2KZKA

Solution structure of alpha-mannosidase binding domain of atg34
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
103
structure length
103
Chain Sequence
NDPLLHVEVSNEDNSLHFILYNKTNIIIPGNCTFEFSSQISEVFSIKMGPHEIGIKGQKELWFFPSLPTPLSNYTMKVVNQDGETILVGKCADSNEITLKSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Uncharacterized protein YOL083W
publication title Selective transport of alpha-mannosidase by autophagic pathways: structural basis for cargo recognition by Atg19 and Atg34.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 7
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2010-06-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2830 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2kzkA00
2KZKA 2KZBA
chains in the Genus database with same CATH superfamily
1NMAL 3EGXA 1HH6A 4LEOA 3ZKXB 5EBWB 3X1FA 4POZC 3VD0A 2H6OA 1IBGL 5JW3L 3UDWA 1B4LA 2H8PB 4QXGH 4ZRGA 2XZCL 4JB9L 3UC2A 5EZOL 3HRZC 2FGZA 1UT1A 3TT3H 5J3HC 2E9WA 3GHPA 4PJ7E 4R97C 4AGLA 2D2CC 3BPCB 1IE5A 3U1QA 3QUHA 1GHFL 3EOAB 4XVTH 4WY7H 5L2KD 2IWEA 3LNFA 1T22A 1SOSA 1WZLA 5BUAA 3VMNA 3Q6FB 1BQLH 1O6VA 4XWOD 3WOVA 1ZEAL 4GMTH 4XNXH 3L7FB 3A3YB 3O2VH 1AKPA 3BKYL 3FRPG 5IBLC 2B3IA 15C8H 2V2WB 3EO1B 4TF4A 1C5CL 3RL2A 3D3VE 1JOIA 5E9DA 3V0JA 4AQAB 3IGKA 2D73A 1X5HA 3RWJB 2MH4A 4OCMC 4PB0L 3CX5J 1N3NB 4K73A 2DBJA 5IG7B 1WYJA 1REIA 2CLVB 4M61B 3D39E 1QFUL 2EDFA 1DVXA 3II3A 2I69A 4QOKB 4ZW6A 4FHBD 5E2WH 1A8JH 4EUPH 1T21B 3QIWC 4QRRE 1UXWB 3PWLA 5DFWH 3QCUL 5A16B 4JDZA 4N0YL 4UIKL 2KQNA 4ODXA 3HZKA 1C08A 2VSDA 1R3IL 2ZYRA 1RJZB 3HVDA 3LKRB 4YVUA 3RVXD 3LXBA 1BQHG 2I5YL 1QG3A 3O6MH 3TZVD 2NCMA 5H2BB 2XFGB 4PJCE 3N3EA 1YYLH 5F6HJ 1UB6B 2R23B 2HYMA 4YSQA 4M7KH 3HS8A 4O2CA 4OCLC 4P5TB 3UFIA 2H5UA 3MODH 5CP7B 4XNYH 1MF2H 2EVFA 1B4JL 3BUQA 4BK8A 2JLPA 2AI0L 5D7EA 1OGAA 4YDJA 4A7VA 3O8XD 4YK4B 1A4AA 4QPEA 1CXEA 3VA6A 1D5IL 2UX6A 2MNWA 2WVUA 4FQ1L 5I6LA 5JHBA 4TVSa 5DQ9A 2JKWA 5LQBL 4AYFA 2IBBA 4FQXD 3VFOA 2B4CC 3I9AA 1MPAH 4B6ZA 3U36B 4B9GA 5IB5A 1ASOA 3IDIA 3CLFL 4AQ1B 4OFYD 4ELMF 2CSPA 2X4SA 4TQ8A 5FK9B 3UH8A 4X8XA 1WBXA 1X44A 4WFHD 4KQ4H 5E1QA 5EU6E 2ZX9A 1NUDA 3EG9A 1KXTB 4HT1L 4MCNA 3HLAB 4PJGE 3T3ME 2WO2B 5E6ZA 1I3RB 4KI5F 4HDIB 2O61B 4XB7A 5HYFA 3IKCA 3GHEH 3FFDB 4HFWB 4JPVH 4C4BA 2AABH 5D4JA 3DUUA 3W9EB 4GG8B 3LH9A 1FGNL 1LJMA 5A2IH 4P2QB 2BS8A 3KW7A 4AIOA 4XO3A 3BH4A 3VAEA 3IDNA 3VJ6A 1U0QA 4KJWD 5DQDL 4RRPA 3VFPA 5EFIB 5AVZB 4Y19B 3WUWA 4N20A 1LP9E 4ZMPA 3H9ZA 2GG1A 2EEDA 3MRIA 1SJHA 2ZYHA 5C08A 1S8DB 4RAHA 5EBLB 5F44A 3LKPB 3TPUA 4JCLA 2AF2A 2CHZA 5DA4A 1MFMA 3ARGB 2QMKA 5BOZG 4XB8A 1NFIB 3ZMNA 3V8OA 3VG9C 3I02A 3EFOA 2DQFA 5KSUB 2VMDA 1TTFA 4PY8I 1BCIA 3GTVA 3BAWA 3ARDB 2EDNA 4ZMWA 1OSPH 3H7BB 2IADA 2XX0A 1CL7H 4GXFA 3US9A 3EGSA 4QKXB 1P4LA 2VN4A 3NUKA 1W0WA 3GS4A 1OIOA 3IBEA 5TDPA 3QDJB 4Z8FL 2GHZA 1IBBA 3BAYA 3V4UL 1AIFA 3TNNA 3VB8A 4AE0A 3TBVB 3PGFH 3GLDA 3B2VL 1QLRB 3L3OB 4JY4A 4NQUA 1MFAH 3O11A 3UYPA 2HVKB 1LO5A 4KKPA 4NN7C 3NA9L 4AG4H 1YYML 4ERSH 4PPTA 2Z0BA 1YSOA 2ROXA 3QC5X 4PV8A 3TBTB 4P9ML 2GT9B 3HCVA 4N6RB 4WTQA 3HG1E 5LGYA 4AC4A 3QRFM 1RU9L 7FABL 2AV1A 4PTUB 2B15A 3V10A 1FFRA 4F2MB 4BE5A 4QT5A 1KN2L 2VUYA 4GKLA 5BJTA 3O45A 3NZ8B 3ZIYA 2J4WH 2HT3C 3CBKB 3CZKA 2NY2C 1J5OL 2NQ3A 3NIGB 3VWKA 3QIBC 3I85A 3LZLA 4LARL 3FTVA 1NBVH 3QEQD 5DHVA 2E8ZA 4F9LA 4FKHA 3O4LA 4I1NB 5I1CH 4FZEL 4W4OA 3FNKA 2XYBA 4ZMOA 5D4IA 2ZXQA 3OKMA 3OL2A 4NZRL 3H42H 3VXPA 5EU7C 3T8MA 4JRYD 1IFHL 3OMZA 2FO4A 3V52L 4A38A 1GS8A 2F53B 1P7KB 5DDHB 1P4BH 3OJ2C 2X4PA 4UILH 5D1QB 3KPRE 2QGEA 3LOWA 4I0PC 5AVTB 1YMMA 1OV8A 2HKAA 4Y89A 4Z7NB 5BXFB 2KS0A 5BS0D 3ROOA 4HCRA 3X13A 5GZOD 1BYPA 4P46D 1ZT7B 3HI1A 5DK2B 4DGYH 4YHYB 3BH9B 3LXCA 4PJAF 2VR5A 5INCA 3C5XA 5CP3H 4ETQA 2AJYH 5AALA 4RMTA 3P54A 3TM6A 2XY2A 4Q2ZA 1W2KT 3WYRA 4OBSA 3ZUNC 4YS4A 1FL5B 3U2JA 4MXQD 4AYBA 1MCNA 4MJ6A 4NM8H 2HKHL 3QB7C 3V5KB 1PLGH 3EDJA 4F58H 4HQQH 5EEWA 1G94A 2PLTA 1WA2X 4IBZA 1ZY9A 3RIAK 5ICUA 1T66D 4XNMB 1ZT4B 5KSVB 3MLTA 1PNCA 3VSTA 2BX5A 3ZUCA 4YPGB 3SOTA 3ZTJG 3SYOA 1I85A 4QCIA 4CN1A 5HDLA 5JPMB 3ERXA 1VEPA 5FCSH 1RUML 4N9OB 4PJDA 4UBDC 3PDDA 1A4CA 5IB4B 3ZR6A 4LLUB 3KMDA 5IBUB 4WJ5A 5L2JA 3HR5A 1UZ6F 4MMZC 1SF5A 1V3LA 4BWTA 5AAWA 1VIWA 1AH1A 2F74B 2HUEA 1B3JA 3S3CB 3V4VB 4HIHA 3B9EA 1ET7A 4QHMA 5E9DE 1X5JA 3IDMA 4PSPA 4QGTA 3F85A 3IRPX 4OSUH 2K1MA 3FQRB 3UBXB 4EN2A 1JPSL 3VQMA 2H2PD 3KLLA 1FZKA 4R7NB 1JPGA 5KWYC 2LLNA 1PKQA 5IREA 4R7LA 2X5PA 2Y7MA 1MFCH 1XSKA 5KS9F 4Z95L 4XX1G 1A3RH 3TS8A 1XH2A 5C0GA 1Y1DA 5ITFA 1LO0L 4I3SL 2YD8A 3GJEA 2LU4A 4IKKA 2WP3O 1B0IA 3LHPL 4QXTB 3FHAA 5IOPA 3DTXA 1E9OA 1QABA 2Z3FA 4IKIA 4PGBB 4NZTH 3P77B 3B8YA 4KTDL 4IOSA 4FLOA 1UWGH 5F96L 3SBWC 4KHTH 4Z7UA 2H32H 2NR6C 2BVEA 2ADIA 2CA3A 2DQIH 1OGAE 2WP3T 3C5JB 3FF8A 3LXUX 3IGLA 4WEBL 3HEIB 1CBVL 1SXNA 4L4JA 4UIMB 4Z5RA 2XV2A 3FF7A 1BX2A 4MCZA 5AW6B 1KTRL 2O5XH 5ICXB 5KANG 4XPAL 4FLHA 5HGDB 1PLCA 3FFCE 4IHOB 4OLZL 5IR1B 1LE9A 2P48B 1OM9A 5DRXA 3BZ5A 4UU9A 5DLMH 1NKGA 4HLZH 4HUUA 1DZ0A 4X4KA 3OKNB 3V95A 4MA7L 5CJQL 3IJ7A 1CGTA 1E2WA 2DWEB 3KBEA 2P5WB 5IMMA 3OC8A 1TXKA 2WYHA 3U4BL 3N40F 5BV7B 3N0PB 3H4HA 1QSEB 2WBJA 4BCZA 1BXXA 3Q05A 1WZMA 4QRSA 4P2OC 4FKEA 3MUHL 1BGXL 1HU8A 3QCTH 2VLRA 4GXVH 2AC0A 2A77L 4H25B 1ZLUK 4LB8A 2IH1B 2PPFA 2TAAA 4H5SA 1KGWA 3BKJL 4NFCA 3VXNB 3TGXA 3V5DA 5KVMC 1TU2A 1W0YT 1TQCC 3FMGL 2YIHA 1IKFH 1PW3A 4U1MB 2F08A 1MFVA 4IDJH 5CS7A 1P84J 4IW4C 2PYFB 2FO8A 2LGNA 3D34A 3QUKB 2A4CA 3RWDA 4OD1L 4S2SB 3WJMA 3L6FB 1OVZA 3PDOB 3QYCA 2X4QA 3RWEB 5CEYA 2AQNA 4KC3B 1NFDB 5CHNA 4O02A 1T5XB 4FL4C 2NY0C 3BPOB 1CB4A 3CFQA 5C08E 1A9EB 2Y06H 4PLNC 2CK0H 2BOBB 5FM4A 4YDZA 1P5VB 3REVB 4QDGA 2HRHA 3CLWA 4HJTA 1HEZB 4M9OA 4LOUD 3B9KC 4PJ9B 4EZLA 3TJHC 3P9MA 2EDXA 3ZRCC 2F19L 4K55A 1Y6KR 3S3BB 3ZL4H 4MNQA 5ALBL 4JANA 4DFIA 4BSWB 1JV5A 5J6HA 1OAUH 1FH5L 4Y2LA 3CZGA 2Q3ZA 1DBMH 1MFBH 4B9PA 1XCQB 3QCVH 2HG5A 1O9WA 1H3TA 3EFFA 4WI4A 4XTRC 3W82A 3WJLC 3STLB 1GYVA 2KT6A 3BE1L 3EKCA 1N4XL 3EOTH 4WO4C 4X7EC 3MRGB 3TWCL 1D9KD 2DPKA 5CLZA 3VFRA 3QO1A 3OX8B 5I8EA 2W38A 4DKFL 4WWKA 1NZRA 1LEGB 1ZA3B 2MJWA 4GY4A 2BFVH 1FL3A 4N8VB 3HE7B 4NNYB 1LD9A 1WGVA 2DM4A 5EBMB 3DOSA 1OGSA 2KLTA 3FO2A 3OLIA 1SHWA 3QNXA 3JZ7A 1EHKB 1PD0A 1DUZB 5TQ0L 3RDJA 1UWXH 1YEKH 3QS2A 3LEVL 4D9LL 4B27A 3G6DL 3TBWA 1LK3H 1G5GA 4FQLH 3FTGB 4L8CB 4IS6A 5SV3A 4HH9B 2EDJA 4F9PA 3LV3B 1XGTB 3HRZA 3DJZA 2F54D 3O4LE 4HPOH 2HTKD 3AU0A 1KIRB 4X6DF 1F56A 4QRQA 3CBRA 2Y3AA 3A4DA 5GS0C 1A7PL 5DZAA 3EGDB 4N0FB 3H9HA 4IMLA 2BVTA 2YZ8A 3NH7H 3VD3A 4BKLB 2FNBA 1HXYA 2ZP8A 5FO9A 3HUJF 3Q1EA 4ZUTB 5IW6A 3FBQA 4LCWE 1MRDH 1WAPA 1YMME 1U8NB 1JK9B 3FN3A 1KLFA 1WC7A 1JK8B 2BY1A 3GMOB 4A7GF 2AANA 1X5XA 4YUEH 1NL0H 3CV5A 4JKMA 2EVHA 4F7CB 3WY2A 2ATPB 4I9WD 4A7QA 6TAAA 4CADA 1EHLL 3FULA 4MDRA 5B7FA 1WLHA 3L2MA 2VABB 4B3EA 2V5RA 4WGKA 3KGUA 3QIWA 2AKRA 2I24N 1KULA 2EAEA 1J5IA 1S3RA 1CLVA 3IJEA 4XCNB 5F9JB 3WLWD 3ILEA 3MUUA 4XP1H 4RFEA 4HOWA 3OSKA 3L9RA 3MNMA 5AKVA 5FLUA 1ORSB 4NZ8A 2L04A 2PWGA 3NMEA 4M43L 1FG2B 1R5WB 4JMXA 4X8CA 3BKMH 5DHYB 4KMTL 2Z92B 1MELA 4NUMA 1GL4B 3SQBB 5JR1L 5D9SA 1I9IL 3K8KA 2XN2A 4IGBD 1IC7L 2IFGA 4OZIF 4PJDE 4K3GA 2DQUH 3PFQA 3WNMA 3G5VB 5JNYA 3NSJA 3ZMEA 3MRHA 3BAJA 2O5ZL 3D0AA 1J9SA 2Z91A 2WUCH 3LPGA 4LRIC 3W37A 4M00A 5CJ8A 5JO5B 3TZVB 5BUPA 2VL5A 3IAPA 1G9ML 4L4VB 3T8XA 2X89A 5HTSA 2Q8BH 4HAFA 4HSQA 4PI0A 5DVNA 2YMXL 3T65A 2IPKA 3T0EB 1CDGA 1LDSA 4H1LA 4Y8DC 2X7LB 1ADWA 2RCSH 4QJ5B 2XTLA 2Y7NA 2MTPA 4KTYA 4G7VH 4PCYA 5HI3D 2JIXD 2O93L 1SN0A 4K2UH 3TA3A 3O8XB 2MCPL 4HZ1A 1I8AA 1T2XA 1HHIB 1ZHLB 2ZKXA 4XMPL 1QUPA 3EOYG 1U8HA 1IAKA 4GRLA 1PKQE 1RCYA 2GSIB 1PZUB 5FUOH 3CDZB 2FQGA 2GBAA 4M5ZL 4FQXB 4PRIA 1CFSA 2NUTA 2OMZA 5JW4N 1MN4A 2GK0A 2NY4D 2H2SD 2QQKH 4A6YA 2J6EA 1E9PB 4N4YB 3AITA 3U4EA 3ALWA 1NPJA 1U6AL 1TJHL 5E94A 2Q5BA 1CXFA 3FOMB 3QHZH 3Q8AA 2MCAA 4KKRA 4LVOB 1VEOA 1MW2A 2ENSA 3S3JA 1SY6L 3V9CA 3ZE0E 3DC0A 4IRJA 4QTIL 3NIFF 4YO0B 1GZHC 5E8DL 4KO7A 2BRRL 5DJCA 1HH6B 1XX9C 1N10A 4LEOB 1FPTL 4MMXA 1KYAA 3ASWA 3QPQD 4JFED 1EZLA 2R29H 5HHMB 5B4MD 1JGLH 1J05A 3KW8A 3ZHKA 4B7LA 1AHMA 4L3AA 3B5GA 5TK2A 1XH1A 2ZAHA 1A7NL 1B4TA 1YCSA 2D0GA 2Z93A 4LEEA 4BHUA 2OR7A 1KCSL 5D7SL 2JCWA 5B8CC 3CQFA 1NTDA 2QDVA 2N59A 2HWZL 3MO1B 1IL1B 1H5BA 3MBEA 3P3TA 4H8QA 1EJ8A 3GSOA 5MEOA 1RSFA 1KXHA 2IFFH 3L3HA 3CX2A 3HMWH 4KUCF 1SVCP 1NAMB 3VB9A 1MJ8H 5B3JF 5J13B 2WXKA 3QORD 4MZIA 3P4LA 4ANWA 4X9BA 4ANXA 5E6IC 5H37H 2VLRE 1JDCA 1MCBA 3O3BB 3OHXA 4RZKA 4JM4H 4A2MA 1AMYA 2BXYA 3VGEA 4UM9B 1QNZL 2CBMA 1XGZA 4MKMA 3N42B 3QI9D 3R7RA 3UP1A 1T1YA 3UAEA 5L88L 4HLJA 5JOFA 2HRGA 2W60A 1ONQA 4IKLA 1ZHNA 1ZANL 4JR9L 3H9SA 3ES6A 2ZQKA 1URZA 3PWLB 3HHSA 2ICWB 2GITB 2DYSB 3NJHA 3MRBA 4FP8L 8FABB 5JIIA 4Y7OC 3CVBA 5HVGB 4W4NA 4BK4A 4Q9RH 3GSWA 3O9WC 1IEHA 4MJIB 4DP4X 2OCFD 4O9HH 4O4YL 2HLAA 3T6WA 1IBDA 2GYSA 2VCOA 3CC1A 4MA1B 4MNQE 2E4FA 4KDTC 4HJSA 4KZCA 1Q9KA 5GSVA 2BZDA 4XB3A 2MIZA 3BGFC 3V6OA 1V5JA 4KKZA 1FYTA 3CJJA 4Q0XH 1CGWA 3QEQB 5DQ9B 1YC7A 1DVQA 4KJYB 3FQUA 1CDCA 2BRQA 4K71B 1P7QD 1IQWL 1GCYA 25C8L 2PO6A 3AY2A 1N6QH 3P40A 4LL9A 3GMPB 4HBCL 3VXRA 3VRIA 1GZQA 3KCPB 4QY8A 5IB5B 4JRYB 3EJYC 4ZUUA 2CDEA 3GK8H 1JZ5A 2OJZH 1R17A 2E9BA 2X4SB 4XNZC 2NLJA 4XC3H 4XR8C 1EV2E 2BCKA 2AV7A 1OAJA 3RLSA 3SSGA 1HYSC 5IF0A 5BS0B 3PAUA 2IF7A 4DQOH 2BZCA 3K6SA 5LAXA 4PJEA 4AJ0A 5KVDH 3LNIA 1HWHB 2QPFA 4P46B 4TN9A 4NDMA 4JM0A 1O75A 4PRPE 2VZ1A 1U4EA 2BOCB 3FQNA 4MJJA 1UXSA 1QFWM 2JNZA 1NPUA 1P5UA 1VJSA 3IDNB 4H26B 2CXGA 3II2A 4HALA 4YZWA 4Y8AA 2YD4A 2CBPA 2R4RL 1IU1A 2NY5L 3U2SA 4XHJD 2JFCA 4FMKA 5DJYA 1XSJA 3UZEA 4UT6H 4KX8A 2V7NB 4MMZA 3TPUB 5E5MB 1UM4L 2Z31C 1F4HA 1PFOA 5HI4C 4HCFA 1HCVA 1AO7D 4L8DA 3UERA 1X9UA 1WISA 3MLZH 1J86A 3R7QA 2G9HB 1D6EA 3EFOB 4OGXL 3B2UC 1L9NA 1I1AD 4WSKA 1N2RA 1ZA6A 3OKOA 4PMEA 3GB7B 5TD4A 2D7PA 1IILE 2EDTA 1MJ7H 4S1SL 3X1NA 4Y5YB 3SYQA 4D0CB 3ARUA 3OZKA 1XH0A 1NCJA 1BFTA 1NCDL 5BPPA 3B6SA 4ODUB 1M71B 3VXTB 1PIGA 2XG5B 3JXAA 4NAQA 5AVVB 3K71B 1NWOA 3WGUB 1J1OH 3C6SB 3BYTA 4YZFE 3W56A 1YY9D 4PJBF 1F4WH 1J1XL 3AUWB 1U91A 1RUKL 4IKNA 4M7ZB 3O11B 1FJ1B 2CLZB 2CNZA 2NY6D 2VXQH 5HVWA 3EXJA 3ZL1A 5CJ5A 2HFFA 1F4XL 3KBPA 1GY2A 1R5VA 5AL8A 1JDDA 4PV8B 3HCVB 2FJHB 3T1WA 4KK5C 1D5XB 3R1GL 2ZUTA 2YUXA 2IPUG 4NO0D 4CMMB 4MA3B 4QT5B 3UTSE 3EYFB 1XDTT 2ZOOA 5MEPB 3TJEL 3QA3A 4I77L 2UWEB 3FOLA 3FUFA 3WXWL 4FJZA 3TBCA 2WSKA 2HN7B 4E2OA 4DP9X 3C8KA 3J07A 1AP2B 4LSUL 1B2YA 2MFNA 5EIQA 5KJRH 4ONFL 1Z5LA 4PU2A 1Q9LA 3RVVC 5DD0H 4JG1H 2PXYC 5J6SA 3VXPB 2CBOA 1FG9C 4M6MH 1KCWA 4OLXH 3U9UA 2FO4B 3NCJL 4XBGB 2VH5L 3DPDA 5T1MA 2VDPH 2YWZA 3RDTA 4PY8J 1EX0A 3F64A 1MFEL 4YHKH 3RB5A 3IMWA 4LSVL 4PV9B 4CSTA 4DOHB 4HZLA 3FN0L 4PRIE 3ABMB 4DTGL 4A6YL 2J6EL 3C09B 3LNDA 1DJZA 1R4XA 1OAYL 1LE5B 3X13B 1HAUA 3UGEA 1UD5A 2NXZB 1FNGB 3EBAA 2B20A 2ZWSA 3JWDL 5DJ8A 1JFQL 3GSNL 5INCB 1IGTA 2C26A 3QFDB 3UZVA 5L6YL 4GG6A 4PJHF 2ZXEB 3EAKA 3MRPA 4GKSA 1GSMA 3M8OH 3SDCD 2VDKL 4BFIB 4KXCA 4S1DD 1E3FA 4Q56A 4Y1TA 1N8OE 3LQAH 3P0GB 4UANA 3RYMA 1NAKH 1DVFD 1ZWIB 2MHAA 2ZZUT 3EHBC 4NUPA 2QR0A 5A3IC 4YFLI 2EO9A 5GS2H 3QJUB 2M8XA 5F3BB 3P3RA 3BP7B 2KLRA 4N3UA 1T03H 5I76A 3RHWF 4NKIH 4AEEA 5FV1L 1GYAA 4NQDA 3K80A 2KZKA 4LPCA 1TJIH 4QCIB 2MEJB 2XTJC 1CLYH 1P1ZB 1WPCA 4Z6AT 3B7SA 5E4AA 3WS3B 3V6FA 1CBJA 1T04A 2IWFA 3RPIA 3HAEA 3VACA 3GZPA 1WAAA 4LIQH 2XWCA 3DV6A 3JWOC 4PVNA 3A21A 2DN7A 5BOJA 1J5DA 1KWGA 5L4FA 3UZQB 5DZNA 3PAZA 4RMQA 4YSSA 1FP5A 1ORQB 1NBCA 2ZICA 4M5YH 5CP3A 5CZXD 1JTOA 4QHMB 1J8HE 2KQMA 5DRNA 1JSYA 3SDDC 3KH3A 5C0JA 3VFMA 3GINA 5EULV 4GW1A 1CD1B 1DJSA 1DCLA 1HHJA 2J8UF 1S9WB 4TNEA 4AW4A 1FZKB 5GS1A 4OLWL 3FQTB 3H9SE 1XGPB 4B9FA 4BCYA 4JY5H 2RD0A 4NP9A 4B5EA 1S3KH 4R7XA 4U1GB 5I16A 3KYMA 4XVTL 5E9AA 3QIUA 5ITFB 4A1RA 4P5MB 5FHAH 3E38A 1HEHC 4TLSA 5CXPA 5DVLA 1N18A 5TPWH 3GJEB 3GXPA 3GC3A 1C1EH 4AUUA 2P5PA 1O7DC 4WQOA 3AT9A 2JKSA 4GMTL 5T8IA 4NYLA 1UZGA 4G6FD 4XNXL 5IOPB 5CSGA 1E9OB 1Y0LB 3O2VL 15C8L 5IQ7H 5T33H 3FQWB 4FGMA 3EF4A 1EFQA 4Z7UB 2WD0A 4GSQA 1DJXA 2VW6A 3IDYB 1I8MA 2ADIB 3DDGA 3V6OE 1FYTE 1BIHA 4FQ2H 1TCRA 5LBSA 3WTWA 4OFIA 5EC2A 2V7HB 3ZDZB 4JZOA 2QL1A 1BX2B 3NESA 4HD5A 1XWVA 1NC2A 5E2WL 5EF0A 5D7KD 2XBDA 4BUQA 2ZYSA 2EEXA 2WY3B 1ZJAA 1Q1PA 4DZ8B 1U95B 3VXRE 1YPZB 4YHIA 4KNSA 4ONHA 3BHBA 4XXCA 3NZSA 3RFZB 2ADGA 4YL9A 4KV5F 1QTYT 3GBDA 3O6ML 3SKMA 1JGDB 2WZAA 3TVMA 3ULVH 1AS8A 2IGFH 4GKNA 1CGUA 1CO1A 4UAHA 1MXGA 1PD1A 4HJGA 3W11C 1BF2A 1DTUA 5SWZA 5D71H 5HBBA 1H3VA 3JWNG 3PU7A 5DVMA 5C6PB 4XNYL 1MF2L 4H5SB 1MCEA 4FNPA 1DBKH 1E0OB 1JRHI 1MHCA 2R0ZH 3GSUB 2VLJD 1QFHA 5KN5A 5I15H 12E8H 4K3DL 3SIKA 3RG1C 2QJDA 3WJMB 1MPAL 2VZ3A 3ZL2A 3HI5L 4NO5B 2XJLA 2XETA 2V0AA 3RA7H 1S9VB 4LDCA 1U8MB 3S3PA 2DIEA 2ZCLH 1ZLWH 1M2VA 4XO8A 4WIQA 1BF5A 2RMNA 5E8NA 5F7LB 2XQYK 4ZYKA 5FOBB 1H3PL 1JZDC 2J2ZA 2WGNB 4KQ4L 5CD5C 5KUKA 2H9GA 1BZ8A 1TQUA 2CO4A 3KPMB 4RQQA 4ESKA 2B59A 4EDXB 3CFNA 3F6LA 1D2PA 5D1XC 1BJ1H 2Z6FA 4MAYC 4IGBB 4Q6YA 3GHEL 4JPVL 4KFMA 5E1GA 3U7YL 3MLYL 1E3ZA 1TNNA 1A47A 1BMZA 2AMUA 4ZI8A 4QR7A 3E1F1 1EUUA 4NQVB 4AK1A 5LXGH 3ECUA 4IU3B 3HS0B 4PLKC 4HPHA 4JQXA 4LCIH 4HG4J 1LL1A 1XF2A 4NKOB 1JL8A 2HZHA 4NWUH 1H8LA 1J5HA 3QUYC 5EUKB 2JIXB 2OZ4A 3S4SA 2XVBA 2FEEL 3LHAA 3MUJA 4IJ3B 1OB1A 4FXTA 1B0RB 5CGBA 1EEYA 4IM8A 3GMNA 2MQCA 5KEZA 4JVPA 2XN9D 3DJ9A 2JB5L 3WS6C 3LIUA 1XVSA 3M1OA 4WTZG 2A9BA 4YDVA 4DH2A 3ASOB 3V5HA 1GZHA 5KSBA 2E9JA 4RSYA 4ZUVA 1OSPL 2NY4B 5ANMA 3SODB 3TV3L 1OWRM 1CL7L 3P3UA 4G8GD 3IBOA 4Y4KB 2VM3A 1FNEA 4RGMC 1G5AA 4GT0A 3IFNL 2BIHA 1WS7A 4XX1E 3QAZC 2OULB 2WQRA 2VDMH 4PRNB 3PGFL 3DJTA 2CUHA 4LHJB 5EU3A 1MFAL 4B9JA 1UURA 4HGWA 2W9LA 3C6EA 3MGOA 1O6SB 3TYFA 2V37A 2Z9TA 4YXLH 1JV2A 4GQZA 1AVAA 4MQXD 1O5PA 1WFJA 2F8OA 4NKDA 2WGXA 4I5BA 2PPCA 3ULAB 4AG4L 4ERSL 3JZYA 1U92B 5IW6B 1GRWA 1MZZA 1HHKB 3QT2A 4N90E 5IMOB 1KLFB 4TLTA 5DWPA 1I53A 4FEMA 5HJ3B 2WN2A 2D0HA 5E6IA 1HILA 5DXWA 2G4EA 5EG6C 3RIFK 4U4IA 4LKXA 3GIZH 1SXBA 2EYSA 2ROYA 1U3JA 3WIIL 3LEXA 4X8GA 2J4WL 2BVPB 3UBXI 3ARSA 1SLXA 3MI6A 3ZSTA 3EYOB 4YFLF 4GG6E 1E6JH 2FT8A 1S7QB 1NBVL 1UH4A 2O5YH 3OJMB 1KN4H 4AQ8A 4IK6A 5I1CL 5DK0B 3TO2B 1KJVB 4Z7AA 3P4MA 1L5GB 3QORB 5LBVA 3D3VD 1ZOXA 2ADFL 1GH7A 1LDPL 1M7DA 3OLEA 3H42L 2J44A 3GS0A 1XR8A 2BMKA 4F8TA 4JCWA 2FBJH 2B4CH 2WLMA 1CWVA 3QI9B 4OD3H 5AQ0A 1P4BL 3SPHA 4UILL 3OAYK 5I74B 4PGEA 1L9QA 3QUMB 4TNVF 4NQDE 2FVNA 4QRRD 1PG7H 4Z7OB 3EXLA 5AOMA 2XV0A 5BQDA 1WD9A 1X7QA 2EE0A 5DI8B 2G2NA 4KDTA 2UZPA 1N5AA 3IJYA 1M3JA 3GXMA 1AGDA 1FVDB 1SVBA 3LRMA 2WWMC 4HV8B 4ILDA 5E6YA 5IHZB 1NDGB 5DS8B 1YUKB 4DGYL 5HYSG 3O6FA 2P80A 3F7PC 5J11C 1ANUA 2C9PA 2AJYL 2VL5B 2EDKA 3PNWB 2BIPA 2FZ3A 2WXRA 1T0PB 1A6VH 3EO9H 3MFGB 5CEXB 4NM8L 1A6TB 1JGIA 1UD4A 1PLGL 2F8XC 4F58L 5J06A 5J4MA 3V0IA 4HQQL 1I3VA 1RV6X 4YIQB 3VGAC 3L4WA 1JXDA 4HWEL 5J1TC 1I7ZB 4J6RL 3RZCA 3MCKA 4QF1A 2J8OA 3VUAA 5KW9H 3GXIA 4GQQA 2XXCB 3QZLA 3G5ZB 3MFFA 1PZBA 2FJGB 2D7QA 5E2JA 2CPUA 4R90H 2EZ0C 5FECB 2OMZB 3S36X 4RGNC 3IFLH 1IGMH 3WDHA 1U3ZA 4NS0A 2JXMB 1IE4A 3EJJX 3GMQA 5KYUA 1RZ7L 3U4EB 3CHQA 1SYSA 4C8XA 4M7JL 2NW3A 5E2TH 4DEPB 4WI7A 2FGWH 3GSNB 3ESPA 2ZX7A 3V7MA 4FQPA 1BYNA 2FJFB 2CUIA 4Z0BH 3CZUB 2B77A 2DWDB 3BPLB 4F7TA 1AGEA 1SJMA 3ZJAA 2HX7A 5FPIA 2VDKB 4FEIA 3LKQB 5DMGC 3SBRA 2HMID 3L45A 2Z31A 1JWUB 4JFVA 4KKCC 5CNHA 1Y18A 2LTQB 2TRYA 1DBBL 1Z0MA 4WENB 3UTTD 2V2TA 1CMOA 4NNXB 3CC5A 2GSGA 1MFCL 1QATA 3M17B 3EUDA 1JMZA 2WOBA 4MVBC 4PJ5A 4KZEL 4OZHA 4QO1B 5JHAA 4XN4A 1G7JA 4RGOH 4HKJA 4X5PA 3RQ3A 2HT4D 4B96A 3DHPA 1AO7B 4NRYB 5DD6A 3P0VH 2EXYD 2WXFA 4BUHA 5JW5B 2VQTA 5J1AA 5BVPH 4PRBB 1CT8A 4NZTL 1NIFA 3OHXB 2BHZA 2CIIB 4MXVF 5SWZE 1UWGL 4G1EA 2EC8A 1NICA 4KHTL 3BVWA 1B2WH 3TONA 2YD3A 3FJTA 2XT1B 1HTYA 4NHCL 4KPHL 3TNMA 2XUWA 2P28B 1NCCH 2MQ0A 3NIGF 4P3DA 3WKPA 4DW2H 1YA5A 3EJCA 5FA3B 4XZUB 3NP3A 4OGAC 5D6CA 2ITDB 4G1MA 2GBUA 1ONQB 1HHHA 2AXJA 2R29A 1OD9A 3ES6B 4RNRB 5EN2B 5CN1A 3UPAA 2OAAA 1PLAA 3DVNA 3G9AB 4K3EL 3ZN6A 1FV1B 3CVHH 2HJFA 4PWIA 1QEWA 2NY6B 1G7QB 2WKOA 3K5SA 1JPTH 3O6KH 5CBEA 1OALA 3IWVA 1KCRL 3DBXA 3LVTA 5C7XH 3O3AA 2AVFA 2ENPA 3HG1D 3C2AH 2JI2A 4JDVB 2GCYB 4Z7NF 3NGBC 2HLAB 5TH2A 3GIVA 5TFSH 3QCTL 4GXVL 3QQ9D 3P0YH 3FSOA 4GAGH 5F7HA 3B34A 2JMRA 4AE1A 2Y0SA 1PZ2A 1PG7W 1CF8H 2FLBT 1IKFL 5D6DA 3CPUA 2G5BA 1T7XA 3EIFA 5ID0B 3ZYJA 3DETC 5C09D 4IDJL 1MHHB 3KXFB 3I84A 2OZ4L 2PO6B 1CR9H 2X0UA 4JO4H 1MWAA 2VC2H 2WBWB 4HKBA 4YOKA 4EUPB 2C1PA 2R83A 5K9OA 4ZUUB 2CDEB 4J28A 2Y06L 3L7EB 2H47C 2BNQA 2CK0L 2K8MA 5EBGA 2VDQH 5GJTH 4PTTA 2KHAA 3FQ1A 3ARZA 4U1HA 1R3KA 4V1DA 3QO0B 3PWPE 3M6DA 4ZMXA 1W72H 2B1HH 3QQ4A 1A1OA 4PJEB 1LLAA 5F9WB 4JHZA 1IM9A 5KSBE 4HSAC 4ABVA 1R3HA 3BOVA 1W9XA 4FNLH 5ANME 5KBLA 1HESA 3JV4A 4NPJA 3QYNA 5ISZA 2J20A 5GGVY 1GY1A 2P26A 3VFWA 3WNLA 3QCVL 5C0EA 3CN4A 1Z9SB 1R24B 4K4KA 3SDCB 1KJ2H 3VXSA 1KIPA 1NGYA 2YA1A 3EOTL 1HXMB 3QXDB 4D7BA 4IQHA 1GZPA 1TQWA 5LWYL 1ZVNA 3D25A 3BPNC 4AW7A 1G84A 5HI5D 4L23A 1TMCB 1ZTMA 3MNDA 3B56A 1DVFB 1HT6A 5BRPA 4GS7B 5DJYB 3IXAA 1XMEB 3K1DA 2BFVL 4ODWB 5JZ7C 3VW3H 5DWUH 1ZIAA 4M1DH 4K7PY 3E6FA 3B43A 2FX9H 1JZIA 1LO2H 2FBOJ 3SGKA 2AJSH 1IBZA 4Z77B 4PRDB 1YEKL 4JRXA 1RIVH 2Z0UA 5FYKE 4DN4H 4B41A 4XMXA 5SWSA 3TH2T 1LK3L 1X5LA 4FQLL 4MCYA 1V54B 3KE0A 3B6SB 1NDMB 1QFPA 4AXWA 1DQLH 4HPOL 2H4EA 3DROA 1MKFA 4P4KC 4WKZB 4JG5A 4LGSB 3ZZLA 1QUNB 5EU5B 1SZNA 1U91B 4DO6A 1JZJA 5ESVA 1IIIA 2ZKMX 3NH7L 1KGIA 3BVXA 3RUGB 1HEJC 2AP2A 1S9XB 1U2YA 4DVBB 1R3JA 2X2UA 3UYOD 1JG9A 1MRDL 1BYOA 4J4PA 4UT6A 4UOJA 4BQ8A 1XV8A 3ZZ1A 4YUEL 1NL0L 5L4IA 5JIMA 1VCAA 3WN5A 5AENA 5BZDA 1UCTA 1J18A 3GLAA 3QA3B 4P59L 1J48A 1TYEB 3HC0B 4PM1A 2Y1YA 3DV4B 5D2LB 1A4KA 4G6FB 2A6IA 4N2KA 3FU6A 1E8ZA 3KDMA 3GUFA 4X98A 3ISWA 5I1DB 3RNKA 3G5YA 2R1WA 4XP1L 3ZQXA 3C6LC 4M1GL 1CFMA 4Y1AA 1YHPA 1ZDQA 2E6QA 1DUYA 3CIQA 1KPRB 3PLYA 4JPWH 3BKML 2J55A 4CKQA 4AIZB 5I75C 4WHYG 2HFTA 3FFCD 4LFHG 4XPHL 3F62A 5FYJE 2XFXA 4UZGA 2BDNH 3MNWA 4BH7B 5T1KD 5J57B 2DQUL 1Z5HA 3CNKA 1NFDF 3BDXA 2D9CA 3EDKA 5HVHB 3KNBA 5JPNA 2WUCL 4GG6B 2H1PH 1TDQA 1UKSA 1UOVA 3MA7B 4PJCF 4L8BA 4DCQB 3VGGA 1DVUA 2Q8BL 1I1YB 1MVFA 4UZSA 2H3XC 2ICWI 1G1YA 1JMXA 2AXFB 5CEZH 2RCSL 3MV8A 3QDMA 4JRWA 4G7VL 3I6GA 1DQQA 1NIAA 2Z35B 2QR0B 3HZVB 4K2UL 5TQ2H 1C16B 3BUYB 5IJKC 1DL7H 2V5YA 5DFAA 3T8VA 1NANI 1CDIA 2VLJB 4XXDA 2YPLD 4HJ0D 5FUOL 4HYTB 2OMWB 3NFPA 1J1PH 2WO3B 2NY1D 1BSIA 2VKXA 2BNUB 4J3OD 1MNUH 4MAYA 5H35B 3ZE2B 4G82A 1DHKA 4PJ5E 4ZX5A 4OZHE 5HPOA 2SEBB 4D8PA 1F00I 2QQKL 4PW9A 4Y9CA 5IY5B 3IKKA 3DV6B 1D5MA 2WQAA 2IAMD 2ZWLT 3L13A 3CSPA 1KPUA 5E03A 3QHZL 2HRPH 1GAFH 4HUKB 2IOOA 3WG7B 1NCAH 1ZT1B 3UACA 4I3RH 4PUBH 2QEJA 1N64H 2VZSA 3VMPA 1HHJB 2R29L 5T3XH 2YMOA 3RY6C 1JGLL 5GS1B 1CXLA 2VR9A 4PN6A 2A7BA 4Z7WB 4G6AC 3HN8A 1CFNA 1NINA 2VISB 2JI1A 3MNVA 4C58B 2ZJSH 1OPGH 4B97A 4E5XA 1E2ZA 2EE3A 1CK0H 4FLSA 2XOTA 2ZWYA 4WV1C 3HPJA 1GGUA 2Q8AH 3IRCA 2VW7A 4GSDL 3L2LA 3L3DB 1HZLA 1XCWA 3LSOA 4Z7QB 1M3IA 3P1VA 3N1GC 1H8NA 2V5MA 1X9QA 1BVKA 5ICZB 2I32A 2IFFL 1GGCH 5F7MC 3HMWL 1DLHA 2XN9B 2YOAA 1MJ8L 2BSBA 1JI1A 2HJKB 4P5RA 1L0XA 2DLFH 1YEDA 4TNFA 3KPOA 2R7EA 3CAFA 1KEGH 2DDQL 2EACA 3TBSA 1CE1H 5MERB 1TZGL 2FQFA 4G80B 5DO8A 4G8GB 3IJSB 4UQ2A 1TCRB 1MWAL 4W9FC 3D85D 4L9LC 4WTZA 3P02A 3J8F7 4Q6KA 3U7AA 5INDA 1XBRA 2P3YA 3PYCA 4HIPA 3ARVA 4PG2C 1NOFA 2YXMA 3MR9B 3QFJA 4MD0B 4ZO8A 5CLTA 4EVNB 4HUWB 2VJ0A 3PUUA 1MCRA 4IHBA 2BNQE 3MV11 2OL3H 4FG6C 4Q9RL 4LCWD 4MNGB 2O6DA 4M7LT 4R26H 4TL4A 2EE6A 4PH8A 3RKPA 5IUSA 4O9HL 4V1DE 1ROWA 1UXLA 1G7MB 3POHA 1XSIA 3QXAA 1T83A 5HGHA 4RA0C 3LYRA 3CTTA 4KI1A 2CQVA 3FT3A 3HG2A 4AV5A 3LPWA 2WIMA 4CVUA 4OB5H 5A2JH 2YMTA 1NPNA 2ZUSA 3EYVB 5EZIH 3V7AG 4LHUG 1PGRB 2V6HA 2H32B 4XO5A 4Q0XL 3LKOA 4FNQA 4M03A 4NN5C 4HULB 2WXJA 1AS6A 3LRLA 3PL6D 3VXSE 2FLRT 2XTJE 2Q87A 1N6QL 1JD7A 3PGCA 1JTPA 5IV2B 1UWEH 4FJ6A 4KTEH 1UJ3C 2X28A 1XAUA 4AKOA 1M2VB 1ACCA 1T7ZA 1V3MA 2EKSB 4JM2C 3GK8L 2OJZL 5JIKA 4PJ6A 4XMKH 5DRZA 2HTLC 4XC3L 2VDLH 1R3LB 4RQQB 5FFGA 3R4DA 1L7TH 2YD6A 3IMSA 4FCAA 4JRXE 2DOCA 5KVDL 3DDFA 3GMLA 5B38A 5DJ0A 1OZTG 4LL4A 3WNOA 5SWSE 3ABZA 2K7QA 5F1IB 1EXUB 4LGRB 1XF3A 4GSRA 2VT0A 1X4ZA 2EP6A 5IK3A 4Y2DA 4YSCA 3NFNB 5T5FA 2AQPA 2HJLA 4KK6D 4POUB 4JDTH 3BWAA 4LLYA 3SCMC 5F9OL 2D3LA 5JUEH 4KXZI 1HL4A 1BVNP 1RMFH 1QQDA 4L37A 2GQHA 2DYPA 5AVRB 4QNPE 3CSGA 2WZ6A 1IGYA 3NJFA 3QRGH 3RB7A 3SO3B 2BY2A 1A0QH 2Q7AA 3VGHA 3G7TA 1MJJB 4DK5A 3QJOA 4UT6L 5HGAA 5E08H 1E65A 1G9NC 2C34A 1J9CT 3OZLA 2FATH 4Q52A 4NQSA 3AT8A 1JZHA 1G7IB 3AS2A 3PUCA 3QJHA 3DHUA 3U6XS 1KJ3H 4PJXA 4YDVB 5FXCH 1IGJA 4Z18A 2VR4A 3QJSB 3ZZQA 2NMSA 3DXAA 1T89A 3SKUD 1M1XA 6FABH 3AREC 1YY8A 3T4AC 1MJ7L 2NZ9C 4DPAX 2AEQH 3LJ3A 2X4OA 2VAJA 4ENZA 1VKXB 2FX8H 2WTOA 4AGMA 1CC3A 4IIQC 4FXKB 1QI5A 4ZS6D 3KPSD 3UAJD 1CDHA 1J1OL 3D4CA 3AVEA 1TT6A 4I13B 4U49A 3VVVA 1CJYA 1F4WL 4PVMA 2AK1H 2UXTA 3ARFC 1HDMB 2VXQL 4Y2OA 4N28A 2EDLA 1JV2B 1HWGB 4Y1AE 3U1SH 3N42F 4JK0D 1E7UA 4UTBA 2FIRT 1LXMA 4Y4HA 1ZPLA 3Q5OA 3HB3C 4YGAB 3NPZB 1P53A 2XWJA 4P9HC 4XVSL 4ZFZB 3UTTB 2TSBA 1HILB 3VQ1C 2JJSC 3OZ9L 4LKXB 4LVEA 3FN9A 4UF7C 2G5RA 4OFKA 1H8OA 2A2QT 2ZWNA 2X1PA 2I9LB 3LDBC 1UT9A 4R0LA 1FFNA 2D4DA 3O3DB 2XVKA 1WBYB 1OGPA 4TVPH 5GRYA 1OAZH 3WMSA 1F3RB 4NBZB 3VD7A 2QQNH 5JORB 3GMMB 5JOEA 4ATWA 5KJRL 1IMHC 4NQEA 3Q8BA 3MV8E 5TGBA 4JHAH 1M7DB 3QDME 2G75A 5IESH 1XR8B 4M6ML 1FRGH 1LHZA 4OLXL 5HYJA 4XVUC 4U6HA 2AEOA 2WPGA 5TE4H 2QVIA 4N2GA 3NCMA 2VDPL 3X3GL 4FFTA 4L3ED 4TSBL 3T5WA 2EIKB 4B3VA 2R51A 2XY1A 1GJIA 2DL2A 3GLEA 2DBLH 5B1JC 2GB2A 4JVUA 1X7QB 5H4YA 1AR1C 2WZPA 1A1MA 1EDYA 5A2FA 1N5AB 3PP3K 2Y3NA 5G55A 3SE9H 3O6FB 3MACH 1TTUA 3QAQA 3KLAA 3M8OL 3DI2B 5CCKH 3QEGH 4AL8H 2NQCA 5ERWB 4UV7H 4YDLB 2IALB 2VNCA 3LQAL 3M46A 3QRLA 1CYWA 1NAKL 1KB5H 2X4TA 3KWXA 5C3TA 1GC1C 2V17H 1ETZB 3ZTEA 4UMGA 2WCGA 4OY9A 4XNBA 3MCKB 1I8UA 3J27A 4AIXA 5K9JH 5EB9A 3RTQA 1T03L 4NKIL 4U3SA 3D2UD 1G1KA 4R7DB 5KS9A 3BEVA 3WIFA 1I4FB 3MFFB 4W9ZA 4M4RB 1TJIL 1CLYL 2W95A 3NIDB 4Q58C 2ZG1A 3BH8A 3GEWB 3BZ4A 3KYKH 4WWKD 3TXAA 4P2AA 3RVUC 1FCGA 5I73C 3GMQB 4P5KB 5KYUB 2WXMA 4WW1A 4LIQL 3MRQB 1Z6JT 3NYKA 1PU0A 4OQTA 4U7MA 1DQJB 5DA0B 2CKNA 2DQMA 3DLQR 4ONOA 4LE8A 4PGCA 2OSYA 4J5VA 4PREA 4F7TB 5T5NF 2YUWA 2JKTM 3GBNH 5DGQA 4OW6A 1RERA 4KHXH 3B3IA 5I6NA 1DLFH 5IFAH 4POZD 2WYIA 5DC2A 2LHAA 2Q0ZX 3SE3C 1I31A 4PRPD 2NNFA 3WEBA 3CFTA 4H8PA 4AVHA 3PWJA 2AEIT 4CMHC 1S78D 3BSGA 4M8QB 5J3HD 4B7IA 1ZVYA 1KZYA 5F72S 3QG7L 3FT4A 3II1A 1G7HB 2OP4L 4GAAA 4ELME 3A47A 4R2GB 5LHDA 1BQ5A 3SZKC 4Y16C 4OZHB 3V0VB 2JTYA 1NGPH 2GJ6A 2IH8A 5FHAL 2FRGP 4LRNH 1SDYA 3B83A 4I18C 2BS71 4KI5E 1U3HA 1ZVSA 3ZQ9A 2ED7A 5IBLD 1XIWA 2G3ZA 4P4KA 4DGIH 2NXYD 5CINH 1DR9A 4OFQA 1MCOH 3OD3A 4F2EA 5IQ7L 5T33L 4N2LA 4U2ZA 5EN3A 4K5NA 1DSYA 1MQKH 4ZMQA 1N70A 4MQ7A 4P04A 4AITA 2UWEF 2KLSA 4JPSA 3GBML 4FQ2L 4NRZA 3KHOA 3QIWD 5E23A 4AOFA 5G5DA 1RVFH 1CFTA 1B9KA 1FL6A 1E4WH 1LM8V 2Y7SA 4M1CC 2NNXA 4QHUA 4IBVA 2XWEA 3Q6GL 3T2OA 4D0DB 2A73A 2W0PA 5C2BH 1E50A 5FO7B 4XO9A 4PEEA 1CXKA 1TJGL 3CU7A 4XBEH 2OMXB 1RK0A 3EYUH 4LLAA 1TFHA 4LMQI 4HMEA 3T2NH 3N06B 4PWEA 2VR8A 5FUZH 4PBDA 3QVAA 2KPWA 3NCEB 1ZE3C 3O3AB 4JBSA 3GZQA 3UJTH 3ULVL 3TJPA 4MTMA 3VXQB 2UUDK 5CZVH 3DUHA 1BXVA 4WI0B 1OL0A 3UTSD 3EJQA 5DZLA 3A22A 4JREC 4A68A 4ZS7H 3NZHH 5T5FL 2JLLA 3C6LA 3SY0A 4F8NA 1DBKL 3CUPB 3DURA 2IOMA 4EIUA 2R0ZL 2G5BB 4M6OH 4G3YH 4L8SC 2DS4A 2RGSA 2H6PB 2KZ1B 1PIFA 1YDPB 4ZNEA 3FUNA 2YGNA 4U1JA 1JF1A 4JEGB 5LN8A 2C1PB 2QKIC 1OW0C 3RA7L 4F8PA 2VLME 3SPCA 2B16A 2ZCLL 4NKMA 3CFMA 5EMYA 5F0PB 1ACZA 4HD9A 4KVCL 4MLIA 4UDTB 2ZKWA 3JWOH 4PJXE 4Y4FD 2JKXA 2JK5B 4K8RH 3AAZA 2VLKD 3DXAE 3QHFH 1LWJA 3EBHA 5T1KB 1J5CA 1Z32X 4RZCB 2PYEA 4Y5XC 4KRNA 4UYQA 5ISZB 4LKCA 4EN3C 2VXSH 1U30A 1EO7A 1A6ZB 2L7QA 2WB1A 3MLXH 5C0BD 2EVGA 3FH5A 2PCFB 1MRFH 3JTSA 4NQXA 4W9LC 4D8OA 2FB4H 5I6KA 4U2YA 1H6UA 3VA2C 4E41A 4BM7A 4I2XA 1CE6B 3IMBA 3HUJA 2ESVE 1S9YA 1UFGA 3IXAB 1HL9A 1A6UL 4ELKA 3T08A 3IXTA 3GGWB 3FCSB 4XPFH 3FONA 4ISVA 2X4NA 4MJ5B 5CJXC 3E6FB 2G60H 4KWUA 2YPLB 4X8JA 4LSQH 3LS4H 2EADA 2ATKA 4HJIA 4PJAE 5EO0B 3SB3A 4C55A 4MXWH 4LCCB 4M3HA 2K6YA 2EQDA 1QX1A 2XVLA 5G4OA 1TZOA 2BS9A 1XTLA 2I07A 1D7BA 1F1AA 2LAGB 4PP2A 3LNGA 4ZQKA 2A6JB 3PHQA 4BQ9A 1NEUA 2X6MA 4M8VA 1QASA 1ZS2A 3TOPA 4JFFD 4MCYB 1G7PA 3PGDA 3RY6A 3WFEH 2DAVA 1URIA 3AXIA 4HF5H 4AXWB 5E0FA 3FBKA 3TL5A 4KTGA 5K93A 4XI5C 2CHNA 3KEDA 3MDJA 4NQEE 1FWXA 1QVOB 3G6JA 1J8HD 4QXWA 2BLFA 4FAAB 4YSRA 4Z7UF 5ESVB 3A6BH 5C92A 2E27H 3OKLA 1SDAB 3IVKB 3MV9A 1OP9A 2Y23A 4ZPVA 3N5AA 4D9QE 3WO3B 3FU7A 3S8GB 3KPQA 4HXAH 1R3JB 1NDTA 3D18A 3ZDZF 3MJWA 5CD3B 3L3GA 3VE0A 4G8IA 1U8PA 1BZQK 5L7XH 3CH1B 3MGTA 3A24A 2ENQA 4KQ0A 4N8UA 1UZ6E 2HT3D 4W81A 3WN5B 1YPZF 5FFLA 3EF7A 4JFYB 4OZFA 2PKDA 5CWSB 3EO0A 2R2BB 3QIBD 5C07D 2YBGA 5CCGE 3QQDB 3PY9A 3IETB 3M45A 1B4RA 2P8LA 1E9QA 1UYWH 3MRMA 4L9LA 2O5YL 2OXGA 1HCYA 1KN4L 2OMBA 2Z64C 3IFPB 3E7JA 2QVKA 4GAJL 3FK3A 5FYLE 5IVNA 1INDH 1S7TA 3QR2A 3ULUC 4KX7A 5ENWB 1HX0A 3QWOA 4WI3A 2L0DA 2FBJL 1SXAA 4UT7H 2XKSA 5DEGA 2AQSA 1ULVA 1TTBA 4I0PD 4OD3L 4A2HA 5KS9E 3BEWA 3D85B 3QUZC 1EBAA 1BFOA 3TF7C 1SDDA 4N2NA 4JKNA 2WLIA 1A1NB 3CH8A 3GM8A 4XCYA 3VXUE 3WY4A 1ZGLA 1MH5A 3MNWB 1KT2A 4Y9GA 3R8QA 4AI7A 2ZX8A 3ZKXC 1I7RA 4BSJA 4RBPH 1VPOH 2F7OA 3AQZA 5D7HA 3WO4B 2YA0A 3CDGA 3M1BA 3JWNH 3KNBB 4HGKC 5FIEA 4EBQH 5JMRA 5JPNB 1VACB 5FO2A 1IC0A 1D5RA 4HWZB 4OVUA 4B9CA 1PYWB 4QRPD 4CVZB 5B7MA 1JGVL 4NLAA 4JFDA 4NIYE 5GRXG 1G7LA 1A6VL 3V9FA 5LDSA 4XBMA 3BQUB 2ZF8A 3FO9A 1ADQA 4WLCA 1VSCA 4J12A 2AJXH 3PHSA 2ALAA 2H41A 2YEVB 4LPWA 4XE0A 1FZJB 5L8JB 3GUTA 4MDIA 5GGTH 4XXDB 3PL6B 4B53A 2HFEA 1WFOA 2K7PA 1PZCA 2VE6B 5GGSB 4UB0H 4R90L 4UBDD 1MCCA 1U8KA 1HJCA 4LLQB 3NCCB 2FJSA 1IGML 1MFDH 4I4WB 2IAAC 5I66B 2GJ6E 5HHNA 4J2QA 4AMWA 4HOXA 2OR9H 5GJSL 1KPUB 2GTWB 5E2TL 4ZZFA 2FGWL 2ICEB 1K2DA 4L29B 2NY7H 4Z0BL 3MBWB 2ARJA 3RI5K 5FO8B 1XL4A 3TEZA 4H0IA 3NJJA 4RFOH 5ESQB 3N1FC 2DIAA 3OPUA 3VFSB 3L5XH 1AC0A 5AWNL 3NTCH 1DO6A 5IQ9A 2AJZA 4JHUA 3WE6A 5C8JB 4HJUA 3MNVB 5E8PA 4KKAC 4E42B 2Y07H 4E5XB 5JHLH 4MD4B 1RJYB 4GW4A 2EH7H 3HPJB 1F6AA 3UAAA 4WEMB 3QFGA 3JV5A 4UTAH 2ZXGA 2FEJA 1QFWI 2FT6A 3Q5TA 5I2IA 3WAKA 2WBXA 2ICWJ 4IRSB 5IMKA 1BVKB 3ZK0A 2FIKB 3KLSA 1DLHB 2VAAB 1SLUA 4GAYB 5BVPL 5CUSH 1JZ4A 2NR6D 3MNZB 3UO1L 4AQ1C 1YEDB 1MCIA 1TITA 4GUPB 3ARFA 2QKSA 3FO0H 1B2WL 2GIXA 1XGQA 2ZOLA 1T5WB 5E1AA 3WHXA 2XA8L 4BFEA 2N01B 2HVJB 2Y5QA 2B14A 5B39G 3RWFB 1N59A 3ZTNH 2Z8WC 3RY4A 3KPSB 1F8TH 2PPAA 2BWIA 2JJSA 4ZNEE 2BP3A 3QFJB 2BIQA 5JYLA 3CVHL 4FQHA 4MB1A 4XMTA 3Q2LA 5EU4A 1JPTL 3O6KL 3SE6A 1JF5A 5C7XL 3GXFA 2APTA 2IPUK 3KLKA 3RPKA 3RX9A 4ZO7A 5IEKA 1LEIB 2X6UA 4P2OD 3C2AL 3G08A 4AH2A 3DRTA 4Z7OF 3P3YA 7PAZA 3FB8B 5TFSL 1A4JA 1C5DB 2BNRD 3T6VA 3ZYOA 3HE6A 1JXGA 1VGEH 3P0YL 2PYEE 5L8LB 2HVBA 4GAGL 4JGNA 2OW7A 1CF8L 1XB6A 3VH8B 2FEEI 1XXDC 3CVDA 4A63A 4TOYH 3QNYA 4X5XB 1SNRA 4E41E 1YN6B 2ARWA 2UZXB 3K2UL 3PGCB 1CR9L 3GSQA 5IQNA 4JO4L 4Z3IA 4I2XE 2Y72A 2NY0D 2VC2L 3HUJE 4KQ3H 4OUUA 1T0NA 1HI6A 1RHHA 2JKLA 3BVUA 3U48A 4X7TA 1T7YA 4X7DC 5CKAA 3CXHK 1KTLA 3FS9A 4R7VA 5BQ7A 4FTVA 4HIEA 5C0DB 1UH3A 2VDQL 4U33A 5E4EB 3I9GH 5I9QB 3B9KD 3U25A 4L3EB 3TJHD 1YRKA 1CLCA 3Q06A 3ZKNC 2H1XA 3KH4A 4MX7B 5DMKB 4NJ9L 1W72L 2B1HL 3BXNA 3F7VA 5C1MB 1RLWA 1ZTXH 2D4FA 5DJAB 3GMLB 1KTDA 1PJWA 5T3ZE 5CEZD 2JSFA 3VWJA 1IB5A 4XTRD 1OXYA 3H9YA 1XCTA 2J3SA 2NUPB 4PJBA 2H45A 2CD0A 5E4OA 4HU8A 3ILQC 4WO4D 1KJ2L 1IBHA 4HP5A 3PIQB 4RISL 1OAKL 4U7SA 2M1KA 4G6KH 3PQYA 5DHMC 2X40A 4L37B 2DYPB 4H0LC 2ZXDA 3WELA 2DW5A 1DBAH 3H54A 3LIZH 4DKEL 1H6FA 3MCLH 5HGAB 5KVGH 3TFKD 3AUVA 4RIRB 5DWUL 1U8JA 5D70H 4LSTH 2H1LM 1RZFH 2Z1PA 4NN6B 1NOLA 2FX9L 1JDAA 2F18A 5EF3A 1UADC 4CC4C 5CBAA 3BLBA 4QRAA 5KG9B 1RIVL 1NCWL 5JHDB 5D1QC 1CFQB 3SE3A 5GISH 2XTSA 1KEMH 3VXOB 2ZIDA 3KBFA 4XC1H 2E0PA 2W65B 4PCTA 2FHCA 4NERA 1UVQA 1Z3RA 1SM3L 1XD1A 4HXBH 3VU1A 4RFNB 1JF6A 3RVTD 1U8QA 1A9BA 5AW8B 3AADB 4YHYC 2FUQA 4Y88A 3BRFA 4U1SA 5LNEA 3GDCA 4MKTA 5LGHL 1RZ8B 2JI3A 1QP1A 1MCDA 2Y7LA 4I18A 4XPBL 4CN4A 2I26N 1TZIA 3W9DB 2EXSA 1B0GA 1I1CA 1KTBA 2PP8A 4JN1H 4EI6A 4XPTL 4KH9A 5DVKA 1IAIM 4UTCA 2XWJB 3QQ3A 3U6XA 4DAGH 3CFIC 5D7IB 4O2EB 5K9KB 1NIDA 5FM5M 4APQD 4PJHA 4DT2A 1DZBA 1ID2A 5AL0A 5IROC 4F33B 2ADYA 3M7FB 3R8BB 1P7HL 1XTMA 1WHPA 1GW6A 3PHOA 4ORZC 4PVBA 4CGTA 1WBZB 4X4MA 5JPMC 4UOZA 5TE7H 3U6RA 5TDNA 3GKZA 3KDPB 3NIFE 4N24A 1ADQL 4IK7A 2NXYB 4JFDE 4QHLA 1XH3A 4ENEC 5SWZD 4X4XA 3KWWA 5JQHC 4CKVX 5HHOE 1E28B 2G75B 1IRAY 1ZXKA 5HYJB 2VDMB 3EH1A 3RJOA 3FU5A 2W9DL 3CPLA 3NQKA 3FT1A 3BAXA 3C8DA 2YAFA 4JPWL 1XSOA 3ZSSA 4WNJA 5JXEC 1MIEH 3H3PH 5DFVC 4XH2A 5FGBC 1TQTA 5HHQA 2VWEC 3S5YA 2VGLM 3H0TA 4QRUA 2OTWA 4I48A 2C4XA 1FHNA 1BOYA 4P23D 1S5IH 2XX1A 4C56A 1OF2A 3JYCA 1E4JA 3WKNA 3KL5A 2VUKA 5B3JE 3WCYA 2CHXA 2J5LB 2ZUQB 3L3IA 4UOW1 3OKKA 1FFPB 5HGBB 2HAZA 4LNVA 4GEIA 1EVUA 3BN9C 3ECBA 1A64A 2ZE0A 3U30B 1MLBB 4PJEF 1G9NL 2YRPA 1MW0A 3KWTA 2EH8H 3L1OH 1NEZG 2X4TB 2QKIA 1FVEB 3AWGA 3STZA 4XX5A 4TNGA 4S1RH 4DKAA 4BFKA 2XZQL 5TQ2L 4TUJA 2ZUYA 3SE4A 4K7FA 3OGCB 1DL7L 4FXGA 3H2QA 3RTQB 1MHPH 4J23A 4HHWA 1ET8A 4HISA 4CL7A 3L9YA 1KNOA 1J1PL 4P99A 3SDYH 1JYXA 1BQHB 1MNUL 3BT2L 3BZ4B 2A9CA 4G2AA 3CDYA 3F8UB 4Y5XA 4WW1B 5EOCH 3IDUA 3LZNA 1JUFA 4LBEA 3ZGHA 4UUJA 1Q9OA 1KSRA 4Z0XA 2HRPL 5FDWA 1NCTA 2I60L 1GAFL 3PWPD 4PGCB 2X6BA 3OR7B 3T4YB 2OLDA 2O6CA 4Y4FB 3MMEA 4HHGA 2X1OA 4I3RL 2VLKB 1KLUA 4JE0A 2P8MA 2IANA 3QE5A 1VERA 3OAWA 1RH8A 3AU1A 3IE9A 5T3XL 2FO1A 1IM3A 2NTFB 1F58L 3PWJB 1KB5A 4LPTA 5CJXA 1ASQA 5C0BB 4YX2H 4UM8B 3GO1H 3IGFA 4NWTH 5T3XE 5DZOA 1RSYA 4KK8D 3UIZA 3P30H 5BO1H 1VFUA 3FB5B 2Q8AL 5CGMA 3QR0A 1CTOA 1V8HA 3ZDYE 5FW7A 4ODTL 4TLUA 2GJ6B 1VB9A 3D48R 4ATTA 1JPFA 3LN5A 4HS8H 3I3BA 3RUGF 1EWHA 1KC5H 3U0PB 3C5ZA 2EECA 4N2BA 3GJFH 5ABDE 3A4FA 1XIWB 1GGCL 1FA4A 3MLUH 5E6ID 1FIGH 2OMUA 3H3BC 5TDOB 5J7CC 2BSDA 4XCCH 4NOBA 1WTLA 2XG4B 2DLFL 1ZHBA 2BP0A 2HH0L 3NCXA 1KEGL 3GTTA 1IEBA 2V9TA 1CE1L 2VIRB 2WTRA 3BO8B 2EXWC 4JDEA 3SYPA 1DJYA 1RK1A 2ZSWB 4JFFB 1MW1A 4OF8A 3KGRA 4AVIA 2EUXA 3BKCH 4NRZB 3IPEA 2NSXA 4ZXBA 5D2LF 3X12B 4NOFA 2ZUUA 1F13A 1HSAA 2KC0A 3SKNB 3TC9A 5C9KA 5AOZA 4M9PA 3TBBA 4NN7B 2UY6A 2WJ5A 3GI9H 5D72H 4AC2A 3DX6A 3Q9QA 2RR3A 3O9WD 1WH0A 5C3LD 2VM9A 1AI1H 2LU7A 3GSRA 4FTVE 4DUVA 2OL3L 4W9CC 1L3WA 1UCBH 3CZLA 3U46A 4G9FD 3VFUA 4YHPA 3TEUA 5MEND 1AYOA 4Y1SA 3LAFA 5CIPA 1GC1L 1I1RA 4AUYA 1VRSA 2DKMA 5I17B 3ALPA 3C08H 3O6LH 1TZAA 1Q9WA 5EO9A 4F92B 5CZKA 2EVIA 4EZMA 2ZOKB 1LEKA 4OB5L 5EF1A 3QIBB 2CIKA 4LLWA 5EZIL 5C07B 4GG6F 3PWUA 2CJUH 4PJBE 3QUZA 1D6VL 4H8HA 1USQA 3SGJC 9CGTA 5F6HI 2PCPA 4WI2A 4G6ML 3PQYE 3GXTA 4R4BB 4YHLL 3AG3B 4WHYH 1E67A 4MMYB 4Q9CA 1UWEL 1FBIH 5EBWA 1JF1B 4BZ2H 4KTEL 3EJYD 4U1LB 2Q7YB 2H8PA 1GKEA 2E8YA 4LBAA 2Z4QB 3V0WH 5E0QA 3VFTB 5LKNA 4I0PB 3CVHB 4XMKL 3ME0B 2ITCA 2G4GA 4OJEH 2VDLL 2YN3A 2VO5A 5CCJA 3BPCA 2PWDA 4AM0Q 4Z3TA 1HINH 1JHLH 4PY7B 1BAFL 3AQDA 3EOAA 3QNZB 3RGVA 3UIYA 3ATDA 3ZE2F 3ARWA 1HNGA 4XP6H 3Q6FA 1Q0YL 3MXVL 4C59B 5D7JB 1WAAF 1KGCD 3L4YA 1A22B 5KZCD 3QZWA 4LKCB 3BDYH 3RBGA 2EEBA 5DEJA 5DC9B 3CSBA 3EO1A 1YEFL 3BP5B 2APBA 1DANT 2EIZB 2R0KH 1QLEH 3BCDA 4QRPB 2P42B 5HGGS 3GSXB 4JDTL 4AQAA 5BRZE 5K9QG 4YH6A 3Q3GB 1N3NA 5JUEL 1JZFA 5IG7A 1RMFL 1IAOB 4LCUB 4F5CA 4M61A 2FR4A 3QRGL 1M57B 1S9YB 1A0QL 3NJIA 4YE0A 5DU7A 4QOKA 4H8VA 1PDKB 5DFTA 5E08L 3IXTB 1ES0B 1T21A 2VC2B 5DHDA 9PCYA 5I0YA 5C0AD 1XF4B 5J12B 2R0LL 3ROLA 4E9VA 5I8CB 2X4NB 4Z7WF 4GFXA 3AFLA 2Y6SD 5E2UL 1KGXA 3X17A 2VL4A 5DS1A 3BZDA 2VTFA 1TZHB 1KJ3L 2VDQB 2YARA 1RJZA 3TV8A 4Z7IA 3U79A 1F41A 3JV6B 4PJHE 4FQJH 4U6YB 6FABL 1MREH 1QLFB 5CFHA 1W72B 3L16A 5ITBL 4Z7QF 1KJMB 2R23A 3V2AR 3PGDB 5EF2A 1CFVL 4X4ME 1KYFA 1Q38A 2PTUA 4P5TA 1SN5A 2BVOB 2XWBA 5CP7A 5EOTB 5AW0B 1KTKE 2O72A 1DDHB 3G6JB 1YEHH 4I0CC 1Z9NA 1J12A 1KJ2B 4XAWH 3GS7A 3L4UA 1AQMA 3MV9B 1JVKA 4E0RB 3FU7B 1FLRL 5C6TH 4PCKA 4RAUB 1N68A 5B1CA 3T0EC 1PG7X 2DQTH 2V5SA 1NM9A 1DFBL 3VGDA 4URKA 4NKQB 4AQ1A 3CVIL 4QTFA 4M02A 3QULB 1JCVA 4GO6B 5FK9A 2J1YA 1KXTA 1OQXA 3I6LE 3HLAA 3Q44A 3H4FA 3OKEB 4Z9KB 1I3RA 1RIHH 4HDIA 4FQXC 4MNHB 4TVPL 3LZOA 2O61A 1OAZL 1JHTB 4HFWA 3VCLA 1CURA 5I1IH 2K0RA 3RVVD 2QQNL 5FWRA 2PXYD 1J9RA 1S7TB 1T1ZA 5D7LE 4TVPE 4NBYB 3W9EA 1BJMA 3QUXD 4G72B 2UZYB 2UX7A 1FRGL 4P2QA 3DOHA 3QJVB 2MKWA 5IWLC 1FF5A 3JUYA 1OP5H 1K8DB 2GSMB 1T7VA 2ZNXA 4NI3A 5A40E 2WZ5A 3C60B 1S2EA 3EDEA 5EFIA 4Y19A 3OB0K 1ZV9A 1JZ6A 1ZGLB 5DMIL 2HXAA 1NCIA 4G5AA 3VD2A 2D31B 1VGKB 3G5XA 3QJTB 1S8DA 3LKPA 4JJHA 3UDWC 2P8PB 3ARGA 3K2KA 3SE9L 3GHBH 1NFIA 4PLJD 1KTCA 1T5KA 5KSUA 3DMMD 4MD5A 3HOGA 4P2OB 2X70B 3F58H 3DK0A 5CCKL 3QEGL 4AL8L 3ARDA 4ALAL 4UV7L 4LLDB 5DJZA 1FNSH 4K5MA 2QHLA 2BNRB 4B0MM 1PNDA 3S5LA 5A3ID 4TQEH 1AQKH 1KB5L 2IV8A 2IANE 4DP0X 1TQCB 2CKBH 5I1JH 3QDJA 4X6EB 2DJUA 4H4NA 5J13C 32C2B 5K9JL 3S2CA 2W88A 3GUTB 1OY3B 2XTJD 5F1SA 2VXVH 1QLRA 4TVUA 3L3OA 4LEXH 2R2EA 2DTMH 2HVKA 1K6QL 2PUQT 1Y07A 2QLYA 5IVXB 5F9AC 3N0AA 2IEPA 2DKSA 4KV5E 2DB8A 3KYKL 4GRWH 4GI6A 4CDHA 4QKTA 3PPEA 5EUOB 4M7LL 3TBTA 3Q7JA 4V11A 2GT9A 4N6RA 5A2AA 3OGOE 1OTUC 1MIMH 4KK9D 4F2MA 1TJXA 2A9DA 4B9KC 3N44B 4FZ8H 4C83B 1TFPA 5TF1H 3F7LA 3NZ8A 3LQMA 3GBNL 2NW2B 5KJ4A 3SDDD 3TO4B 4F15C 4JQVC 1EGJH 4KHXL 2GHWB 1DLFL 1HC1A 5IFAL 1F02I 3EH5B 3OAUL 3MZGB 5AAMA 1RK7A 1RZKH 4WWNA 3E3QC 3IT8D 3TBYB 1BBJB 1R33A 4KX9A 2QSCH 4XHQA 1WICA 1JHKH 1K4CB 4A04A 4WO4B 4ZUWB 4MA1C 4P2CG 1MRCH 3SBPA 3WMQA 5DUBA 4BRVA 3ZE1B 1PTZA 5E95B 2Y9RT 2F53A 1P7KA 5GGTA 5DDHA 3BAEH 4OIAA 1PF3A 3VI4B 5D1QA 2X4UA 1WJ3A 5EIVA 2P4AB 4GW5A 5BXFA 4F3FA 5IMKB 4EI5D 3JUZA 2F7QA 3H6AA 1NGQH 4UT9H 1OOWA 5F9DC 4DGIL 3WY3A 5CINL 1ZLVH 4LP5A 1WFUA 1ZT7A 1Q0EA 3ARYA 4NT6B 4RRPG 5DK2A 1AACA 4J3OG 3BH9A 4FF9A 2BSED 3WUWG 1QPPA 5AVWB 4DPRA 4LP8A 1UEMA 5JOPD 3OPZL 2VITB 2CO6B 1G6RH 4HUXB 1UA6H 3MUGB 2BC4A 3GZKA 4K5LA 2ENJA 4KOBA 1FL5A 4NCC1 4J2XA 5K33A 5E51A 3VSVA 3EYQC 1RVFL 2DV6A 1E4WL 3MGAA 4JN2B 1SJXA 4ODVH 3MRKB 3VD5A 1NBYB 2B9BA 5IOKA 2GFBB 1KIQB 4XNMA 1AY1H 1ZT4A 5KVEH 1MXDA 3ZDYB 4M6NL 5KSVA 3EYUL 4DP8X 1DQDH 4YPGA 5AB2A 3T2NL 5FUZL 2NX5D 5C0RL 4TPRH 2FECL 3UJTL 4LQFH 5JPMA 4ZK8A 3T0BA 4PJ8D 1P6AB 3UG5A 4WW2A 4KBPA 5D8JL 5FC9A 5CZVL 3W11D 5IB4A 5ID1B 2XIIA 4LLUA 5DUPL 5ACZB 3GXDA 3NCYS 4WTWA 4APQB 4ANVA 3K6IA 3HJEA 1S7VB 3NZHL 1YC8A 1FGVH 2F74A 3L4VA 3ECVA 5LDUA 3JQOB 4G3YL 3V4VA 1ED3B 2X05A 4GXUM 5ADPH 3Q8CA 3G9VA 3QJXA 4A39A 5G4MA 5CN3A 4F5CE 3QDMD 3UBXA 1KLGB 3DSFH 3IS1X 3E9TA 3ZDXB 4HUCA 4LSSH 4QOKE 4R7NA 8CGTA 2EDQA 1EHXA 3DO3A 3IJ9A 1AZCA 5CD5D 4FI6A 2BWDA 4XODA 4AZ8B 2QGBA 2B39A 1OP4A 4NP4H 1ZSDB 2X2IA 3RX5A 4DPBX 3MRRB 4M7ZC 3U0WL 1CDBA 5E5RB 5D1XD 3S36H 1G4MA 1AD9B 2OL3B 35C8H 3BXNB 3NIDF 3F7VB 4K8RL 4BFRA 4P23B 2X41A 2IDSA 2H2PC 2J72A 1RL1A 2PR4H 4NZUL 3HC2A 5DZVA 4QXTA 3D0VB 2VXSL 1PCXA 4J3XA 4MSWB 1XCTB 1MI5A 1JTTA 2GBVA 3P77A 3MLXL 4FNUA 2QT6A 4MYWB 2P5ED 2NNCA 2FB4L 3H2PA 2NY3C 4LP4A 5ECJE 1TOXA 2AEPH 2BINA 3C5JA 3MJ9H 3HNTH 2APXA 3EJSA 4V2BA 3QUYD 1WG3A 4ZPTB 3VWKC 4UIMA 1TCMA 1K5NB 1G9HA 5ICXA 4F9LC 4E9QA 5HGDA 4W4OC 3PXLA 4IHOA 4XPFL 5IR1A 4LT7A 2CJSA 2G5UA 2G60L 1NM4A 3OKNA 4LSQL 2CRMA 1EHNA 2JJWA 3K81A 3LS4L 3QG6B 3BP4B 2P5WA 1PL3A 1AJ7H 5DF0A 2VDLB 1BHGA 2MCMA 1O9VA 3BZEA 1DVTA 4OZHF 1QSEA 2A83B 2P7TB 1MCSA 2PETA 3G04B 3QBTB 4WUKH 5K1JA 4AEHH 3V4PB 1UVQB 4HF5L 4YC2C 1MG2C 3IU4H 2UVFA 4NPKA 2F5BH 4N5EC 4H25A 5C6WH 3U9PH 5DGRA 2QFPA 2H0FA 2NXZC 3BUBA 3VXNA 1G4RA 4U1SB 2R9HC 4G8FB 3S5ZA 2V3EA 1JI2A 3OTTA 2DM2A 4P2QE 5PCYA 3K4DA 4U1MA 5JMOC 2YHGA 4J1UB 4OF7A 2PYFA 1TR7A 3OMAB 5AW2B 3QUKA 2Q9OA 1SGKA 1Z9OA 4JLRA 2WIIB 3TIEB 2OSLA 3KJ4B 1AXTL 4TS6A 3L6FA 3PDOA 4FQQB 5L7XL 3QQ3B 4Y19E 3RWEA 1NFDA 1T5XA 3MBXL 5AG8A 3GKWH 4X6BB 1ZE3H 5B8CB 4OLVL 1A9EA 4GQPH 3EFDH 2BOBA 3REVA 1P5VA 2WKOF 4JO3H 3WEOA 4PJ9A 3DIFB 4QXUL 2DLEA 4HJ1A 4K9JA 4Q8BA 3W0WA 4BSWA 3KWWB 3INUL 3TH3T 2X1QA 2B1AH 4G70B 4S1QH 1XCQA 3CHRA 1VEMA 4X5LA 3QDJE 3STLA 4UT7L 1MVUA 3LXAA 4L5FE 4C47A 4QRFA 4YMPA 3MRGA 3UYRL 2CHDA 4XH2B 2YAHA 3FQYA 5C0FB 1G9MC 3F7RA 4KKLC 4TUUA 3IS0X 3P4NB 2OTWB 4R4NC 1LEGA 4QXVA 1INEH 2WWMD 3ZKQD 4N8VA 3HE7A 4C56B 4MHHI 1VPOL 3LH8A 5EBMA 4PGZA 4YHZH 3O9WB 4N3TA 4KROD 2GJZB 5HD8D 2XZAH 4BD4A 5SWQB 1YNLH 3ZT7A 3VXMB 4KJPD 5KYYA 1BXAA 1DUZA 1TTCA 4MXVE 4G9FB 4F2ME 3PWVB 4B95C 5MENB 2IBZY 4OTXH 2A9MH 3PE9A 2LFGA 4UDUB 2F1AA 2Y36H 4DJMA 2NOYA 3PV7A 2J6WA 3NIGE 4IOFC 3FTGA 4L8CA 3STZB 3GRWH 2ZKHH 3COOA 2K4AA 4HH9A 3BGFB 3B7YA 1XGTA 3LV3A 4KZ0A 2M2DA 2WCPA 4CU8A 1MLCB 3KAAA 4TUJB 2AJXL 3F04A 1KIRA 5IM7B 4XAKE 4FXGB 3UTZB 5L0QC 3HG3A 1TTAA 2IQAB 1QO3B 4HC1H 5GGTL 5ILTH 1SXSA 3EGDA 4N0FA 1I8KB 4ELDA 3QUMH 3IDYC 3QJZA 4RGND 4YBLB 4L0YA 4UB0L 1OCWH 2F53E 2Y2YA 1QHQA 2AQ3A 5SX4H 1MFDL 2VLMD 4TLKA 5D1QE 4ZUTA 3AY4A 4Z7NE 1KV3A 1QRND 3CCHB 1JUFB 2HTKC 2WAQA 3IU3B 2OR9L 5HY9B 1XR9B 2YUVA 3F7KA 4AM0B 4X5WB 3BIAX 4F7CA 5DJ2B 4FQIH 1SPDA 1F0LA 2ATPA 2NY7L 4JFOB 3MMEB 3NJLA 3DXAD 3OG4B 4IEFB 4UWQB 4YHOL 1QYGH 4GBXD 5L2KA 4ZMLA 3PJNA 5DMGD 4YL4A 4RFOL 1IGIH 3OSVA 2WBJC 4KKCD 5KZCB 2VABA 3AU1B 3E8UH 3EH3B 1KB5B 3ARTA 3CMOH 3CSFA 3K6FA 4WGVB 4XCNA 4JVWA 2NPLX 5F9JA 4WFEE 2V2XB 2H0PA 1MAMH 3L5WB 2EH7L 2ESVD 4LOEA 1ORSA 3B3BA 1R5WA 2APFA 3CU1A 5DHYA 2JELH 4UTAL 2Z92A 4XMLL 3NRPA 3AG2B 5EPMB 4MYPA 2XJKA 5C0AB 2EDMA 3SQBA 1VAHA 2P24B 2X3BA 5E5LA 1VFBA 4RH4A 1AYRA 3OG6B 1SN2A 5CUSL 2QQQA 3AS0A 3KJ6L 1II4E 5J9PB 1ZHBB 1NGWB 1QSFD 3RJDA 1RD6A 1IEBB 3FO0L 3MUZ1 3TZVA 5IIEB 2O26U 3APNA 3KG5A 5IHBA 2LVCA 1BOGB 4OGAD 3ULUH 4RMSA 4X9HA 2JKNA 1I9JH 3QP3A 3B2XA 2E75C 3ZTNL 4ZXBB 4QLWA 2X7LA 2VWEE 3MHZA 4IGBC 4NSKB 5J6GA 1F8TL 1LK2B 3FH8A 1P1VA 4BQCA 3O8XA 1KBGH 3FT2B 5GGQH 2OQJB 1HHIA 1YZZA 3APDA 3LPOA 4Y2NA 2GSIA 3GSRB 3DSNA 3CDZA 2MNUA 3WHE1 3VRLF 1JZ7A 4FQXA 1V27A 4N2IA 4R4FL 3U46B 1TO5A 2JJVA 2WZPD 1L6PA 3RIFF 4CN6A 1E9PA 3GJFA 4AGNA 3VFNA 3MN8A 4IJ3C 4OD2A 4OFYA 5FA4B 1VGEL 4HIXH 3X14B 3D12B 4R6UA 1V10A 5IWLA 2CIKB 4X9FA 3X1GA 4LLMB 1FFTB 3DETD 3P11H 3MLRH 1PAMA 2FYYB 4ZAKB 4BSVB 2A1WH 2CGZA 1IZJA 1SXCA 1IGCL 4NM4H 4YO0A 3RWHB 4FOMA 2PXYB 4UI2A 5EC1B 2QMJA 1BVZA 4QEGA 4F1SA 3MRCB 3QUXB 2FWSA 4Y4KC 3JVGA 4JUSA 5K39B 3MKKA 4F9PC 4G9DB 2CM6A 4PG9B 2AQ1A 2JB6A 1PS3A 1XGUB 1OAQL 2CLRA 3MRFB 2ITCB 4KO6A 4QAMB 5JDSB 4AY0A 3LS5H 3VXUD 5BV7L 3RGVB 2P5WE 2GTZB 4PB9L 5GRUH 4ZFFA 1ZTXL 3MLWH 5FHBH 3GPEA 3PAVA 3X2QB 3MO1A 5B4MC 1IL1A 1QSEE 2WHVA 1VADB 3QZWB 2NY5C 4K9EH 3ATBA 1NAMA 3DX8B 4ZX4A 4O2FB 3DMMB 4AWJC 1DANU 2PP9A 3O3BA 4WWPA 4PI2A 4X9YA 4AQZA 4XMUA 1F3JA 2OMVB 1FZOA 1SMDA 5BZZA 5I5IA 3BSHA 4UM9A 2WKLA 2FD6H 1EAJA 4JO8A 2R4SH 1DBAL 4YDNA 2FR4B 1GCFA 1W8EA 4KJQC 2VQ4A 4OM0L 5JZ7D 4XGZB 1KOAA 2FL5B 3MCLL 4Z3FA 5IJBC 5KVGL 1ML0A 5AW3B 3WKML 3ROLB 4OCYH 3FUHA 4LAQH 4F37F 2ICWA 2GITA 4K94H 3KPNA 1NFDE 2BIMA 1UACH 4FMFA 4H1LG 1FE8L 4BZ1H 2QPDB 1FQ9C 4JQVA 8FABA 4KU1A 3VSUA 2J21A 2V9QA 1W6LA 2QSVA 4LF3B 5I74C 5I1EH 2R2CA 3M88A 4MJIA 5GISL 5LN4A 1KEML 2R69H 3V0HA 3K3QA 1ZLUH 3T2LA 5KVFL 2P52A 2EDYA 3WAJA 4R3SB 4XC1L 1OK0A 1HQ4A 4Z7VA 2DRUA 2OJEB 2DMGA 4ZOAA 1QFWH 3IPFA 5KVFE 2XWBB 3OVUB 4XN7A 3AJ7A 3O0LA 5I1LA 3FQ2A 3SDDB 4Y7MA 1J9TA 4OCXL 5EWIL 1U8OB 4BYHA 4JZJA 4KITB 3QEQA 4LDOB 2W0FB 2YPKB 4KJYA 3IMTA 2RAMA 4EJ1C 2SODB 5H8DA 4JN1L 3FC8A 5HDQL 2ZP0T 5AOJA 4WK2B 5M95B 3GMPA 2VDRB 3RRQA 3CSYA 1EHAA 1EXGA 3KCPA 4DAGL 4JRYA 1XHHA 3W39B 3ML8A 1L0YA 3TA3C 3AGWA 4G8EB 3RHWK 1CLOH 4OKDA 5JHMA 2NRDA 3O4OB 4PLOB 2AJ3A 1GVIA 4GRLC 3Q2NA 2DQCL 4DNLA 5BS0A 4EI5B 2HX8A 1A14L 1AE6L 4JX0A 5LCVA 5TE7L 3VCLB 5GZOA 1T1ZB 4OKVB 4P46A 2DM3A 4E9TA 3WFZA 4FFZA 3C6LD 2BOCA 2X4RB 3KBHE 3WNIA 3JWDC 1GYCA 4F7KA 3ETBJ 5KYXB 3EDDA 2J12B 4Y9EA 4FD0A 4H26A 3ARBD 5AEAA 3IDGB 4I89A 4MQTB 4OAWB 5I71B 3BPLC 1MIEL 2C9AA 2X2HA 1WIUA 1S7XB 2EEFA 3H3PL 3LRKA 4FC3E 4IRJC 5PAZA 2AQRA 4FG2A 4W9JC 3ZPDA 1CU4L 4WJG3 2DMHA 1AGFB 3G5XB 1S5IL 2V7NA 3FYEB 4MMXC 5E5MA 3HNSH 4F91B 4M62H 2LTQC 5DSCB 1YUHB 2G9HA 2NX5B 4IRZH 1OEZW 4MD5B 4PJ8B 1NKOA 3CFJB 3IYLW 3BWZA 2AGJL 5DCCA 4B0MB 5DJZB 3GB7A 4BFJA 2KZBA 4Y5YA 4D0CA 3ULVF 4FFVC 1MCHA 3VGBA 3S5LB 3DIVA 3L1OL 2EIJB 4ODUA 1H5BC 1M71A 2DKUA 3MBEC 2XG5A 3VXTA 5JYMA 3K71A 2GVYA 3DECA 4S1RL 4PJIB 4WUUD 5FCUH 4LFHD 2A5UA 2V9UA 4G8AC 1YNTB 3C6SA 2OJ1A 5A2KH 5E00A 2AMGA 5EIIB 5EDXA 3OHXC 3NDZE 2AW2A 1RZJL 3SZ6A 1K3IA 2B2XL 2R2EB 1JZEA 4U6XB 1FJ1A 2CLZA 1YJDH 2FNWA 3SDYL 5F1NB 1BG9A 2YFOA 2IQ9L 1NCOA 4QWWC 1UM5H 2FJHA 2YR3A 3UC0H 2IMNA 1ZGLP 5EH1A 1KYUA 4EE2A 1D5XA 3UJIH 4QI3A 4CMMA 3LQZB 3DO4A 4MA3A 3EYFA 5D1XB 1T6VN 3VNZA 5HYQB 5MEPA 1L9PA 4PJXF 2UWEA 2C7UB 2Z7WA 1KB9J 2WXIA 3BVNB 4WFFD 2MRYA 3FFOA 2HN7A 1A3QA 5T3ZD 4L4VE 1AP2A 5HDBB 4MWFB 3DX3A 3T0EE 2QHRH 3IWUA 3NA4A 1OTTC 4J27A 2CKBA 4NXKA 5AZUA 5ADOH 5BNXD 2P5EB 3GO1L 5MP6H 5DUBB 5BVJB 3N43B 5AD0B 4BJLA 3P30L 1IBYA 5BO1L 4XBGA 3QUYB 3V6OC 2X4UB 4P2YA 2O30A 2X6AA 3BSZA 1X7TA 4G5ZH 4GW5B 4PV9A 2EABA 4KGJA 4HS8L 4NC1E 1KC5L 3Q1SL 4F3FB 1OSYA 1AGBB 2PO6C 5I19H 2K45A 5T1DH 4HAGA 1LE5A 3MLUL 2F1EA 1FIGL 4L05A 2W59A 1J9QA 1FNGA 4XCCL 4YGVB 4JNXA 1MCQA 1MQ8A 4NBXB 5D7IF 3QFDA 4DFHA 1VHPA 2OA9A 1RUPH 2X9ZA 1QRKA 4NUGL 3FB6B 5HVFB 4WFHE 2N56A 3IMRA 2BC4B 4BFIA 4OLUH 3TIDB 3OR6B 3QAZB 4G7QB 4HGMA