2KZUA

Daxx helical bundle (dhb) domain / rassf1c complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
b'GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
molecule tags Apoptosis
source organism Homo sapiens
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzuA00
2KZSA 2KZUA
chains in the Genus database with same CATH superfamily
3GRUA 1QQWA 3HJQA 2DZLA 3E21A 1QDTA 2LVOC 4JN6A 5EXXA 4JI6M 3IG5A 4D82A 4LJ9A 5L8RF 4AQYM 2NQ8C 4IBEA 4GEWA 4NOOB 5FSWA 4JV5M 4DR3M 1JQJC 4L15A 1F4IA 4IBFA 1IN8A 3NWLA 1NV9A 1MU5A 3HJSA 1A5TA 2R45A 2HHHM 2UU9M 1G71A 2CWBA 1OAOC 4NC6A 4WP2A 1P3QQ 4IBKA 1TTEA 5EP4A 5ITXA 3JAMS 4HLQA 2C98A 1IY0A 3HU2A 4AZFA 1H6UA 5DYIA 2L6OA 2KEBA 4LJ8A 5DFLA 3U5ZA 2DAMA 4RF0A 1I4WA 2ZTCA 3C3DA 2FOIC 2QSFX 3KXEC 4FCTA 3GLFB 2L7HA 2F5QA 2CV2A 3E46A 3SASA 3SYLA 3GLGA 3U6QA 2F5SA 1D0LA 4NRWA 3H4JA 4GRIA 3W67A 1FJGM 4YHHM 1WR1B 4BBAA 1ZQ9A 4XBOA 1IN6A 3U6CA 2XFTA 2DI0A 1Q3CA 2OOBA 4X65M 1DO0A 5EJCA 3BOSA 3U6PA 2XF3A 1SXJB 2O25A 1XB2B 4Z6YA 1R2YA 1E94E 5DYGA 1EE8A 4BB9A 3V76A 4QOSA 4M0WA 1VDLA 4NL4H 3SAWA 2Q2EB 3FTCA 4I81A 4B08A 2QCUA 3HGIA 1Z5BA 1ZMVA 3FD9A 3E9SA 1OIZA 3MJ5A 3BBZA 4G3OA 1SXJA 3SBJA 1QVRA 1VEGA 3HX3A 1V34A 5KPRA 3GLIE 2BJWA 2WSEF 3MHVC 4LJ4A 2XSZD 1WJ7A 4JI3M 4PT5A 2XZUA 4LRTA 4GMQA 1DGGA 3LMMA 3NBIA 5KPTA 1DGHA 2JXNA 2VDBB 2D7GA 5EXSA 5ITUA 1KFVA 4AI6A 3T38A 2J5YA 2JY8A 4IJFA 1N34M 4F1IA 4JI0M 4FCWA 1S3SA 3GPXA 3TWKA 5KQDA 4KODA 2BJVA 2L7IA 3UJNA 2LVQD 1SG9A 3SAUA 1IFYA 2UXDM 3SATA 4B7FA 1QANA 3AKZA 1XXHE 4LZZA 1CUKA 1Q02A 1E9SA 4Z8XA 2ZAMA 2LVNC 1OFHA 1IM2A 4LFAM 3B9PA 1MJGM 2Y0QA 4X62M 4KHPM 3ZCBB 2LWXA 2R62A 2BWEA 1PGYA 1OKSA 1T3TA 4M0DA 2C9OA 1SXJE 1G4AE 2J7NA 4GKKM 2QNJA 3LW5F 3M6AA 3FYCA 4AW4A 2JY7A 3GP1A 1D0KA 1GVNA 1QAMA 1Y8GA 1DO2A 1NJGA 1ZMWA 3R9XB 1L2DA 3FUXA 3QYBA 4G6ZA 3SFZA 1L1TA 2L4FA 3I01M 2K9DA 4IJEA 1EFUB 3B74A 4X64M 3THGA 1D0MA 3IECA 3GO8A 4DUYM 3U5ZB 1V92A 4LF7M 3SYKA 4REZA 2KXEA 3C9PA 1TH4A 1HT2E 2KW0A 1GO5A 2L4EA 4ZPXA 5C1BA 3T1HM 2DXIA 4L4UA 2VF8A 4KT0F 3W0LB 2VIIA 4JI7M 1QYRA 3ILKA 1LV7A 3KP0E 3FTEA 3TQSA 4FD2A 2K47A 2O5RA 3B7ZA 4LCBA 4A3VB 3KOZE 4DV5M 2RGOA 3SMSA 3U6DA 1XMQM 1UM8A 3T1YM 1XMOM 1G8PA 2X8AA 2Z4RA 3GLHA 4WW0A 2I7PA 4EIWA 5IREB 1HQYE 2EJSA 2JA2A 3I04M 3H4MA 3OTOM 4DV4M 4GIPA 2YNMD 2YR0A 1JR3D 2LXEA 3ZH9B 3LVWA 1QZMA 1IQPA 3RFWA 1QAOA 1HR0M 5EQTA 1Z6TA 1X37A 3HU3A 4BLCA 4IIWA 2WZJA 1ORYB 3A98B 3HZJA 2LVAA 4GH9A 4DV7M 2Z8YM 2DHRA 3GRYA 1IN5A 2C99A 2VF7A 3K1JA 4CIZA 4GKJM 2OO9A 4RF1A 3DFZA 4QOZC 3C58A 3GPPA 3U60B 3CTWB 1TF0B 4F2LA 4P17A 3JR4A 4GHLA 3QWLA 3KSJA 4B7HA 4HL4A 1LTMA 3MK6A 2QP9X 1VDDA 2N35A 3GLHE 5ITTA 3K92A 2QBYA 1T43A 1OFIA 1TH2A 4HEOA 4TUWA 2ERCA 3D8LA 1N33M 3GLGE 4B3SM 1IXSB 1PJTA 3R8FA 4AKGA 3KS4A 3U61B 3VFDA 5ITRA 3VDUA 2OQ4A 2JNHA 1L1ZA 5IZ7D 1IXRC 2MROB 4FCVA 4KO8A 1XC8A 3FRHA 3KOWE 2UUAM 2R65A 3W68A 4G4NA 3KW6A 4OX9M 2AHMA 3B89A 3TE6A 1XNRM 1D2NA 5GKNA 3HWSA 4L78A 3TL4X 1NSFA 2KZUA 2W82A 1Q3BA 3LQQA 4M9XA 3VK7A 4QNMA 3U61A 1HJPA 4QHTA 5E6JA 5EP3A 3GLFE 2QQ8A 3RGPA 2FE8A 1K82A 3EIHA 3HKPA 2Z3XA 1YLAA 1N32M 1QAQA 2VQEM 3CF2A 3E4RA 2VQFM 1RU3A 4DV0M 4DUZM 3AOGA 2CE7A 1HT1E 2UXBM 2JWSA 2QENA 2KNZA 5KO3A 3GLIA 4DV3M 5BPVA 3A42A 1AUAA 3M7GA 2XLJA 1TDHA 4B7GA 2CRUA 3ZC7B 1JB0F 1KSFX 1IY1A 4M9SA 3KFUG 1C1KA 2M60A 1DV0A 1PJQA 4IBIA 5JI2E 3TWLA 2V6ZM 2DENA 1L2BA 3HHXA 2GNOA 4X66M 1WHCA 2L2DA 3C3EA 3FKEA 5ITQA 2I7NA 2MJ5B 3DZDA 3J7AS 3GLFA 3MMPA 1UFZA 2EKFA 3BXWA 3AFHA 2HAKA 4GC9A 3PNYA 4NXNM 4Q7JA 3FUUA 3FYDA 5FTKA 1TGUA 3J27B 4FWDA 2ZAOA 5FTJA 2O01F 4DR6M 5LMNM 1E32A 3LCUA 2CP8A 4G4RA 1IN4A 1ZAEA 1C7YA 1IBKM 1SXJC 4RNAA 1TDZA 2DNAA 3VLFB 5IT9S 4DR1M 4PCZA 4OVZB 3I4VA 2Y20A 3AJIB 1NNJA 2QPAA 2DAIA 4PDGA 5LMUM 2EUCA 2WSFF 4MM3B 3U6OA 3B7QA 1IN7A 3LVVA 3PVSA 4RKUF 3SMPA 2L09A 3JR5A 2RGHA 2CV1A 4LF8M 2CHVA 2G3QA 4I8OA 3GQ4A 4L6V6 4G4QA 2DVWB 2V1UA 1MX0A 2HKJA 3EIEA 2FH0A 4DV2M 4Y28F 1NHWC 4B3RM 4AKHA 1R5LA 2KNVA 2DWNA 4LF5M 1ZV1A 4JI4M 1Q39A 3AV0A 3VKHA 1T6OA 1R6BX 1WXQA 3PFIA 1YSYA 3I4YA 4QHSA 4CHTB 2ZM6M 3IHPA 1KYIA 1GL7A 8CATA 1NY6A 3SHFA 2QHOB 2C9CA 2FNAA 1FNNA 2HCBA 2R44A 4MGIE 3GPYA 1JR3E 4KLNA 5FTLA 3TWMA 2CHQA 5FLXS 2UXCM 1ZMUA 1OIPA 4LRSA 2Z7JA 1HNZM 4IBDA 1G59A 2APLA 2KRKA 4LY6A 3L2AA 2D7HA 4CJ6A 5ITYA 1J5EM 4QNRA 3KP1E 3K8ZA 3ZQJA 3LQRA 2CV0A 3T6PA 4LFBM 1YUBA 3IG8A 3KDSE 4LGYA 1DGBA 1Z5CA 4LF6M 2YQZA 3FTFA 4I4LA 4MH0E 4AG6A 3L26A 3KOXE 1PRBA 4G4OA 1K3XA 5A2QS 2BWBA 3KOYE 2MR9A 1PJSA 4NSOB 1NJFA 1WGLA 4MGZE 4B3TM 3UK6A 2OOAA 1DGHB 2JP7A 3CF0A 4ANRA 4I5SA 3KVWA 4DV6M 1K3WA 2H1RA 4LFCM 2DWZB 1L8QA 4FW9A 4LF4M 1N77A 2UUBM 4NRVA 4WURA 3U6EA 4W5WA 4DR7M 2CEAA 4S12A 4LJ5A 3KS8A 1AIPC 4MGHA 5EXPA 3M0EA 2LBCA 4L8RC 1JR3A 3L28A 2JY6B 3B7NA 3KSXA 3T15A 4IBBA 1GLNA 2CUZA 4FWHA 1VG5A 3GLHB 1HNXM 2R46A 1VEJA 5KPZA 2QBYB 2BNKA 3PXGA 3FRIA 2G8LA 2K6BA 5E26A 1IBLM 2M5ZA 3GQ5A 2GQFA 2HWJA 3GLGB 4JYAM 4CGYB 4MGYE 1L2CA 4DV1M 3F92A 2KRUA 3K9OA 1XNQM 3HY5A 2E5LM 5ITXE 4NSRA 3LCVB 1GJTA 1OQYA 3GPUA 2Y21A 5EP2A 4GHAA 1PM5A 4R71A 2X4AA 4D81A 1PJJA 2QZ4A 4PD2A 4R7GA 1XWIA 4L16A 4PDIA 1DGFA 4DR5M 2F5PA 2UUCM 4MB7A 4XGIA 3RE8A 1NVMA 3K2LA 4MGKE 3J80S 3HJ8A 4DR4M 4JI1M 1GABA 2X49A 3K9PA 2JY5A 3RGSA 3NBXX 1W5TA 2R0IA 3UGJA 5BR8M 2ZTDA 2RRUA 1QUTA 2YFQA 3J2PB 4LZJA 4JI8M 2C96A 3U6SA 1Z59A 4D80A 2LHCA 2HL7A 1I94M 2WSCF 2MGWA 1N75A 4GC5A 1GKIA 3A46A 3DA1A 3QAUA 2R4EA 4LGMA 2EA0A 3HHZA 1N36M 2DKLA 1HQCA 5JI3E 1V33A 2LH0A 2LTUA 3AOEC 3D8BA 5FTNA 3FTDA 3UZUA 1QUSA 2JUJA 4YY3M 3FE3A 2P5TA 2KDLA 3HHWA 1G3IA 4FWGA 3CGWA 1IXZA 2K0BX 4K0KM 1EIJA 2CFOA 2LVPC 2R6FA 5DNYA 4AG5A 4P16A 1IBMM 3GRRA 3U6LA 2XZFA 2KNAA 3VK8A 3L25A 3L29A 3TPZA 3WHLA 1Z5AA 1OTRA 3W0FA 3DOAA 1NY5A 2DZNB 5H37D 3GLIB 4DBGB 2EKKA 2V1CA 2JZ1A 4JXJA 4LJ6A 2XH9A 3QYEA 3Q8XA 4M9ZA 1NV8A 4II7A 1QZEA 2R18A 4DR2M 1TR8A 4UN2B 2CHGA 2DAKA 2DZOB 3SARA 3HU1A 4FVMA 3WHKA 2FS1A 2H5XA 3AL0C 1NO1A 2XFSA 1XXHA 1E9RA 1SXJD 2ZANA 1OAIA 4XK8F 1R4GA 3VDPA 2J7OA 1NNUC 5FTMA 2DAEA 1W5SA 3AOEA 4JI5M 2B3TA 1IY2A 1VQ1A 3HHYA 3UMMA 1MN3A 2A5YB 4ITQA 2D7EA 2OPFA 1HNWM 5C18A 3U6MA 3U60A 2Z4SA 2R4JA 3FUVA 3SHGB 4CISA 2F5NA 4IBGA 3GRVA 1OJLA 2MH8A 3A45A 2ZBKB 1BVSA 5EXTA 3Q8GA 2C5RA 4AKIA 1R2ZA 4B3MM 2F4VM 1XHBA 1J09A 1YE9A 4JI2M 2XEPA 4LF9M 3I51A 2KZSA 4OU7A 2KHHA 1N78A 3GQ3A 4R3DA 4IBJA 1R7RA 3L27A 1QDRA 7CATA 1XXHB 3FUTA 2LHGA 5IWAM 3J7BA 2RKOA 1WIVA 1GL6A 2KA6B 1IXSA 2DAGA 4NXMM 1J7KA 4OW0A 4LG2A 2Y0TA 5KQ8A 2FFJA 2JZ0A 2G5GX 1G41A 2DWLA 2DHYA 1NHGC 3PNVA 4OVZA 3SAVA 1WGNA 5EP1A 3VKGA 1TH3A 2EO2A 2DWMA 4LJAA 2F5OA 1VEKA 2LNHC 1GJSA 3FUWA 3CF6E 4LJ7A 4GITA 2XSZA 4IBCA 3SC3A 5F3WA 2XGNA 3J81S 1PJIA
chains in the Genus database with same CATH topology
3GRUA 1QQWA 3HJQA 4JN6A 4JI6M 5EXXA 3IG5A 4D82A 4LJ9A 4AQYM 2NQ8C 4IBEA 4NOOB 5FSWA 4JV5M 4DR3M 1JQJC 4L15A 4IBFA 1IN8A 3NWLA 1MU5A 3HJSA 2R45A 2HHHM 2UU9M 4IBKA 5EP4A 5ITXA 3JAMS 4HLQA 2C98A 1IY0A 3HU2A 4AZFA 1H6UA 5DYIA 2L6OA 2KEBA 4LJ8A 3U5ZA 4RF0A 1I4WA 2FOIC 3KXEC 4FCTA 3GLFB 2L7HA 2F5QA 2CV2A 3SASA 3SYLA 3GLGA 3U6QA 2F5SA 4NRWA 4GRIA 1FJGM 4YHHM 4BBAA 1ZQ9A 4XBOA 1IN6A 3U6CA 2XFTA 1Q3CA 4X65M 1DO0A 5EJCA 3BOSA 3U6PA 2XF3A 1SXJB 1R2YA 4Z6YA 1E94E 5DYGA 1EE8A 4BB9A 4QOSA 4M0WA 3SAWA 4NL4H 2Q2EB 3FTCA 4I81A 4B08A 2QCUA 3HGIA 1Z5BA 3FD9A 3E9SA 3MJ5A 1SXJA 3SBJA 1QVRA 5KPRA 2BJWA 3MHVC 4LJ4A 2XSZD 2XZUA 4JI3M 4PT5A 4LRTA 4GMQA 1DGGA 3LMMA 3NBIA 5KPTA 1DGHA 5EXSA 2D7GA 1KFVA 5ITUA 4AI6A 3T38A 4IJFA 1N34M 4JI0M 4FCWA 1S3SA 3GPXA 3TWKA 5KQDA 4KODA 2BJVA 2L7IA 3UJNA 3SAUA 2UXDM 3SATA 4B7FA 1QANA 3AKZA 4LZZA 4Z8XA 1E9SA 2ZAMA 1OFHA 1IM2A 4LFAM 3B9PA 4X62M 2Y0QA 4KHPM 3ZCBB 2LWXA 2R62A 4M0DA 1T3TA 2C9OA 1SXJE 1G4AE 2J7NA 4GKKM 3M6AA 4AW4A 3FYCA 3GP1A 1GVNA 1QAMA 1DO2A 1NJGA 3R9XB 1L2DA 3FUXA 3SFZA 4G6ZA 1L1TA 4IJEA 3GO8A 4DUYM 4X64M 3THGA 3U5ZB 4LF7M 3SYKA 4REZA 2KXEA 1TH4A 1HT2E 2KW0A 5C1BA 4ZPXA 2DXIA 3T1HM 4L4UA 3W0LB 4JI7M 2VIIA 1QYRA 3ILKA 1LV7A 3KP0E 3FTEA 3TQSA 4FD2A 2K47A 2O5RA 4DV5M 4LCBA 4A3VB 3KOZE 2RGOA 3SMSA 3U6DA 1XMQM 1UM8A 3T1YM 1XMOM 1G8PA 2X8AA 2Z4RA 3GLHA 4WW0A 2I7PA 4EIWA 5IREB 1HQYE 2JA2A 3H4MA 3OTOM 4DV4M 4GIPA 2YNMD 2YR0A 1JR3D 2LXEA 3ZH9B 3LVWA 1QZMA 1IQPA 3RFWA 1QAOA 1HR0M 5EQTA 1Z6TA 1X37A 3HU3A 4BLCA 4IIWA 1ORYB 3A98B 4GH9A 4DV7M 2DHRA 3GRYA 1IN5A 2C99A 3K1JA 4GKJM 4RF1A 3DFZA 4QOZC 3C58A 3GPPA 3U60B 3CTWB 3JR4A 4GHLA 3QWLA 3KSJA 4B7HA 4HL4A 3MK6A 2QP9X 1VDDA 5ITTA 3K92A 2QBYA 1OFIA 1TH2A 4TUWA 2ERCA 3D8LA 1N33M 4B3SM 1IXSB 3R8FA 4AKGA 3KS4A 3U61B 3VFDA 5ITRA 3VDUA 2OQ4A 1L1ZA 5IZ7D 1IXRC 4FCVA 4KO8A 1XC8A 3KOWE 2UUAM 2R65A 4G4NA 3KW6A 4OX9M 2AHMA 3TE6A 1XNRM 1D2NA 5GKNA 3HWSA 4L78A 3TL4X 1NSFA 2KZUA 2W82A 1Q3BA 3LQQA 4M9XA 3VK7A 4QNMA 3U61A 5E6JA 4QHTA 5EP3A 1K82A 3RGPA 2FE8A 3EIHA 3HKPA 2Z3XA 1N32M 1QAQA 2VQEM 3CF2A 3E4RA 2VQFM 4DV0M 4DUZM 3AOGA 2CE7A 1HT1E 2UXBM 2QENA 5KO3A 3GLIA 4DV3M 5BPVA 3A42A 3M7GA 2XLJA 1TDHA 4B7GA 3ZC7B 1KSFX 1IY1A 4M9SA 3KFUG 1C1KA 2M60A 4IBIA 5JI2E 3TWLA 2V6ZM 1L2BA 3HHXA 4X66M 3FKEA 5ITQA 2I7NA 3DZDA 3J7AS 3GLFA 3AFHA 4GC9A 3PNYA 4NXNM 3FUUA 3FYDA 5FTKA 1TGUA 3J27B 4FWDA 2ZAOA 5FTJA 4DR6M 5LMNM 1E32A 4G4RA 1IN4A 1ZAEA 1IBKM 1SXJC 4RNAA 1TDZA 3VLFB 5IT9S 4DR1M 4PCZA 4OVZB 3I4VA 2Y20A 3AJIB 1NNJA 2QPAA 4PDGA 5LMUM 2EUCA 4MM3B 3U6OA 1IN7A 3LVVA 3PVSA 3SMPA 2L09A 3JR5A 2RGHA 2CV1A 4LF8M 2CHVA 4I8OA 3GQ4A 4G4QA 2DVWB 2V1UA 1MX0A 2HKJA 3EIEA 4DV2M 1NHWC 4B3RM 4AKHA 2DWNA 4JI4M 1Q39A 3AV0A 3VKHA 1R6BX 1WXQA 3PFIA 1YSYA 3I4YA 4QHSA 4CHTB 2ZM6M 1KYIA 1GL7A 8CATA 1NY6A 3SHFA 2C9CA 2FNAA 1FNNA 2HCBA 4MGIE 3GPYA 3TWMA 4KLNA 5FTLA 2UXCM 2CHQA 5FLXS 4LRSA 2Z7JA 1HNZM 4IBDA 1G59A 2KRKA 4LY6A 3L2AA 2D7HA 5ITYA 1J5EM 4QNRA 3KP1E 3K8ZA 3LQRA 2CV0A 4LFBM 1YUBA 3IG8A 3KDSE 4LGYA 1DGBA 1Z5CA 4LF6M 2YQZA 3FTFA 4I4LA 4MH0E 4AG6A 3L26A 3KOXE 4G4OA 1K3XA 5A2QS 3KOYE 4NSOB 4B3TM 1NJFA 4MGZE 3UK6A 1DGHB 3CF0A 4I5SA 3KVWA 4DV6M 1K3WA 2H1RA 4LFCM 2DWZB 1L8QA 4FW9A 4LF4M 1N77A 2UUBM 4NRVA 4WURA 3U6EA 4W5WA 4DR7M 2CEAA 4S12A 4LJ5A 3KS8A 4MGHA 5EXPA 3M0EA 4L8RC 1JR3A 3L28A 4LF5M 3KSXA 3T15A 4IBBA 1GLNA 2CUZA 4FWHA 3GLHB 1HNXM 2R46A 5KPZA 2QBYB 2BNKA 3PXGA 5E26A 2G8LA 1IBLM 2M5ZA 3GQ5A 3GLGB 4JYAM 4CGYB 4MGYE 1L2CA 4DV1M 2KRUA 1XNQM 2E5LM 5ITXE 4NSRA 3GPUA 2Y21A 5EP2A 4GHAA 1PM5A 2X4AA 4D81A 1PJJA 2QZ4A 4PD2A 4R7GA 1XWIA 4L16A 4PDIA 1DGFA 4DR5M 2F5PA 2UUCM 4MB7A 4XGIA 3RE8A 1NVMA 3K2LA 4MGKE 3J80S 3HJ8A 4DR4M 4JI1M 2X49A 3UGJA 3RGSA 5BR8M 1W5TA 2YFQA 3J2PB 4LZJA 4JI8M 2C96A 3U6SA 1Z59A 4D80A 2HL7A 1I94M 1N75A 4GC5A 1GKIA 3A46A 3DA1A 3QAUA 2R4EA 4LGMA 2EA0A 3HHZA 1N36M 1HQCA 5JI3E 2LH0A 3AOEC 3D8BA 5FTNA 3FTDA 3UZUA 4YY3M 2P5TA 3HHWA 1G3IA 4FWGA 1IXZA 4K0KM 2CFOA 5DNYA 4AG5A 4P16A 1IBMM 3GRRA 3U6LA 2XZFA 3VK8A 3L25A 3L29A 3TPZA 3WHLA 1Z5AA 3W0FA 3DOAA 1NY5A 2DZNB 5H37D 3GLIB 2V1CA 4JXJA 4LJ6A 2XH9A 3Q8XA 4M9ZA 4II7A 2R18A 4DR2M 3SARA 2CHGA 2DZOB 3HU1A 4FVMA 3WHKA 3AL0C 2XFSA 1XXHA 1E9RA 1SXJD 2ZANA 3VDPA 2J7OA 1NNUC 5FTMA 4JI5M 1W5SA 3AOEA 1IY2A 3UMMA 3HHYA 4ITQA 2A5YB 1HNWM 2D7EA 2OPFA 5C18A 3U6MA 3U60A 2Z4SA 2R4JA 3FUVA 3SHGB 4CISA 2F5NA 4IBGA 3GRVA 1OJLA 5EXTA 3A45A 2ZBKB 2C5RA 4AKIA 1R2ZA 4B3MM 2F4VM 1XHBA 1J09A 1YE9A 4JI2M 2XEPA 4LF9M 3I51A 2KZSA 4OU7A 1N78A 3GQ3A 4R3DA 4IBJA 1R7RA 3L27A 7CATA 1XXHB 3FUTA 5IWAM 3J7BA 2RKOA 1GL6A 2KA6B 4NXMM 1J7KA 4OW0A 4LG2A 2Y0TA 5KQ8A 2FFJA 2G5GX 1G41A 2DWLA 1NHGC 3PNVA 4OVZA 3SAVA 5EP1A 3VKGA 1TH3A 2EO2A 2DWMA 4LJAA 2F5OA 2LNHC 3FUWA 3CF6E 4LJ7A 4GITA 2XSZA 4IBCA 3SC3A 5F3WA 2XGNA 3J81S 1PJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZS A;  2KZU A; 
#chains in the Genus database with same CATH topology
 3GRU A;  1QQW A;  3HJQ A;  2DZL A;  3E21 A;  1QDT A;  2LVO C;  4JN6 A;  5EXX A;  4JI6 M;  3IG5 A;  4D82 A;  4LJ9 A;  5L8R F;  4AQY M;  2NQ8 C;  4IBE A;  4GEW A;  4NOO B;  5FSW A;  4JV5 M;  4DR3 M;  1JQJ C;  4L15 A;  1F4I A;  4IBF A;  1IN8 A;  3NWL A;  1NV9 A;  1MU5 A;  3HJS A;  1A5T A;  2R45 A;  2HHH M;  2UU9 M;  1G71 A;  2CWB A;  1OAO C;  4NC6 A;  4WP2 A;  1P3Q Q;  4IBK A;  1TTE A;  5EP4 A;  5ITX A;  3JAM S;  4HLQ A;  2C98 A;  1IY0 A;  3HU2 A;  4AZF A;  1H6U A;  5DYI A;  2L6O A;  2KEB A;  4LJ8 A;  5DFL A;  3U5Z A;  2DAM A;  4RF0 A;  1I4W A;  2ZTC A;  3C3D A;  2FOI C;  2QSF X;  3KXE C;  4FCT A;  3GLF B;  2L7H A;  2F5Q A;  2CV2 A;  3E46 A;  3SAS A;  3SYL A;  3GLG A;  3U6Q A;  2F5S A;  1D0L A;  4NRW A;  3H4J A;  4GRI A;  3W67 A;  1FJG M;  4YHH M;  1WR1 B;  4BBA A;  1ZQ9 A;  4XBO A;  1IN6 A;  3U6C A;  2XFT A;  2DI0 A;  1Q3C A;  2OOB A;  4X65 M;  1DO0 A;  5EJC A;  3BOS A;  3U6P A;  2XF3 A;  1SXJ B;  2O25 A;  1XB2 B;  4Z6Y A;  1R2Y A;  1E94 E;  5DYG A;  1EE8 A;  4BB9 A;  3V76 A;  4QOS A;  4M0W A;  1VDL A;  4NL4 H;  3SAW A;  2Q2E B;  3FTC A;  4I81 A;  4B08 A;  2QCU A;  3HGI A;  1Z5B A;  1ZMV A;  3FD9 A;  3E9S A;  1OIZ A;  3MJ5 A;  3BBZ A;  4G3O A;  1SXJ A;  3SBJ A;  1QVR A;  1VEG A;  3HX3 A;  1V34 A;  5KPR A;  3GLI E;  2BJW A;  2WSE F;  3MHV C;  4LJ4 A;  2XSZ D;  1WJ7 A;  4JI3 M;  4PT5 A;  2XZU A;  4LRT A;  4GMQ A;  1DGG A;  3LMM A;  3NBI A;  5KPT A;  1DGH A;  2JXN A;  2VDB B;  2D7G A;  5EXS A;  5ITU A;  1KFV A;  4AI6 A;  3T38 A;  2J5Y A;  2JY8 A;  4IJF A;  1N34 M;  4F1I A;  4JI0 M;  4FCW A;  1S3S A;  3GPX A;  3TWK A;  5KQD A;  4KOD A;  2BJV A;  2L7I A;  3UJN A;  2LVQ D;  1SG9 A;  3SAU A;  1IFY A;  2UXD M;  3SAT A;  4B7F A;  1QAN A;  3AKZ A;  1XXH E;  4LZZ A;  1CUK A;  1Q02 A;  1E9S A;  4Z8X A;  2ZAM A;  2LVN C;  1OFH A;  1IM2 A;  4LFA M;  3B9P A;  1MJG M;  2Y0Q A;  4X62 M;  4KHP M;  3ZCB B;  2LWX A;  2R62 A;  2BWE A;  1PGY A;  1OKS A;  1T3T A;  4M0D A;  2C9O A;  1SXJ E;  1G4A E;  2J7N A;  4GKK M;  2QNJ A;  3LW5 F;  3M6A A;  3FYC A;  4AW4 A;  2JY7 A;  3GP1 A;  1D0K A;  1GVN A;  1QAM A;  1Y8G A;  1DO2 A;  1NJG A;  1ZMW A;  3R9X B;  1L2D A;  3FUX A;  3QYB A;  4G6Z A;  3SFZ A;  1L1T A;  2L4F A;  3I01 M;  2K9D A;  4IJE A;  1EFU B;  3B74 A;  4X64 M;  3THG A;  1D0M A;  3IEC A;  3GO8 A;  4DUY M;  3U5Z B;  1V92 A;  4LF7 M;  3SYK A;  4REZ A;  2KXE A;  3C9P A;  1TH4 A;  1HT2 E;  2KW0 A;  1GO5 A;  2L4E A;  4ZPX A;  5C1B A;  3T1H M;  2DXI A;  4L4U A;  2VF8 A;  4KT0 F;  3W0L B;  2VII A;  4JI7 M;  1QYR A;  3ILK A;  1LV7 A;  3KP0 E;  3FTE A;  3TQS A;  4FD2 A;  2K47 A;  2O5R A;  3B7Z A;  4LCB A;  4A3V B;  3KOZ E;  4DV5 M;  2RGO A;  3SMS A;  3U6D A;  1XMQ M;  1UM8 A;  3T1Y M;  1XMO M;  1G8P A;  2X8A A;  2Z4R A;  3GLH A;  4WW0 A;  2I7P A;  4EIW A;  5IRE B;  1HQY E;  2EJS A;  2JA2 A;  3I04 M;  3H4M A;  3OTO M;  4DV4 M;  4GIP A;  2YNM D;  2YR0 A;  1JR3 D;  2LXE A;  3ZH9 B;  3LVW A;  1QZM A;  1IQP A;  3RFW A;  1QAO A;  1HR0 M;  5EQT A;  1Z6T A;  1X37 A;  3HU3 A;  4BLC A;  4IIW A;  2WZJ A;  1ORY B;  3A98 B;  3HZJ A;  2LVA A;  4GH9 A;  4DV7 M;  2Z8Y M;  2DHR A;  3GRY A;  1IN5 A;  2C99 A;  2VF7 A;  3K1J A;  4CIZ A;  4GKJ M;  2OO9 A;  4RF1 A;  3DFZ A;  4QOZ C;  3C58 A;  3GPP A;  3U60 B;  3CTW B;  1TF0 B;  4F2L A;  4P17 A;  3JR4 A;  4GHL A;  3QWL A;  3KSJ A;  4B7H A;  4HL4 A;  1LTM A;  3MK6 A;  2QP9 X;  1VDD A;  2N35 A;  3GLH E;  5ITT A;  3K92 A;  2QBY A;  1T43 A;  1OFI A;  1TH2 A;  4HEO A;  4TUW A;  2ERC A;  3D8L A;  1N33 M;  3GLG E;  4B3S M;  1IXS B;  1PJT A;  3R8F A;  4AKG A;  3KS4 A;  3U61 B;  3VFD A;  5ITR A;  3VDU A;  2OQ4 A;  2JNH A;  1L1Z A;  5IZ7 D;  1IXR C;  2MRO B;  4FCV A;  4KO8 A;  1XC8 A;  3FRH A;  3KOW E;  2UUA M;  2R65 A;  3W68 A;  4G4N A;  3KW6 A;  4OX9 M;  2AHM A;  3B89 A;  3TE6 A;  1XNR M;  1D2N A;  5GKN A;  3HWS A;  4L78 A;  3TL4 X;  1NSF A;  2KZU A;  2W82 A;  1Q3B A;  3LQQ A;  4M9X A;  3VK7 A;  4QNM A;  3U61 A;  1HJP A;  4QHT A;  5E6J A;  5EP3 A;  3GLF E;  2QQ8 A;  3RGP A;  2FE8 A;  1K82 A;  3EIH A;  3HKP A;  2Z3X A;  1YLA A;  1N32 M;  1QAQ A;  2VQE M;  3CF2 A;  3E4R A;  2VQF M;  1RU3 A;  4DV0 M;  4DUZ M;  3AOG A;  2CE7 A;  1HT1 E;  2UXB M;  2JWS A;  2QEN A;  2KNZ A;  5KO3 A;  3GLI A;  4DV3 M;  5BPV A;  3A42 A;  1AUA A;  3M7G A;  2XLJ A;  1TDH A;  4B7G A;  2CRU A;  3ZC7 B;  1JB0 F;  1KSF X;  1IY1 A;  4M9S A;  3KFU G;  1C1K A;  2M60 A;  1DV0 A;  1PJQ A;  4IBI A;  5JI2 E;  3TWL A;  2V6Z M;  2DEN A;  1L2B A;  3HHX A;  2GNO A;  4X66 M;  1WHC A;  2L2D A;  3C3E A;  3FKE A;  5ITQ A;  2I7N A;  2MJ5 B;  3DZD A;  3J7A S;  3GLF A;  3MMP A;  1UFZ A;  2EKF A;  3BXW A;  3AFH A;  2HAK A;  4GC9 A;  3PNY A;  4NXN M;  4Q7J A;  3FUU A;  3FYD A;  5FTK A;  1TGU A;  3J27 B;  4FWD A;  2ZAO A;  5FTJ A;  2O01 F;  4DR6 M;  5LMN M;  1E32 A;  3LCU A;  2CP8 A;  4G4R A;  1IN4 A;  1ZAE A;  1C7Y A;  1IBK M;  1SXJ C;  4RNA A;  1TDZ A;  2DNA A;  3VLF B;  5IT9 S;  4DR1 M;  4PCZ A;  4OVZ B;  3I4V A;  2Y20 A;  3AJI B;  1NNJ A;  2QPA A;  2DAI A;  4PDG A;  5LMU M;  2EUC A;  2WSF F;  4MM3 B;  3U6O A;  3B7Q A;  1IN7 A;  3LVV A;  3PVS A;  4RKU F;  3SMP A;  2L09 A;  3JR5 A;  2RGH A;  2CV1 A;  4LF8 M;  2CHV A;  2G3Q A;  4I8O A;  3GQ4 A;  4L6V 6;  4G4Q A;  2DVW B;  2V1U A;  1MX0 A;  2HKJ A;  3EIE A;  2FH0 A;  4DV2 M;  4Y28 F;  1NHW C;  4B3R M;  4AKH A;  1R5L A;  2KNV A;  2DWN A;  4LF5 M;  1ZV1 A;  4JI4 M;  1Q39 A;  3AV0 A;  3VKH A;  1T6O A;  1R6B X;  1WXQ A;  3PFI A;  1YSY A;  3I4Y A;  4QHS A;  4CHT B;  2ZM6 M;  3IHP A;  1KYI A;  1GL7 A;  8CAT A;  1NY6 A;  3SHF A;  2QHO B;  2C9C A;  2FNA A;  1FNN A;  2HCB A;  2R44 A;  4MGI E;  3GPY A;  1JR3 E;  4KLN A;  5FTL A;  3TWM A;  2CHQ A;  5FLX S;  2UXC M;  1ZMU A;  1OIP A;  4LRS A;  2Z7J A;  1HNZ M;  4IBD A;  1G59 A;  2APL A;  2KRK A;  4LY6 A;  3L2A A;  2D7H A;  4CJ6 A;  5ITY A;  1J5E M;  4QNR A;  3KP1 E;  3K8Z A;  3ZQJ A;  3LQR A;  2CV0 A;  3T6P A;  4LFB M;  1YUB A;  3IG8 A;  3KDS E;  4LGY A;  1DGB A;  1Z5C A;  4LF6 M;  2YQZ A;  3FTF A;  4I4L A;  4MH0 E;  4AG6 A;  3L26 A;  3KOX E;  1PRB A;  4G4O A;  1K3X A;  5A2Q S;  2BWB A;  3KOY E;  2MR9 A;  1PJS A;  4NSO B;  1NJF A;  1WGL A;  4MGZ E;  4B3T M;  3UK6 A;  2OOA A;  1DGH B;  2JP7 A;  3CF0 A;  4ANR A;  4I5S A;  3KVW A;  4DV6 M;  1K3W A;  2H1R A;  4LFC M;  2DWZ B;  1L8Q A;  4FW9 A;  4LF4 M;  1N77 A;  2UUB M;  4NRV A;  4WUR A;  3U6E A;  4W5W A;  4DR7 M;  2CEA A;  4S12 A;  4LJ5 A;  3KS8 A;  1AIP C;  4MGH A;  5EXP A;  3M0E A;  2LBC A;  4L8R C;  1JR3 A;  3L28 A;  2JY6 B;  3B7N A;  3KSX A;  3T15 A;  4IBB A;  1GLN A;  2CUZ A;  4FWH A;  1VG5 A;  3GLH B;  1HNX M;  2R46 A;  1VEJ A;  5KPZ A;  2QBY B;  2BNK A;  3PXG A;  3FRI A;  2G8L A;  2K6B A;  5E26 A;  1IBL M;  2M5Z A;  3GQ5 A;  2GQF A;  2HWJ A;  3GLG B;  4JYA M;  4CGY B;  4MGY E;  1L2C A;  4DV1 M;  3F92 A;  2KRU A;  3K9O A;  1XNQ M;  3HY5 A;  2E5L M;  5ITX E;  4NSR A;  3LCV B;  1GJT A;  1OQY A;  3GPU A;  2Y21 A;  5EP2 A;  4GHA A;  1PM5 A;  4R71 A;  2X4A A;  4D81 A;  1PJJ A;  2QZ4 A;  4PD2 A;  4R7G A;  1XWI A;  4L16 A;  4PDI A;  1DGF A;  4DR5 M;  2F5P A;  2UUC M;  4MB7 A;  4XGI A;  3RE8 A;  1NVM A;  3K2L A;  4MGK E;  3J80 S;  3HJ8 A;  4DR4 M;  4JI1 M;  1GAB A;  2X49 A;  3K9P A;  2JY5 A;  3RGS A;  3NBX X;  1W5T A;  2R0I A;  3UGJ A;  5BR8 M;  2ZTD A;  2RRU A;  1QUT A;  2YFQ A;  3J2P B;  4LZJ A;  4JI8 M;  2C96 A;  3U6S A;  1Z59 A;  4D80 A;  2LHC A;  2HL7 A;  1I94 M;  2WSC F;  2MGW A;  1N75 A;  4GC5 A;  1GKI A;  3A46 A;  3DA1 A;  3QAU A;  2R4E A;  4LGM A;  2EA0 A;  3HHZ A;  1N36 M;  2DKL A;  1HQC A;  5JI3 E;  1V33 A;  2LH0 A;  2LTU A;  3AOE C;  3D8B A;  5FTN A;  3FTD A;  3UZU A;  1QUS A;  2JUJ A;  4YY3 M;  3FE3 A;  2P5T A;  2KDL A;  3HHW A;  1G3I A;  4FWG A;  3CGW A;  1IXZ A;  2K0B X;  4K0K M;  1EIJ A;  2CFO A;  2LVP C;  2R6F A;  5DNY A;  4AG5 A;  4P16 A;  1IBM M;  3GRR A;  3U6L A;  2XZF A;  2KNA A;  3VK8 A;  3L25 A;  3L29 A;  3TPZ A;  3WHL A;  1Z5A A;  1OTR A;  3W0F A;  3DOA A;  1NY5 A;  2DZN B;  5H37 D;  3GLI B;  4DBG B;  2EKK A;  2V1C A;  2JZ1 A;  4JXJ A;  4LJ6 A;  2XH9 A;  3QYE A;  3Q8X A;  4M9Z A;  1NV8 A;  4II7 A;  1QZE A;  2R18 A;  4DR2 M;  1TR8 A;  4UN2 B;  2CHG A;  2DAK A;  2DZO B;  3SAR A;  3HU1 A;  4FVM A;  3WHK A;  2FS1 A;  2H5X A;  3AL0 C;  1NO1 A;  2XFS A;  1XXH A;  1E9R A;  1SXJ D;  2ZAN A;  1OAI A;  4XK8 F;  1R4G A;  3VDP A;  2J7O A;  1NNU C;  5FTM A;  2DAE A;  1W5S A;  3AOE A;  4JI5 M;  2B3T A;  1IY2 A;  1VQ1 A;  3HHY A;  3UMM A;  1MN3 A;  2A5Y B;  4ITQ A;  2D7E A;  2OPF A;  1HNW M;  5C18 A;  3U6M A;  3U60 A;  2Z4S A;  2R4J A;  3FUV A;  3SHG B;  4CIS A;  2F5N A;  4IBG A;  3GRV A;  1OJL A;  2MH8 A;  3A45 A;  2ZBK B;  1BVS A;  5EXT A;  3Q8G A;  2C5R A;  4AKI A;  1R2Z A;  4B3M M;  2F4V M;  1XHB A;  1J09 A;  1YE9 A;  4JI2 M;  2XEP A;  4LF9 M;  3I51 A;  2KZS A;  4OU7 A;  2KHH A;  1N78 A;  3GQ3 A;  4R3D A;  4IBJ A;  1R7R A;  3L27 A;  1QDR A;  7CAT A;  1XXH B;  3FUT A;  2LHG A;  5IWA M;  3J7B A;  2RKO A;  1WIV A;  1GL6 A;  2KA6 B;  1IXS A;  2DAG A;  4NXM M;  1J7K A;  4OW0 A;  4LG2 A;  2Y0T A;  5KQ8 A;  2FFJ A;  2JZ0 A;  2G5G X;  1G41 A;  2DWL A;  2DHY A;  1NHG C;  3PNV A;  4OVZ A;  3SAV A;  1WGN A;  5EP1 A;  3VKG A;  1TH3 A;  2EO2 A;  2DWM A;  4LJA A;  2F5O A;  1VEK A;  2LNH C;  1GJS A;  3FUW A;  3CF6 E;  4LJ7 A;  4GIT A;  2XSZ A;  4IBC A;  3SC3 A;  5F3W A;  2XGN A;  3J81 S;  1PJI A; 
#chains in the Genus database with same CATH homology
 3GRU A;  1QQW A;  3HJQ A;  4JN6 A;  4JI6 M;  5EXX A;  3IG5 A;  4D82 A;  4LJ9 A;  4AQY M;  2NQ8 C;  4IBE A;  4NOO B;  5FSW A;  4JV5 M;  4DR3 M;  1JQJ C;  4L15 A;  4IBF A;  1IN8 A;  3NWL A;  1MU5 A;  3HJS A;  2R45 A;  2HHH M;  2UU9 M;  4IBK A;  5EP4 A;  5ITX A;  3JAM S;  4HLQ A;  2C98 A;  1IY0 A;  3HU2 A;  4AZF A;  1H6U A;  5DYI A;  2L6O A;  2KEB A;  4LJ8 A;  3U5Z A;  4RF0 A;  1I4W A;  2FOI C;  3KXE C;  4FCT A;  3GLF B;  2L7H A;  2F5Q A;  2CV2 A;  3SAS A;  3SYL A;  3GLG A;  3U6Q A;  2F5S A;  4NRW A;  4GRI A;  1FJG M;  4YHH M;  4BBA A;  1ZQ9 A;  4XBO A;  1IN6 A;  3U6C A;  2XFT A;  1Q3C A;  4X65 M;  1DO0 A;  5EJC A;  3BOS A;  3U6P A;  2XF3 A;  1SXJ B;  1R2Y A;  4Z6Y A;  1E94 E;  5DYG A;  1EE8 A;  4BB9 A;  4QOS A;  4M0W A;  3SAW A;  4NL4 H;  2Q2E B;  3FTC A;  4I81 A;  4B08 A;  2QCU A;  3HGI A;  1Z5B A;  3FD9 A;  3E9S A;  3MJ5 A;  1SXJ A;  3SBJ A;  1QVR A;  5KPR A;  2BJW A;  3MHV C;  4LJ4 A;  2XSZ D;  2XZU A;  4JI3 M;  4PT5 A;  4LRT A;  4GMQ A;  1DGG A;  3LMM A;  3NBI A;  5KPT A;  1DGH A;  5EXS A;  2D7G A;  1KFV A;  5ITU A;  4AI6 A;  3T38 A;  4IJF A;  1N34 M;  4JI0 M;  4FCW A;  1S3S A;  3GPX A;  3TWK A;  5KQD A;  4KOD A;  2BJV A;  2L7I A;  3UJN A;  3SAU A;  2UXD M;  3SAT A;  4B7F A;  1QAN A;  3AKZ A;  4LZZ A;  4Z8X A;  1E9S A;  2ZAM A;  1OFH A;  1IM2 A;  4LFA M;  3B9P A;  4X62 M;  2Y0Q A;  4KHP M;  3ZCB B;  2LWX A;  2R62 A;  4M0D A;  1T3T A;  2C9O A;  1SXJ E;  1G4A E;  2J7N A;  4GKK M;  3M6A A;  4AW4 A;  3FYC A;  3GP1 A;  1GVN A;  1QAM A;  1DO2 A;  1NJG A;  3R9X B;  1L2D A;  3FUX A;  3SFZ A;  4G6Z A;  1L1T A;  4IJE A;  3GO8 A;  4DUY M;  4X64 M;  3THG A;  3U5Z B;  4LF7 M;  3SYK A;  4REZ A;  2KXE A;  1TH4 A;  1HT2 E;  2KW0 A;  5C1B A;  4ZPX A;  2DXI A;  3T1H M;  4L4U A;  3W0L B;  4JI7 M;  2VII A;  1QYR A;  3ILK A;  1LV7 A;  3KP0 E;  3FTE A;  3TQS A;  4FD2 A;  2K47 A;  2O5R A;  4DV5 M;  4LCB A;  4A3V B;  3KOZ E;  2RGO A;  3SMS A;  3U6D A;  1XMQ M;  1UM8 A;  3T1Y M;  1XMO M;  1G8P A;  2X8A A;  2Z4R A;  3GLH A;  4WW0 A;  2I7P A;  4EIW A;  5IRE B;  1HQY E;  2JA2 A;  3H4M A;  3OTO M;  4DV4 M;  4GIP A;  2YNM D;  2YR0 A;  1JR3 D;  2LXE A;  3ZH9 B;  3LVW A;  1QZM A;  1IQP A;  3RFW A;  1QAO A;  1HR0 M;  5EQT A;  1Z6T A;  1X37 A;  3HU3 A;  4BLC A;  4IIW A;  1ORY B;  3A98 B;  4GH9 A;  4DV7 M;  2DHR A;  3GRY A;  1IN5 A;  2C99 A;  3K1J A;  4GKJ M;  4RF1 A;  3DFZ A;  4QOZ C;  3C58 A;  3GPP A;  3U60 B;  3CTW B;  3JR4 A;  4GHL A;  3QWL A;  3KSJ A;  4B7H A;  4HL4 A;  3MK6 A;  2QP9 X;  1VDD A;  5ITT A;  3K92 A;  2QBY A;  1OFI A;  1TH2 A;  4TUW A;  2ERC A;  3D8L A;  1N33 M;  4B3S M;  1IXS B;  3R8F A;  4AKG A;  3KS4 A;  3U61 B;  3VFD A;  5ITR A;  3VDU A;  2OQ4 A;  1L1Z A;  5IZ7 D;  1IXR C;  4FCV A;  4KO8 A;  1XC8 A;  3KOW E;  2UUA M;  2R65 A;  4G4N A;  3KW6 A;  4OX9 M;  2AHM A;  3TE6 A;  1XNR M;  1D2N A;  5GKN A;  3HWS A;  4L78 A;  3TL4 X;  1NSF A;  2KZU A;  2W82 A;  1Q3B A;  3LQQ A;  4M9X A;  3VK7 A;  4QNM A;  3U61 A;  5E6J A;  4QHT A;  5EP3 A;  1K82 A;  3RGP A;  2FE8 A;  3EIH A;  3HKP A;  2Z3X A;  1N32 M;  1QAQ A;  2VQE M;  3CF2 A;  3E4R A;  2VQF M;  4DV0 M;  4DUZ M;  3AOG A;  2CE7 A;  1HT1 E;  2UXB M;  2QEN A;  5KO3 A;  3GLI A;  4DV3 M;  5BPV A;  3A42 A;  3M7G A;  2XLJ A;  1TDH A;  4B7G A;  3ZC7 B;  1KSF X;  1IY1 A;  4M9S A;  3KFU G;  1C1K A;  2M60 A;  4IBI A;  5JI2 E;  3TWL A;  2V6Z M;  1L2B A;  3HHX A;  4X66 M;  3FKE A;  5ITQ A;  2I7N A;  3DZD A;  3J7A S;  3GLF A;  3AFH A;  4GC9 A;  3PNY A;  4NXN M;  3FUU A;  3FYD A;  5FTK A;  1TGU A;  3J27 B;  4FWD A;  2ZAO A;  5FTJ A;  4DR6 M;  5LMN M;  1E32 A;  4G4R A;  1IN4 A;  1ZAE A;  1IBK M;  1SXJ C;  4RNA A;  1TDZ A;  3VLF B;  5IT9 S;  4DR1 M;  4PCZ A;  4OVZ B;  3I4V A;  2Y20 A;  3AJI B;  1NNJ A;  2QPA A;  4PDG A;  5LMU M;  2EUC A;  4MM3 B;  3U6O A;  1IN7 A;  3LVV A;  3PVS A;  3SMP A;  2L09 A;  3JR5 A;  2RGH A;  2CV1 A;  4LF8 M;  2CHV A;  4I8O A;  3GQ4 A;  4G4Q A;  2DVW B;  2V1U A;  1MX0 A;  2HKJ A;  3EIE A;  4DV2 M;  1NHW C;  4B3R M;  4AKH A;  2DWN A;  4JI4 M;  1Q39 A;  3AV0 A;  3VKH A;  1R6B X;  1WXQ A;  3PFI A;  1YSY A;  3I4Y A;  4QHS A;  4CHT B;  2ZM6 M;  1KYI A;  1GL7 A;  8CAT A;  1NY6 A;  3SHF A;  2C9C A;  2FNA A;  1FNN A;  2HCB A;  4MGI E;  3GPY A;  3TWM A;  4KLN A;  5FTL A;  2UXC M;  2CHQ A;  5FLX S;  4LRS A;  2Z7J A;  1HNZ M;  4IBD A;  1G59 A;  2KRK A;  4LY6 A;  3L2A A;  2D7H A;  5ITY A;  1J5E M;  4QNR A;  3KP1 E;  3K8Z A;  3LQR A;  2CV0 A;  4LFB M;  1YUB A;  3IG8 A;  3KDS E;  4LGY A;  1DGB A;  1Z5C A;  4LF6 M;  2YQZ A;  3FTF A;  4I4L A;  4MH0 E;  4AG6 A;  3L26 A;  3KOX E;  4G4O A;  1K3X A;  5A2Q S;  3KOY E;  4NSO B;  4B3T M;  1NJF A;  4MGZ E;  3UK6 A;  1DGH B;  3CF0 A;  4I5S A;  3KVW A;  4DV6 M;  1K3W A;  2H1R A;  4LFC M;  2DWZ B;  1L8Q A;  4FW9 A;  4LF4 M;  1N77 A;  2UUB M;  4NRV A;  4WUR A;  3U6E A;  4W5W A;  4DR7 M;  2CEA A;  4S12 A;  4LJ5 A;  3KS8 A;  4MGH A;  5EXP A;  3M0E A;  4L8R C;  1JR3 A;  3L28 A;  4LF5 M;  3KSX A;  3T15 A;  4IBB A;  1GLN A;  2CUZ A;  4FWH A;  3GLH B;  1HNX M;  2R46 A;  5KPZ A;  2QBY B;  2BNK A;  3PXG A;  5E26 A;  2G8L A;  1IBL M;  2M5Z A;  3GQ5 A;  3GLG B;  4JYA M;  4CGY B;  4MGY E;  1L2C A;  4DV1 M;  2KRU A;  1XNQ M;  2E5L M;  5ITX E;  4NSR A;  3GPU A;  2Y21 A;  5EP2 A;  4GHA A;  1PM5 A;  2X4A A;  4D81 A;  1PJJ A;  2QZ4 A;  4PD2 A;  4R7G A;  1XWI A;  4L16 A;  4PDI A;  1DGF A;  4DR5 M;  2F5P A;  2UUC M;  4MB7 A;  4XGI A;  3RE8 A;  1NVM A;  3K2L A;  4MGK E;  3J80 S;  3HJ8 A;  4DR4 M;  4JI1 M;  2X49 A;  3UGJ A;  3RGS A;  5BR8 M;  1W5T A;  2YFQ A;  3J2P B;  4LZJ A;  4JI8 M;  2C96 A;  3U6S A;  1Z59 A;  4D80 A;  2HL7 A;  1I94 M;  1N75 A;  4GC5 A;  1GKI A;  3A46 A;  3DA1 A;  3QAU A;  2R4E A;  4LGM A;  2EA0 A;  3HHZ A;  1N36 M;  1HQC A;  5JI3 E;  2LH0 A;  3AOE C;  3D8B A;  5FTN A;  3FTD A;  3UZU A;  4YY3 M;  2P5T A;  3HHW A;  1G3I A;  4FWG A;  1IXZ A;  4K0K M;  2CFO A;  5DNY A;  4AG5 A;  4P16 A;  1IBM M;  3GRR A;  3U6L A;  2XZF A;  3VK8 A;  3L25 A;  3L29 A;  3TPZ A;  3WHL A;  1Z5A A;  3W0F A;  3DOA A;  1NY5 A;  2DZN B;  5H37 D;  3GLI B;  2V1C A;  4JXJ A;  4LJ6 A;  2XH9 A;  3Q8X A;  4M9Z A;  4II7 A;  2R18 A;  4DR2 M;  3SAR A;  2CHG A;  2DZO B;  3HU1 A;  4FVM A;  3WHK A;  3AL0 C;  2XFS A;  1XXH A;  1E9R A;  1SXJ D;  2ZAN A;  3VDP A;  2J7O A;  1NNU C;  5FTM A;  4JI5 M;  1W5S A;  3AOE A;  1IY2 A;  3UMM A;  3HHY A;  4ITQ A;  2A5Y B;  1HNW M;  2D7E A;  2OPF A;  5C18 A;  3U6M A;  3U60 A;  2Z4S A;  2R4J A;  3FUV A;  3SHG B;  4CIS A;  2F5N A;  4IBG A;  3GRV A;  1OJL A;  5EXT A;  3A45 A;  2ZBK B;  2C5R A;  4AKI A;  1R2Z A;  4B3M M;  2F4V M;  1XHB A;  1J09 A;  1YE9 A;  4JI2 M;  2XEP A;  4LF9 M;  3I51 A;  2KZS A;  4OU7 A;  1N78 A;  3GQ3 A;  4R3D A;  4IBJ A;  1R7R A;  3L27 A;  7CAT A;  1XXH B;  3FUT A;  5IWA M;  3J7B A;  2RKO A;  1GL6 A;  2KA6 B;  4NXM M;  1J7K A;  4OW0 A;  4LG2 A;  2Y0T A;  5KQ8 A;  2FFJ A;  2G5G X;  1G41 A;  2DWL A;  1NHG C;  3PNV A;  4OVZ A;  3SAV A;  5EP1 A;  3VKG A;  1TH3 A;  2EO2 A;  2DWM A;  4LJA A;  2F5O A;  2LNH C;  3FUW A;  3CF6 E;  4LJ7 A;  4GIT A;  2XSZ A;  4IBC A;  3SC3 A;  5F3W A;  2XGN A;  3J81 S;  1PJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...