2KZUA

Daxx helical bundle (dhb) domain / rassf1c complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
molecule keywords Death-associated protein 6
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzuA00
2KZSA 2KZUA
chains in the Genus database with same CATH superfamily
2R44A 1JR3E 3CGWA 1D0LA 1QUTA 1IY2A 1FNNA 2DENA 3TPZA 2ZAOA 1VQ1A 3D8LA 4KO8A 2L7IA 2OOAA 4OVZA 1IBMM 2ZANA 2RGOA 3DOAA 3E9SA 1KFVA 1LV7A 4GC5A 3SARA 3U61A 3VLFB 2LVAA 4DV4M 2LVOC 3BXWA 3HU1A 2QSFX 3I4VA 3SHFA 4NL4H 3R9XB 3U6SA 4OX9M 1OIZA 2XLJA 4G4QA 3U6EA 4JXJA 3DZDA 4FCVA 4R7GA 3TWLA 1VEKA 5EP4A 1QZEA 4B7FA 1OAIA 1TH3A 5EP3A 1KSFX 2Q2EB 2L09A 4B3RM 3GPUA 4L4UA 4CJ6A 3H4MA 2RGHA 2XFTA 3I01M 2YQZA 3E46A 4PT5A 1XMOM 5JI2E 2CE7A 3FTEA 4NRWA 3QAUA 5DNYA 1HJPA 2DZOB 2EKFA 2H5XA 3UMMA 4FWHA 4LF4M 3A45A 3FYDA 4PDIA 1IBLM 2QZ4A 4DR4M 8CATA 1Q02A 2JY6B 3J81S 4G4OA 3ZC7B 3KP1E 4AI6A 2GQFA 5IWAM 3AV0A 3VK7A 1NV9A 2KXEA 3EIHA 1DGBA 1TGUA 2I7NA 1IFYA 3V76A 2CP8A 1R6BX 1NNUC 5H37D 4DR6M 3ILKA 4HL4A 2B3TA 4QOZC 1UFZA 4LZZA 1JB0F 2DKLA 4QOSA 1K82A 2CHVA 4M9XA 3SBJA 4YHHM 4DV2M 1WJ7A 2QBYB 2XSZA 3GLGA 3GO8A 3GQ4A 3HJ8A 3QYEA 2QHOB 4M9SA 2CWBA 2MJ5B 4MGZE 4RF0A 3GLFE 2F5SA 2MH8A 2HHHM 2Y0QA 2ERCA 1DO2A 5BR8M 1HNWM 1PJJA 3LVWA 1DGGA 1E9SA 1G4AE 4KODA 2VDBB 4GEWA 4P16A 2O5RA 3AOGA 3KS8A 3NBIA 3JAMS 3KFUG 2XF3A 3PVSA 1IQPA 2CV0A 4L15A 1Z6TA 3FTDA 3U6PA 3RGSA 1VEGA 2KZUA 2C99A 4ANRA 5ITRA 1IN5A 2DWLA 4GHLA 3GQ3A 4I4LA 4D82A 5EP2A 3C58A 4CGYB 3SC3A 4B3TM 1WIVA 1NVMA 5LMUM 4DV7M 2GNOA 5FTMA 4OU7A 1L2DA 3TWMA 1GJTA 4F1IA 2Y20A 3NBXX 4IJFA 1GVNA 4AKGA 4HEOA 4JI6M 1W5TA 2RRUA 4XBOA 3SHGB 1IBKM 3VKGA 3D8BA 4AW4A 3SYLA 5ITTA 1IN6A 5EXSA 1Z5CA 1E9RA 3K1JA 4QNMA 4NSOB 4DR3M 3M0EA 2R46A 1QAQA 2DWNA 1Z5BA 2F5PA 1ZQ9A 4IBKA 3E21A 3T6PA 3GLFB 1MU5A 1YSYA 3TWKA 4D80A 3L27A 2VQFM 4RKUF 1V34A 1G59A 2LHGA 1G41A 4XGIA 1OTRA 2QQ8A 1JR3D 2YR0A 4G4NA 2FFJA 2LBCA 2OOBA 2CHGA 1TH4A 3GRYA 5F3WA 1QDRA 3VK8A 4QHSA 5KO3A 3J2PB 1G8PA 1OFHA 3FUWA 2UUBM 1GJSA 2HWJA 4MM3B 5A2QS 2DNAA 2BJVA 2LNHC 1PRBA 3HWSA 5EQTA 3U60A 1D0MA 3KSJA 4LG2A 4I5SA 5GKNA 5ITQA 2HKJA 1AUAA 2DAEA 2Z3XA 1TF0B 7CATA 4GC9A 5FTKA 1QAMA 1D2NA 1IY1A 2FE8A 3HHYA 4LJ8A 4Q7JA 3LCVB 3KDSE 1J09A 1NHGC 2WSCF 5FTLA 4LJ5A 2R0IA 2R4EA 2V1CA 3VKHA 4FD2A 3GPPA 2J7OA 1TTEA 1PJSA 2Y0TA 4FWDA 3L25A 2KRKA 4CHTB 1HQYE 1R2ZA 3HU2A 3GP1A 4I81A 2C9OA 3J7AS 1Z59A 4NRVA 3CF6E 4WURA 1YLAA 2G5GX 1C7YA 5FTNA 4IJEA 2QPAA 4BB9A 2ZTCA 1DV0A 1NNJA 3A42A 3HKPA 4IBFA 4GHAA 1GABA 1P3QQ 3RGPA 1BVSA 1DGHA 3T38A 1ZMWA 3FUXA 4NSRA 3FUVA 5ITUA 1N34M 1L2BA 1HNZM 2LVNC 4DBGB 4JI1M 1SXJC 4GITA 1G71A 1VEJA 4GKJM 4LZJA 4DUYM 1QAOA 1NY6A 2RKOA 1K3WA 2FS1A 4BLCA 1T6OA 5ITXA 1IM2A 1GO5A 2Z4SA 4X64M 3PNYA 4ZPXA 5E26A 1GLNA 2K9DA 1OJLA 4NOOB 2APLA 1PJTA 4R71A 2D7HA 1HQCA 2Z7JA 4NXMM 3A46A 1L2CA 2KHHA 2QNJA 1DO0A 2YNMD 1IXSA 4S12A 2F4VM 3TE6A 4DV6M 1QUSA 2OQ4A 2M5ZA 2ZTDA 3QWLA 4Y28F 2L6OA 4IBDA 4OVZB 4B3SM 2CHQA 2E5LM 3LCUA 3HHZA 3PNVA 1WHCA 3U61B 2BNKA 3TL4X 4PDGA 4IBCA 2LTUA 4ITQA 1QDTA 4UN2B 3GLGE 4MB7A 2DVWB 2CEAA 3W0LB 4LF6M 4JYAM 2KNAA 1XXHA 4DV3M 3UZUA 1EIJA 2L4FA 3C3DA 3UGJA 2CUZA 4LF8M 3OTOM 4B08A 1NSFA 3KOWE 2KEBA 4DR1M 2UXCM 5IT9S 3THGA 2YFQA 4FCTA 2A5YB 1WGNA 3W0FA 3SATA 3U6DA 1DGHB 2DAKA 1VG5A 3FD9A 2L4EA 3J27B 3SFZA 2FNAA 1OKSA 1NV8A 2LHCA 2LXEA 1Y8GA 3WHLA 2JY7A 5EXPA 4X66M 1XMQM 1IN4A 3F92A 2C96A 3L29A 3QYBA 4LJ4A 2KNZA 2DZNB 3KP0E 4NXNM 2R62A 3IG8A 3HZJA 3M6AA 1TR8A 3T15A 4JI4M 3EIEA 1H6UA 3BBZA 3ZQJA 1WGLA 3SAWA 2UUCM 4I8OA 4LY6A 2C5RA 5KQ8A 4Z8XA 2VQEM 3AKZA 3BOSA 4IBJA 2H1RA 2LH0A 3GLIA 1F4IA 4JI8M 3GLIE 2DAIA 3VDPA 2R45A 3U5ZA 1N32M 3IECA 3AL0C 1FJGM 1EE8A 4G3OA 5FTJA 3JR4A 5BPVA 4M9ZA 3GLGB 1JQJC 2X8AA 3FKEA 4NC6A 2R4JA 3AFHA 2WSEF 3HY5A 2MR9A 1E94E 3KW6A 4IBBA 2QP9X 3FRIA 1Z5AA 1VDLA 2VIIA 3GPYA 2R18A 3HHWA 2LWXA 3UK6A 3M7GA 3K8ZA 2V6ZM 4YY3M 2F5NA 3FYCA 2DWZB 3CF0A 3HHXA 2JZ1A 2X4AA 3B89A 2KDLA 4P17A 4L6V6 5DYIA 4JI2M 2DI0A 2JWSA 2LVQD 5EXTA 5KQDA 2ZAMA 4FVMA 3I51A 3SAVA 4BBAA 3T1YM 1RU3A 1VDDA 4MH0E 4F2LA 1XHBA 3KSXA 3RE8A 3U6OA 1NHWC 2HL7A 4IIWA 5C1BA 4LJ9A 3CTWB 1Q39A 4IBGA 2KZSA 4LJ7A 3SASA 4LF7M 1IN7A 3L2AA 3NWLA 4REZA 4FCWA 4XK8F 1WR1B 3FTFA 1N75A 3L28A 3PFIA 1DGFA 1GKIA 4LFAM 3B7QA 1GL7A 4QNRA 1N77A 2Z8YM 3I04M 4MGYE 4DR5M 2F5QA 2EKKA 2JA2A 5ITYA 4CISA 4G4RA 2DHYA 1N78A 2DXIA 1Q3CA 2JNHA 3KOXE 4KT0F 4M0DA 2XFSA 1SXJA 2JXNA 3GLIB 3FRHA 1SXJE 3FTCA 3KS4A 5EJCA 3GPXA 3K9PA 4LJ6A 3AJIB 1ZV1A 4OW0A 5IREB 2UUAM 4LGYA 2CFOA 5FLXS 4WP2A 1AIPC 5JI3E 2DZLA 1QYRA 2QCUA 4DV5M 2R6FA 1R2YA 3HGIA 1L1TA 4JV5M 4JI0M 2EO2A 2UXDM 3LMMA 3B9PA 4A3VB 1HR0M 4LJAA 2FH0A 2LVPC 2M60A 2D7GA 1X37A 2JY8A 2KRUA 3PXGA 3SMPA 1IN8A 4AQYM 1ZAEA 1G3IA 3DA1A 4GKKM 2QBYA 3VFDA 3WHKA 4GH9A 1OFIA 2XSZD 3U60B 1XC8A 2W82A 4JN6A 1LTMA 1ZMUA 5EP1A 4PCZA 1HNXM 5ITXE 4FWGA 1XNQM 1R5LA 1EFUB 2BWBA 2DHRA 3FUUA 2Z4RA 4MGIE 3LQRA 5KPTA 1TH2A 2BWEA 2JUJA 4X62M 3HX3A 3UJNA 3GLHA 4TUWA 2K47A 3GLHE 2ZBKB 3R8FA 2BJWA 1I4WA 1D0KA 2DAMA 3W67A 1QZMA 4RNAA 2DAGA 2ZM6M 1TDHA 1MJGM 3TQSA 4AZFA 3K2LA 2G8LA 2OO9A 3K92A 4LRSA 2AHMA 4W5WA 5KPRA 1J7KA 5LMNM 1SXJB 2L7HA 3GRVA 2DWMA 3CF2A 2MGWA 2HAKA 4B7HA 1HT1E 2XEPA 4LFBM 2C9CA 5KPZA 1CUKA 1PM5A 1OQYA 3LVVA 1XXHE 5DFLA 2NQ8C 1L1ZA 2G3QA 1NJFA 3KVWA 2EUCA 3U6MA 1OIPA 1HT2E 4HLQA 3JR5A 1ORYB 1T3TA 4MGHA 3KOYE 1J5EM 1Q3BA 3MJ5A 1N33M 2EA0A 3KOZE 3AOEA 4DR7M 1TDZA 3B7NA 4WW0A 3GRRA 1MX0A 4GRIA 2K0BX 2L2DA 1PGYA 3GQ5A 2UU9M 3HJQA 2P5TA 3IG5A 4G6ZA 1YE9A 4GMQA 4K0KM 4DUZM 2UXBM 5IZ7D 3U6LA 4D81A 5DYGA 4EIWA 2K6BA 4JI3M 1NJGA 3KXEC 1YUBA 1A5TA 3GLFA 2VF7A 4AKHA 5E6JA 1QVRA 1QQWA 4B3MM 4AKIA 1XWIA 1V92A 4GIPA 2VF8A 1NO1A 3U6CA 3B74A 3GLHB 3MHVC 4PD2A 1KYIA 2KNVA 2CV2A 2JY5A 1IXSB 4L16A 3AOEC 3ZH9B 2C98A 2I7PA 2O01F 1WXQA 4LGMA 1R4GA 5C18A 1ZMVA 2KA6B 2QENA 3C9PA 2XZUA 2N35A 1I94M 4FW9A 2V1UA 2O25A 3Q8GA 1W5SA 3LW5F 3VDUA 4B7GA 1C1KA 1IXZA 4L78A 3FE3A 3H4JA 1XXHB 1MN3A 2JZ0A 4MGKE 2EJSA 1OAOC 3IHPA 3C3EA 3K9OA 3DFZA 4LRTA 4M0WA 2D7EA 1GL6A 2KW0A 3I4YA 2XZFA 1R7RA 4X65M 4KLNA 3E4RA 4JI7M 3SMSA 3L26A 1K3XA 1SXJD 2J5YA 2R65A 4QHTA 3U6QA 1QANA 4KHPM 3J7BA 4IBIA 2CV1A 1IXRC 2F5OA 3MK6A 4R3DA 2JP7A 2CRUA 1E32A 4Z6YA 2XGNA 4LF5M 1XNRM 1T43A 5EXXA 1SG9A 2HCBA 1XB2B 3GRUA 4II7A 3HU3A 1L8QA 4DV0M 1UM8A 1N36M 2WSFF 3SYKA 4JI5M 3W68A 3MMPA 4L8RC 1IY0A 1NY5A 2FOIC 1S3SA 3HJSA 2MROB 3T1HM 1V33A 5FSWA 3LQQA 2WZJA 5L8RF 3Q8XA 3RFWA 3U5ZB 2J7NA 4IBEA 2X49A 3SAUA 4AG6A 4AG5A 2OPFA 4LCBA 3ZCBB 3B7ZA 1PJIA 4RF1A 1PJQA 4LFCM 2XH9A 2Y21A 3FUTA 3A98B 4CIZA 4DV1M 4LF9M 3J80S 4DR2M 1JR3A
chains in the Genus database with same CATH topology
3TPZA 1IY2A 1FNNA 2ZAOA 3D8LA 4KO8A 2L7IA 4OVZA 1IBMM 2ZANA 2RGOA 3DOAA 3E9SA 1KFVA 1LV7A 4GC5A 3SARA 3U61A 3VLFB 4DV4M 3HU1A 3I4VA 3SHFA 4NL4H 3R9XB 3U6SA 4OX9M 2XLJA 4G4QA 3U6EA 4JXJA 3DZDA 4FCVA 4R7GA 3TWLA 5EP4A 4B7FA 1TH3A 5EP3A 1KSFX 2Q2EB 2L09A 4B3RM 3GPUA 4L4UA 3H4MA 2RGHA 2XFTA 2YQZA 4PT5A 1XMOM 5JI2E 2CE7A 3FTEA 4NRWA 3QAUA 5DNYA 2DZOB 3UMMA 4FWHA 4LF4M 3A45A 3FYDA 4PDIA 1IBLM 2QZ4A 4DR4M 8CATA 4G4OA 3J81S 3ZC7B 3KP1E 4AI6A 5IWAM 3AV0A 3VK7A 2KXEA 3EIHA 1DGBA 1TGUA 2I7NA 1R6BX 1NNUC 5H37D 4DR6M 3ILKA 4HL4A 4QOZC 4LZZA 4QOSA 1K82A 2CHVA 4M9XA 3SBJA 4YHHM 4DV2M 2QBYB 2XSZA 3GLGA 3GO8A 3GQ4A 3HJ8A 4M9SA 4MGZE 4RF0A 2F5SA 2HHHM 2Y0QA 2ERCA 1DO2A 5BR8M 1HNWM 1PJJA 3LVWA 1DGGA 1E9SA 1G4AE 4KODA 4P16A 2O5RA 3AOGA 3KS8A 3NBIA 3JAMS 3KFUG 2XF3A 3PVSA 1IQPA 2CV0A 4L15A 1Z6TA 3FTDA 3U6PA 3RGSA 2KZUA 2C99A 5ITRA 1IN5A 2DWLA 4GHLA 3GQ3A 4I4LA 4D82A 5EP2A 3C58A 4CGYB 3SC3A 4B3TM 1NVMA 5LMUM 4DV7M 5FTMA 4OU7A 1L2DA 3TWMA 2Y20A 4IJFA 1GVNA 4AKGA 4JI6M 1W5TA 4XBOA 3SHGB 1IBKM 3VKGA 3D8BA 4AW4A 3SYLA 5ITTA 1IN6A 5EXSA 1Z5CA 1E9RA 3K1JA 4QNMA 4NSOB 4DR3M 3M0EA 2R46A 1QAQA 2DWNA 1Z5BA 2F5PA 1ZQ9A 4IBKA 3GLFB 1MU5A 1YSYA 3TWKA 4D80A 3L27A 2VQFM 1G59A 1G41A 4XGIA 1JR3D 2YR0A 4G4NA 2FFJA 2CHGA 1TH4A 3GRYA 5F3WA 3VK8A 4QHSA 5KO3A 3J2PB 1G8PA 1OFHA 3FUWA 2UUBM 5A2QS 4MM3B 2BJVA 2LNHC 3HWSA 5EQTA 3U60A 3KSJA 4LG2A 4I5SA 5GKNA 5ITQA 2HKJA 2Z3XA 7CATA 4GC9A 5FTKA 1QAMA 1D2NA 1IY1A 2FE8A 3HHYA 4LJ8A 3KDSE 1J09A 1NHGC 5FTLA 4LJ5A 2R4EA 2V1CA 3VKHA 4FD2A 3GPPA 2J7OA 3L25A 2Y0TA 4FWDA 2KRKA 4CHTB 1HQYE 1R2ZA 3HU2A 3GP1A 4I81A 2C9OA 3J7AS 1Z59A 4NRVA 3CF6E 4WURA 2G5GX 5FTNA 4IJEA 2QPAA 4BB9A 1NNJA 3A42A 3HKPA 4IBFA 4GHAA 3RGPA 1DGHA 3T38A 5ITUA 1HNZM 3FUXA 4NSRA 3FUVA 1N34M 1L2BA 4JI1M 1SXJC 4GITA 4GKJM 4LZJA 4DUYM 1QAOA 1NY6A 2RKOA 1K3WA 4BLCA 5ITXA 1IM2A 2Z4SA 4X64M 3PNYA 4ZPXA 5E26A 1GLNA 4NOOB 1OJLA 2D7HA 1HQCA 2Z7JA 4NXMM 3A46A 1L2CA 1DO0A 2YNMD 4S12A 2F4VM 3TE6A 4DV6M 2OQ4A 2M5ZA 3QWLA 4B3SM 2L6OA 4IBDA 4OVZB 2CHQA 2E5LM 3HHZA 3PNVA 3U61B 2BNKA 3TL4X 4PDGA 4IBCA 4ITQA 4MB7A 2DVWB 2CEAA 3W0LB 4LF6M 4JYAM 1XXHA 4DV3M 3UZUA 3UGJA 2CUZA 4LF8M 3OTOM 4B08A 1NSFA 3KOWE 2KEBA 4DR1M 2UXCM 5IT9S 3THGA 2YFQA 4FCTA 2A5YB 3W0FA 3SATA 3U6DA 1DGHB 3FD9A 3J27B 3SFZA 2FNAA 2LXEA 4X66M 3WHLA 5EXPA 1XMQM 1IN4A 2C96A 3L29A 4LJ4A 3KP0E 2DZNB 4NXNM 2R62A 3IG8A 3M6AA 3T15A 4JI4M 3EIEA 1H6UA 3SAWA 2UUCM 4I8OA 4LY6A 2C5RA 5KQ8A 4Z8XA 2VQEM 3AKZA 3BOSA 4IBJA 2H1RA 2LH0A 3GLIA 4JI8M 3VDPA 2R45A 3U5ZA 1N32M 3AL0C 1FJGM 1EE8A 5FTJA 3JR4A 3GLGB 5BPVA 4M9ZA 1JQJC 2X8AA 3FKEA 2R4JA 3AFHA 1E94E 3KW6A 4IBBA 2QP9X 1Z5AA 2VIIA 3GPYA 2R18A 3HHWA 2LWXA 3UK6A 3M7GA 3K8ZA 2V6ZM 4YY3M 2F5NA 3FYCA 2DWZB 3CF0A 3HHXA 2X4AA 5DYIA 4JI2M 5EXTA 5KQDA 2ZAMA 4FVMA 3I51A 3SAVA 4BBAA 3T1YM 1VDDA 4MH0E 3U6OA 1XHBA 3KSXA 3RE8A 1NHWC 2HL7A 4IIWA 5C1BA 4LJ9A 3CTWB 1Q39A 4IBGA 2KZSA 4LJ7A 3SASA 4LF7M 1IN7A 3L2AA 3NWLA 4REZA 4FCWA 3FTFA 1N75A 3L28A 3PFIA 1DGFA 1GKIA 4LFAM 1GL7A 4QNRA 1N77A 4DR5M 4MGYE 2F5QA 2JA2A 5ITYA 4CISA 4G4RA 1N78A 2DXIA 1Q3CA 3KOXE 4M0DA 3GLIB 2XFSA 1SXJA 1SXJE 3FTCA 3KS4A 5EJCA 3GPXA 4LJ6A 3AJIB 4OW0A 5IREB 2UUAM 4LGYA 2CFOA 5FLXS 4DV5M 5JI3E 1QYRA 2QCUA 1R2YA 1L1TA 3HGIA 4JV5M 4JI0M 2EO2A 2UXDM 3LMMA 3B9PA 4A3VB 1HR0M 4LJAA 2M60A 2D7GA 1X37A 2KRUA 3PXGA 3SMPA 1IN8A 4AQYM 1ZAEA 1G3IA 3DA1A 4GKKM 2QBYA 3VFDA 3WHKA 4GH9A 1OFIA 2XSZD 3U60B 1XC8A 2W82A 4JN6A 5EP1A 4PCZA 1HNXM 1XNQM 5ITXE 4FWGA 2DHRA 3FUUA 2Z4RA 4MGIE 3LQRA 5KPTA 1TH2A 4X62M 3UJNA 3GLHA 4TUWA 2K47A 2ZBKB 3R8FA 2BJWA 1I4WA 1QZMA 4RNAA 2ZM6M 1TDHA 3TQSA 4AZFA 3K2LA 2G8LA 3K92A 4W5WA 4LRSA 2AHMA 5KPRA 5LMNM 1J7KA 1SXJB 2L7HA 3GRVA 2DWMA 3CF2A 4B7HA 1HT1E 2XEPA 4LFBM 2C9CA 5KPZA 1PM5A 3LVVA 1L1ZA 2NQ8C 1NJFA 3KVWA 2EUCA 3U6MA 1HT2E 4HLQA 3JR5A 1ORYB 1T3TA 4MGHA 3KOYE 1J5EM 1Q3BA 3MJ5A 1N33M 2EA0A 3KOZE 3AOEA 4DR7M 1TDZA 4WW0A 3GRRA 1MX0A 4GRIA 3GQ5A 2UU9M 3HJQA 2P5TA 3IG5A 4G6ZA 1YE9A 4GMQA 4K0KM 4DUZM 2UXBM 5IZ7D 3U6LA 4D81A 5DYGA 4EIWA 4JI3M 1NJGA 3KXEC 1YUBA 3GLFA 4AKHA 5E6JA 1QVRA 1QQWA 4B3MM 4AKIA 1XWIA 4GIPA 3U6CA 3GLHB 3MHVC 4PD2A 1KYIA 2CV2A 4L16A 1IXSB 3ZH9B 3AOEC 2C98A 2I7PA 1WXQA 4LGMA 5C18A 2KA6B 2QENA 2XZUA 2V1UA 1I94M 4FW9A 1W5SA 3VDUA 4B7GA 1C1KA 1IXZA 4L78A 1XXHB 4MGKE 4LRTA 4M0WA 3DFZA 2D7EA 1GL6A 2KW0A 3I4YA 2XZFA 1R7RA 4X65M 4KLNA 3E4RA 4JI7M 3SMSA 3L26A 1K3XA 1SXJD 2R65A 4QHTA 3U6QA 1QANA 4KHPM 3J7BA 4IBIA 2CV1A 1IXRC 2F5OA 3MK6A 4R3DA 1E32A 4Z6YA 2XGNA 4LF5M 1XNRM 5EXXA 2HCBA 3GRUA 4II7A 3HU3A 1L8QA 4DV0M 1UM8A 1N36M 3SYKA 4JI5M 4L8RC 1IY0A 1NY5A 2FOIC 1S3SA 3HJSA 3T1HM 5FSWA 3LQQA 3Q8XA 3RFWA 3U5ZB 2J7NA 4IBEA 2X49A 3SAUA 4AG6A 4AG5A 2OPFA 4LCBA 3ZCBB 1PJIA 4RF1A 4LFCM 2XH9A 2Y21A 3FUTA 3A98B 4DV1M 4LF9M 3J80S 4DR2M 1JR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZS A;  2KZU A; 
#chains in the Genus database with same CATH topology
 2R44 A;  1JR3 E;  3CGW A;  1D0L A;  1QUT A;  1IY2 A;  1FNN A;  2DEN A;  3TPZ A;  2ZAO A;  1VQ1 A;  3D8L A;  4KO8 A;  2L7I A;  2OOA A;  4OVZ A;  1IBM M;  2ZAN A;  2RGO A;  3DOA A;  3E9S A;  1KFV A;  1LV7 A;  4GC5 A;  3SAR A;  3U61 A;  3VLF B;  2LVA A;  4DV4 M;  2LVO C;  3BXW A;  3HU1 A;  2QSF X;  3I4V A;  3SHF A;  4NL4 H;  3R9X B;  3U6S A;  4OX9 M;  1OIZ A;  2XLJ A;  4G4Q A;  3U6E A;  4JXJ A;  3DZD A;  4FCV A;  4R7G A;  3TWL A;  1VEK A;  5EP4 A;  1QZE A;  4B7F A;  1OAI A;  1TH3 A;  5EP3 A;  1KSF X;  2Q2E B;  2L09 A;  4B3R M;  3GPU A;  4L4U A;  4CJ6 A;  3H4M A;  2RGH A;  2XFT A;  3I01 M;  2YQZ A;  3E46 A;  4PT5 A;  1XMO M;  5JI2 E;  2CE7 A;  3FTE A;  4NRW A;  3QAU A;  5DNY A;  1HJP A;  2DZO B;  2EKF A;  2H5X A;  3UMM A;  4FWH A;  4LF4 M;  3A45 A;  3FYD A;  4PDI A;  1IBL M;  2QZ4 A;  4DR4 M;  8CAT A;  1Q02 A;  2JY6 B;  3J81 S;  4G4O A;  3ZC7 B;  3KP1 E;  4AI6 A;  2GQF A;  5IWA M;  3AV0 A;  3VK7 A;  1NV9 A;  2KXE A;  3EIH A;  1DGB A;  1TGU A;  2I7N A;  1IFY A;  3V76 A;  2CP8 A;  1R6B X;  1NNU C;  5H37 D;  4DR6 M;  3ILK A;  4HL4 A;  2B3T A;  4QOZ C;  1UFZ A;  4LZZ A;  1JB0 F;  2DKL A;  4QOS A;  1K82 A;  2CHV A;  4M9X A;  3SBJ A;  4YHH M;  4DV2 M;  1WJ7 A;  2QBY B;  2XSZ A;  3GLG A;  3GO8 A;  3GQ4 A;  3HJ8 A;  3QYE A;  2QHO B;  4M9S A;  2CWB A;  2MJ5 B;  4MGZ E;  4RF0 A;  3GLF E;  2F5S A;  2MH8 A;  2HHH M;  2Y0Q A;  2ERC A;  1DO2 A;  5BR8 M;  1HNW M;  1PJJ A;  3LVW A;  1DGG A;  1E9S A;  1G4A E;  4KOD A;  2VDB B;  4GEW A;  4P16 A;  2O5R A;  3AOG A;  3KS8 A;  3NBI A;  3JAM S;  3KFU G;  2XF3 A;  3PVS A;  1IQP A;  2CV0 A;  4L15 A;  1Z6T A;  3FTD A;  3U6P A;  3RGS A;  1VEG A;  2KZU A;  2C99 A;  4ANR A;  5ITR A;  1IN5 A;  2DWL A;  4GHL A;  3GQ3 A;  4I4L A;  4D82 A;  5EP2 A;  3C58 A;  4CGY B;  3SC3 A;  4B3T M;  1WIV A;  1NVM A;  5LMU M;  4DV7 M;  2GNO A;  5FTM A;  4OU7 A;  1L2D A;  3TWM A;  1GJT A;  4F1I A;  2Y20 A;  3NBX X;  4IJF A;  1GVN A;  4AKG A;  4HEO A;  4JI6 M;  1W5T A;  2RRU A;  4XBO A;  3SHG B;  1IBK M;  3VKG A;  3D8B A;  4AW4 A;  3SYL A;  5ITT A;  1IN6 A;  5EXS A;  1Z5C A;  1E9R A;  3K1J A;  4QNM A;  4NSO B;  4DR3 M;  3M0E A;  2R46 A;  1QAQ A;  2DWN A;  1Z5B A;  2F5P A;  1ZQ9 A;  4IBK A;  3E21 A;  3T6P A;  3GLF B;  1MU5 A;  1YSY A;  3TWK A;  4D80 A;  3L27 A;  2VQF M;  4RKU F;  1V34 A;  1G59 A;  2LHG A;  1G41 A;  4XGI A;  1OTR A;  2QQ8 A;  1JR3 D;  2YR0 A;  4G4N A;  2FFJ A;  2LBC A;  2OOB A;  2CHG A;  1TH4 A;  3GRY A;  5F3W A;  1QDR A;  3VK8 A;  4QHS A;  5KO3 A;  3J2P B;  1G8P A;  1OFH A;  3FUW A;  2UUB M;  1GJS A;  2HWJ A;  4MM3 B;  5A2Q S;  2DNA A;  2BJV A;  2LNH C;  1PRB A;  3HWS A;  5EQT A;  3U60 A;  1D0M A;  3KSJ A;  4LG2 A;  4I5S A;  5GKN A;  5ITQ A;  2HKJ A;  1AUA A;  2DAE A;  2Z3X A;  1TF0 B;  7CAT A;  4GC9 A;  5FTK A;  1QAM A;  1D2N A;  1IY1 A;  2FE8 A;  3HHY A;  4LJ8 A;  4Q7J A;  3LCV B;  3KDS E;  1J09 A;  1NHG C;  2WSC F;  5FTL A;  4LJ5 A;  2R0I A;  2R4E A;  2V1C A;  3VKH A;  4FD2 A;  3GPP A;  2J7O A;  1TTE A;  1PJS A;  2Y0T A;  4FWD A;  3L25 A;  2KRK A;  4CHT B;  1HQY E;  1R2Z A;  3HU2 A;  3GP1 A;  4I81 A;  2C9O A;  3J7A S;  1Z59 A;  4NRV A;  3CF6 E;  4WUR A;  1YLA A;  2G5G X;  1C7Y A;  5FTN A;  4IJE A;  2QPA A;  4BB9 A;  2ZTC A;  1DV0 A;  1NNJ A;  3A42 A;  3HKP A;  4IBF A;  4GHA A;  1GAB A;  1P3Q Q;  3RGP A;  1BVS A;  1DGH A;  3T38 A;  1ZMW A;  3FUX A;  4NSR A;  3FUV A;  5ITU A;  1N34 M;  1L2B A;  1HNZ M;  2LVN C;  4DBG B;  4JI1 M;  1SXJ C;  4GIT A;  1G71 A;  1VEJ A;  4GKJ M;  4LZJ A;  4DUY M;  1QAO A;  1NY6 A;  2RKO A;  1K3W A;  2FS1 A;  4BLC A;  1T6O A;  5ITX A;  1IM2 A;  1GO5 A;  2Z4S A;  4X64 M;  3PNY A;  4ZPX A;  5E26 A;  1GLN A;  2K9D A;  1OJL A;  4NOO B;  2APL A;  1PJT A;  4R71 A;  2D7H A;  1HQC A;  2Z7J A;  4NXM M;  3A46 A;  1L2C A;  2KHH A;  2QNJ A;  1DO0 A;  2YNM D;  1IXS A;  4S12 A;  2F4V M;  3TE6 A;  4DV6 M;  1QUS A;  2OQ4 A;  2M5Z A;  2ZTD A;  3QWL A;  4Y28 F;  2L6O A;  4IBD A;  4OVZ B;  4B3S M;  2CHQ A;  2E5L M;  3LCU A;  3HHZ A;  3PNV A;  1WHC A;  3U61 B;  2BNK A;  3TL4 X;  4PDG A;  4IBC A;  2LTU A;  4ITQ A;  1QDT A;  4UN2 B;  3GLG E;  4MB7 A;  2DVW B;  2CEA A;  3W0L B;  4LF6 M;  4JYA M;  2KNA A;  1XXH A;  4DV3 M;  3UZU A;  1EIJ A;  2L4F A;  3C3D A;  3UGJ A;  2CUZ A;  4LF8 M;  3OTO M;  4B08 A;  1NSF A;  3KOW E;  2KEB A;  4DR1 M;  2UXC M;  5IT9 S;  3THG A;  2YFQ A;  4FCT A;  2A5Y B;  1WGN A;  3W0F A;  3SAT A;  3U6D A;  1DGH B;  2DAK A;  1VG5 A;  3FD9 A;  2L4E A;  3J27 B;  3SFZ A;  2FNA A;  1OKS A;  1NV8 A;  2LHC A;  2LXE A;  1Y8G A;  3WHL A;  2JY7 A;  5EXP A;  4X66 M;  1XMQ M;  1IN4 A;  3F92 A;  2C96 A;  3L29 A;  3QYB A;  4LJ4 A;  2KNZ A;  2DZN B;  3KP0 E;  4NXN M;  2R62 A;  3IG8 A;  3HZJ A;  3M6A A;  1TR8 A;  3T15 A;  4JI4 M;  3EIE A;  1H6U A;  3BBZ A;  3ZQJ A;  1WGL A;  3SAW A;  2UUC M;  4I8O A;  4LY6 A;  2C5R A;  5KQ8 A;  4Z8X A;  2VQE M;  3AKZ A;  3BOS A;  4IBJ A;  2H1R A;  2LH0 A;  3GLI A;  1F4I A;  4JI8 M;  3GLI E;  2DAI A;  3VDP A;  2R45 A;  3U5Z A;  1N32 M;  3IEC A;  3AL0 C;  1FJG M;  1EE8 A;  4G3O A;  5FTJ A;  3JR4 A;  5BPV A;  4M9Z A;  3GLG B;  1JQJ C;  2X8A A;  3FKE A;  4NC6 A;  2R4J A;  3AFH A;  2WSE F;  3HY5 A;  2MR9 A;  1E94 E;  3KW6 A;  4IBB A;  2QP9 X;  3FRI A;  1Z5A A;  1VDL A;  2VII A;  3GPY A;  2R18 A;  3HHW A;  2LWX A;  3UK6 A;  3M7G A;  3K8Z A;  2V6Z M;  4YY3 M;  2F5N A;  3FYC A;  2DWZ B;  3CF0 A;  3HHX A;  2JZ1 A;  2X4A A;  3B89 A;  2KDL A;  4P17 A;  4L6V 6;  5DYI A;  4JI2 M;  2DI0 A;  2JWS A;  2LVQ D;  5EXT A;  5KQD A;  2ZAM A;  4FVM A;  3I51 A;  3SAV A;  4BBA A;  3T1Y M;  1RU3 A;  1VDD A;  4MH0 E;  4F2L A;  1XHB A;  3KSX A;  3RE8 A;  3U6O A;  1NHW C;  2HL7 A;  4IIW A;  5C1B A;  4LJ9 A;  3CTW B;  1Q39 A;  4IBG A;  2KZS A;  4LJ7 A;  3SAS A;  4LF7 M;  1IN7 A;  3L2A A;  3NWL A;  4REZ A;  4FCW A;  4XK8 F;  1WR1 B;  3FTF A;  1N75 A;  3L28 A;  3PFI A;  1DGF A;  1GKI A;  4LFA M;  3B7Q A;  1GL7 A;  4QNR A;  1N77 A;  2Z8Y M;  3I04 M;  4MGY E;  4DR5 M;  2F5Q A;  2EKK A;  2JA2 A;  5ITY A;  4CIS A;  4G4R A;  2DHY A;  1N78 A;  2DXI A;  1Q3C A;  2JNH A;  3KOX E;  4KT0 F;  4M0D A;  2XFS A;  1SXJ A;  2JXN A;  3GLI B;  3FRH A;  1SXJ E;  3FTC A;  3KS4 A;  5EJC A;  3GPX A;  3K9P A;  4LJ6 A;  3AJI B;  1ZV1 A;  4OW0 A;  5IRE B;  2UUA M;  4LGY A;  2CFO A;  5FLX S;  4WP2 A;  1AIP C;  5JI3 E;  2DZL A;  1QYR A;  2QCU A;  4DV5 M;  2R6F A;  1R2Y A;  3HGI A;  1L1T A;  4JV5 M;  4JI0 M;  2EO2 A;  2UXD M;  3LMM A;  3B9P A;  4A3V B;  1HR0 M;  4LJA A;  2FH0 A;  2LVP C;  2M60 A;  2D7G A;  1X37 A;  2JY8 A;  2KRU A;  3PXG A;  3SMP A;  1IN8 A;  4AQY M;  1ZAE A;  1G3I A;  3DA1 A;  4GKK M;  2QBY A;  3VFD A;  3WHK A;  4GH9 A;  1OFI A;  2XSZ D;  3U60 B;  1XC8 A;  2W82 A;  4JN6 A;  1LTM A;  1ZMU A;  5EP1 A;  4PCZ A;  1HNX M;  5ITX E;  4FWG A;  1XNQ M;  1R5L A;  1EFU B;  2BWB A;  2DHR A;  3FUU A;  2Z4R A;  4MGI E;  3LQR A;  5KPT A;  1TH2 A;  2BWE A;  2JUJ A;  4X62 M;  3HX3 A;  3UJN A;  3GLH A;  4TUW A;  2K47 A;  3GLH E;  2ZBK B;  3R8F A;  2BJW A;  1I4W A;  1D0K A;  2DAM A;  3W67 A;  1QZM A;  4RNA A;  2DAG A;  2ZM6 M;  1TDH A;  1MJG M;  3TQS A;  4AZF A;  3K2L A;  2G8L A;  2OO9 A;  3K92 A;  4LRS A;  2AHM A;  4W5W A;  5KPR A;  1J7K A;  5LMN M;  1SXJ B;  2L7H A;  3GRV A;  2DWM A;  3CF2 A;  2MGW A;  2HAK A;  4B7H A;  1HT1 E;  2XEP A;  4LFB M;  2C9C A;  5KPZ A;  1CUK A;  1PM5 A;  1OQY A;  3LVV A;  1XXH E;  5DFL A;  2NQ8 C;  1L1Z A;  2G3Q A;  1NJF A;  3KVW A;  2EUC A;  3U6M A;  1OIP A;  1HT2 E;  4HLQ A;  3JR5 A;  1ORY B;  1T3T A;  4MGH A;  3KOY E;  1J5E M;  1Q3B A;  3MJ5 A;  1N33 M;  2EA0 A;  3KOZ E;  3AOE A;  4DR7 M;  1TDZ A;  3B7N A;  4WW0 A;  3GRR A;  1MX0 A;  4GRI A;  2K0B X;  2L2D A;  1PGY A;  3GQ5 A;  2UU9 M;  3HJQ A;  2P5T A;  3IG5 A;  4G6Z A;  1YE9 A;  4GMQ A;  4K0K M;  4DUZ M;  2UXB M;  5IZ7 D;  3U6L A;  4D81 A;  5DYG A;  4EIW A;  2K6B A;  4JI3 M;  1NJG A;  3KXE C;  1YUB A;  1A5T A;  3GLF A;  2VF7 A;  4AKH A;  5E6J A;  1QVR A;  1QQW A;  4B3M M;  4AKI A;  1XWI A;  1V92 A;  4GIP A;  2VF8 A;  1NO1 A;  3U6C A;  3B74 A;  3GLH B;  3MHV C;  4PD2 A;  1KYI A;  2KNV A;  2CV2 A;  2JY5 A;  1IXS B;  4L16 A;  3AOE C;  3ZH9 B;  2C98 A;  2I7P A;  2O01 F;  1WXQ A;  4LGM A;  1R4G A;  5C18 A;  1ZMV A;  2KA6 B;  2QEN A;  3C9P A;  2XZU A;  2N35 A;  1I94 M;  4FW9 A;  2V1U A;  2O25 A;  3Q8G A;  1W5S A;  3LW5 F;  3VDU A;  4B7G A;  1C1K A;  1IXZ A;  4L78 A;  3FE3 A;  3H4J A;  1XXH B;  1MN3 A;  2JZ0 A;  4MGK E;  2EJS A;  1OAO C;  3IHP A;  3C3E A;  3K9O A;  3DFZ A;  4LRT A;  4M0W A;  2D7E A;  1GL6 A;  2KW0 A;  3I4Y A;  2XZF A;  1R7R A;  4X65 M;  4KLN A;  3E4R A;  4JI7 M;  3SMS A;  3L26 A;  1K3X A;  1SXJ D;  2J5Y A;  2R65 A;  4QHT A;  3U6Q A;  1QAN A;  4KHP M;  3J7B A;  4IBI A;  2CV1 A;  1IXR C;  2F5O A;  3MK6 A;  4R3D A;  2JP7 A;  2CRU A;  1E32 A;  4Z6Y A;  2XGN A;  4LF5 M;  1XNR M;  1T43 A;  5EXX A;  1SG9 A;  2HCB A;  1XB2 B;  3GRU A;  4II7 A;  3HU3 A;  1L8Q A;  4DV0 M;  1UM8 A;  1N36 M;  2WSF F;  3SYK A;  4JI5 M;  3W68 A;  3MMP A;  4L8R C;  1IY0 A;  1NY5 A;  2FOI C;  1S3S A;  3HJS A;  2MRO B;  3T1H M;  1V33 A;  5FSW A;  3LQQ A;  2WZJ A;  5L8R F;  3Q8X A;  3RFW A;  3U5Z B;  2J7N A;  4IBE A;  2X49 A;  3SAU A;  4AG6 A;  4AG5 A;  2OPF A;  4LCB A;  3ZCB B;  3B7Z A;  1PJI A;  4RF1 A;  1PJQ A;  4LFC M;  2XH9 A;  2Y21 A;  3FUT A;  3A98 B;  4CIZ A;  4DV1 M;  4LF9 M;  3J80 S;  4DR2 M;  1JR3 A; 
#chains in the Genus database with same CATH homology
 3TPZ A;  1IY2 A;  1FNN A;  2ZAO A;  3D8L A;  4KO8 A;  2L7I A;  4OVZ A;  1IBM M;  2ZAN A;  2RGO A;  3DOA A;  3E9S A;  1KFV A;  1LV7 A;  4GC5 A;  3SAR A;  3U61 A;  3VLF B;  4DV4 M;  3HU1 A;  3I4V A;  3SHF A;  4NL4 H;  3R9X B;  3U6S A;  4OX9 M;  2XLJ A;  4G4Q A;  3U6E A;  4JXJ A;  3DZD A;  4FCV A;  4R7G A;  3TWL A;  5EP4 A;  4B7F A;  1TH3 A;  5EP3 A;  1KSF X;  2Q2E B;  2L09 A;  4B3R M;  3GPU A;  4L4U A;  3H4M A;  2RGH A;  2XFT A;  2YQZ A;  4PT5 A;  1XMO M;  5JI2 E;  2CE7 A;  3FTE A;  4NRW A;  3QAU A;  5DNY A;  2DZO B;  3UMM A;  4FWH A;  4LF4 M;  3A45 A;  3FYD A;  4PDI A;  1IBL M;  2QZ4 A;  4DR4 M;  8CAT A;  4G4O A;  3J81 S;  3ZC7 B;  3KP1 E;  4AI6 A;  5IWA M;  3AV0 A;  3VK7 A;  2KXE A;  3EIH A;  1DGB A;  1TGU A;  2I7N A;  1R6B X;  1NNU C;  5H37 D;  4DR6 M;  3ILK A;  4HL4 A;  4QOZ C;  4LZZ A;  4QOS A;  1K82 A;  2CHV A;  4M9X A;  3SBJ A;  4YHH M;  4DV2 M;  2QBY B;  2XSZ A;  3GLG A;  3GO8 A;  3GQ4 A;  3HJ8 A;  4M9S A;  4MGZ E;  4RF0 A;  2F5S A;  2HHH M;  2Y0Q A;  2ERC A;  1DO2 A;  5BR8 M;  1HNW M;  1PJJ A;  3LVW A;  1DGG A;  1E9S A;  1G4A E;  4KOD A;  4P16 A;  2O5R A;  3AOG A;  3KS8 A;  3NBI A;  3JAM S;  3KFU G;  2XF3 A;  3PVS A;  1IQP A;  2CV0 A;  4L15 A;  1Z6T A;  3FTD A;  3U6P A;  3RGS A;  2KZU A;  2C99 A;  5ITR A;  1IN5 A;  2DWL A;  4GHL A;  3GQ3 A;  4I4L A;  4D82 A;  5EP2 A;  3C58 A;  4CGY B;  3SC3 A;  4B3T M;  1NVM A;  5LMU M;  4DV7 M;  5FTM A;  4OU7 A;  1L2D A;  3TWM A;  2Y20 A;  4IJF A;  1GVN A;  4AKG A;  4JI6 M;  1W5T A;  4XBO A;  3SHG B;  1IBK M;  3VKG A;  3D8B A;  4AW4 A;  3SYL A;  5ITT A;  1IN6 A;  5EXS A;  1Z5C A;  1E9R A;  3K1J A;  4QNM A;  4NSO B;  4DR3 M;  3M0E A;  2R46 A;  1QAQ A;  2DWN A;  1Z5B A;  2F5P A;  1ZQ9 A;  4IBK A;  3GLF B;  1MU5 A;  1YSY A;  3TWK A;  4D80 A;  3L27 A;  2VQF M;  1G59 A;  1G41 A;  4XGI A;  1JR3 D;  2YR0 A;  4G4N A;  2FFJ A;  2CHG A;  1TH4 A;  3GRY A;  5F3W A;  3VK8 A;  4QHS A;  5KO3 A;  3J2P B;  1G8P A;  1OFH A;  3FUW A;  2UUB M;  5A2Q S;  4MM3 B;  2BJV A;  2LNH C;  3HWS A;  5EQT A;  3U60 A;  3KSJ A;  4LG2 A;  4I5S A;  5GKN A;  5ITQ A;  2HKJ A;  2Z3X A;  7CAT A;  4GC9 A;  5FTK A;  1QAM A;  1D2N A;  1IY1 A;  2FE8 A;  3HHY A;  4LJ8 A;  3KDS E;  1J09 A;  1NHG C;  5FTL A;  4LJ5 A;  2R4E A;  2V1C A;  3VKH A;  4FD2 A;  3GPP A;  2J7O A;  3L25 A;  2Y0T A;  4FWD A;  2KRK A;  4CHT B;  1HQY E;  1R2Z A;  3HU2 A;  3GP1 A;  4I81 A;  2C9O A;  3J7A S;  1Z59 A;  4NRV A;  3CF6 E;  4WUR A;  2G5G X;  5FTN A;  4IJE A;  2QPA A;  4BB9 A;  1NNJ A;  3A42 A;  3HKP A;  4IBF A;  4GHA A;  3RGP A;  1DGH A;  3T38 A;  5ITU A;  1HNZ M;  3FUX A;  4NSR A;  3FUV A;  1N34 M;  1L2B A;  4JI1 M;  1SXJ C;  4GIT A;  4GKJ M;  4LZJ A;  4DUY M;  1QAO A;  1NY6 A;  2RKO A;  1K3W A;  4BLC A;  5ITX A;  1IM2 A;  2Z4S A;  4X64 M;  3PNY A;  4ZPX A;  5E26 A;  1GLN A;  4NOO B;  1OJL A;  2D7H A;  1HQC A;  2Z7J A;  4NXM M;  3A46 A;  1L2C A;  1DO0 A;  2YNM D;  4S12 A;  2F4V M;  3TE6 A;  4DV6 M;  2OQ4 A;  2M5Z A;  3QWL A;  4B3S M;  2L6O A;  4IBD A;  4OVZ B;  2CHQ A;  2E5L M;  3HHZ A;  3PNV A;  3U61 B;  2BNK A;  3TL4 X;  4PDG A;  4IBC A;  4ITQ A;  4MB7 A;  2DVW B;  2CEA A;  3W0L B;  4LF6 M;  4JYA M;  1XXH A;  4DV3 M;  3UZU A;  3UGJ A;  2CUZ A;  4LF8 M;  3OTO M;  4B08 A;  1NSF A;  3KOW E;  2KEB A;  4DR1 M;  2UXC M;  5IT9 S;  3THG A;  2YFQ A;  4FCT A;  2A5Y B;  3W0F A;  3SAT A;  3U6D A;  1DGH B;  3FD9 A;  3J27 B;  3SFZ A;  2FNA A;  2LXE A;  4X66 M;  3WHL A;  5EXP A;  1XMQ M;  1IN4 A;  2C96 A;  3L29 A;  4LJ4 A;  3KP0 E;  2DZN B;  4NXN M;  2R62 A;  3IG8 A;  3M6A A;  3T15 A;  4JI4 M;  3EIE A;  1H6U A;  3SAW A;  2UUC M;  4I8O A;  4LY6 A;  2C5R A;  5KQ8 A;  4Z8X A;  2VQE M;  3AKZ A;  3BOS A;  4IBJ A;  2H1R A;  2LH0 A;  3GLI A;  4JI8 M;  3VDP A;  2R45 A;  3U5Z A;  1N32 M;  3AL0 C;  1FJG M;  1EE8 A;  5FTJ A;  3JR4 A;  3GLG B;  5BPV A;  4M9Z A;  1JQJ C;  2X8A A;  3FKE A;  2R4J A;  3AFH A;  1E94 E;  3KW6 A;  4IBB A;  2QP9 X;  1Z5A A;  2VII A;  3GPY A;  2R18 A;  3HHW A;  2LWX A;  3UK6 A;  3M7G A;  3K8Z A;  2V6Z M;  4YY3 M;  2F5N A;  3FYC A;  2DWZ B;  3CF0 A;  3HHX A;  2X4A A;  5DYI A;  4JI2 M;  5EXT A;  5KQD A;  2ZAM A;  4FVM A;  3I51 A;  3SAV A;  4BBA A;  3T1Y M;  1VDD A;  4MH0 E;  3U6O A;  1XHB A;  3KSX A;  3RE8 A;  1NHW C;  2HL7 A;  4IIW A;  5C1B A;  4LJ9 A;  3CTW B;  1Q39 A;  4IBG A;  2KZS A;  4LJ7 A;  3SAS A;  4LF7 M;  1IN7 A;  3L2A A;  3NWL A;  4REZ A;  4FCW A;  3FTF A;  1N75 A;  3L28 A;  3PFI A;  1DGF A;  1GKI A;  4LFA M;  1GL7 A;  4QNR A;  1N77 A;  4DR5 M;  4MGY E;  2F5Q A;  2JA2 A;  5ITY A;  4CIS A;  4G4R A;  1N78 A;  2DXI A;  1Q3C A;  3KOX E;  4M0D A;  3GLI B;  2XFS A;  1SXJ A;  1SXJ E;  3FTC A;  3KS4 A;  5EJC A;  3GPX A;  4LJ6 A;  3AJI B;  4OW0 A;  5IRE B;  2UUA M;  4LGY A;  2CFO A;  5FLX S;  4DV5 M;  5JI3 E;  1QYR A;  2QCU A;  1R2Y A;  1L1T A;  3HGI A;  4JV5 M;  4JI0 M;  2EO2 A;  2UXD M;  3LMM A;  3B9P A;  4A3V B;  1HR0 M;  4LJA A;  2M60 A;  2D7G A;  1X37 A;  2KRU A;  3PXG A;  3SMP A;  1IN8 A;  4AQY M;  1ZAE A;  1G3I A;  3DA1 A;  4GKK M;  2QBY A;  3VFD A;  3WHK A;  4GH9 A;  1OFI A;  2XSZ D;  3U60 B;  1XC8 A;  2W82 A;  4JN6 A;  5EP1 A;  4PCZ A;  1HNX M;  1XNQ M;  5ITX E;  4FWG A;  2DHR A;  3FUU A;  2Z4R A;  4MGI E;  3LQR A;  5KPT A;  1TH2 A;  4X62 M;  3UJN A;  3GLH A;  4TUW A;  2K47 A;  2ZBK B;  3R8F A;  2BJW A;  1I4W A;  1QZM A;  4RNA A;  2ZM6 M;  1TDH A;  3TQS A;  4AZF A;  3K2L A;  2G8L A;  3K92 A;  4W5W A;  4LRS A;  2AHM A;  5KPR A;  5LMN M;  1J7K A;  1SXJ B;  2L7H A;  3GRV A;  2DWM A;  3CF2 A;  4B7H A;  1HT1 E;  2XEP A;  4LFB M;  2C9C A;  5KPZ A;  1PM5 A;  3LVV A;  1L1Z A;  2NQ8 C;  1NJF A;  3KVW A;  2EUC A;  3U6M A;  1HT2 E;  4HLQ A;  3JR5 A;  1ORY B;  1T3T A;  4MGH A;  3KOY E;  1J5E M;  1Q3B A;  3MJ5 A;  1N33 M;  2EA0 A;  3KOZ E;  3AOE A;  4DR7 M;  1TDZ A;  4WW0 A;  3GRR A;  1MX0 A;  4GRI A;  3GQ5 A;  2UU9 M;  3HJQ A;  2P5T A;  3IG5 A;  4G6Z A;  1YE9 A;  4GMQ A;  4K0K M;  4DUZ M;  2UXB M;  5IZ7 D;  3U6L A;  4D81 A;  5DYG A;  4EIW A;  4JI3 M;  1NJG A;  3KXE C;  1YUB A;  3GLF A;  4AKH A;  5E6J A;  1QVR A;  1QQW A;  4B3M M;  4AKI A;  1XWI A;  4GIP A;  3U6C A;  3GLH B;  3MHV C;  4PD2 A;  1KYI A;  2CV2 A;  4L16 A;  1IXS B;  3ZH9 B;  3AOE C;  2C98 A;  2I7P A;  1WXQ A;  4LGM A;  5C18 A;  2KA6 B;  2QEN A;  2XZU A;  2V1U A;  1I94 M;  4FW9 A;  1W5S A;  3VDU A;  4B7G A;  1C1K A;  1IXZ A;  4L78 A;  1XXH B;  4MGK E;  4LRT A;  4M0W A;  3DFZ A;  2D7E A;  1GL6 A;  2KW0 A;  3I4Y A;  2XZF A;  1R7R A;  4X65 M;  4KLN A;  3E4R A;  4JI7 M;  3SMS A;  3L26 A;  1K3X A;  1SXJ D;  2R65 A;  4QHT A;  3U6Q A;  1QAN A;  4KHP M;  3J7B A;  4IBI A;  2CV1 A;  1IXR C;  2F5O A;  3MK6 A;  4R3D A;  1E32 A;  4Z6Y A;  2XGN A;  4LF5 M;  1XNR M;  5EXX A;  2HCB A;  3GRU A;  4II7 A;  3HU3 A;  1L8Q A;  4DV0 M;  1UM8 A;  1N36 M;  3SYK A;  4JI5 M;  4L8R C;  1IY0 A;  1NY5 A;  2FOI C;  1S3S A;  3HJS A;  3T1H M;  5FSW A;  3LQQ A;  3Q8X A;  3RFW A;  3U5Z B;  2J7N A;  4IBE A;  2X49 A;  3SAU A;  4AG6 A;  4AG5 A;  2OPF A;  4LCB A;  3ZCB B;  1PJI A;  4RF1 A;  4LFC M;  2XH9 A;  2Y21 A;  3FUT A;  3A98 B;  4DV1 M;  4LF9 M;  3J80 S;  4DR2 M;  1JR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...