2KZTA

Structure of the tandem ma-3 region of pdcd4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
163
structure length
163
Chain Sequence
b'GLPLDERAFEKTLTPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death protein 4
publication title Structure of the tandem MA-3 region of Pdcd4 protein and characterization of its interactions with eIF4A and eIF4G: molecular mechanisms of a tumor suppressor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 51
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2kztA00
4GMJA 4IULA 2FULA 2ZU6B 2IOSA 3EIQC 4JHJA 4CRWA 2IOLA 5ANRA 3JUIA 1UW4B 1H2UA 2RG8A 3FEYA 2IONA 4GMLA 1H6KA 1PAQA 1UG3A 2KZTB 1N54A 3L6AA 2GGFA 2HM8A 4JHKA 3FEXA 4B8CB 2I2OA 2VSXE 4B8AA 4CEMA 2KZTA 4B89A 4LUNU 4CT4A 1H2TC 1H2VC 4C9BB 1N52A 3D3MA 2IU1A 2NSZA 3RK6A 1HU3A 2VSOE 3EIJA
chains in the Genus database with same CATH superfamily
4YDYA 3ML8A 2OVFA 5KNGA 1U2VG 3TWXA 3G2SA 2P9SG 3FTVA 2F37A 4A63B 4DPRA 2J4DA 3B13A 5FZSA 3EIJA 3QNKA 4TV3A 3S2AA 3D9JA 1D9SA 4PDXA 3FTWA 2KM4A 2XPZA 1N95A 2MOWA 3MEKA 4HOTA 3KEZA 4AVXA 5AJDA 4APFA 2GRRB 4A1SA 2X6IA 4JXTA 1TN8A 4RSYA 2E0IA 2WXFA 4NURA 2WXHA 4I1MA 1KT1A 4FJZA 2LXLA 4CCAA 4B0ZA 5LP0A 5BNWA 3VTXA 3CVPA 1L5JA 3AG2E 1QQEA 2P58C 3AS8A 1OCRE 3UT8A 4RQIA 3GW4A 2FULA 5EYPF 5E76A 4M7CA 4K5BA 3HHMA 3ZIMA 1Z3XA 3PZ1A 4B8AA 1YCSB 4RG9A 5BXOA 2KZTA 4LUNU 2ETCA 4IRUA 2QYJA 3DXMG 4WNDA 2GRLA 5FQ7A 1K3ZD 4UI9J 4U96D 5B3SE 2YQ8A 1H19A 3FTUA 4NRHB 3BG1B 3GYZA 5ENTD 4C48B 4LRZA 1OCOE 5EX0A 1JWGA 3Q75A 4UI9C 2BF0X 4TXPA 4W9RA 4HI9A 2X3MA 3APDA 2OV8A 1ELKA 1E8ZA 2ZISA 2WMOA 2WXNA 3PUKA 4HLEA 2H6HA 2YHEA 4ANWA 2FEZA 3BUAA 3ZW3A 1DCQA 3RAUA 3R9MA 4R7LA 3UINC 2OCCE 1NZNA 4O1OA 3FU0A 4UUCA 1OCZE 3C5RA 4U95D 1OWOA 5ENOD 2IOSA 3TWUA 1S0PA 5BUZA 1HF8A 2WM9A 5AENA 3L13A 5CMWA 4I9EA 1E8YA 4B89A 1KLXA 4AEZC 3FTSA 5CCMA 3LYAA 2WXPA 2BUGA 2PQNA 3ZPJA 4G2VA 5LFAA 3EU5A 2DVWA 2RFMA 2WXOA 2LSUA 1ELWA 1A5EA 1RW2A 4JL0A 4FLHA 3QDNA 4GTTA 2IOLA 3LDZA 3Q47B 4OAVB 1BLXB 2ETBA 2X6JA 1U3DA 3MKQB 1IKND 3DPDA 5EKQD 5A7DB 5JHBA 2IEJA 3J5QB 4F53A 2VGYA 2V5QC 2DCPA 2WB2A 1YA0A 3CVWA 1ZB1A 3WG7E 3I3NA 5AAOA 4D10C 2H6FA 4LSZE 4K0RA 3S7DA 1HG2A 1TN7A 4BERA 4UWGA 4JHKA 3LS8A 3CLJA 4BX9A 3RO3A 2VSNA 4JVSA 3QOUA 3Q49B 2IFUA 3MYVA 3HXCA 3FHEA 4I1AA 3UT7A 4PS8A 2IONA 5AQBA 2XS1A 1HZ4A 4HB5A 2P9LG 4A3VA 3FY4A 5CEDB 3TL5A 5KJKA 2XRZA 4XIFA 5FZRA 3W9GA 4NIKA 2IO2C 1W3BA 4GZ5A 4E6HA 3LY7A 1QBQA 2WPVA 4Q69A 3MCXA 4I6GA 4C0EA 2MRIA 3UQ3A 3ZNGA 4JEUA 1H2TC 2AVPA 4HS2A 1LF8A 1OT8A 3ZEFA 2WXRA 5CERB 4UWHA 2P9UG 5D66A 1D8DA 5EDSA 2FO1E 2DYRE 1EPUA 2KCVA 4HRMB 2R02A 4E85A 5JMND 4YDEA 3LJNA 3MZLB 3UX4A 1MQSA 3CVYA 1HE8A 1BI8B 4U8VD 4GYWA 4PS3A 3CVLA 4OAUC 2HE0A 1IHGA 3PE3A 5HRYA 3ZFWA 3T5XA 4GMRA 3X2QE 2C0MA 2Y69E 4U0SA 3FU6A 4N3BA 4U04A 2F8YA 3GZ2A 3CKCA 4XI0A 2ZGGA 3KEAA 4F3VA 5CCLA 1ZU2A 2DIWA 5ITZF 5DIZA 2IQCA 3QWPA 2BKKB 1HH8A 4G8LA 4O6FA 4IN3B 4J8DA 5G04J 5BV0A 2VSYA 5LOZA 4DX1A 4GZCA 1FVFA 3FU5A 4FC8A 1MX6A 5AN8A 1NA0A 2V4HC 4GTMA 3P1UA 2AXZA 3HYMB 4DX2A 1IQUA 2OEWA 4TUMA 3RKVA 2CG3A 3L6AA 4AP2A 2VQ2A 3UIOC 3Q9NC 2LAHA 1H0AA 4GTQA 4H7XA 3EHNA 4RLYA 2ZGDA 3SFXA 4J8FA 3VLDA 1DC2A 4MBGA 3LKUA 2HR2A 3CHPA 4G24A 1H6KA 4YDWA 1TNBA 2J9QA 4DJAA 3KSLA 4XX5A 2QYUA 3ASDA 3WXXA 3LY8A 1FT2A 4BTBA 2H6IA 3S7JA 4GYOA 1MYOA 3FH7A 1H2UA 1QNFA 4J8YA 2HO1A 4X8QA 4L1BA 3Q15A 2IY0C 2V5FA 4HXIA 3NOGD 1TNUA 5A23A 3RRNB 3U66A 1K1AA 3UM2A 4GZDA 3ZKJA 1PY1A 2VGXA 3TG5A 1TN6A 3JUIA 1A17A 4LNGA 2X6KA 1E7VA 4Z68A 3RRMB 3UIPC 4CGWA 4FA6A 4APOA 4ILGA 4GU5A 4TXQA 2OOEA 4RVBA 3CIAA 2ILRA 4ATZD 2LNIA 2J08A 2GROB 4EHMA 4EQFA 3G2WA 4I9CA 3ZYLA 2L6BA 3TWRA 4XI9A 3ABLE 1O5MA 4LG6A 2AXUA 3FTZA 4IYPA 3C3RA 1ELRA 3ZVVA 1IQRA 3LCAA 5JJ6A 4UWLA 4LCTA 2BKGA 3CHRA 1OXJA 1UG3A 4QQIA 2GGFA 2PQRA 4G26A 2FO7A 1AP7A 2I2OA 3Q9UC 4HNAD 4HBDA 5CMYA 3CGHA 3APFA 4GZ3A 3UM1A 3V2XA 4I6JA 2WXGA 3EUVA 3UI2A 2XPIA 3GZ1A 5CBNA 2PNNA 1YYHA 1DNPA 1OWLA 4ATGA 2XCBA 3JXJA 3QB2A 3JQ0A 1TR4A 3E32A 4WNFA 4CGVA 4HRNA 2YNQA 4O60A 3R7QA 3ASOE 4L2LA 5BV1A 3Q73A 1KPSB 3DSTA 4GTOA 4DLQA 1HFAA 3MKQA 5AJLA 3CK9A 2DBAA 3FUFA 3J5PA 4LEUA 5EX3A 2FBNA 4EZLA 5KJMA 2XQ0A 4BSXA 4F1SA 2VSXE 3ZUVB 3MKRA 3QC1A 1TYQG 3NBNB 4KMOA 1Q2ZA 4ILIA 3TWQA 1BD8A 2AW6A 5G05J 3PE4A 2CHWA 4BWRA 2RKKA 3HIZA 1ZBPA 3HVEB 4L23A 2OVBA 2J49A 3NF1A 1TJCA 5G05C 4TRQA 3N71A 2A5EA 5BT1A 5AQ9A 1SA4A 3DWLG 4HI8A 2MHKA 3B7BA 3CVQA 4OVUA 3L54A 4XKBA 2R2LA 3QWVA 4L9PA 3FTYA 4JB8P 4XZ4A 3FUKA 3MGBA 3D9KA 3VLEA 3UKRG 2GRMA 4I43A 2WVIA 1QYMA 3KSQA 2AWIA 3OXGA 3BEEA 3E37A 4DK5A 3L17A 1O1RA 1HU3A 3FUHA 4HVBA 4TXRA 2XEVA 3L08A 4KBQA 4A55A 3D9NA 3TWVA 3LVQE 1VDYA 4J6IA 1IHBA 5FTPA 4C0MA 4GPMA 1HXIA 3LPZA 4EECA 3R9AB 1E90A 3T8MA 5E75A 1TNYA 5HI7A 1WY6A 4JHJA 1OUVA 2JLBA 3MV3B 1B89A 2BEDA 4GPKA 1JUQA 4G11A 3NB2A 5BW8C 2KC7A 2WXJA 3PVLA 5EN5D 2XCCA 1Y6IA 4F1PA 4WNGA 4IULA 3SO8A 5KBAA 3IKOB 4Y6CA 5JA4D 1WM5A 3FUEA 1WDYA 2XPYA 4CT4A 4PH4B 2H6GA 2L0IA 3NQPA 3AU4A 4K5AB 2DZNA 4YVOA 5DBKA 3CVVA 2R5SA 4A3TA 5CRVA 1H6PA 3DBSA 3IV0A 4J8EA 1MX2A 2HYZA 2C0LA 3ZGQA 4UWKA 3U64A 5T3RA 3CR3A 5ENRD 4AV7A 4GTRA 3DSUA 3ULYA 4M3OA 2RFAA 4GAAA 5AIJA 3ESLA 5FQ8A 4WAFA 3ONKA 3EJNA 4EPZA 1EYHA 5CHEE 3QJZA 4J0UA 4JEHA 2VTBA 4AJWA 1BI7B 1UJKA 2QY7A 3ASGA 1OWMA 3UUXA 5ENSD 4KVMA 3QK0A 2R17C 4CEMA 1UN8A 4PUCA 3KAEA 2ETAA 3C98A 4TUUA 2PL2A 2IU1A 1IYGA 1DCEA 3B7TA 3ML9A 2J4BA 3I5PA 2L0TB 4DI4A 4EZKA 3APCA 3FFLA 4MKTA 4N2QA 2AXVA 2XZDG 3I4RB 3L22A 3SGHA 5HS0A 2EIKE 3IHVA 3EHQA 5JHAA 3PRZA 1E8WA 2P9KG 2CG2A 3V30A 5ARGA 2KCLA 2LAIA 4HLLA 4KZ0A 4ZHBA 4GCOA 3FDHA 5FIOA 3IXEA 3D9IA 4Q94A 4QFVA 4U07A 3G2UA 4DI3A 2CFZA 3BG0B 3MJWA 3RO2A 3SD5A 2XEHA 1E8XA 3SNXA 4DRXE 3OAWA 2DZOA 1FCHA 5T8IA 3BU8A 1LTXA 1AWCB 5FJYA 2IF4A 2QC9A 2UY1B 3KS2A 4MLPA 3V2OA 1H6OA 5G04C 4N2SA 5FT9A 4GTPA 3NZSA 4KYOB 4FADA 4UWFA 1XGWA 1BPOA 3ZU7B 5FZQA 5FINA 4BX8A 5C1DA 5FQ4A 2NXPA 2P2CP 3QARA 1XNFA 3TWSA 4AOFA 3PEUB 4CDMA 1N4SA 2Y1LE 3NOCD 4ME2A 1NA3A 4UI9K 3FUIA 2ZIRA 3PUJA 4CDNA 3UT4A 2A5UA 4KVOA 2EINE 5B1BE 4GTVA 2WXLA 4FULA 3RRUA 1OY3D 2WXQA 2CHXA 2NSZA 2VGEA 4U8HA 1UOHA 1YMPA 3K9IA 1HO8A 4U0UA 3PS6A 3Q79A 3OXLA 5BXUA 3O4ZA 1N9AA 1N4QA 3IEGA 2EIJE 3DSXA 3DSVA 3OXFA 4JA7A 3UPVA 1OWPA 2P9IG 2YINA 1MX4A 2J07A 3L16A 3D9HA 5KJLA 3HVEA 3D9OA 4PS7A 1KT0A 2B6CA 2J8SD 2M63A 3AG4E 1TJFA 3GZSA 3ONLA 1WG0A 1X81A 2JEKA 3SF4A 2P9NG 3UTMA 4AY5A 1N54A 3ZYKA 4FU3A 4HORA 3LJ3A 3U4TA 3HXFA 3RU0A 1WAO1 1HG5A 1FPPA 2GRNB 1S63A 3FTXA 3T8KA 3PEVB 4J8SA 3FUJA 4BESA 4EBAG 3ABME 3TXMA 1N0QA 4CRWA 3SFYA 5HQ8A 3HXEA 1HX8A 2GRPB 3ZXPA 4BY6A 2KCKA 4N39A 3IBEA 1N11A 2WMNA 4O1PA 2OEVA 3RJVA 3TXNA 4ACLA 4I2WA 4GMJA 3CHQA 1NI1A 3E4BA 4HOUA 3B7UX 1S70B 3P2BA 2X6HA 2KATA 2V4LA 3EU9A 3Q7FA 2QFCA 1QZ2A 3E30A 3UKUG 3UM3A 2EQXA 3TWWA 4BT8A 3FUNA 4BETA 4LNBA 4AY6A 2R59A 4WNEA 2LSVA 3SHFA 3ZYMA 4JPSA 3AU5A 3LVRE 4CYMD 2B0OE 3DXKG 4HOSA 2E2EA 3JQ1A 1N52A 2LO6A 4I17A 4XKCA 3ZHEB 1O1TA 4ACKA 1MJ0A 2Q7FA 3PH0C 1S64A 5AARA 1NFIE 3CQGB 1N94A 3DPYA 3FWVA 5D0OD 3ZRHA 3SY2A 4LNUD 4HFGA 3S7BA 5CEAA 4FLBA 3DSWA 1PC2A 4G23A 2ZXWE 4ANVA 4DX7D 4DUIA 3UMVA 5D0QD 4GA1A 3ZXSA 2PM6A 2EIME 2DWZA 4ZFHA 3JYSA 2A4ZA 1V55E 3RSEG 2VGXB 2V0PA 3CK7A 2VSOE 1SA5A 1DVPA 3ZYQA 3AAAC 3TG4A 4URKA 3ABKE 4H7YA 5EIDA 4OYSA 4GB9A 5ARFA 2X6FA 3ISMC 3IHYA 1E96B 4UQZA 3PZ4A 3SBTB 3CK8A 3CHOA 4N5QA 2Y4TA 4YNDA 3DRAA 5CRUA 1V54E 5EIBE 3CEQA 5CBOA 4I2ZA 3OTNA 4WWNA 5LCWJ 2WXKA 4WWOA 1N4PA 2WQHA 4U7EB 3NZUA 2YHCA 4B93B 2AJAA 3G2TA 2R05A 3ASHA 3FP3A 1BU9A 5BPPA 3TJPA 5LCWC 2XENA 3TGOA 2WXIA 4Q96A 3TWTA 3I4GA 4EZJA 1TNOA 2X38A 3FEXA 4G25A 1MHQA 1TEZA 3CHSA 2XS8A 3MV2B 2FI7A 2C2LA 3HXBA 4ILHB 2Y3AA 2Y0BG 5EILA 3B95A 3ENEA 4GA0A 5ANRA 2XGSA 2L6JA 4XE0A 1E7UA 2RG8A 1P5QA 3CHMA 4UQXA 4L7TA 1SZAA 5B1AE 1G3NB 1Y8MA 3TAXA 4UQYA 1EF1C 2LUHA 3FUMA 2KBXA 2XHEA 4BT9A 1K1BA 3C3QA 1FT1A 4BFRA 5HKPA 3W9FA 3DEOA 3URZA 3FEYA 3UXGA 1PAQA 4AM9A 4U63A 4K03A 1UJJA 2VYIA 3SBSA 2XGOA 4GTSA 4ABNA 3D3MA 1SW6A 3VLFA 4MRUA 4N3AA 3T5VA 3D9LA 2UY1A 3NAWA 3MA5A 2I9CA 1U3CA 3Q78A 2LXMA 4FJYA 4U0ZA 4AXHA 1Z6TA 2KZTB 4I6EA 4CZ2D 5CECB 4F6RD 4FHKA 3AJIA 4NACA 1O1SA 2PM7A 5EYLA 1SQMA 5J08A 5KCMA 4CDRA 2CHZA 4L2YA 3ULEG 3MX3A 1Z5SC 3B7SA 2HM8A 3ULQA 1LD8A 5KJNA 2F0YA 1N4RA 3RIBA 1NP7A 2DYSE 3D9PA 5J90A 3C3OA 4G8KA 1N0RA 4BTAA 3AG3E 3EHRA 1INZA 3V79K 2XRYA 4JD2G 2JABA 1NL4A 2L9BA 4RG6A 3LY9A 4BSZB 3U3WA 3HRAA 2CFUA 3O48A 3ZN3A 3EHMA 4ANXA 3QWWA 4ANUA 3CVUA 2P9PG 2XZTG 4V3IA 5C2YA 3PZ2A 2NYJA 3SFZA 3Q5MA 1SVXA 4YDOA 5KNHD 4KZCA 3F6QA 4P29A 5AQAA 5JJTA 3B7RL 3CVXA 2UWJG 5IY5E 4KXKB 2R03A 3G2VA 2IO3C 1SZ9A 2XEEA 3CQCB 4JHRA 5LX8A 5D2MC 4GZ6A 5ANLA 5ENPD 2I1KA 5ENQD 4U8YD 3SZ7A 2WQ7A 3L9TA 3PZDA 2QZAA 1LD7A 3C72A 3DEPA 3PDNA 3L82A 1K8KG 3ASFA 4LERA 4FHJA 4A1GA 1IXVA 4Y6WA 1D8EA 4I1OB 1UN9A 3T9KA 2VJ8A 3SI5A 2KXPC 4EBAA 1MZCA 2BTDA 2FF4A 3EDTB 3JUEA 3HXDA 2Y4UA 4FP7A 3HDXA 1KZOA 3AS5A 5A6CA 3QAQA 3Q4AB 3E34A 3U9WA 2MYOA 4JZYA 4DLOA 1OWNA 1JCRA 2I1JA 2WXMA 4WWPA 4B94A 3FH8A 1JPLA 3UM0A 3CSTA 2XGMA 4N5CA 2EILE 5ENNA 3D9MA 1KZPA 2GRQB 2V8SE 4GYYA 3CSFA 5FWQA 1EDUA 5JJ7A 3EIQC 3S7FA 3ZHEA 4HQDA 3ESKA 4GMLA 2IJGX 4K5CA 4HRLA 2ONDA 2I6HA 3CKBA 4JW1A 1JCSA 4N3CA 5T4YA 2GW1A 1TNZA 4YVQC 2VTBB 1JCQA 1X5BA 1FVHA 2ZU6B 2F8XK 4WUYA 3VTYA 3PNLB 3LEWA 3BQOA 5M72A 4GCNA 1Z3YA 1H2VC 4BEPA 4JA9A 4F7AA 4G1TA 1JWFA 2J09A 3DSSA 4NQ0A 3QKYA 3V31A 5FQ6A 2PZIA 3CVNA 3FUDA 5AYWD 4HOQA 5H7PA 3ASNE 5G2NA 4B8CB 4OVVA 4JC8A 4MS6A 5KWDA 3JXIA 4DX6D 4XEIG 4DX5D 3LXUX 3Q7AA 3HG0D 3PZ3A 4KT6B 3JCKC 3CV0A 2WQ6A 1GW6A 3PREA 3AS4A 4AIFA 1UW4B 2RD0A 5AQ7A 5G55A 1HS6A 3AG1E 3PNTB 4GA2A 3FULA 4J7WA 4CT0A 3FH5A 3E33A 1OCCE 2NC9A 4C9BB 1RZ4A 3KD7A 3RK6A 3SQVA 3R7RA 3FU3A
chains in the Genus database with same CATH topology
3P1UA 3ML8A 4AV7A 2Y4TA 2OVFA 2AXZA 3HYMB 4YNDA 1IQUA 3RKVA 2CG3A 3CEQA 4M3OA 3G2SA 4GAAA 3L6AA 4AP2A 5AIJA 3ESLA 4I2ZA 3OTNA 4WWNA 5FQ8A 5LCWJ 2WXKA 4WWOA 2VQ2A 2WQHA 4WAFA 3FTVA 3ONKA 3NZUA 2YHCA 3EJNA 3G2TA 4DPRA 3ASHA 2J4DA 3FP3A 2LAHA 4EPZA 1EYHA 1H0AA 3B13A 4H7XA 5CHEE 3EHNA 5FZSA 3EIJA 3QJZA 4J8FA 4J0UA 3VLDA 5BPPA 3TJPA 3LKUA 5LCWC 4JEHA 2VTBA 2HR2A 3CHPA 3QNKA 4AJWA 1UJKA 3TGOA 4TV3A 3S2AA 2WXIA 4Q96A 2QY7A 3ASGA 4G24A 3D9JA 1H6KA 1OWMA 3UUXA 4PDXA 3I4GA 2J9QA 4KVMA 3QK0A 4DJAA 2X38A 2R17C 4EZJA 3FEXA 4G25A 1MHQA 4XX5A 4CEMA 1TEZA 3FTWA 1UN8A 2KM4A 4PUCA 3CHSA 3ASDA 3WXXA 3MV2B 2XPZA 2FI7A 2C2LA 3KAEA 2MOWA 3LY8A 3MEKA 3C98A 3KEZA 4TUUA 4HOTA 2PL2A 4AVXA 2IU1A 5AJDA 4APFA 4ILHB 1IYGA 4A1SA 2X6IA 2Y3AA 3B7TA 3ML9A 2J4BA 3I5PA 2L0TB 4JXTA 4BTBA 4RSYA 4DI4A 4EZKA 3S7JA 3APCA 4GYOA 2E0IA 2WXFA 3ENEA 4GA0A 5ANRA 2XGSA 3FFLA 3FH7A 4MKTA 2L6JA 4N2QA 2AXVA 4NURA 1E7UA 1H2UA 2RG8A 2WXHA 4I1MA 1QNFA 1P5QA 4XE0A 2HO1A 1KT1A 3I4RB 3CHMA 3L22A 4FJZA 4UQXA 4L1BA 3Q15A 4L7TA 1SZAA 3SGHA 4CCAA 4B0ZA 2V5FA 1Y8MA 3TAXA 5BNWA 5LP0A 4UQYA 1EF1C 4HXIA 3VTXA 3IHVA 5A23A 5JHAA 3RRNB 3CVPA 1L5JA 3PRZA 1E8WA 3U66A 1QQEA 2CG2A 4GZDA 5ARGA 3FUMA 2XHEA 2KCLA 4BT9A 2P58C 1PY1A 2LAIA 4KZ0A 3AS8A 2VGXA 3UT8A 3GW4A 2FULA 4BFRA 3TG5A 4GCOA 5E76A 3URZA 3JUIA 3FEYA 3FDHA 3HHMA 1PAQA 3ZIMA 4AM9A 1Z3XA 4U63A 4B8AA 1A17A 4K03A 4RG9A 1UJJA 2VYIA 2KZTA 4LUNU 3SBSA 2XGOA 2X6KA 1E7VA 4IRUA 3D9IA 4Q94A 4QFVA 3RRMB 4ABNA 4CGWA 4U07A 3D3MA 4FA6A 4APOA 3G2UA 2GRLA 4MRUA 4WNDA 5FQ7A 4ILGA 4N3AA 3VLFA 3D9LA 3T5VA 4GU5A 4UI9J 2UY1A 4DI3A 2OOEA 4RVBA 3MA5A 2I9CA 1U3CA 2CFZA 2YQ8A 3CIAA 2ILRA 1H19A 3BG0B 3MJWA 3RO2A 3SD5A 3SNXA 1E8XA 4FJYA 3OAWA 4U0ZA 3FTUA 4NRHB 3BG1B 2LNIA 3GYZA 1FCHA 5T8IA 4AXHA 1Z6TA 2J08A 2KZTB 4I6EA 4LRZA 4EQFA 5EX0A 1JWGA 4UI9C 3G2WA 4I9CA 3ZYLA 2BF0X 5FJYA 4XI9A 2IF4A 4FHKA 4W9RA 2UY1B 3KS2A 2X3MA 2AXUA 3FTZA 4MLPA 3APDA 4IYPA 2OV8A 5G04C 1ELKA 1E8ZA 4N2SA 1ELRA 4NACA 2WMOA 5FT9A 2WXNA 2PM7A 3PUKA 3ZVVA 3NZSA 1IQRA 1SQMA 5J08A 5KCMA 4CDRA 4KYOB 3LCAA 4FADA 2CHZA 1XGWA 4L2YA 4UWFA 4UWLA 5JJ6A 4HLEA 2YHEA 4LCTA 3CHRA 4ANWA 1BPOA 5FZQA 3MX3A 2FEZA 3ZW3A 1UG3A 3B7SA 4BX8A 2GGFA 2PQRA 2HM8A 2FO7A 4G26A 5C1DA 2I2OA 3ULQA 5FQ4A 4R7LA 2NXPA 3QARA 1XNFA 5KJNA 4AOFA 3PEUB 4CDMA 1NZNA 5CMYA 3RIBA 3CGHA 3APFA 1NP7A 3FU0A 4GZ3A 3D9PA 4I6JA 5J90A 2WXGA 4ME2A 1OWOA 1NA3A 2IOSA 2XPIA 1S0PA 5BUZA 4UI9K 1HF8A 2WM9A 4BTAA 3FUIA 5AENA 3PUJA 4CDNA 3UT4A 3GZ1A 1INZA 2A5UA 2XRYA 3L13A 5CMWA 4I9EA 4KVOA 1E8YA 1DNPA 2WXLA 1OWLA 4FULA 1KLXA 3RRUA 4AEZC 4ATGA 4B89A 2L9BA 4RG6A 2XCBA 3LY9A 3QB2A 2WXQA 3FTSA 2CHXA 2NSZA 3U3WA 3JQ0A 2CFUA 4U8HA 4WNFA 3O48A 3K9IA 3ZN3A 3EHMA 4ANXA 1HO8A 4CGVA 4U0UA 5CCMA 3QWWA 3LYAA 2YNQA 2WXPA 4ANUA 3CVUA 4V3IA 2BUGA 2PQNA 3ZPJA 3PS6A 3R7QA 5C2YA 4G2VA 5LFAA 4L2LA 3OXLA 5BV1A 3O4ZA 2WXOA 3Q5MA 3SFZA 4DLQA 1HFAA 3MKQA 2LSUA 4KZCA 3IEGA 1ELWA 4P29A 5AJLA 4JL0A 3CK9A 2DBAA 3OXFA 4JA7A 4FLHA 5JJTA 3QDNA 3B7RL 3FUFA 3CVXA 2UWJG 4KXKB 4LEUA 3UPVA 3G2VA 2IOLA 1OWPA 3LDZA 3Q47B 2YINA 5EX3A 1SZ9A 2FBNA 4EZLA 5KJMA 3CQCB 4JHRA 2XQ0A 5LX8A 2J07A 1U3DA 2X6JA 3L16A 4BSXA 3MKQB 4F1SA 5KJLA 2VSXE 3DPDA 3HVEA 5EKQD 4GZ6A 3MKRA 3QC1A 5A7DB 5ANLA 3D9OA 4PS7A 5JHBA 4KMOA 2I1KA 4F53A 1KT0A 2VGYA 4ILIA 2M63A 2DCPA 2WB2A 3SZ7A 1YA0A 2WQ7A 2AW6A 1TJFA 3GZSA 3ONLA 3PZDA 5G05J 3CVWA 2JEKA 3SF4A 3PE4A 2CHWA 3PDNA 4BWRA 3I3NA 3HIZA 4D10C 1ZBPA 3ASFA 4LERA 4AY5A 4K0RA 3HVEB 3S7DA 4L23A 1N54A 4FHJA 4A1GA 1HG2A 2OVBA 4UWGA 2J49A 4JHKA 3ZYKA 4FU3A 4HORA 3NF1A 3LJ3A 1TJCA 3LS8A 4Y6WA 5G05C 4TRQA 3N71A 3CLJA 3RU0A 3U4TA 4BX9A 1WAO1 3RO3A 1HG5A 2VSNA 4I1OB 4JVSA 1UN9A 5BT1A 3FTXA 2VJ8A 3QOUA 3Q49B 3PEVB 4J8SA 3FUJA 3SI5A 2IFUA 3MYVA 2MHKA 4EBAG 4I1AA 3FHEA 4EBAA 3UT7A 3TXMA 4CRWA 3CVQA 5HQ8A 2BTDA 4OVUA 1HX8A 4PS8A 2FF4A 2IONA 3EDTB 3L54A 4XKBA 4BY6A 2KCKA 4N39A 2Y4UA 4FP7A 3QWVA 3IBEA 3FTYA 4XZ4A 2WMNA 3HDXA 3FUKA 3MGBA 3RJVA 3TXNA 3AS5A 1HZ4A 4A3VA 5A6CA 3D9KA 3FY4A 4ACLA 3VLEA 4I2WA 3QAQA 3Q4AB 3TL5A 4GMJA 3CHQA 3U9WA 5KJKA 4JZYA 2XRZA 4XIFA 4DLOA 2GRMA 5FZRA 4I43A 1OWNA 2I1JA 3E4BA 4HOUA 2WVIA 1W3BA 2WXMA 3B7UX 4GZ5A 4E6HA 3LY7A 3P2BA 2WPVA 4WWPA 3FH8A 3MCXA 4B94A 4I6GA 4C0EA 2X6HA 4Q69A 2MRIA 1JPLA 3UQ3A 2AWIA 2KATA 4JEUA 2V4LA 3CSTA 2XGMA 4N5CA 3OXGA 3BEEA 1H2TC 2AVPA 2QFCA 1QZ2A 4HS2A 1LF8A 4DK5A 5ENNA 2EQXA 3L17A 1HU3A 3D9MA 3FUHA 4BT8A 3FUNA 4HVBA 2V8SE 4GYYA 3CSFA 4AY6A 2R59A 4WNEA 2XEVA 5FWQA 3ZEFA 1EDUA 5JJ7A 2WXRA 3EIQC 3S7FA 3ZHEA 2LSVA 3SHFA 3L08A 3ESKA 4KBQA 4GMLA 4UWHA 3ZYMA 4A55A 2IJGX 4JPSA 2ONDA 2I6HA 3CKBA 3AU5A 3LVRE 5EDSA 3D9NA 3LVQE 1EPUA 1VDYA 4J6IA 2KCVA 4JW1A 4HOSA 5FTPA 4C0MA 1HXIA 4E85A 2E2EA 3JQ1A 4N3CA 3LPZA 1N52A 5T4YA 3R9AB 2LO6A 1E90A 4I17A 4XKCA 4EECA 2GW1A 3T8MA 4YVQC 2VTBB 3ZHEB 1X5BA 5E75A 1FVHA 4ACKA 5HI7A 1WY6A 2ZU6B 4JHJA 4WUYA 2Q7FA 1OUVA 3MZLB 2JLBA 3UX4A 3PH0C 1MQSA 3MV3B 3CVYA 1B89A 1HE8A 3VTYA 3CQGB 4GYWA 3PNLB 3LEWA 4PS3A 4GPKA 5M72A 3FWVA 3CVLA 1JUQA 5D0OD 4GCNA 3ZRHA 1IHGA 4G11A 3PE3A 3ZFWA 5BW8C 2KC7A 1Z3YA 2WXJA 1H2VC 4HFGA 3S7BA 3PVLA 3T5XA 4JA9A 4FLBA 4F7AA 2XCCA 2C0MA 1Y6IA 4G1TA 4U0SA 1JWFA 3FU6A 4WNGA 2J09A 4N3BA 4U04A 4NQ0A 1PC2A 3GZ2A 4G23A 3CKCA 4IULA 3QKYA 4ANVA 5FQ6A 4XI0A 2PZIA 3CVNA 4F3VA 3UMVA 5CCLA 3IKOB 4Y6CA 5D0QD 3FUDA 4GA1A 1ZU2A 5AYWD 3ZXSA 4HOQA 2PM6A 2DIWA 5G2NA 4B8CB 4OVVA 1WM5A 3FUEA 3JYSA 4JC8A 4MS6A 2A4ZA 2XPYA 4CT4A 4PH4B 3LXUX 5DIZA 2VGXB 2V0PA 3CK7A 4KT6B 2IQCA 3JCKC 2VSOE 3QWPA 2L0IA 3NQPA 3AU4A 1HH8A 3CV0A 4YVOA 5DBKA 1DVPA 2WQ6A 2R5SA 4O6FA 4A3TA 3CVVA 1GW6A 3PREA 3ZYQA 3AS4A 4IN3B 4AIFA 4J8DA 3TG4A 4URKA 4H7YA 5G04J 1UW4B 2RD0A 5G55A 1HS6A 5BV0A 3PNTB 4OYSA 2VSYA 4GA2A 5LOZA 3FULA 4GB9A 5ARFA 4CT0A 4GZCA 2X6FA 1FVFA 3DBSA 3IV0A 4J8EA 3IHYA 3FH5A 3FU5A 1E96B 2HYZA 2C0LA 3ZGQA 2NC9A 4FC8A 4UQZA 4C9BB 4UWKA 3KD7A 3RK6A 5T3RA 3U64A 3CR3A 1NA0A 3R7RA 3FU3A 3SBTB 3CK8A 3CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMJ A;  4IUL A;  2FUL A;  2ZU6 B;  2IOS A;  3EIQ C;  4JHJ A;  4CRW A;  2IOL A;  5ANR A;  3JUI A;  1UW4 B;  1H2U A;  2RG8 A;  3FEY A;  2ION A;  4GML A;  1H6K A;  1PAQ A;  1UG3 A;  2KZT B;  1N54 A;  3L6A A;  2GGF A;  2HM8 A;  4JHK A;  3FEX A;  4B8C B;  2I2O A;  2VSX E;  4B8A A;  4CEM A;  2KZT A;  4B89 A;  4LUN U;  4CT4 A;  1H2T C;  1H2V C;  4C9B B;  1N52 A;  3D3M A;  2IU1 A;  2NSZ A;  3RK6 A;  1HU3 A;  2VSO E;  3EIJ A; 
#chains in the Genus database with same CATH topology
 4YDY A;  3ML8 A;  2OVF A;  5KNG A;  1U2V G;  3TWX A;  3G2S A;  2P9S G;  3FTV A;  2F37 A;  4A63 B;  4DPR A;  2J4D A;  3B13 A;  5FZS A;  3EIJ A;  3QNK A;  4TV3 A;  3S2A A;  3D9J A;  1D9S A;  4PDX A;  3FTW A;  2KM4 A;  2XPZ A;  1N95 A;  2MOW A;  3MEK A;  4HOT A;  3KEZ A;  4AVX A;  5AJD A;  4APF A;  2GRR B;  4A1S A;  2X6I A;  4JXT A;  1TN8 A;  4RSY A;  2E0I A;  2WXF A;  4NUR A;  2WXH A;  4I1M A;  1KT1 A;  4FJZ A;  2LXL A;  4CCA A;  4B0Z A;  5LP0 A;  5BNW A;  3VTX A;  3CVP A;  1L5J A;  3AG2 E;  1QQE A;  2P58 C;  3AS8 A;  1OCR E;  3UT8 A;  4RQI A;  3GW4 A;  2FUL A;  5EYP F;  5E76 A;  4M7C A;  4K5B A;  3HHM A;  3ZIM A;  1Z3X A;  3PZ1 A;  4B8A A;  1YCS B;  4RG9 A;  5BXO A;  2KZT A;  4LUN U;  2ETC A;  4IRU A;  2QYJ A;  3DXM G;  4WND A;  2GRL A;  5FQ7 A;  1K3Z D;  4UI9 J;  4U96 D;  5B3S E;  2YQ8 A;  1H19 A;  3FTU A;  4NRH B;  3BG1 B;  3GYZ A;  5ENT D;  4C48 B;  4LRZ A;  1OCO E;  5EX0 A;  1JWG A;  3Q75 A;  4UI9 C;  2BF0 X;  4TXP A;  4W9R A;  4HI9 A;  2X3M A;  3APD A;  2OV8 A;  1ELK A;  1E8Z A;  2ZIS A;  2WMO A;  2WXN A;  3PUK A;  4HLE A;  2H6H A;  2YHE A;  4ANW A;  2FEZ A;  3BUA A;  3ZW3 A;  1DCQ A;  3RAU A;  3R9M A;  4R7L A;  3UIN C;  2OCC E;  1NZN A;  4O1O A;  3FU0 A;  4UUC A;  1OCZ E;  3C5R A;  4U95 D;  1OWO A;  5ENO D;  2IOS A;  3TWU A;  1S0P A;  5BUZ A;  1HF8 A;  2WM9 A;  5AEN A;  3L13 A;  5CMW A;  4I9E A;  1E8Y A;  4B89 A;  1KLX A;  4AEZ C;  3FTS A;  5CCM A;  3LYA A;  2WXP A;  2BUG A;  2PQN A;  3ZPJ A;  4G2V A;  5LFA A;  3EU5 A;  2DVW A;  2RFM A;  2WXO A;  2LSU A;  1ELW A;  1A5E A;  1RW2 A;  4JL0 A;  4FLH A;  3QDN A;  4GTT A;  2IOL A;  3LDZ A;  3Q47 B;  4OAV B;  1BLX B;  2ETB A;  2X6J A;  1U3D A;  3MKQ B;  1IKN D;  3DPD A;  5EKQ D;  5A7D B;  5JHB A;  2IEJ A;  3J5Q B;  4F53 A;  2VGY A;  2V5Q C;  2DCP A;  2WB2 A;  1YA0 A;  3CVW A;  1ZB1 A;  3WG7 E;  3I3N A;  5AAO A;  4D10 C;  2H6F A;  4LSZ E;  4K0R A;  3S7D A;  1HG2 A;  1TN7 A;  4BER A;  4UWG A;  4JHK A;  3LS8 A;  3CLJ A;  4BX9 A;  3RO3 A;  2VSN A;  4JVS A;  3QOU A;  3Q49 B;  2IFU A;  3MYV A;  3HXC A;  3FHE A;  4I1A A;  3UT7 A;  4PS8 A;  2ION A;  5AQB A;  2XS1 A;  1HZ4 A;  4HB5 A;  2P9L G;  4A3V A;  3FY4 A;  5CED B;  3TL5 A;  5KJK A;  2XRZ A;  4XIF A;  5FZR A;  3W9G A;  4NIK A;  2IO2 C;  1W3B A;  4GZ5 A;  4E6H A;  3LY7 A;  1QBQ A;  2WPV A;  4Q69 A;  3MCX A;  4I6G A;  4C0E A;  2MRI A;  3UQ3 A;  3ZNG A;  4JEU A;  1H2T C;  2AVP A;  4HS2 A;  1LF8 A;  1OT8 A;  3ZEF A;  2WXR A;  5CER B;  4UWH A;  2P9U G;  5D66 A;  1D8D A;  5EDS A;  2FO1 E;  2DYR E;  1EPU A;  2KCV A;  4HRM B;  2R02 A;  4E85 A;  5JMN D;  4YDE A;  3LJN A;  3MZL B;  3UX4 A;  1MQS A;  3CVY A;  1HE8 A;  1BI8 B;  4U8V D;  4GYW A;  4PS3 A;  3CVL A;  4OAU C;  2HE0 A;  1IHG A;  3PE3 A;  5HRY A;  3ZFW A;  3T5X A;  4GMR A;  3X2Q E;  2C0M A;  2Y69 E;  4U0S A;  3FU6 A;  4N3B A;  4U04 A;  2F8Y A;  3GZ2 A;  3CKC A;  4XI0 A;  2ZGG A;  3KEA A;  4F3V A;  5CCL A;  1ZU2 A;  2DIW A;  5ITZ F;  5DIZ A;  2IQC A;  3QWP A;  2BKK B;  1HH8 A;  4G8L A;  4O6F A;  4IN3 B;  4J8D A;  5G04 J;  5BV0 A;  2VSY A;  5LOZ A;  4DX1 A;  4GZC A;  1FVF A;  3FU5 A;  4FC8 A;  1MX6 A;  5AN8 A;  1NA0 A;  2V4H C;  4GTM A;  3P1U A;  2AXZ A;  3HYM B;  4DX2 A;  1IQU A;  2OEW A;  4TUM A;  3RKV A;  2CG3 A;  3L6A A;  4AP2 A;  2VQ2 A;  3UIO C;  3Q9N C;  2LAH A;  1H0A A;  4GTQ A;  4H7X A;  3EHN A;  4RLY A;  2ZGD A;  3SFX A;  4J8F A;  3VLD A;  1DC2 A;  4MBG A;  3LKU A;  2HR2 A;  3CHP A;  4G24 A;  1H6K A;  4YDW A;  1TNB A;  2J9Q A;  4DJA A;  3KSL A;  4XX5 A;  2QYU A;  3ASD A;  3WXX A;  3LY8 A;  1FT2 A;  4BTB A;  2H6I A;  3S7J A;  4GYO A;  1MYO A;  3FH7 A;  1H2U A;  1QNF A;  4J8Y A;  2HO1 A;  4X8Q A;  4L1B A;  3Q15 A;  2IY0 C;  2V5F A;  4HXI A;  3NOG D;  1TNU A;  5A23 A;  3RRN B;  3U66 A;  1K1A A;  3UM2 A;  4GZD A;  3ZKJ A;  1PY1 A;  2VGX A;  3TG5 A;  1TN6 A;  3JUI A;  1A17 A;  4LNG A;  2X6K A;  1E7V A;  4Z68 A;  3RRM B;  3UIP C;  4CGW A;  4FA6 A;  4APO A;  4ILG A;  4GU5 A;  4TXQ A;  2OOE A;  4RVB A;  3CIA A;  2ILR A;  4ATZ D;  2LNI A;  2J08 A;  2GRO B;  4EHM A;  4EQF A;  3G2W A;  4I9C A;  3ZYL A;  2L6B A;  3TWR A;  4XI9 A;  3ABL E;  1O5M A;  4LG6 A;  2AXU A;  3FTZ A;  4IYP A;  3C3R A;  1ELR A;  3ZVV A;  1IQR A;  3LCA A;  5JJ6 A;  4UWL A;  4LCT A;  2BKG A;  3CHR A;  1OXJ A;  1UG3 A;  4QQI A;  2GGF A;  2PQR A;  4G26 A;  2FO7 A;  1AP7 A;  2I2O A;  3Q9U C;  4HNA D;  4HBD A;  5CMY A;  3CGH A;  3APF A;  4GZ3 A;  3UM1 A;  3V2X A;  4I6J A;  2WXG A;  3EUV A;  3UI2 A;  2XPI A;  3GZ1 A;  5CBN A;  2PNN A;  1YYH A;  1DNP A;  1OWL A;  4ATG A;  2XCB A;  3JXJ A;  3QB2 A;  3JQ0 A;  1TR4 A;  3E32 A;  4WNF A;  4CGV A;  4HRN A;  2YNQ A;  4O60 A;  3R7Q A;  3ASO E;  4L2L A;  5BV1 A;  3Q73 A;  1KPS B;  3DST A;  4GTO A;  4DLQ A;  1HFA A;  3MKQ A;  5AJL A;  3CK9 A;  2DBA A;  3FUF A;  3J5P A;  4LEU A;  5EX3 A;  2FBN A;  4EZL A;  5KJM A;  2XQ0 A;  4BSX A;  4F1S A;  2VSX E;  3ZUV B;  3MKR A;  3QC1 A;  1TYQ G;  3NBN B;  4KMO A;  1Q2Z A;  4ILI A;  3TWQ A;  1BD8 A;  2AW6 A;  5G05 J;  3PE4 A;  2CHW A;  4BWR A;  2RKK A;  3HIZ A;  1ZBP A;  3HVE B;  4L23 A;  2OVB A;  2J49 A;  3NF1 A;  1TJC A;  5G05 C;  4TRQ A;  3N71 A;  2A5E A;  5BT1 A;  5AQ9 A;  1SA4 A;  3DWL G;  4HI8 A;  2MHK A;  3B7B A;  3CVQ A;  4OVU A;  3L54 A;  4XKB A;  2R2L A;  3QWV A;  4L9P A;  3FTY A;  4JB8 P;  4XZ4 A;  3FUK A;  3MGB A;  3D9K A;  3VLE A;  3UKR G;  2GRM A;  4I43 A;  2WVI A;  1QYM A;  3KSQ A;  2AWI A;  3OXG A;  3BEE A;  3E37 A;  4DK5 A;  3L17 A;  1O1R A;  1HU3 A;  3FUH A;  4HVB A;  4TXR A;  2XEV A;  3L08 A;  4KBQ A;  4A55 A;  3D9N A;  3TWV A;  3LVQ E;  1VDY A;  4J6I A;  1IHB A;  5FTP A;  4C0M A;  4GPM A;  1HXI A;  3LPZ A;  4EEC A;  3R9A B;  1E90 A;  3T8M A;  5E75 A;  1TNY A;  5HI7 A;  1WY6 A;  4JHJ A;  1OUV A;  2JLB A;  3MV3 B;  1B89 A;  2BED A;  4GPK A;  1JUQ A;  4G11 A;  3NB2 A;  5BW8 C;  2KC7 A;  2WXJ A;  3PVL A;  5EN5 D;  2XCC A;  1Y6I A;  4F1P A;  4WNG A;  4IUL A;  3SO8 A;  5KBA A;  3IKO B;  4Y6C A;  5JA4 D;  1WM5 A;  3FUE A;  1WDY A;  2XPY A;  4CT4 A;  4PH4 B;  2H6G A;  2L0I A;  3NQP A;  3AU4 A;  4K5A B;  2DZN A;  4YVO A;  5DBK A;  3CVV A;  2R5S A;  4A3T A;  5CRV A;  1H6P A;  3DBS A;  3IV0 A;  4J8E A;  1MX2 A;  2HYZ A;  2C0L A;  3ZGQ A;  4UWK A;  3U64 A;  5T3R A;  3CR3 A;  5ENR D;  4AV7 A;  4GTR A;  3DSU A;  3ULY A;  4M3O A;  2RFA A;  4GAA A;  5AIJ A;  3ESL A;  5FQ8 A;  4WAF A;  3ONK A;  3EJN A;  4EPZ A;  1EYH A;  5CHE E;  3QJZ A;  4J0U A;  4JEH A;  2VTB A;  4AJW A;  1BI7 B;  1UJK A;  2QY7 A;  3ASG A;  1OWM A;  3UUX A;  5ENS D;  4KVM A;  3QK0 A;  2R17 C;  4CEM A;  1UN8 A;  4PUC A;  3KAE A;  2ETA A;  3C98 A;  4TUU A;  2PL2 A;  2IU1 A;  1IYG A;  1DCE A;  3B7T A;  3ML9 A;  2J4B A;  3I5P A;  2L0T B;  4DI4 A;  4EZK A;  3APC A;  3FFL A;  4MKT A;  4N2Q A;  2AXV A;  2XZD G;  3I4R B;  3L22 A;  3SGH A;  5HS0 A;  2EIK E;  3IHV A;  3EHQ A;  5JHA A;  3PRZ A;  1E8W A;  2P9K G;  2CG2 A;  3V30 A;  5ARG A;  2KCL A;  2LAI A;  4HLL A;  4KZ0 A;  4ZHB A;  4GCO A;  3FDH A;  5FIO A;  3IXE A;  3D9I A;  4Q94 A;  4QFV A;  4U07 A;  3G2U A;  4DI3 A;  2CFZ A;  3BG0 B;  3MJW A;  3RO2 A;  3SD5 A;  2XEH A;  1E8X A;  3SNX A;  4DRX E;  3OAW A;  2DZO A;  1FCH A;  5T8I A;  3BU8 A;  1LTX A;  1AWC B;  5FJY A;  2IF4 A;  2QC9 A;  2UY1 B;  3KS2 A;  4MLP A;  3V2O A;  1H6O A;  5G04 C;  4N2S A;  5FT9 A;  4GTP A;  3NZS A;  4KYO B;  4FAD A;  4UWF A;  1XGW A;  1BPO A;  3ZU7 B;  5FZQ A;  5FIN A;  4BX8 A;  5C1D A;  5FQ4 A;  2NXP A;  2P2C P;  3QAR A;  1XNF A;  3TWS A;  4AOF A;  3PEU B;  4CDM A;  1N4S A;  2Y1L E;  3NOC D;  4ME2 A;  1NA3 A;  4UI9 K;  3FUI A;  2ZIR A;  3PUJ A;  4CDN A;  3UT4 A;  2A5U A;  4KVO A;  2EIN E;  5B1B E;  4GTV A;  2WXL A;  4FUL A;  3RRU A;  1OY3 D;  2WXQ A;  2CHX A;  2NSZ A;  2VGE A;  4U8H A;  1UOH A;  1YMP A;  3K9I A;  1HO8 A;  4U0U A;  3PS6 A;  3Q79 A;  3OXL A;  5BXU A;  3O4Z A;  1N9A A;  1N4Q A;  3IEG A;  2EIJ E;  3DSX A;  3DSV A;  3OXF A;  4JA7 A;  3UPV A;  1OWP A;  2P9I G;  2YIN A;  1MX4 A;  2J07 A;  3L16 A;  3D9H A;  5KJL A;  3HVE A;  3D9O A;  4PS7 A;  1KT0 A;  2B6C A;  2J8S D;  2M63 A;  3AG4 E;  1TJF A;  3GZS A;  3ONL A;  1WG0 A;  1X81 A;  2JEK A;  3SF4 A;  2P9N G;  3UTM A;  4AY5 A;  1N54 A;  3ZYK A;  4FU3 A;  4HOR A;  3LJ3 A;  3U4T A;  3HXF A;  3RU0 A;  1WAO 1;  1HG5 A;  1FPP A;  2GRN B;  1S63 A;  3FTX A;  3T8K A;  3PEV B;  4J8S A;  3FUJ A;  4BES A;  4EBA G;  3ABM E;  3TXM A;  1N0Q A;  4CRW A;  3SFY A;  5HQ8 A;  3HXE A;  1HX8 A;  2GRP B;  3ZXP A;  4BY6 A;  2KCK A;  4N39 A;  3IBE A;  1N11 A;  2WMN A;  4O1P A;  2OEV A;  3RJV A;  3TXN A;  4ACL A;  4I2W A;  4GMJ A;  3CHQ A;  1NI1 A;  3E4B A;  4HOU A;  3B7U X;  1S70 B;  3P2B A;  2X6H A;  2KAT A;  2V4L A;  3EU9 A;  3Q7F A;  2QFC A;  1QZ2 A;  3E30 A;  3UKU G;  3UM3 A;  2EQX A;  3TWW A;  4BT8 A;  3FUN A;  4BET A;  4LNB A;  4AY6 A;  2R59 A;  4WNE A;  2LSV A;  3SHF A;  3ZYM A;  4JPS A;  3AU5 A;  3LVR E;  4CYM D;  2B0O E;  3DXK G;  4HOS A;  2E2E A;  3JQ1 A;  1N52 A;  2LO6 A;  4I17 A;  4XKC A;  3ZHE B;  1O1T A;  4ACK A;  1MJ0 A;  2Q7F A;  3PH0 C;  1S64 A;  5AAR A;  1NFI E;  3CQG B;  1N94 A;  3DPY A;  3FWV A;  5D0O D;  3ZRH A;  3SY2 A;  4LNU D;  4HFG A;  3S7B A;  5CEA A;  4FLB A;  3DSW A;  1PC2 A;  4G23 A;  2ZXW E;  4ANV A;  4DX7 D;  4DUI A;  3UMV A;  5D0Q D;  4GA1 A;  3ZXS A;  2PM6 A;  2EIM E;  2DWZ A;  4ZFH A;  3JYS A;  2A4Z A;  1V55 E;  3RSE G;  2VGX B;  2V0P A;  3CK7 A;  2VSO E;  1SA5 A;  1DVP A;  3ZYQ A;  3AAA C;  3TG4 A;  4URK A;  3ABK E;  4H7Y A;  5EID A;  4OYS A;  4GB9 A;  5ARF A;  2X6F A;  3ISM C;  3IHY A;  1E96 B;  4UQZ A;  3PZ4 A;  3SBT B;  3CK8 A;  3CHO A;  4N5Q A;  2Y4T A;  4YND A;  3DRA A;  5CRU A;  1V54 E;  5EIB E;  3CEQ A;  5CBO A;  4I2Z A;  3OTN A;  4WWN A;  5LCW J;  2WXK A;  4WWO A;  1N4P A;  2WQH A;  4U7E B;  3NZU A;  2YHC A;  4B93 B;  2AJA A;  3G2T A;  2R05 A;  3ASH A;  3FP3 A;  1BU9 A;  5BPP A;  3TJP A;  5LCW C;  2XEN A;  3TGO A;  2WXI A;  4Q96 A;  3TWT A;  3I4G A;  4EZJ A;  1TNO A;  2X38 A;  3FEX A;  4G25 A;  1MHQ A;  1TEZ A;  3CHS A;  2XS8 A;  3MV2 B;  2FI7 A;  2C2L A;  3HXB A;  4ILH B;  2Y3A A;  2Y0B G;  5EIL A;  3B95 A;  3ENE A;  4GA0 A;  5ANR A;  2XGS A;  2L6J A;  4XE0 A;  1E7U A;  2RG8 A;  1P5Q A;  3CHM A;  4UQX A;  4L7T A;  1SZA A;  5B1A E;  1G3N B;  1Y8M A;  3TAX A;  4UQY A;  1EF1 C;  2LUH A;  3FUM A;  2KBX A;  2XHE A;  4BT9 A;  1K1B A;  3C3Q A;  1FT1 A;  4BFR A;  5HKP A;  3W9F A;  3DEO A;  3URZ A;  3FEY A;  3UXG A;  1PAQ A;  4AM9 A;  4U63 A;  4K03 A;  1UJJ A;  2VYI A;  3SBS A;  2XGO A;  4GTS A;  4ABN A;  3D3M A;  1SW6 A;  3VLF A;  4MRU A;  4N3A A;  3T5V A;  3D9L A;  2UY1 A;  3NAW A;  3MA5 A;  2I9C A;  1U3C A;  3Q78 A;  2LXM A;  4FJY A;  4U0Z A;  4AXH A;  1Z6T A;  2KZT B;  4I6E A;  4CZ2 D;  5CEC B;  4F6R D;  4FHK A;  3AJI A;  4NAC A;  1O1S A;  2PM7 A;  5EYL A;  1SQM A;  5J08 A;  5KCM A;  4CDR A;  2CHZ A;  4L2Y A;  3ULE G;  3MX3 A;  1Z5S C;  3B7S A;  2HM8 A;  3ULQ A;  1LD8 A;  5KJN A;  2F0Y A;  1N4R A;  3RIB A;  1NP7 A;  2DYS E;  3D9P A;  5J90 A;  3C3O A;  4G8K A;  1N0R A;  4BTA A;  3AG3 E;  3EHR A;  1INZ A;  3V79 K;  2XRY A;  4JD2 G;  2JAB A;  1NL4 A;  2L9B A;  4RG6 A;  3LY9 A;  4BSZ B;  3U3W A;  3HRA A;  2CFU A;  3O48 A;  3ZN3 A;  3EHM A;  4ANX A;  3QWW A;  4ANU A;  3CVU A;  2P9P G;  2XZT G;  4V3I A;  5C2Y A;  3PZ2 A;  2NYJ A;  3SFZ A;  3Q5M A;  1SVX A;  4YDO A;  5KNH D;  4KZC A;  3F6Q A;  4P29 A;  5AQA A;  5JJT A;  3B7R L;  3CVX A;  2UWJ G;  5IY5 E;  4KXK B;  2R03 A;  3G2V A;  2IO3 C;  1SZ9 A;  2XEE A;  3CQC B;  4JHR A;  5LX8 A;  5D2M C;  4GZ6 A;  5ANL A;  5ENP D;  2I1K A;  5ENQ D;  4U8Y D;  3SZ7 A;  2WQ7 A;  3L9T A;  3PZD A;  2QZA A;  1LD7 A;  3C72 A;  3DEP A;  3PDN A;  3L82 A;  1K8K G;  3ASF A;  4LER A;  4FHJ A;  4A1G A;  1IXV A;  4Y6W A;  1D8E A;  4I1O B;  1UN9 A;  3T9K A;  2VJ8 A;  3SI5 A;  2KXP C;  4EBA A;  1MZC A;  2BTD A;  2FF4 A;  3EDT B;  3JUE A;  3HXD A;  2Y4U A;  4FP7 A;  3HDX A;  1KZO A;  3AS5 A;  5A6C A;  3QAQ A;  3Q4A B;  3E34 A;  3U9W A;  2MYO A;  4JZY A;  4DLO A;  1OWN A;  1JCR A;  2I1J A;  2WXM A;  4WWP A;  4B94 A;  3FH8 A;  1JPL A;  3UM0 A;  3CST A;  2XGM A;  4N5C A;  2EIL E;  5ENN A;  3D9M A;  1KZP A;  2GRQ B;  2V8S E;  4GYY A;  3CSF A;  5FWQ A;  1EDU A;  5JJ7 A;  3EIQ C;  3S7F A;  3ZHE A;  4HQD A;  3ESK A;  4GML A;  2IJG X;  4K5C A;  4HRL A;  2OND A;  2I6H A;  3CKB A;  4JW1 A;  1JCS A;  4N3C A;  5T4Y A;  2GW1 A;  1TNZ A;  4YVQ C;  2VTB B;  1JCQ A;  1X5B A;  1FVH A;  2ZU6 B;  2F8X K;  4WUY A;  3VTY A;  3PNL B;  3LEW A;  3BQO A;  5M72 A;  4GCN A;  1Z3Y A;  1H2V C;  4BEP A;  4JA9 A;  4F7A A;  4G1T A;  1JWF A;  2J09 A;  3DSS A;  4NQ0 A;  3QKY A;  3V31 A;  5FQ6 A;  2PZI A;  3CVN A;  3FUD A;  5AYW D;  4HOQ A;  5H7P A;  3ASN E;  5G2N A;  4B8C B;  4OVV A;  4JC8 A;  4MS6 A;  5KWD A;  3JXI A;  4DX6 D;  4XEI G;  4DX5 D;  3LXU X;  3Q7A A;  3HG0 D;  3PZ3 A;  4KT6 B;  3JCK C;  3CV0 A;  2WQ6 A;  1GW6 A;  3PRE A;  3AS4 A;  4AIF A;  1UW4 B;  2RD0 A;  5AQ7 A;  5G55 A;  1HS6 A;  3AG1 E;  3PNT B;  4GA2 A;  3FUL A;  4J7W A;  4CT0 A;  3FH5 A;  3E33 A;  1OCC E;  2NC9 A;  4C9B B;  1RZ4 A;  3KD7 A;  3RK6 A;  3SQV A;  3R7R A;  3FU3 A; 
#chains in the Genus database with same CATH homology
 3P1U A;  3ML8 A;  4AV7 A;  2Y4T A;  2OVF A;  2AXZ A;  3HYM B;  4YND A;  1IQU A;  3RKV A;  2CG3 A;  3CEQ A;  4M3O A;  3G2S A;  4GAA A;  3L6A A;  4AP2 A;  5AIJ A;  3ESL A;  4I2Z A;  3OTN A;  4WWN A;  5FQ8 A;  5LCW J;  2WXK A;  4WWO A;  2VQ2 A;  2WQH A;  4WAF A;  3FTV A;  3ONK A;  3NZU A;  2YHC A;  3EJN A;  3G2T A;  4DPR A;  3ASH A;  2J4D A;  3FP3 A;  2LAH A;  4EPZ A;  1EYH A;  1H0A A;  3B13 A;  4H7X A;  5CHE E;  3EHN A;  5FZS A;  3EIJ A;  3QJZ A;  4J8F A;  4J0U A;  3VLD A;  5BPP A;  3TJP A;  3LKU A;  5LCW C;  4JEH A;  2VTB A;  2HR2 A;  3CHP A;  3QNK A;  4AJW A;  1UJK A;  3TGO A;  4TV3 A;  3S2A A;  2WXI A;  4Q96 A;  2QY7 A;  3ASG A;  4G24 A;  3D9J A;  1H6K A;  1OWM A;  3UUX A;  4PDX A;  3I4G A;  2J9Q A;  4KVM A;  3QK0 A;  4DJA A;  2X38 A;  2R17 C;  4EZJ A;  3FEX A;  4G25 A;  1MHQ A;  4XX5 A;  4CEM A;  1TEZ A;  3FTW A;  1UN8 A;  2KM4 A;  4PUC A;  3CHS A;  3ASD A;  3WXX A;  3MV2 B;  2XPZ A;  2FI7 A;  2C2L A;  3KAE A;  2MOW A;  3LY8 A;  3MEK A;  3C98 A;  3KEZ A;  4TUU A;  4HOT A;  2PL2 A;  4AVX A;  2IU1 A;  5AJD A;  4APF A;  4ILH B;  1IYG A;  4A1S A;  2X6I A;  2Y3A A;  3B7T A;  3ML9 A;  2J4B A;  3I5P A;  2L0T B;  4JXT A;  4BTB A;  4RSY A;  4DI4 A;  4EZK A;  3S7J A;  3APC A;  4GYO A;  2E0I A;  2WXF A;  3ENE A;  4GA0 A;  5ANR A;  2XGS A;  3FFL A;  3FH7 A;  4MKT A;  2L6J A;  4N2Q A;  2AXV A;  4NUR A;  1E7U A;  1H2U A;  2RG8 A;  2WXH A;  4I1M A;  1QNF A;  1P5Q A;  4XE0 A;  2HO1 A;  1KT1 A;  3I4R B;  3CHM A;  3L22 A;  4FJZ A;  4UQX A;  4L1B A;  3Q15 A;  4L7T A;  1SZA A;  3SGH A;  4CCA A;  4B0Z A;  2V5F A;  1Y8M A;  3TAX A;  5BNW A;  5LP0 A;  4UQY A;  1EF1 C;  4HXI A;  3VTX A;  3IHV A;  5A23 A;  5JHA A;  3RRN B;  3CVP A;  1L5J A;  3PRZ A;  1E8W A;  3U66 A;  1QQE A;  2CG2 A;  4GZD A;  5ARG A;  3FUM A;  2XHE A;  2KCL A;  4BT9 A;  2P58 C;  1PY1 A;  2LAI A;  4KZ0 A;  3AS8 A;  2VGX A;  3UT8 A;  3GW4 A;  2FUL A;  4BFR A;  3TG5 A;  4GCO A;  5E76 A;  3URZ A;  3JUI A;  3FEY A;  3FDH A;  3HHM A;  1PAQ A;  3ZIM A;  4AM9 A;  1Z3X A;  4U63 A;  4B8A A;  1A17 A;  4K03 A;  4RG9 A;  1UJJ A;  2VYI A;  2KZT A;  4LUN U;  3SBS A;  2XGO A;  2X6K A;  1E7V A;  4IRU A;  3D9I A;  4Q94 A;  4QFV A;  3RRM B;  4ABN A;  4CGW A;  4U07 A;  3D3M A;  4FA6 A;  4APO A;  3G2U A;  2GRL A;  4MRU A;  4WND A;  5FQ7 A;  4ILG A;  4N3A A;  3VLF A;  3D9L A;  3T5V A;  4GU5 A;  4UI9 J;  2UY1 A;  4DI3 A;  2OOE A;  4RVB A;  3MA5 A;  2I9C A;  1U3C A;  2CFZ A;  2YQ8 A;  3CIA A;  2ILR A;  1H19 A;  3BG0 B;  3MJW A;  3RO2 A;  3SD5 A;  3SNX A;  1E8X A;  4FJY A;  3OAW A;  4U0Z A;  3FTU A;  4NRH B;  3BG1 B;  2LNI A;  3GYZ A;  1FCH A;  5T8I A;  4AXH A;  1Z6T A;  2J08 A;  2KZT B;  4I6E A;  4LRZ A;  4EQF A;  5EX0 A;  1JWG A;  4UI9 C;  3G2W A;  4I9C A;  3ZYL A;  2BF0 X;  5FJY A;  4XI9 A;  2IF4 A;  4FHK A;  4W9R A;  2UY1 B;  3KS2 A;  2X3M A;  2AXU A;  3FTZ A;  4MLP A;  3APD A;  4IYP A;  2OV8 A;  5G04 C;  1ELK A;  1E8Z A;  4N2S A;  1ELR A;  4NAC A;  2WMO A;  5FT9 A;  2WXN A;  2PM7 A;  3PUK A;  3ZVV A;  3NZS A;  1IQR A;  1SQM A;  5J08 A;  5KCM A;  4CDR A;  4KYO B;  3LCA A;  4FAD A;  2CHZ A;  1XGW A;  4L2Y A;  4UWF A;  4UWL A;  5JJ6 A;  4HLE A;  2YHE A;  4LCT A;  3CHR A;  4ANW A;  1BPO A;  5FZQ A;  3MX3 A;  2FEZ A;  3ZW3 A;  1UG3 A;  3B7S A;  4BX8 A;  2GGF A;  2PQR A;  2HM8 A;  2FO7 A;  4G26 A;  5C1D A;  2I2O A;  3ULQ A;  5FQ4 A;  4R7L A;  2NXP A;  3QAR A;  1XNF A;  5KJN A;  4AOF A;  3PEU B;  4CDM A;  1NZN A;  5CMY A;  3RIB A;  3CGH A;  3APF A;  1NP7 A;  3FU0 A;  4GZ3 A;  3D9P A;  4I6J A;  5J90 A;  2WXG A;  4ME2 A;  1OWO A;  1NA3 A;  2IOS A;  2XPI A;  1S0P A;  5BUZ A;  4UI9 K;  1HF8 A;  2WM9 A;  4BTA A;  3FUI A;  5AEN A;  3PUJ A;  4CDN A;  3UT4 A;  3GZ1 A;  1INZ A;  2A5U A;  2XRY A;  3L13 A;  5CMW A;  4I9E A;  4KVO A;  1E8Y A;  1DNP A;  2WXL A;  1OWL A;  4FUL A;  1KLX A;  3RRU A;  4AEZ C;  4ATG A;  4B89 A;  2L9B A;  4RG6 A;  2XCB A;  3LY9 A;  3QB2 A;  2WXQ A;  3FTS A;  2CHX A;  2NSZ A;  3U3W A;  3JQ0 A;  2CFU A;  4U8H A;  4WNF A;  3O48 A;  3K9I A;  3ZN3 A;  3EHM A;  4ANX A;  1HO8 A;  4CGV A;  4U0U A;  5CCM A;  3QWW A;  3LYA A;  2YNQ A;  2WXP A;  4ANU A;  3CVU A;  4V3I A;  2BUG A;  2PQN A;  3ZPJ A;  3PS6 A;  3R7Q A;  5C2Y A;  4G2V A;  5LFA A;  4L2L A;  3OXL A;  5BV1 A;  3O4Z A;  2WXO A;  3Q5M A;  3SFZ A;  4DLQ A;  1HFA A;  3MKQ A;  2LSU A;  4KZC A;  3IEG A;  1ELW A;  4P29 A;  5AJL A;  4JL0 A;  3CK9 A;  2DBA A;  3OXF A;  4JA7 A;  4FLH A;  5JJT A;  3QDN A;  3B7R L;  3FUF A;  3CVX A;  2UWJ G;  4KXK B;  4LEU A;  3UPV A;  3G2V A;  2IOL A;  1OWP A;  3LDZ A;  3Q47 B;  2YIN A;  5EX3 A;  1SZ9 A;  2FBN A;  4EZL A;  5KJM A;  3CQC B;  4JHR A;  2XQ0 A;  5LX8 A;  2J07 A;  1U3D A;  2X6J A;  3L16 A;  4BSX A;  3MKQ B;  4F1S A;  5KJL A;  2VSX E;  3DPD A;  3HVE A;  5EKQ D;  4GZ6 A;  3MKR A;  3QC1 A;  5A7D B;  5ANL A;  3D9O A;  4PS7 A;  5JHB A;  4KMO A;  2I1K A;  4F53 A;  1KT0 A;  2VGY A;  4ILI A;  2M63 A;  2DCP A;  2WB2 A;  3SZ7 A;  1YA0 A;  2WQ7 A;  2AW6 A;  1TJF A;  3GZS A;  3ONL A;  3PZD A;  5G05 J;  3CVW A;  2JEK A;  3SF4 A;  3PE4 A;  2CHW A;  3PDN A;  4BWR A;  3I3N A;  3HIZ A;  4D10 C;  1ZBP A;  3ASF A;  4LER A;  4AY5 A;  4K0R A;  3HVE B;  3S7D A;  4L23 A;  1N54 A;  4FHJ A;  4A1G A;  1HG2 A;  2OVB A;  4UWG A;  2J49 A;  4JHK A;  3ZYK A;  4FU3 A;  4HOR A;  3NF1 A;  3LJ3 A;  1TJC A;  3LS8 A;  4Y6W A;  5G05 C;  4TRQ A;  3N71 A;  3CLJ A;  3RU0 A;  3U4T A;  4BX9 A;  1WAO 1;  3RO3 A;  1HG5 A;  2VSN A;  4I1O B;  4JVS A;  1UN9 A;  5BT1 A;  3FTX A;  2VJ8 A;  3QOU A;  3Q49 B;  3PEV B;  4J8S A;  3FUJ A;  3SI5 A;  2IFU A;  3MYV A;  2MHK A;  4EBA G;  4I1A A;  3FHE A;  4EBA A;  3UT7 A;  3TXM A;  4CRW A;  3CVQ A;  5HQ8 A;  2BTD A;  4OVU A;  1HX8 A;  4PS8 A;  2FF4 A;  2ION A;  3EDT B;  3L54 A;  4XKB A;  4BY6 A;  2KCK A;  4N39 A;  2Y4U A;  4FP7 A;  3QWV A;  3IBE A;  3FTY A;  4XZ4 A;  2WMN A;  3HDX A;  3FUK A;  3MGB A;  3RJV A;  3TXN A;  3AS5 A;  1HZ4 A;  4A3V A;  5A6C A;  3D9K A;  3FY4 A;  4ACL A;  3VLE A;  4I2W A;  3QAQ A;  3Q4A B;  3TL5 A;  4GMJ A;  3CHQ A;  3U9W A;  5KJK A;  4JZY A;  2XRZ A;  4XIF A;  4DLO A;  2GRM A;  5FZR A;  4I43 A;  1OWN A;  2I1J A;  3E4B A;  4HOU A;  2WVI A;  1W3B A;  2WXM A;  3B7U X;  4GZ5 A;  4E6H A;  3LY7 A;  3P2B A;  2WPV A;  4WWP A;  3FH8 A;  3MCX A;  4B94 A;  4I6G A;  4C0E A;  2X6H A;  4Q69 A;  2MRI A;  1JPL A;  3UQ3 A;  2AWI A;  2KAT A;  4JEU A;  2V4L A;  3CST A;  2XGM A;  4N5C A;  3OXG A;  3BEE A;  1H2T C;  2AVP A;  2QFC A;  1QZ2 A;  4HS2 A;  1LF8 A;  4DK5 A;  5ENN A;  2EQX A;  3L17 A;  1HU3 A;  3D9M A;  3FUH A;  4BT8 A;  3FUN A;  4HVB A;  2V8S E;  4GYY A;  3CSF A;  4AY6 A;  2R59 A;  4WNE A;  2XEV A;  5FWQ A;  3ZEF A;  1EDU A;  5JJ7 A;  2WXR A;  3EIQ C;  3S7F A;  3ZHE A;  2LSV A;  3SHF A;  3L08 A;  3ESK A;  4KBQ A;  4GML A;  4UWH A;  3ZYM A;  4A55 A;  2IJG X;  4JPS A;  2OND A;  2I6H A;  3CKB A;  3AU5 A;  3LVR E;  5EDS A;  3D9N A;  3LVQ E;  1EPU A;  1VDY A;  4J6I A;  2KCV A;  4JW1 A;  4HOS A;  5FTP A;  4C0M A;  1HXI A;  4E85 A;  2E2E A;  3JQ1 A;  4N3C A;  3LPZ A;  1N52 A;  5T4Y A;  3R9A B;  2LO6 A;  1E90 A;  4I17 A;  4XKC A;  4EEC A;  2GW1 A;  3T8M A;  4YVQ C;  2VTB B;  3ZHE B;  1X5B A;  5E75 A;  1FVH A;  4ACK A;  5HI7 A;  1WY6 A;  2ZU6 B;  4JHJ A;  4WUY A;  2Q7F A;  1OUV A;  3MZL B;  2JLB A;  3UX4 A;  3PH0 C;  1MQS A;  3MV3 B;  3CVY A;  1B89 A;  1HE8 A;  3VTY A;  3CQG B;  4GYW A;  3PNL B;  3LEW A;  4PS3 A;  4GPK A;  5M72 A;  3FWV A;  3CVL A;  1JUQ A;  5D0O D;  4GCN A;  3ZRH A;  1IHG A;  4G11 A;  3PE3 A;  3ZFW A;  5BW8 C;  2KC7 A;  1Z3Y A;  2WXJ A;  1H2V C;  4HFG A;  3S7B A;  3PVL A;  3T5X A;  4JA9 A;  4FLB A;  4F7A A;  2XCC A;  2C0M A;  1Y6I A;  4G1T A;  4U0S A;  1JWF A;  3FU6 A;  4WNG A;  2J09 A;  4N3B A;  4U04 A;  4NQ0 A;  1PC2 A;  3GZ2 A;  4G23 A;  3CKC A;  4IUL A;  3QKY A;  4ANV A;  5FQ6 A;  4XI0 A;  2PZI A;  3CVN A;  4F3V A;  3UMV A;  5CCL A;  3IKO B;  4Y6C A;  5D0Q D;  3FUD A;  4GA1 A;  1ZU2 A;  5AYW D;  3ZXS A;  4HOQ A;  2PM6 A;  2DIW A;  5G2N A;  4B8C B;  4OVV A;  1WM5 A;  3FUE A;  3JYS A;  4JC8 A;  4MS6 A;  2A4Z A;  2XPY A;  4CT4 A;  4PH4 B;  3LXU X;  5DIZ A;  2VGX B;  2V0P A;  3CK7 A;  4KT6 B;  2IQC A;  3JCK C;  2VSO E;  3QWP A;  2L0I A;  3NQP A;  3AU4 A;  1HH8 A;  3CV0 A;  4YVO A;  5DBK A;  1DVP A;  2WQ6 A;  2R5S A;  4O6F A;  4A3T A;  3CVV A;  1GW6 A;  3PRE A;  3ZYQ A;  3AS4 A;  4IN3 B;  4AIF A;  4J8D A;  3TG4 A;  4URK A;  4H7Y A;  5G04 J;  1UW4 B;  2RD0 A;  5G55 A;  1HS6 A;  5BV0 A;  3PNT B;  4OYS A;  2VSY A;  4GA2 A;  5LOZ A;  3FUL A;  4GB9 A;  5ARF A;  4CT0 A;  4GZC A;  2X6F A;  1FVF A;  3DBS A;  3IV0 A;  4J8E A;  3IHY A;  3FH5 A;  3FU5 A;  1E96 B;  2HYZ A;  2C0L A;  3ZGQ A;  2NC9 A;  4FC8 A;  4UQZ A;  4C9B B;  4UWK A;  3KD7 A;  3RK6 A;  5T3R A;  3U64 A;  3CR3 A;  1NA0 A;  3R7R A;  3FU3 A;  3SBT B;  3CK8 A;  3CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...