B 3N50A 3WEAA 4UM9B 5KSVA 1DJXA 3MU3A 1BEXA 2A1WH 3TO4C 5FF6A 1CLYL 3MNWA 5ETUB 3FUKA 4R7LA 4I48A 5HDQH 4KTGA 4F7PB 4F91B 1ZXQA 5T3XL 1LMKA 5IBTH 2BNUA 1MPAH 2DD8L 1DO6A 2JELH 4RRPG 2EDYA 2OV0A 3NABH 5ACZB 1D9KB 2ZTBA 1TPXB 4G83A 2YOCA 2ADFL 4DTGL 3QHTC 4OUUB 1EUTA 4AM0Q 1F6LL 4HHGA 1B88A 3IMWA 1E5CA 1KZQA 4IIQA 2E8ZA 1G5AA 1P69B 1BVNT 5H8DA 5BOZG 1HH9B 1E8WA 2MOQA 4O9HL 3N0AA 3LNIA 4XX1G 4CVWA 5IM7A 1WZ1L 4NQUA 5BRZD 1CWVA 3RP1A 1G7IB 4MD5B 4JM2A 2AITA 2EH7H 3MLPA 4DO4A 3UC0H 3MO1B 4UU9A 4NX0A 2QELA 5HDBE 4RGMC 3RDTD 3CU7A 2Z93A 3WAKA 3PDDA 4UQ9A 5ISZA 4D7BA 3B9KB 3D3VE 5A2CA 1T2XA 1PZAA 3D34A 3WEMA 3P9MB 1ZMYA 3ILEA 1S5HA 2VLJB 2OS7A 4K5LA 4DF9A 1ZTXH 2WSKA 5INCB 3PJNA 3RY6C 5F9OH 3ZMNA 2E7LC 2ZG1A 4OCLC 5DSCA 4HBCH 1UUSA 5HI3D 3WFCH 5FECB 2BIIA 3A4DA 4KVNL 3D2UB 5E00A 3RB7A 1JN6A 4Y2DA 5EBMB 3HZKB 4FFYH 4YHIB 1IRAY 2ZCZA 4QXWA 5IHZB 1DQDL 2QGEA 3CFNA 3WL9A 3HC0B 5BMFL 4AG4L 3QHZH 3ABLB 3F6JA 3FBKA 2E7DA 4O2EA 4MYPA 1WD8A 5ID1A 5D1QD 2H6OA 1N6QL 4FQXB 3TBYB 1GPOL 3EDJA 3FFDB 5D1ZC 4N2GA 2F53E 5D2LF 5EC1B 3FQ1A 3VFPB 3MOQA 1EEZA 4PJIB 4JZJB 4TUJA 1KN2L 1R3LB 3DVNA 3K0WA 4FG0A 1F4AA 4LU5H 1B2WH 3GGWB 1I53A 3L95A 5AZ2L 3V4PH 1IKNA 4QRUB 3ZYOA 2ZAHA 2Z0BA 4JFEE 4DP6X 1HKLH 1XB6A 1T66C 4N8UA 3VD3A 1VZHA 3VXME 4LCVA 5C08B 3ZTCC 3WNOA 1IM9D 4H8QA 2FBRA 1Z5HA 1ZHKB 5DTFB 2N1KA 3ULUC 3P3SA 3EUUA 4TLSA 2VIRB 2W5PA 1WS8A 1NTDA 1FPTH 2X4UB 3OAUL 5G4OA 3UTOA 4PGBA 2BJML 4RZKA 1FI8C 1UURA 4ZT1A 1RQ5A 1BBJA 3O2DH 1HSBA 1CTOA 4UINH 2PTVA 3CZJA 4M7LL 4YDIH 3UROR 3QULA 3O3AA 3W11C 5AW1B 3H9HB 1KGIA 3MX0A 3QUYB 3QZMA 2IJ0C 3HNVL 2AQ3A 2RCSH 5E4OA 3MV8A 3RL1A 2B59A 4N9OB 5C0AA 4LHUA 5KG9B 4OM0H 1MJUH 3Q7JA 4TRPL 2XQYA 1FO0B 3BE1H 3HG5A 1QPKA 4NENA 5AVRB 5MENB 1KBKA 3GMMA 4HIJB 2G9KA 3HRZA 2BO0A 3L9RB 3UIZA 5B39A 3NIFB 3ESVF 3AU1A 1IFHH 5HSFA 1N2RA 4FHKA 1Y7VA 3ZE1E 5EOCH 3H8NA 3HE6C 3U6XA 3VMPA 3N3EA 3FUHA 4BFOA 3I3BA 2HLAA 5GS1B 3DI2B 1RVFL 1WIOA 3WUWG 5KBDA 4HEPG 4BRVA 5I76B 4ALAC 4DFHA 5DZOA 3FT0A 3O0RL 4HAKA 2H32A 1EO7A 4WHTB 3MRIA 3QWRA 3E6HB 3WIHL 3H9SE 1GAFH 4DSYA 5HHOE 1KJ3H 1QKZH 1Z3GH 1EZVX 3NSXA 1MRFL 2WXPA 4BK4A 1XGTA 2CAKA 3EADA 3EYVA 3DJZA 1PJ9A 3EO9H 1MFBH 2AK4E 3LKNB 3B56A 3WI9A 3IFNH 2ALAA 1KDIA 5BRZA 4AEFA 1OHZA 2IBBA 1JDCA 2OXHB 4LE8A 4NFCA 1A65A 5EZIH 5I18L 4JNXA 4PREB 4JHUA 2F1AA 2WC7A 1F42A 3SZKC 4HC1L 4Q14A 3RDTA 4LLWB 2RTTA 3U36A 1E3FA 4B0MM 5C0IA 4JFOB 4Y8AA 2ENSA 3C5SA 5K39B 3CFUA 3QIWC 1XF5B 2A6KB 3TU6A 2CBQA 4PJFE 3EO1A 3P73A 5EEWA 3UYRH 3IM1A 1EPFA 2R0WH 1ASPA 1VACA 3QG7L 4NWTH 1AQKH 3FCUB 4M5ZL 4XTRC 1CMOA 4MAUH 3QG6A 4P8QA 1JF5A 1C5DB 4I88A 1XGPB 4ZX5A 1VLXA 2XUWA 2EDFA 4ZS6D 3WIHA 1QASA 3JWOL 2ZUXA 3FZUC 5AAPA 4ZYKA 2R7EB 1I3RB 2FIRT 2NYYC 4P57B 2OX5A 2IG2H 3AM8A 3GINA 4Q6IC 1YNTB 3VVVA 4BK5A 2V5SA 4BZ1H 4JM4H 2OZ4H 4LKXB 5D1QA 3QRLA 1B0IA 4E9LA 5I30H 5I9QC 1NEPA 1GRWA 1YNKL 4KRNA 2MOVA 3BAIA 5F6IC 5CN3A 1UM6L 4F15C 4WY7L 4HH9B 5J6GB 1TJMA 2CO7A 3G08B 3GHPA 5J89A 4HHAA 4IMLB 1AI1L 4AE0A 4HPHA 2JKNA 3QCTL 1T1WA 4AX3A 4MCZB 2RA1A 2NY7L 1NCNA 1RZ8A 3O45A 3US9A 5PAZA 1IM9A 4YHOL 1YECL 2JMRA 4XVJL 5ALCL 5GGVY 2UY7B 3E1ZA 4AYEC 3NAAL 5EA0L 3P77B 3DETD 4XWGH 3U2SA 1I85A 3TPUA 4LGRB 4HK3N 1WV7T 2VZ3A 3F85A 2AMGA 4HUWA 1F58L 3HBPA 4DJMA 4S1SL 4MSWB 5EBLA 1ED3B 1I1RA 3ZDWA 1PD0A 2AJVL 4BDVB 5I75B 5K9KA 1MFMA 2EINB 3HPLA 4HK0B 3HR5A 1BZ9B 3GSQA 5I71C 3R06B 3FTYA 3QXAA 3Q43A 3DO7B 3KPNA 5DD6A 4F9LA 5CCGE 1YY8A 2YD9A 4KVCH 4XP6L 4JW3A 5IF0B 3IK2A 4U3SA 4NQEE 2P8PB 4OF8A 3OHXC 4YSEA 1NQBA 2JK5B 4X4XA 5DURB 1QP1A 3HC3L 2ZOWA 2XWEA 1AJ7L 4FQCH 1EDQA 1I1YB 1T1YB 1OE2A 2JJTC 5C8JB 4HJ1A 1ZTMA 2CKNA 2FDBP 2J7LA 4FTDA 5AAMA 4G1EA 3GZOA 5FF6B 1NCWH 4Q9QH 1A1MA 3MNWB 4I48B 1TTAA 5DJCA 2R15A 4UBDD 4YSRA 2BNUB 3IWUA 4OTXH 1EMTL 1F97A 3SOBL 4N0FA 4X7DC 1A7RH 4NZUL 4KKCD 4MTMA 1OKEA 1PU0A 4LLUB 4QXTA 4N8CH 2CO6A 4HU2A 4YHPA 2X6VA 4LSRL 3GSXA 4IK7A 3HS9A 1JXKA 4XHJD 1KYOJ 2IDSA 1E42A 2IWGA 4S1RH 3MRCA 1JI2A 1RUAL 1XGZA 4F7EA 4R97C 3A6CH 5IM7B 1AZZC 4TN9A 1XAKA 3K7UA 3AT8A 4PJCF 3ROLA 4GRWE 3GI8H 3Q6FB 4JM2B 2J1KA 3G6DH 2HT3C 1LDPL 3VSVA 3SDDD 4UU9B 3VQLA 5BV7H 1DSYA 4HPYL 5GQBA 4EO5A 2JJWA 4YL4A 3OAYK 3RWFA 3V6ZA 4FI7A 2C9VA 3EFFA 1JZGA 2Z93B 2BLFA 3VM7A 2A0LC 4GB9A 5ISZB 2XFXA 2WXHA 3D51A 4M1DH 1VPOH 4H13C 3BD4A 3RWEA 4FABH 1BLNA 3ARDC 4KZEH 1F6FB 5EFIA 1URLA 1YQVL 1S5HB 1T4KA 2FJHB 3NACH 2L7UA 1OM3H 3L7EA 4OU3A 4EI0A 3SGEH 2QQLH 3U7YH 2WZ0A 5DSCB 1U33A 5FO7A 4YK4B 5IHHA 3K4DA 5IMLA 4P5TC 4DO6A 5LGKA 1YPZE 5E00B 2R39A 4LVHC 4Y2DB 4NP4L 5K9QG 4YHZH 4B97A 3EYUH 3SDCA 3TFKC 3R1GL 4WI8A 3TX4A 4O2EB 5AKVA 5TPWH 4GRMA 5IJKC 4H8PA 4CMMA 2HVBA 2V3EA 4J3OH 1KCVL 2KLRA 4UT7H 4QRTA 5D72L 1H5BB 4M7JL 5F7KC 1BYNA 1LWRA 1EEZB 4TUJB 5EO1B 3BH8A 3CQPA 4BM7A 5AFAA 1N10A 4YXKL 3RWIA 3L95B 3LMJH 2HRHA 4HKZA 3FOMA 5F9WB 3JWNE 1EEYA 4QHLA 2PKDA 3NCFB 1UD8A 1BVLA 4OAWA 1UM5H 3I9PA 4HFUL 1AKJD 2P8LB 1FZJB 5FPIA 5CLZA 1TCRA 1AE6L 2HKFL 4B0MB 5IY5B 4M7KL 3ZKND 1G7JA 3DARA 3CX5J 1H3WM 4I0PC 4PGBB 3TIDA 2FK9A 1P1ZB 1RIUL 2OJZL 2N01B 3GS4A 3K8LA 1BBJB 3SD5A 3F3HA 3UADA 3WD5H 4LLDA 3B2MA 1YY9C 4WVRA 4DGIL 1ND0B 2EDHA 3MX0B 3E7JA 4ZZFA 4A2EA 1XGYL 3RZWA 5EN3A 3QK0A 1VB9A 5E2TL 5EO0A 4QLWA 1GGYA 1KY6A 1A3QA 4PJ9C 4MVBC 4OLYH 3RL1B 2B59B 5E2WH 4H0HB 4M48L 3ZUCA 2QPEB 2AXGA 3ECBA 3GSNH 3GS7A 1P1VA 1YN7A 3GMMB 4BGLA 2PXYB 2ZAIA 1OTSD 2VDLL 3HRZB 2DL9A 3GEWB 3OSVA 4C8XA 2NXZB 5ICZA 5B39B 1KB9K 1TZIA 4RMWA 3AU1B 4HHWA 4OZHF 1N2RB 2GJPA 3A6OA 5K5YA 5LNGA 2FR4A 5LCVL 2UZIL 2OSLA 2Y07L 2YXWA 4J6IA 4XWOD 4KQ4H 4XCEA 2PWGA 3QVAA 4AEHH 2C4FU 3MRPA 1BYOA 5EIQA 2R56L 4HJJH 4F8PA 1WYJA 5CP7A 4OY9A 3LIZL 4JHAH 1S3KL 3S37H 1AKPA 1M53A 2Q9OA 5LGYA 5F0PB 3NJHA 2GABA 3MRIB 3T6WA 4DNLA 1AHMA 4DVRH 5HHPA 1TFHA 1YEIL 1BFTA 2G5UA 1CDHA 2WXJA 3D87B 4JFDB 2Y25A 2Q1EA 3VG9B 3LS4L 2PTTA 2JH2A 2I9TA 1XGTB 5JR1H 3VU2A 1G0YR 3X17A 4FA6A 2EDJA 1OCWH 4NO5A 2ZCKH 3TBTA 3MNZA 3QDAA 2GCYB 5BRZB 4ODSH 3UZQA 1JZHA 4UIKL 4XPAH 2A77L 3AWEA 3VB9A 4FNSA 3WIIL 3TF4A 3C2AL 2ITCB 2QT6A 3RWDA 3SDDA 2VXQH 3A24A 1QSEE 1PZCA 4KROD 1DFXA 3C6SB 4XMKL 2FT8A 5C0IB 3RDTB 3V9FA 5IROC 1MSPA 4XP9H 1UWGH 3B9EA 2HLEB 1BOYA 5IVXA 4OJEH 4ADIA 5LCVA 1E8YA 3BZ4A 3C2SA 4UZGA 3I50H 4EIUA 5AG9A 2WBWB 3TC9A 1VACB 2ZP9A 3RUGF 3MLZL 1J5OL 2AJYL 1GCYA 3LIZA 1ET5A 3L5IA 1NBZB 2B2XH 1G7PB 1J1PH 2ZUWA 2E7HA 3NA9L 4WFHD 3V0DA 5I5JA 2DH2A 4ZYKB 3FTGA 4HS3A 3VFMB 5D2NE 3OKOB 1JPGA 2OTUA 2OX5B 5EIIG 1HHHA 1HL4A 3OC8A 1FFRA 2XZCH 4PWKA 1SHSA 5TQ0L 2YRBA 4H0LC 4JPVH 2H3XC 3B83A 5D1QB 1ZS2A 2WP3O 3O3UN 4CBZA 4FD0A 1JHTA 4ANVA 3VWJC 4WEBL 2DJ4A 1MHPH 1FZOA 1CG9A 4GG8A 1KWGA 1JK9A 4AV4A 5B8CC 1RJLA 4RIRA 2CO7B 2M8XA 1SJHA 4KAQH 3V5DA 4HHAB 4AK1A 2DQTL 3PGFL 1JYWA 4EF3A 4P3DA 1T1WB 3UTZA 1XF2B 1IZJA 2YEVB 2FLMA 4GOSA 3ZO9A 3B34A 4EKJA 1IM9B 1NMBH 2ZSVA 4CMHB 3GMRA 3HA0A 1AKJA 5GIRA 3DIFB 5CSBA 1EAPA 1JNNL 5LVEA 3ABKB 1P4BH 2IPKB 2QSCL 2WN2A 4HUWB 5F7WC 1NAKL 3CN4A 4JDTH 5EBLB 4WW1A 2ZUVA 4DZBA 2LOEA 1F90H 3NMEA 4XX5A 4YGAB 5K9KB 3EDDA 3K1KC 3GFUA 35C8L 3HPLB 3HR5B 1MFEL 4PS7A 1BIHA 3GSQB 5GPRA 1DFBH 2VJXA 4OCWL 1WBXB 3ROOA 3EDFA 3KPNB 1SEQL 2DQHL 3UZEA 1YY8B 5DCCA 1GJIA 3BP4A 2OYKA 2P42B 4A7GF 4JE4B 4U3SB 3RVXC 3UJTL 1RZPA 2FO4A 1S7UB 3SDXE 3UH8A 4D0BA 4IRJD 4X4XB 1TNMA 1QRND 3CFBA 4U1KA 2XACC 3SJVE 1E6OL 3ALWA 2QJDA 3TCXA 5L88H 1WFJA 4ZBJA 3UAAA 4JZOA 4ZPVA 3JWNC 2J6EL 1HCFX 2XCMC 4Z3IA 4BXVA 1ZSHA 1OGSA 3US1A 1WTGT 4NN6C 6FABL 1T20A 4WU5B 5D6DA 4YDKH 1A1MB 2J1ZA 3HRPA 3CLFH 43CAB 5DJCB 4FTVD 1KLFB 3KJ6H 4R7NA 2OMTA 2C9UA 1G6VK 3IDXH 4N0FB 2XXFA 3WFDH 5FHAL 1DLFL 1KTLB 4HLJA 3W57A 4WW2F 4WUKH 1N26A 4E5XA 1GMEA 1G9ML 1R5IB 4JO3H 4MS6A 1C12A 1S7SB 2CO6B 4YHPB 4GSUA 3TOPA 1TVDA 5C6PB 4OI8A 2IH1A 3U4BL 5I66B 1DVZA 3MRCB 3MJWA 4F7EB 3LYRA 5DR5L 3UDWC 4KHXL 5GRXG 3DX6A 3FYEB 4XNYH 3S2AA 2D0GA 4JQIH 3JV5A 4A7TA 2Z8VC 2EO7A 1ZLEA 1KJ2H 4LMQI 3CBRA 2DN7A 3DSFL 4DVBA 4EQ3A 2HPOA 3V6ZB 3RWFB 1D7BA 3NDZE 3ZQXA 3EFFB 4DQAA 5C7XL 1U58A 2WUCL 2J6EA 2XFXB 5DJZA 1MQ8A 4QJ5B 1IAIH 3GSUB 5AENA 3RWEB 2IDQA 4L1BA 3K2IA 4LVEA 5IWLC 3MAWA 5EFIB 1T4KB 2XWCA 3UTTE 1I1FB 3L7EB 4HUXB 2VABA 4L9LA 3WY4A 4OFVA 3CFCH 3V6FA 5AL8A 2AVFA 1S3RA 3HI6L 5FO7B 5JOPD 2Q3AA 2FRGP 3CK0H 5IMLB 1CC3A 3FXIC 3O2WH 3TCLA 4M8RA 2BFVL 3HHSA 1X6NA 2GJZA 3QXVA 4M56A 3V79C 2A4CA 1YEKL 5FGSA 1DCLA 1OCCB 3TESA 1CF8H 4J3TA 1XSKA 4JR9L 4UQIM 4M3JA 4FFTA 5C6WH 4PJXF 5DVKA 4Z3EA 5FR3A 2C4FT 1L6XA 4GRMB 1IILE 3NA4A 4J27A 4CMMB 3MN8A 2VMDA 3BGAA 3GKWH 3NZSA 4QRTB 1ETA1 2HUEA 2G60L 5F44A 4ERSH 3ZTNH 2HJKA 2XIBA 3BHBA 1I7TA 3MRJB 3BH8B 2I25N 1F86A 3OWEA 4I1RA 4YHKH 1HU8A 3KW8A 5C0RH 5HJDA 2C4XA 2XWRA 3RWIB 3S8FB 4U1NB 4KK6D 3P1VA 4HKZB 4OQTH 4UV7L 1KELL 4YUEH 1EGJA 1OPGL 3EYSL 1EEYB 2BOBA 3MRMA 5JORB 4KK8C 3KWWA 4ODVH 3N41B 1BVLB 2QTEA 4OAWB 1RUML 3VTTA 3QDHA 4PTUB 3FQUB 1A21A 5GS3A 1O9VA 2W0PA 4HPOH 1TCRB 3T4AA 3Q8FA 1G7JB 1BMGA 3F7YA 4ZTPH 2C3GA 3OXSA 3TIDB 1A7PH 4PEEA 1DQJB 5I1EL 3SPGA 2OBGA 9PCYA 2CR3A 3MRDA 1ETZA 2H3KA 3I2CH 4ZNEE 4LLDB 1RUPH 4WI5A 5EU6E 4XBPA 1UH4A 1E4JA 2PETA 3BSGA 5ICYB 5SV4A 1RI8A 4AI7A 4MCYB 4Y0GA 1LE5A 2Z35A 5F3BA 1S9XA 1RHHB 5EO0B 3X2QB 1BVOA 2JB5H 5C0EB 3A3YB 4E9XA 3IN2A 5HHME 5EC2A 2VXVL 4IRJA 5TD4A 4XE5B 2AXGB 1QRNA 1TNNA 2IPTL 3ECBB 4FXGA 1YN7B 5LHDA 2EDEA 3NT0A 1JFQH 4P9MH 4XMLH 5ICZB 3RZCD 1TZIB 4LCWE 4KGLA 1X5GA 4HZ1A 2DQEL 4UMSA 2XNAA 2FR4B 1TTRA 4TQIA 3S37X 5AYQA 4HXBH 1WAEA 3QRGH 4XCEB 1HHKA 4JPIA 3MRPB 4ZNCD 1SLVA 1NDMA 3QYNA 1DP0A 3OV6A 4FQ1L 1FCGA 3IMTA 4L9DA 4FTVA 1J8HD 2NNCA 1TQCC 3PHQA 4M5TA 1S9YA 1PIFA 2XPGB 3MLWL 1TUPA 2NTSP 3UPAA 3POHA 2CM5A 3MR9A 4Z7OE 4U1LA 5HHPB 1BHGA 1J9CT 3F04A 2O6CA 3L2NA 3WJMA 1JGLH 3NJJA 4PLJD 2YAOA 2NZIA 2Z1PA 3SYPA 4B3VA 5F7NC 2PTTB 4OQ1A 2I9TB 3KR3L 3LH8A 1PLBA 4PJEF 4WLCA 2WP3T 4JCMA 3N1FC 4J6RL 1AG0A 1M3JA 3TBTB 3MNZB 4J7RA 4LVOC 3RWCA 3BWSA 5IHWA 1NCCH 3U30B 1M7UA 4JO5A 3UZQB 3KL0A 1IE4A 2EEDA 2OMNA 3KEHA 4XN1A 5T1KD 5I0DA 3RWDB 3C5ZD 4PJ8C 3SDDB 2GSIA 3HNTL 2VDLB 3V7MA 5KJRH 5AUMA 1GKEA 1PBYA 3PL6C 5CR8A 3Q1EA 2A6IB 2EO1A 5IVXB 2D7QA 4ZFGH 4XC3H 1SXAA 1WCQA 1YLBB 1H19A 5K1VA 1U3ZA 4JG1L 2GY7B 3GLZA 4X2UA 3T6ZA 1HNGA 2NXYD 1CU4H 2WLLA 2DRUA 3DROA 1MW1A 1PLGL 3I6LD 2C7UA 5KSBE 3MMEA 4FFZL 3SKJH 4CC4C 5F1OB 4MA8L 4OZIF 3FTGB 1IBYA 1JPGB 2EZ0C 2OTUB 2RFXA 3P4LA 3NJKA 4QTHA 4A55A 5IR1A 2XVLA 3D4CA 1Y1DA 5GHWL 3ALPA 4CADB 1DBMH 2ATKA 4IBWA 2N59A 1JHTB 3U4EA 3B6SA 1A7NL 3F7QA 4G82A 4Z7AA 1ZGLP 3RDJA 3GBLA 1FZOB 4GG8B 5EOTA 1S7XA 1HZKA 3HUJF 3A6BH 5I5MA 1JK9B 1G5GA 1RJLB 3CZLA 4RIRB 2AQ1A 5DT1L 4FKEA 1SJHB 4N2OA 3V5DB 5DJDB 4L05A 3VXSE 3D25B 1QHPA 5CD3A 1FBIH 2VERA 3UTZB 1DUZA 4XXWA 1KGCD 3CZSA 4OFKA 4QRRE 1HC1A 5JW4M 4OGZA 1WQVT 3CFKA 4ZW6A 2ZSVB 4G3YH 3GMRB 2WUBH 1AKJB 3S3PA 1O6SA 5GIRB 1MCCA 5CEZH 5FEBA 5JPNC 1TLKA 2FBOJ 2IGTA 3B3BA 5IEHB 1PZBA 4OB5L 4JZNA 2CZNA 3GXPA 4PV8B 5BCAA 5E24E 2PPCA 1A66A 3IFLL 4F2ME 4WW1B 4FFZA 4OIBA 3WLWC 5JHLL 2F61A 3FAWA 1RL1A 3N6YA 3T3PB 4U1IA 4YSOA 1E4KA 1OSYA 1A1OA 4R0LC 4BSJA 1CFBA 2OI9B 4JJ5A 1JE6A 1MW3A 3Q3GA 3ROOB 1T0MA 2DYRB 3TH2T 5DJ6B 1M4KA 3BP4B 4LRIA 5HHXH 4DERA 1NC2D 4NCC1 1NDGB 1URIA 4HG4J 2FO4B 5BXFA 4NKQB 4XAKD 1ERNA 4J3UA 4BKSC 3KH3A 5KW9L 3CFBB 5C0CD 3VW3L 4NN7B 4FHBD 4U1KB 1FDLH 3NIFE 4WSKA 1XF3A 5F7EL 4AGOA 3GJFA 3LJ3A 4E42A 3RZCA 2UZXA 1YAZA 3CDZA 4JZOB 1Q9WA 4P2OC 4ZPVB 3LH2L 3VMNA 3GLEA 4W9GC 4XAWL 3WFBH 1QTSA 4HMDA 1XF1A 2D7OA 5A6LA 1L0PA 1SFHA 4R7NB 1AAJA 2OMTB 1J8HA 3MCLH 3HVNA 4LSUL 2NQ3A 4A67A 3N5AA 5JHLA 2L7EA 4YBLB 4OSUH 4HUMB 4E5XB 3CZFA 2R9HD 5J3HC 1NBVH 3OAWA 2E76C 2IH1B 4Z0BH 4NB7A 3DX7A 2UUDH 1SDYA 3N42F 2HKHH 5DZJA 4ISVA 1T1XA 4PV9B 1BQUA 1UH3A 2WLKA 3DX6B 3H54A 4HOWA 4WJ5A 2APXA 2JTDA 2VC2L 2DBLL 3LSOB 4X6CF 5T1KA 3D4ZA 3HN8A 1AG6A 1X5LA 4I0KA 3C5ZA 4ZX6A 4JPKH 3Q05A 4P5MA 2K7QA 3KL5A 4MJ5A 1UACH 4KROB 1X9RA 1MIEL 4V33A 4BKLA 1NEUA 1LO2H 3LPWA 1U58B 3BAYA 1RKRA 3EJZC 3JWNG 5DJZB 3SKOB 3NK3A 1Z9MA 3HKZA 5E4IA 3A67H 1RAMA 1LEGA 5JHBA 5DHMC 4JJOA 5IW6B 5ITBL 2Z8SA 3MBXH 4MDJA 2W0LA 2VABB 1MVYA 2WINA 4L9LB 5TQ2H 3OBAA 3V6FB 2BM3A 4PYGA 3PWNA 4QYOB 1TPXC 2DOCA 5H94A 1A6AA 3BCFA 1SOQA 1RK7A 3MXWL 3TCLB 1K4DA 3LKOA 1X7QB 3HHSB 2GJ6D 4R7XA 2GJZB 1NEZA 5D93B 5AYUL 3MSPA 5J11C 3NTCL 1RZJL 3QJRB 5BW7A 4MJ6A 1QW8A 5L6YL 5GGVL 1KXQE 3IE4A 3QUXC 4FLQA 4Z3TA 3ZHNA 1H8SA 3DIDA 1R0AH 4A6YB 3QZWG 3VA2C 1B4JL 2HJKB 1X4ZA 3BHBB 1I1CA 1OV8A 4GMTH 5AVQB 8FABB 4IBYA 5SX4I 5D7EA 2APBA 1I7TB 1UB5B 4G8FA 3BUYA 1IIKA 3DSNA 2OMVA 3DHJA 3NZHH 4PRBA 3SPJA 1NZRA 2VM3A 3E3QC 3VUAA 3V9CA 2EE0A 2IFFL 4P2QD 2F5BH 3MRMB 4KJYA 4ZOAA 5JQHC 1KTKE 3VG0H 1XGQA 3KWWB 4RESB 3U6RA 4FQHA 4I3GA 4X8XA 4PVLA 3FFCE 5IEKA 1JD9A 1CDCA 3QFDA 4P3CL 3ALXA 4JFZH 1OB0A 3T4AB 3TYFA 5KVFH 3V6BR 1AOHA 2BVPA 2FVNA 3L3DB 2B4CC 3F7YB 1E2WA 3IB4A 2CK0L 3OXSB 1JK8B 1V3KA 4HIPA 1NLBL 3MRDB 4J1UA 1ETZB 1HI6A 4PY7A 1ZD6A 1CK0H 4FQXC 2C3WA 4CRPA 4WNSA 2YS4A 3OZ9L 2WZAA 1G94A 4G8EA 3AQZA 2R1YA 2WKOA 5FKPA 2MHAA 1LE5B 2Z35B 1M6OA 2HSIA 1S9XB 5F3BB 1J1OH 1HHGA 3V8OA 4OZ4A 1NC2A 1D5MA 3H56A 1WZAA 5GGQL 1N4XL 3TVMC 1EK3A 1AMYA 5EC2B 3BUPA 4IRJB 3P69A 5I73B 1QRNB 4FXGB 5C0CA 3TZVD 1MNUH 4XOAA 2D7NA 3SB3A 2R69L 2F15A 2XNAB 2ZX5A 5HPOA 1CTMA 1GW6A 2GEQA 1R46A 3NDYE 3FSVA 4D2NA 1D6EA 3NCJL 3VI3F 3P11H 1A1NA 1GGCH 1HHKB 1JZIA 2KKQA 3EG9A 3NN8A 1UH2A 3QQ9C 3TA3D 1NDMB 3U0TB 1K5NA 4RX4D 4FTVB 1DBBH 2AGJL 2WBJD 4ZO8A 3WHE0 1S9YB 2L7JA 5I5IA 3FUNA 4U7SA 3QYMA 1QBLH 1AR2A 4H8VA 4AYFA 5ABAA 3MR9B 4I85A 1EHXA 4H8WL 2FJGB 2WTRA 1TYRA 4U1LB 5KBMA 3RGVC 4FERA 4NKDA 1U8JA 2D03H 3FU3A 4NT6A 2BVOA 4IBUA 1FQ9C 1GZQB 4EMZA 3WDIA 5IHLB 3FT4A 2OJEA 3FTWA 4KXBA 1WFMA 3MA9L 3BESR 4Q0XL 3VFUB 1SOXA 2IDTA 3KNBB 2DIAA 1Q0XL 2GK2A 3UJIL 2GSIB 5DVLA 5ISZE 4HCRH 2A7BA 3NZUA 2ROYA 5AUMB 3VD0A 1X5JA 3L16A 1I9IL 3QEGL 3LQAC 4HSQA 5GS1C 2VQTA 3C9NA 3IMSA 2FWOA 4E9YA 5LG6A 4U1HB 1YYLL 2CMRL 2CHWA 2JI3A 2VRKA 5F93C 2ZX8A 4R2GD 1R47A 4OGYL 4DKDC 1ZWIA 3MROB 2WLLB 4C54A 2EDKA 3QXTA 4HJ0D 3TV3L 3PYCA 2C7UB 3MMEB 2GJ6A 4X0NA 1OARL 3SDAC 3UMTA 2BY0A 5KOVC 4U2ZA 1WRFA 4QGTA 3A4EA 2RFXB 2AERT 2WK2A 5E8PB 5IR1B 2G3NA 4G80B 2MOGA 3BAEH 4CBPA 4C59B 3DBXA 1PL3A 5E0QA 2XVBA 2OR9L 3TWCL 5IB2A 4KV5F 2NW2A 4HD9A 4KKAC 4XP4L 3HC2A 3B6SB 4J12A 1CLCA 1VHPA 3DOIA 4BK8A 4KI5F 4XE0A 4HKJB 4NRZB 3UFIA 2FD6L 3HOGA 5B4MC 3GXIA 5HGHA 5CD3B 1UFGA 1WICA 1UZGA 5DVOA 4ZUUA 2VN5A 3LRSB 4X8CA 1NJ9A 4M6OH 3ZW3A 4BQ9A 4YQXH 4M7ZB 1IAOB 2PYEE 4U3HA 1VCBC 3W5NA 4LPCA 4OFIA 1O6SB 3T08A 2EVGA 5EU5B 3IVKA 4DP7X 1O9WA 4O4YL 2BCKA 3ESUF 1X6LA 3SY0A 2A1WL 4JZNB 1P4UA 4A66A 3APFA 3RX5A 1NICA 1K3ZA 1WEJH 5DC4B 3E38A 1VENA 5IBTL 4IRSD 5DC2A 4E41D 4U1IB 1YEFL 2JELL 2UZYA 3NABL 4DHLA 2XN9D 4JPSA 1A1OB 4GKOA 4JJ5B 1HIMH 4HUKB 5EEVA 1NOAA 3Q3GB 1T0MB 2G75A 3MV8E 1A4KB 1TMCB 5C0AE 1KT2A 3MTRA 1PG7H 4MNQE 2I24N 4L0PB 5BXFB 1TT6A 3EJQA 2OLDA 4G6FD 4DT2A 2VMJA 2WZ5A 1B2YA 5TFSH 3HFFA 3I3DA 3DXAD 3MJ6A 4Y2LA 3TZVA 3LRGA 4B9YA 3GJFB 5HJGA 2H1PH 3RZCB 2UZXB 2EH7L 3CDZB 4E42B 1Q9WB 4TUOB 4F7TA 4KC3B 2YSSA 5DUMH 5TH2A 3UC0L 1UQSA 5C0BE 1MCOH 1ZKAA 3CSYA 3DVFA 4TKWA 2WO3B 3DLQR 1AR1D 3QUGA 5D96C 3ZVVA 4WI4A 2E5EA 1I75A 3TA3A 1V3JA 2HTKC 3E1F1 4RX4A 4F37K 2OAAA 1J8HB 2WBJA 3BN9C 3O4LD 2ICEA 3UGEA 2PABA 5I75C 4RMRA 1TFPA 1V7ML 5F9OL 4GS7B 3CZFB 5GXBB 4CILA 2X7LA 2D7PA 2FBJH 1INQB 3DX7B 4L1TA 5B3NA 1KIPB 4ISVB 4JK0D 1Y18A 1HXYA 1T1XB 2D8KA 2OR8A 3EOAA 3MBED 1L7TH 3ZZ1A 3QHZL 1MQKH 4BQBA 1HOCA 4WJ5B 4M5YL 1MFDH 3ELQA 4WGVB 4DP4X 4R4FL 5T1KB 1PGRB 4R96A 3C5ZB 5I0ZA 1RSYA 1B9KA 4P5MB 3LKSA 4L3CA 4MJ5B 5KVEH 1L0XA 4BKLB 3BH9A 4H8UA 1MCQA 2BNQD 1CI3M 3ZDZF 2BWQA 2YJLA 5IIEA 4LU5L 3GPSA 2NNAA 1LEGB 3V4PL 1L4IA 3RB5A 4D94A 5MEOA 4L8BA 1XMEB 4YBQC 4MDJB 2WINB 3DDGA 2EEXA 5T1LD 2NXYB 4LLMA 1GZHA 1OD9A 5GRZA 3S4SG 4AGNA 4OCYH 2AFNA 2G4GA 1DJHA 1LMIA 2WZ6A 2VW4A 4MXWH 4G9FE 3CH8A 5ICUA 3IDJA 5JQ6L 4PJAA 4WI6A 3M8OH 3I6SA 4WO4D 4ONFL 1NEZB 5B7MA 4K4KA 4IIQC 3JTSA 3ME0B 1I7RA 2NY2D 1FPTL 4MJ6B 1DCEA 1INDH 4Q9CA 4LK4A 5D1QE 3STLA 2D3NA 4FFYA 3L2LA 1KJMA 2VLME 3O2DL 4DETA 3MACH 1SEBA 2CDEA 4UINL 4ZMQA 2F19H 4YDIL 5EF3A 2Z8RA 1P7BA 3CMGA 2X89A 5CGMA 3RFZC 2ARJA 4G8FB 2YD2A 3PWPE 4DP2X 2G2NA 3VM5A 3BUYB 3DSNB 3SCMD 2OMVB 3I9AA 4PRBB 5ACMA 2F9BT 1WHPA 4G6KH 3CBKB 2B39A 1MJUL 2VMCA 3DMMC 3BE1L 5E9DD 4P4KA 4TNWF 4KJYB 3GIZH 1XGQB 1ZXKA 2O5YH 4IS6A 4FQHB 4QI3A 2IBGA 2WNGA 1JG9A 1L7IH 5D4HA 3V4PA 5IEKB 1EXGA 5FO9A 3QFDB 4P9HH 1NGXB 4YK4C 4Q9RH 3T3ME 5TGBA 3TJHC 4LEOA 2C3XA 4KJPC 5EOCL 3TYFB 4M6NH 2V9QA 2ID5A 4Y2DC 2BVPB 5FGCB 4UOW0 1JZ4A 1CFVH 4N8VB 1M9SA 1L6ZA 5HVHC 3IXTB 4KXZH 5DJ0A 4ANUA 3JZ7A 1XGUA 1G9HA 5CZXD 3ZDXB 2W38A 3SBWA 1ZCRA 3KD4A 4X98A 3ZTDC 4J1UB 5IGXH 1ES0A 4IRSA 4E41A 1NCDH 1HI6B 3AXIA 3WO4B 4F7MA 3DYOA 2XN9A 4YOKA 1IARB 1UENA 3LKRA 2R1YB 1CFQA 1GAFL 2MHAB 3O2DA 4N9GA 2EXYC 4AW7A 4X7FC 1M6OB 3OKKA 3RUGA 1HHGB 1QKZL 3OF6D 4OZ4B 1RZGA 1NC2B 1D5MB 4HS6A 4MB5A 3S3CB 1TOXA 5GGUA 1IGMH 2BNRE 3BUIA 1MFBL 3L3OB 3BGFB 2HRGA 2HT2D 5C0CB 1NIDA 5F9WC 1T2QL 1OLZA 3PWUB 3DXAA 5HD8D 4A39A 4UV4H 1F4WH 2RBLA 4QRFA 4D9RD 1GXEA 2XQBL 4MMZA 4YHMH 1TEYA 2VMEA 5I6PA 5KSUA 1D6EB 1R9FA 2K6WA 1WA1X 3LNFA 3KWVA 1A1NB 1QFPA 1S6NA 1JL8A 3EG9B 2GHZA 5AVWB 2IV9A 1T5XA 1ZLUK 1K5NB 3QNFA 1KTBA 4NGHH 1R3JA 3FF8A 1OXYA 4I8DA 2LAAA 3O4LA 4D0CA 5B38A 2YAEA 4PJ7B 4HCGA 4MQSB 1SHXA 4Q74A 2FUTA 2R0WL 1MEXH 3K6OA 4NWTL 4PR5A 4AYFB 1AQKL 1ZT1A 2WTRB 5AOJA 2Q76A 1M57B 3O41A 4NKDB 4UAHA 3PHOA 4QD2E 4NT6B 5EZJA 3WY2A 1NGZB 2EDNA 2BVOB 3CIAA 4G42A 3AAZA 1V7NL 4L37A 1BJMA 4OZFB 1P2CA 1BQ5A 3GRWH 3MBEA 4FF9A 3HBQA 3BISA 1NLDH 2OJEB 5FA4A 2W88A 2IG2L 2I9LA 5JOFB 3C5JB 4WWKD 5JHDD 1A7OH 4BZ1L 3HRZC 2DBJA 1MCSA 2OZ4L 3MRRA 5I30L 1F4XL 1A4AA 3TFBA 1UJTA 3VXQA 4OCSH 3OG6B 4GUQA 2BNQA 2XKSA 3EBIA 4BFIA 3T1WA 2YD5A 2LQRA 2Z7UA 1JDDA 1JTPA 1ZHBA 3C9NB 4F7KA 4LMQE 2FWOB 1TKWB 2IWKA 4ILDA 1EFXA 1WGVA 1FIGH 1LQSR 1RPQA 1K4CA 2P3YA 3T1FA 1XXFC 5DDHB 1QEWA 5T1LA 5C0ND 2C1PA 1OAZL 4WWOA 5CINH 4ZZKA 4YLQT 3X1FA 1SBBA 3TN0B 2TSBA 5J57B 3IJYA 2GJ6B 4WO4A 4XWGL 4FZ8H 4TNGA 3I6KA 4KY1H 1G0XA 2A38A 2V5MA 3CC1A 5E5UB 5I19H 3AC0A 3ZE0B 4ELMF 2XC8A 3PXHA 2XT1B 1II4E 4MDIA 4P3WA 3UBFA 1MDAA 1ZV5A 5CZVL 3RU8H 3FSAA 4GRWF 1EHNA 5F1IA 4BZ1A 2OZ4A 2HX9A 3N40F 4DPRA 4KVCL 3FQYA 3BD5A 2BOCB 2JKIS 3SCMA 2R2BB 3B8YA 1I31A 5HGHB 2YMXH 2GTQA 4I13B 3ZYZA 5TE6L 1N59A 4CW1A 3Q8BA 4P2QB 1ACCA 5E9DA 4ZUUB 5J13C 4AEIH 5GGSY 2UWEF 4CVXB 2O5XH 4YWGH 3JTBA 4PJGE 4KY2A 3M7FB 4PLNC 3TP4A 4RCAA 2CGRH 3NRFA 1BFVL 4KRLB 4ZXBD 2NY5H 3IVKB 3V95A 4LSPH 5ANME 3T77A 4Q9QL 4PB0H 4NPJA 3N1GC 4NOFA 4PTTA 3AM8C 3QQNA 1HILB 1Q90A 4BK5C 5F1NA 3NIDF 1S7RA 2UZYB 1PG7X 5D1QC 4MLIA 1F0LA 1WWWX 2R0ZH 5I8CA 3CH1B 5BUAA 3K3QA 4JO2H 1N19A 1RIHH 2G75B 3TBCA 3QORD 2XA3A 4N8CL 1RHFA 1KT2B 2PCPA 3AABA 3OF6A 2ARWA 3G5ZA 1I3UA 4S1RL 3BAXA 2W1NA 4AIZA 5CLWA 1NCJA 4OVVA 1NKOA 3L1GA 1B3IA 1RK0B 2XBTA 4FNPA 4PHZA 4N8PA 3V7AE 3GI8L 4F7TB 2ZPKL 4HU8A 4YFLI 1U3HD 3G6DL 2YSSB 1J87A 1J7VR 2BIHA 1UQSB 3IDNA 3ZL4L 3CSYB 1CDYA 3NK4A 4IGBB 5FS5A 4CMHC 5I6MA 5DJ2B 5D6CA 1I85C 3T0AA 1CR9H 2AZAA 5LQBH 3S35L 3K2UH 3TA3B 3WTSA 4M1DL 1VPOL 3LQZB 4F57H 4FABL 4HLZG 3JWOC 3L1OH 1ORSA 2WBJB 3QJUB 4KZEL 2ICEB 3VI4F 1JMZA 4GKSA 2OULB 3C60A 4TLTA 2DQCH 4GI8A 3JYBA 5JIHA 2D73A 3U7AA 4BH7A 5I1JL 1YC7A 4J23A 3BQUB 5FW6A 5E5RB 2BIPA 4IBTA 4MCMA 4DUXA 1HXYB 2NLJB 2Z7WA 3CDYA 3EYUL 4U1MA 1XB8A 1DBKH 2XZQH 1EBAA 1HOCB 5TPWL 4QHMB 4WWKA 4YDLC 2VR8A 3VB8A 4R96B 4NZFA 4UT7L 3N43B 3LKSB 4L3CB 4B6ZA 1BZQK 1D5IH 2MJWA 2XBZA 4YC2B 5AAMC 3V0VB 4XCFL 1MIMH 3GB7A 2CIKA 5EN2B 3V4UH 4G6MH 1A6UL 5AB2A 4CUCA 2NNAB 1UTDA 1C7TA 3LMJL 2AV1B 3F8UB 4L8BB 4FQLH 4R2GB 4LLMB 1TZHA 3S2CA 4OLUH 4DN3H 3BMVA 5JMRA 5DJ8A 4ZAKB 3IDJB 4G5ZH 4PJAB 3ILQC 2PF6A 2Y23A 4BQCA 5KJ7E 3ZDYB 5C07D 1TU2A 1I7RB 5LKNA 3AGWA 3VRLE 1WH0A 4FX5A 3STLB 4FQ2H 1PQZA 3SGJA 4L8SA 5J6HA 1IIIA 2K78A 5DZ9A 1SEBB 2CDEB 4HIXH 1Y6MR 3WN5C 1YEGH 3VA6A 2MPAH 1KGYE 1TQUA 2BH0A 2EC8A 2ARJB 2WAQA 2X70A 4LCIL 3BRGC 2EIKB 2CUAA 4EUPA 1A6ZA 1TQBB 5IZ7A 2X3CA 1JGVH 1E7VA 4N25A 2IO5A 3K4ZA 3VYOA 2ITFA 3B37A 2ORBL 1IL1A 1PY4A 2JCCA 5ERWA 3V4PB 1CS6A 2GIYA 2ZNXA 4UM8A 2EIMB 3EZJB 2WN3A 4K9EH 4XO8A 1FC2D 5FO9B 1IC5H 5HI4D 3H9ZA 3UBHA 3B5TA 1CDIA 4ZXBA 4YHNA 2YAFA 4ZS6C 3WMQA 1ZA6B 4KHTL 5T5FL 3F00A 3KPQA 4AEHL 5A40E 5DJ0B 3SDCC 2BK8A 1XGUB 3OL2A 1DSFH 4Z7WF 2ED7A 4X98B 4LEBA 4TTDD 3T2NH 2WM0A 1ES0B 4IRSB 4E41B 1A6VH 4GFTB 3BPNB 4F7MB 1SXZA 2XN9B 3LRMA 3DUUA 1FE8H 4DVRL 2VDNH 3P9WB 3K2MC 12E8H 1CFQB 4N9GB 3PWVB 3QORA 4UCFA 1TENA 2Z9TA 3H6JA 2A9BA 2DMBA 4HS6B 3T0XA 5GGUB 2H2SD 1KIRA 4G6FB 4YIQA 5M95B 3PV6A 4ZODA 4Z3GA 1IGIH 2X1QA 1OCWL 4U0RC 1RUKH 5DVMA 2ATAA 4OZIA 1PZ3A 3AT0A 3DXAB 4YXLH 4IBLT 4XPAL 5AQ0A 5CM1A 4EZKA 4MMZB 4IOFD 2VXQL 5KSUB 2JLLA 3CWGA 1IX2A 3G5WA 1AR1B 1A6TA 3BRDA 3ECWA 4G7SB 3ZMRA 1V54B 1PEWA 1T5XB 3X14A 1X5YA 1UWXH 2W65A 4IK6A 1R3JB 2I5YL 1BOGA 1XB3A 3O4LB 2E27H 4QHUA 2AQTA 1J1XL 5T1DH 3KWTA 4DKTA 1A14H 3I50L 3LKPA 4ZG1A 1IGFH 2WXMA 3KCPA 2W91A 1SOKA 2QQNL 1ZT1B 4PR5B 4IBSA 5JA8B 2Q76B 3O41B 2AK1H 1G9EA 3PHOB 1J10A 1D7DA 2B2XL 1K8IA 1QSFD 3ERXA 4ES8A 5T33H 4KKPA 1WBYA 1UWFA 3B1TA 3AAZB 3Q1SH 4G42B 4L37B 2WPGA 2WOYA 3MBEB 4CJ1A 2Y1AA 4YLBA 2YAHA 1UUNA 3QA3A 4GIAA 1OAYH 1MCEA 3LPOA 3V0EA 2ZKMX 4JPVL 2JSFA 4N3UA 1SQMA 4P2YA 4EZJA 2V2TA 3MRRB 3HLAA 4YSCA 3DYPA 4BINA 2VDQH 4Z5RA 4ODHH 5H37H 4PFEA 2BNQB 1MHPL 4BFIB 5C0GA 4PRDA 2Y22A 3VXRD 2VXQA 1CLOH 1XIWD 1ZHBB 4RLDA 4KAQL 4UBDC 5KS9E 1IE5A 2B1AL