2KZUA

Daxx helical bundle (dhb) domain / rassf1c complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
b'GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzuA00
2KZUA 2KZSA
chains in the Genus database with same CATH superfamily
2N35A 1AIPC 2YQZA 3KSJA 4NL4H 1XMOM 3H4JA 4Z6YA 4NXMM 4I8OA 4NRVA 1OKSA 1YSYA 4EIWA 1W5SA 4R7GA 1FNNA 3R9XB 1UFZA 3FRIA 1XHBA 2R62A 2F5QA 4IBGA 1D2NA 1QYRA 2CFOA 3GLFA 3U61B 2RGHA 1D0KA 1TTEA 3FTDA 3LCVB 2UUBM 1V34A 4FCTA 1IN7A 4LRTA 2DVWB 2UXBM 5KO3A 4X66M 2CHVA 2QNJA 3E9SA 3U6QA 2FOIC 4IBFA 4KT0F 3SMSA 3A42A 4B3TM 2WZJA 2OOBA 3DZDA 3M7GA 4L78A 5FTNA 3MMPA 4YY3M 4DUZM 4DR2M 1IBMM 4DR7M 4IBDA 1R4GA 2X8AA 3FUVA 3ZH9B 5LMNM 3JR5A 2UU9M 1TGUA 3LQQA 1N33M 4Z8XA 4CGYB 2XH9A 4F2LA 3ZCBB 4L15A 1SXJB 1XNQM 1L8QA 3WHLA 1TH3A 4LF7M 2KHHA 2XFTA 1Y8GA 3SAWA 2B3TA 2K0BX 2QHOB 1IY2A 1KYIA 4KODA 4DV2M 1NJFA 2L4EA 8CATA 1T6OA 3IHPA 4WW0A 2Y21A 1NV8A 2DENA 1OIPA 3J81S 4D82A 4LY6A 4OU7A 1T43A 3KOYE 4X65M 4FW9A 4LFCM 3GPUA 4GKJM 5IZ7D 1WR1B 4KO8A 2JY6B 2XEPA 2I7NA 1E94E 2LBCA 2Z4SA 3FE3A 3RGPA 2UUCM 1GJSA 3KXEC 2L09A 2C9CA 3HJ8A 1V92A 1R7RA 3K92A 1Q3CA 4GH9A 3J80S 3CGWA 1QDRA 1Z5CA 4G4QA 3HJSA 2XZFA 2HWJA 1QAMA 3H4MA 3GLGB 4LRSA 2D7GA 2X49A 5F3WA 1JR3E 2JA2A 3L25A 2C99A 3DFZA 1OTRA 2D7HA 3K9PA 2CWBA 4AI6A 3LCUA 1IN4A 5KPTA 2KNAA 2ZM6M 5EXXA 4GHAA 3K8ZA 1NNJA 2FE8A 4LJ6A 2L2DA 4LCBA 1Z5BA 2MROB 3U6EA 1IY1A 4GITA 5C1BA 5A2QS 1BVSA 5DFLA 5ITXE 1XXHA 4P17A 1GVNA 5FSWA 2MJ5B 2QBYB 4DR4M 5KPRA 2R46A 4QHTA 4X62M 1HR0M 1XNRM 2EJSA 3J2PB 1DGHB 4LF9M 5KQ8A 4GHLA 4AKIA 3SAUA 2DZOB 1Q3BA 3BOSA 2A5YB 2WSEF 1GKIA 3FUUA 1ORYB 5EP3A 3PVSA 1GJTA 3GPPA 1R2ZA 1GL7A 2ZTDA 4GIPA 4JXJA 2F4VM 2X4AA 4MB7A 1CUKA 2DHRA 2DAKA 3GO8A 3GLIA 5ITTA 3TQSA 1WGLA 4L8RC 2KNVA 3I51A 2LTUA 1IM2A 2DAGA 4PD2A 1DO2A 3R8FA 2OPFA 3V76A 3VFDA 3W0LB 2F5PA 2G5GX 2LVOC 2DAIA 1QAQA 4CISA 1NJGA 4II7A 3A98B 4RNAA 2R65A 1OFHA 3D8BA 3U6CA 3IECA 2C98A 3GLFB 3W68A 3HX3A 1J7KA 4FD2A 3SHGB 4HLQA 3LVWA 3FUTA 1TH4A 1YUBA 4QHSA 4DR6M 3KS4A 2XF3A 4G4NA 2Z4RA 3J7AS 2JZ1A 3C3DA 1XWIA 4F1IA 2HKJA 3FKEA 4M0DA 3TE6A 2K47A 1K3WA 3U6DA 3VKHA 2KXEA 1PJSA 5IT9S 2Q2EB 1G41A 2BWEA 3NWLA 1S3SA 1DGFA 2XZUA 1VDDA 2CEAA 2DAEA 2EKFA 5EXTA 3SYLA 3UK6A 3UGJA 3I01M 4I81A 2KEBA 4S12A 3HJQA 1DV0A 2JP7A 4B3RM 1LV7A 2M60A 3UMMA 4IBIA 4PDIA 3GLHE 1QUTA 4GEWA 4QOSA 2R6FA 3GRRA 2RKOA 4RF0A 2APLA 1QANA 3VK8A 4JI4M 4JI0M 3AL0C 2Z3XA 2P5TA 3L2AA 4LJ8A 3U60A 1Q39A 1WHCA 4LJ9A 1L1TA 1YE9A 3SFZA 4OX9M 2QZ4A 2LH0A 2J5YA 1KFVA 3L26A 4AQYM 1N36M 3GLFE 2J7NA 1GO5A 5EJCA 1QAOA 2YFQA 1IQPA 1L1ZA 3M0EA 4DR1M 4NSRA 2ZTCA 1MJGM 4B7FA 3GQ4A 3MHVC 1N77A 1R2YA 4JI3M 4DBGB 3I04M 1XMQM 2GQFA 2J7OA 1W5TA 4XGIA 3T1YM 1J5EM 3HU1A 2FFJA 2CUZA 2JY7A 1NHWC 2MGWA 3AFHA 4DR5M 5ITRA 2L6OA 4DUYM 1XXHB 4AG6A 3AV0A 4BB9A 4LGMA 1JB0F 2ERCA 4JI7M 1QQWA 3FYDA 4QNMA 4MGIE 1HT2E 2CRUA 3KW6A 4DV5M 1HNWM 1K82A 3VLFB 2HHHM 4K0KM 2CE7A 4GC5A 4LZZA 1NO1A 2Y0TA 3THGA 4W5WA 4JI2M 1J09A 1E9RA 4LJ7A 4FWHA 4LFAM 2OO9A 2CV2A 4LF4M 4NXNM 3CF0A 3CTWB 2KW0A 1ZQ9A 3GLIB 4DV7M 4LZJA 4HL4A 5BPVA 5JI3E 3U6MA 2DI0A 4JI5M 3GQ5A 1EIJA 1ZV1A 5DNYA 1HNXM 4NSOB 1I94M 3FUXA 4BBAA 2AHMA 1JQJC 1DGGA 3HU2A 3GRUA 4FCVA 1VEKA 3CF2A 3MJ5A 1YLAA 2F5OA 1IN6A 3SARA 2LVPC 2OQ4A 5EXPA 2VQEM 2WSFF 2EO2A 3FYCA 3GRVA 4D81A 2R45A 3PNYA 4DV0M 2R18A 3SATA 1SXJE 1JR3A 2RGOA 1I4WA 1F4IA 3RFWA 4NOOB 1PM5A 4L16A 1IXRC 2DHYA 1OIZA 1V33A 1Z6TA 1PJQA 5GKNA 2QQ8A 1QZMA 1OQYA 4MGKE 4M9XA 2BNKA 4M9ZA 1WIVA 2KDLA 3A45A 2I7PA 3U6SA 1H6UA 1IXZA 1ZMUA 3HWSA 2KZUA 3U6LA 3RGSA 1IFYA 1GL6A 4B3MM 2EA0A 1IBLM 2XSZD 2DAMA 2Z8YM 3AOEC 3IG5A 4IBBA 4IJFA 3T6PA 4CJ6A 2F5NA 2UUAM 1HQYE 4JI1M 4PCZA 4M0WA 2VIIA 3FUWA 3FD9A 1X37A 4KLNA 1NY6A 4NC6A 5E26A 3GQ3A 3HHWA 2K6BA 4G3OA 4LFBM 3U60B 4ZPXA 4DV4M 3GLGE 1IXSA 1AUAA 1ZAEA 4IBJA 1PGYA 3B7QA 1GABA 5LMUM 4L4UA 2O5RA 3SYKA 4FWDA 2JY5A 3AKZA 2CHQA 2HCBA 2JNHA 2XFSA 2XSZA 4IBCA 3K9OA 2O01F 2FS1A 3HKPA 4QNRA 2CV0A 5EQTA 3AOEA 3SBJA 4IBEA 1Z5AA 2Y20A 1PJTA 5ITUA 3HHZA 1QVRA 2NQ8C 2KRKA 4LGYA 3UZUA 4JI6M 1NVMA 2H1RA 3KOWE 2DWZB 3E46A 3T15A 3C58A 1P3QQ 5IWAM 2VDBB 5FTMA 3VKGA 2QPAA 3C3EA 4XK8F 2R44A 4Q7JA 4UN2B 2LVAA 2CP8A 3B9PA 3HU3A 4WURA 3SHFA 1HNZM 1OAIA 4OVZA 1R5LA 4A3VB 1L2CA 1OJLA 3I4VA 2YNMD 4JYAM 2G3QA 1IN8A 1N75A 2BJWA 1QDTA 1NNUC 2JUJA 1NSFA 4MH0E 5FLXS 4G4RA 2GNOA 2C96A 1DGBA 2DZNB 3WHKA 1MN3A 1G4AE 1IN5A 3K1JA 4FCWA 1G8PA 2L4FA 2DWNA 3SMPA 4M9SA 4XBOA 2EUCA 1SG9A 2Z7JA 5JI2E 4G6ZA 4MM3B 3HGIA 2LWXA 3ZC7B 1L2DA 3PNVA 3GLHA 4FVMA 2G8LA 3JR4A 3AJIB 3W0FA 4LG2A 3OTOM 3QAUA 3T38A 2K9DA 4JI8M 2V1CA 1N34M 2Y0QA 4AG5A 5EP1A 3J7BA 3U5ZA 3UJNA 3Q8GA 2JWSA 4X64M 4B08A 3TWMA 3SASA 4LF6M 3B74A 4GKKM 3LQRA 4I5SA 3KP0E 4YHHM 1E32A 1EE8A 1G71A 2D7EA 2CV1A 3AOGA 3QYBA 2MR9A 3VDPA 1PJIA 3DA1A 3LVVA 2XLJA 4BLCA 4QOZC 1LTMA 1PJJA 4MGHA 3J27B 1XC8A 3QYEA 1Q02A 4LJ5A 3PXGA 4P16A 3E4RA 2E5LM 1C1KA 4I4LA 4IIWA 3E21A 3KDSE 7CATA 2VQFM 1ZMVA 4AKGA 3GRYA 2FNAA 2DWMA 3I4YA 2LHCA 1K3XA 3BXWA 3SC3A 2R4EA 2W82A 2M5ZA 1TF0B 3TWLA 1IBKM 3NBXX 4MGYE 4PDGA 2BJVA 4G4OA 1JR3D 4NRWA 3VK7A 2KZSA 3EIHA 2ZAMA 2DXIA 3FTCA 4GC9A 4PT5A 3FTFA 1MU5A 2V6ZM 2H5XA 3L27A 3NBIA 3GP1A 3L28A 1WJ7A 5DYIA 3QWLA 3GPYA 4B3SM 3LW5F 1IXSB 3KOXE 1MX0A 1VQ1A 4KHPM 3KS8A 1SXJC 1EFUB 3PFIA 3KOZE 5E6JA 5EXSA 3KFUG 3IG8A 2OOAA 3HY5A 1SXJD 1HQCA 2O25A 2KNZA 2VF8A 3LMMA 4CHTB 3U61A 4AW4A 3T1HM 3ZQJA 5ITQA 4R3DA 1NY5A 5FTJA 4DV1M 1ZMWA 2XGNA 2DKLA 5IREB 1XXHE 3ILKA 4RKUF 2DNAA 3GPXA 3B7ZA 3BBZA 1QUSA 2C9OA 1NHGC 2CHGA 1TDZA 2QENA 1VDLA 1A5TA 4IBKA 1VG5A 3F92A 2LNHC 1N32M 4RF1A 3TWKA 1TDHA 4AKHA 5FTLA 1QZEA 2LHGA 5ITXA 2L7HA 3L29A 2LVNC 1OAOC 1TH2A 4GMQA 4D80A 4R71A 2KRUA 1SXJA 2LXEA 4OVZB 3K2LA 3TPZA 3FRHA 1VEJA 5KQDA 3SAVA 1T3TA 1Z59A 1R6BX 4TUWA 5KPZA 2KA6B 2V1UA 2HAKA 3HHXA 1FJGM 3U6OA 1D0MA 2EKKA 3GLIE 3M6AA 1DO0A 1D0LA 5BR8M 2R0IA 3JAMS 5H37D 1L2BA 5DYGA 2JZ0A 3KSXA 4L6V6 3KP1E 4LF8M 2R4JA 4B7HA 2MH8A 3GLHB 3U6PA 1TR8A 1C7YA 3CF6E 4CIZA 4LF5M 1G3IA 2ZANA 5C18A 2C5RA 1IY0A 2ZBKB 4ITQA 2JXNA 5EP4A 5L8RF 3C9PA 2QCUA 4GRIA 3U5ZB 2L7IA 3DOAA 3GLGA 1GLNA 3W67A 2DZLA 3KVWA 3MK6A 3FTEA 4AZFA 1WGNA 2DWLA 5ITYA 4LJ4A 3D8LA 1N78A 4JV5M 1WXQA 1OFIA 4DV6M 1PRBA 1XB2B 3HHYA 5EP2A 3A46A 4DV3M 1RU3A 2BWBA 2LVQD 2QSFX 4JN6A 4LJAA 2QBYA 3B89A 1HT1E 2JY8A 4DR3M 1NV9A 2FH0A 5FTKA 4HEOA 1DGHA 4IJEA 2HL7A 2RRUA 3EIEA 4REZA 4FWGA 3HZJA 1KSFX 3VDUA 1UM8A 2QP9X 2ZAOA 2F5SA 2WSCF 1E9SA 4WP2A 4Y28F 3RE8A 2VF7A 2UXCM 3B7NA 1G59A 1VEGA 3TL4X 1HJPA 4MGZE 4ANRA 4B7GA 2UXDM 3Q8XA 2YR0A 4OW0A
chains in the Genus database with same CATH topology
2YQZA 3KSJA 4NL4H 1XMOM 4Z6YA 4NXMM 4I8OA 4NRVA 4EIWA 1YSYA 1W5SA 4R7GA 1FNNA 3R9XB 1XHBA 2R62A 2F5QA 4IBGA 1D2NA 1QYRA 2CFOA 3GLFA 3U61B 2RGHA 3FTDA 2UUBM 4FCTA 1IN7A 4LRTA 2DVWB 2UXBM 5KO3A 4X66M 2CHVA 3E9SA 3U6QA 2FOIC 4IBFA 3SMSA 4B3TM 3A42A 3DZDA 3M7GA 4L78A 5FTNA 4YY3M 4DR7M 4DUZM 4DR2M 1IBMM 4IBDA 2X8AA 3FUVA 3ZH9B 5LMNM 3JR5A 2UU9M 1TGUA 3LQQA 1N33M 4Z8XA 4CGYB 2XH9A 3ZCBB 4L15A 1SXJB 1XNQM 1L8QA 3WHLA 1TH3A 4LF7M 2XFTA 3SAWA 4DV2M 1IY2A 1KYIA 4KODA 1NJFA 8CATA 4WW0A 2Y21A 3J81S 4D82A 4LY6A 4OU7A 3KOYE 4X65M 4FW9A 4LFCM 3GPUA 4GKJM 5IZ7D 4KO8A 2XEPA 2I7NA 1E94E 2Z4SA 3RGPA 2UUCM 3KXEC 2L09A 2C9CA 3HJ8A 3K92A 1R7RA 1Q3CA 4GH9A 3J80S 1Z5CA 4G4QA 3HJSA 2XZFA 1QAMA 3H4MA 3GLGB 4LRSA 2D7GA 2X49A 5F3WA 2JA2A 3L25A 2C99A 3DFZA 4AI6A 2D7HA 1IN4A 5KPTA 2ZM6M 5EXXA 4GHAA 3K8ZA 1NNJA 2FE8A 4LJ6A 4LCBA 1Z5BA 3U6EA 1IY1A 4GITA 5C1BA 5A2QS 5ITXE 1XXHA 1GVNA 5FSWA 2QBYB 4DR4M 5KPRA 2R46A 4QHTA 4X62M 1HR0M 1XNRM 3J2PB 1DGHB 4LF9M 5KQ8A 4GHLA 4AKIA 3SAUA 2DZOB 1Q3BA 3BOSA 2A5YB 1GKIA 3FUUA 1ORYB 5EP3A 3PVSA 3GPPA 1R2ZA 1GL7A 4JXJA 4GIPA 2F4VM 2X4AA 4MB7A 2DHRA 3GLIA 3GO8A 5ITTA 3TQSA 4L8RC 3I51A 1IM2A 4PD2A 1DO2A 3R8FA 2OPFA 3VFDA 3W0LB 2F5PA 2G5GX 4CISA 1QAQA 1NJGA 4II7A 3A98B 4RNAA 2R65A 1OFHA 3D8BA 3U6CA 2C98A 3GLFB 1J7KA 4FD2A 3SHGB 4HLQA 3LVWA 3FUTA 1TH4A 1YUBA 4QHSA 4DR6M 3KS4A 2XF3A 4G4NA 2Z4RA 3J7AS 1XWIA 2HKJA 3FKEA 4M0DA 3TE6A 2K47A 1K3WA 3U6DA 3VKHA 2KXEA 5IT9S 2Q2EB 1G41A 3NWLA 1S3SA 1DGFA 2XZUA 1VDDA 2CEAA 5EXTA 3SYLA 3UGJA 3UK6A 4I81A 2KEBA 4S12A 3HJQA 4B3RM 1LV7A 2M60A 3UMMA 4IBIA 4PDIA 4QOSA 3GRRA 4JI4M 2RKOA 4RF0A 3VK8A 1QANA 3AL0C 4JI0M 2Z3XA 2P5TA 3L2AA 4LJ8A 3U60A 1Q39A 4LJ9A 1L1TA 1YE9A 3SFZA 4OX9M 2QZ4A 2LH0A 1KFVA 3L26A 4AQYM 1N36M 2J7NA 5EJCA 1QAOA 2YFQA 1IQPA 1L1ZA 3M0EA 4DR1M 4NSRA 4B7FA 3GQ4A 3MHVC 1N77A 1R2YA 4JI3M 1XMQM 2J7OA 1W5TA 4XGIA 3T1YM 1J5EM 3HU1A 3AFHA 2FFJA 2CUZA 1NHWC 4DR5M 5ITRA 2L6OA 4DUYM 1XXHB 4AG6A 3AV0A 4BB9A 4LGMA 2ERCA 4JI7M 1QQWA 3FYDA 4QNMA 4MGIE 1HT2E 3KW6A 1HNWM 4DV5M 1K82A 3VLFB 2HHHM 4K0KM 2CE7A 4GC5A 4LZZA 2Y0TA 3THGA 4W5WA 4JI2M 1J09A 1E9RA 4LJ7A 4FWHA 4LFAM 2CV2A 4LF4M 4NXNM 3CF0A 3CTWB 2KW0A 1ZQ9A 3GLIB 4DV7M 4LZJA 4HL4A 5BPVA 5JI3E 3U6MA 4JI5M 3GQ5A 5DNYA 1HNXM 4NSOB 1I94M 3FUXA 4BBAA 2AHMA 1DGGA 1JQJC 3HU2A 3GRUA 4FCVA 3CF2A 3MJ5A 3SARA 2F5OA 1IN6A 2OQ4A 5EXPA 2VQEM 2EO2A 3FYCA 3GRVA 4D81A 2R45A 3PNYA 4DV0M 2R18A 3SATA 1SXJE 2RGOA 1JR3A 1I4WA 3RFWA 4NOOB 1PM5A 4L16A 1IXRC 1Z6TA 5GKNA 1QZMA 4MGKE 4M9XA 2BNKA 4M9ZA 3U6SA 3A45A 2I7PA 1H6UA 1IXZA 3HWSA 2KZUA 3U6LA 3RGSA 1GL6A 4B3MM 2EA0A 1IBLM 2XSZD 3AOEC 4IBBA 2F5NA 3IG5A 4IJFA 2UUAM 1HQYE 4JI1M 4PCZA 4M0WA 2VIIA 3FUWA 3FD9A 1X37A 4KLNA 1NY6A 5E26A 3GQ3A 3HHWA 4LFBM 3U60B 4ZPXA 4DV4M 1ZAEA 4IBJA 5LMUM 4L4UA 2O5RA 3SYKA 4FWDA 3AKZA 2CHQA 2HCBA 2XFSA 2XSZA 4IBCA 4QNRA 3HKPA 2CV0A 5EQTA 3AOEA 3SBJA 4IBEA 1Z5AA 2Y20A 5ITUA 3HHZA 1QVRA 2NQ8C 2KRKA 4LGYA 3UZUA 4JI6M 1NVMA 2H1RA 3KOWE 2DWZB 3C58A 3T15A 5IWAM 3VKGA 5FTMA 2QPAA 3B9PA 3HU3A 4WURA 3SHFA 1HNZM 4OVZA 4A3VB 1L2CA 1OJLA 3I4VA 2YNMD 4JYAM 1IN8A 1N75A 2BJWA 5FLXS 1NNUC 4MH0E 1NSFA 4G4RA 2C96A 1DGBA 2DZNB 3WHKA 1G4AE 1IN5A 3K1JA 4FCWA 1G8PA 2DWNA 3SMPA 4M9SA 4XBOA 2EUCA 2Z7JA 5JI2E 4G6ZA 4MM3B 3HGIA 2LWXA 3ZC7B 1L2DA 3PNVA 3GLHA 4FVMA 2G8LA 3JR4A 3AJIB 3W0FA 4LG2A 3OTOM 3QAUA 3T38A 4JI8M 2V1CA 1N34M 2Y0QA 4AG5A 5EP1A 3J7BA 3U5ZA 3UJNA 4X64M 4B08A 3TWMA 3SASA 4LF6M 4GKKM 3LQRA 4I5SA 3KP0E 4YHHM 1E32A 1EE8A 2D7EA 2CV1A 3AOGA 3VDPA 1PJIA 3DA1A 3LVVA 2XLJA 4BLCA 4QOZC 1PJJA 4MGHA 3J27B 1XC8A 4LJ5A 3PXGA 4P16A 3E4RA 2E5LM 1C1KA 4I4LA 4IIWA 3KDSE 7CATA 2VQFM 4AKGA 3GRYA 2FNAA 2DWMA 3I4YA 1K3XA 3SC3A 2R4EA 2W82A 2M5ZA 3TWLA 1IBKM 4MGYE 4PDGA 2BJVA 4G4OA 1JR3D 4NRWA 3VK7A 2KZSA 3EIHA 2ZAMA 2DXIA 3FTCA 4GC9A 4PT5A 3FTFA 1MU5A 2V6ZM 3L27A 3NBIA 3GP1A 3L28A 5DYIA 3GPYA 3QWLA 4B3SM 1IXSB 3KOXE 1MX0A 4KHPM 3KS8A 1SXJC 5E6JA 3PFIA 3KOZE 5EXSA 3KFUG 3IG8A 1SXJD 1HQCA 3LMMA 4CHTB 3U61A 4AW4A 3T1HM 5ITQA 4R3DA 1NY5A 5FTJA 4DV1M 2XGNA 5IREB 3ILKA 3GPXA 1TDZA 2C9OA 1NHGC 2CHGA 2QENA 4IBKA 1N32M 4AKHA 2LNHC 4RF1A 3TWKA 1TDHA 5FTLA 5ITXA 2L7HA 3L29A 1TH2A 4GMQA 4D80A 2KRUA 1SXJA 2LXEA 4OVZB 3K2LA 3TPZA 5KQDA 3SAVA 1T3TA 1Z59A 1R6BX 4TUWA 5KPZA 2KA6B 2V1UA 3HHXA 1FJGM 3U6OA 3M6AA 1DO0A 5BR8M 3JAMS 5H37D 1L2BA 5DYGA 3KSXA 3KP1E 4LF8M 2R4JA 4B7HA 3GLHB 3U6PA 4LF5M 3CF6E 1G3IA 2ZANA 5C18A 2C5RA 1IY0A 2ZBKB 4ITQA 5EP4A 2QCUA 4GRIA 3U5ZB 2L7IA 3DOAA 3GLGA 1GLNA 3KVWA 3MK6A 3FTEA 4AZFA 2DWLA 5ITYA 4LJ4A 3D8LA 1N78A 4JV5M 1WXQA 1OFIA 4DV6M 3HHYA 5EP2A 3A46A 4DV3M 4LJAA 4JN6A 2QBYA 1HT1E 4DR3M 5FTKA 1DGHA 4IJEA 2HL7A 3EIEA 4REZA 4FWGA 1KSFX 3VDUA 1UM8A 2QP9X 2ZAOA 2F5SA 1E9SA 3RE8A 2UXCM 1G59A 3TL4X 4MGZE 4B7GA 2UXDM 3Q8XA 2YR0A 4OW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZU A;  2KZS A; 
#chains in the Genus database with same CATH topology
 2N35 A;  1AIP C;  2YQZ A;  3KSJ A;  4NL4 H;  1XMO M;  3H4J A;  4Z6Y A;  4NXM M;  4I8O A;  4NRV A;  1OKS A;  1YSY A;  4EIW A;  1W5S A;  4R7G A;  1FNN A;  3R9X B;  1UFZ A;  3FRI A;  1XHB A;  2R62 A;  2F5Q A;  4IBG A;  1D2N A;  1QYR A;  2CFO A;  3GLF A;  3U61 B;  2RGH A;  1D0K A;  1TTE A;  3FTD A;  3LCV B;  2UUB M;  1V34 A;  4FCT A;  1IN7 A;  4LRT A;  2DVW B;  2UXB M;  5KO3 A;  4X66 M;  2CHV A;  2QNJ A;  3E9S A;  3U6Q A;  2FOI C;  4IBF A;  4KT0 F;  3SMS A;  3A42 A;  4B3T M;  2WZJ A;  2OOB A;  3DZD A;  3M7G A;  4L78 A;  5FTN A;  3MMP A;  4YY3 M;  4DUZ M;  4DR2 M;  1IBM M;  4DR7 M;  4IBD A;  1R4G A;  2X8A A;  3FUV A;  3ZH9 B;  5LMN M;  3JR5 A;  2UU9 M;  1TGU A;  3LQQ A;  1N33 M;  4Z8X A;  4CGY B;  2XH9 A;  4F2L A;  3ZCB B;  4L15 A;  1SXJ B;  1XNQ M;  1L8Q A;  3WHL A;  1TH3 A;  4LF7 M;  2KHH A;  2XFT A;  1Y8G A;  3SAW A;  2B3T A;  2K0B X;  2QHO B;  1IY2 A;  1KYI A;  4KOD A;  4DV2 M;  1NJF A;  2L4E A;  8CAT A;  1T6O A;  3IHP A;  4WW0 A;  2Y21 A;  1NV8 A;  2DEN A;  1OIP A;  3J81 S;  4D82 A;  4LY6 A;  4OU7 A;  1T43 A;  3KOY E;  4X65 M;  4FW9 A;  4LFC M;  3GPU A;  4GKJ M;  5IZ7 D;  1WR1 B;  4KO8 A;  2JY6 B;  2XEP A;  2I7N A;  1E94 E;  2LBC A;  2Z4S A;  3FE3 A;  3RGP A;  2UUC M;  1GJS A;  3KXE C;  2L09 A;  2C9C A;  3HJ8 A;  1V92 A;  1R7R A;  3K92 A;  1Q3C A;  4GH9 A;  3J80 S;  3CGW A;  1QDR A;  1Z5C A;  4G4Q A;  3HJS A;  2XZF A;  2HWJ A;  1QAM A;  3H4M A;  3GLG B;  4LRS A;  2D7G A;  2X49 A;  5F3W A;  1JR3 E;  2JA2 A;  3L25 A;  2C99 A;  3DFZ A;  1OTR A;  2D7H A;  3K9P A;  2CWB A;  4AI6 A;  3LCU A;  1IN4 A;  5KPT A;  2KNA A;  2ZM6 M;  5EXX A;  4GHA A;  3K8Z A;  1NNJ A;  2FE8 A;  4LJ6 A;  2L2D A;  4LCB A;  1Z5B A;  2MRO B;  3U6E A;  1IY1 A;  4GIT A;  5C1B A;  5A2Q S;  1BVS A;  5DFL A;  5ITX E;  1XXH A;  4P17 A;  1GVN A;  5FSW A;  2MJ5 B;  2QBY B;  4DR4 M;  5KPR A;  2R46 A;  4QHT A;  4X62 M;  1HR0 M;  1XNR M;  2EJS A;  3J2P B;  1DGH B;  4LF9 M;  5KQ8 A;  4GHL A;  4AKI A;  3SAU A;  2DZO B;  1Q3B A;  3BOS A;  2A5Y B;  2WSE F;  1GKI A;  3FUU A;  1ORY B;  5EP3 A;  3PVS A;  1GJT A;  3GPP A;  1R2Z A;  1GL7 A;  2ZTD A;  4GIP A;  4JXJ A;  2F4V M;  2X4A A;  4MB7 A;  1CUK A;  2DHR A;  2DAK A;  3GO8 A;  3GLI A;  5ITT A;  3TQS A;  1WGL A;  4L8R C;  2KNV A;  3I51 A;  2LTU A;  1IM2 A;  2DAG A;  4PD2 A;  1DO2 A;  3R8F A;  2OPF A;  3V76 A;  3VFD A;  3W0L B;  2F5P A;  2G5G X;  2LVO C;  2DAI A;  1QAQ A;  4CIS A;  1NJG A;  4II7 A;  3A98 B;  4RNA A;  2R65 A;  1OFH A;  3D8B A;  3U6C A;  3IEC A;  2C98 A;  3GLF B;  3W68 A;  3HX3 A;  1J7K A;  4FD2 A;  3SHG B;  4HLQ A;  3LVW A;  3FUT A;  1TH4 A;  1YUB A;  4QHS A;  4DR6 M;  3KS4 A;  2XF3 A;  4G4N A;  2Z4R A;  3J7A S;  2JZ1 A;  3C3D A;  1XWI A;  4F1I A;  2HKJ A;  3FKE A;  4M0D A;  3TE6 A;  2K47 A;  1K3W A;  3U6D A;  3VKH A;  2KXE A;  1PJS A;  5IT9 S;  2Q2E B;  1G41 A;  2BWE A;  3NWL A;  1S3S A;  1DGF A;  2XZU A;  1VDD A;  2CEA A;  2DAE A;  2EKF A;  5EXT A;  3SYL A;  3UK6 A;  3UGJ A;  3I01 M;  4I81 A;  2KEB A;  4S12 A;  3HJQ A;  1DV0 A;  2JP7 A;  4B3R M;  1LV7 A;  2M60 A;  3UMM A;  4IBI A;  4PDI A;  3GLH E;  1QUT A;  4GEW A;  4QOS A;  2R6F A;  3GRR A;  2RKO A;  4RF0 A;  2APL A;  1QAN A;  3VK8 A;  4JI4 M;  4JI0 M;  3AL0 C;  2Z3X A;  2P5T A;  3L2A A;  4LJ8 A;  3U60 A;  1Q39 A;  1WHC A;  4LJ9 A;  1L1T A;  1YE9 A;  3SFZ A;  4OX9 M;  2QZ4 A;  2LH0 A;  2J5Y A;  1KFV A;  3L26 A;  4AQY M;  1N36 M;  3GLF E;  2J7N A;  1GO5 A;  5EJC A;  1QAO A;  2YFQ A;  1IQP A;  1L1Z A;  3M0E A;  4DR1 M;  4NSR A;  2ZTC A;  1MJG M;  4B7F A;  3GQ4 A;  3MHV C;  1N77 A;  1R2Y A;  4JI3 M;  4DBG B;  3I04 M;  1XMQ M;  2GQF A;  2J7O A;  1W5T A;  4XGI A;  3T1Y M;  1J5E M;  3HU1 A;  2FFJ A;  2CUZ A;  2JY7 A;  1NHW C;  2MGW A;  3AFH A;  4DR5 M;  5ITR A;  2L6O A;  4DUY M;  1XXH B;  4AG6 A;  3AV0 A;  4BB9 A;  4LGM A;  1JB0 F;  2ERC A;  4JI7 M;  1QQW A;  3FYD A;  4QNM A;  4MGI E;  1HT2 E;  2CRU A;  3KW6 A;  4DV5 M;  1HNW M;  1K82 A;  3VLF B;  2HHH M;  4K0K M;  2CE7 A;  4GC5 A;  4LZZ A;  1NO1 A;  2Y0T A;  3THG A;  4W5W A;  4JI2 M;  1J09 A;  1E9R A;  4LJ7 A;  4FWH A;  4LFA M;  2OO9 A;  2CV2 A;  4LF4 M;  4NXN M;  3CF0 A;  3CTW B;  2KW0 A;  1ZQ9 A;  3GLI B;  4DV7 M;  4LZJ A;  4HL4 A;  5BPV A;  5JI3 E;  3U6M A;  2DI0 A;  4JI5 M;  3GQ5 A;  1EIJ A;  1ZV1 A;  5DNY A;  1HNX M;  4NSO B;  1I94 M;  3FUX A;  4BBA A;  2AHM A;  1JQJ C;  1DGG A;  3HU2 A;  3GRU A;  4FCV A;  1VEK A;  3CF2 A;  3MJ5 A;  1YLA A;  2F5O A;  1IN6 A;  3SAR A;  2LVP C;  2OQ4 A;  5EXP A;  2VQE M;  2WSF F;  2EO2 A;  3FYC A;  3GRV A;  4D81 A;  2R45 A;  3PNY A;  4DV0 M;  2R18 A;  3SAT A;  1SXJ E;  1JR3 A;  2RGO A;  1I4W A;  1F4I A;  3RFW A;  4NOO B;  1PM5 A;  4L16 A;  1IXR C;  2DHY A;  1OIZ A;  1V33 A;  1Z6T A;  1PJQ A;  5GKN A;  2QQ8 A;  1QZM A;  1OQY A;  4MGK E;  4M9X A;  2BNK A;  4M9Z A;  1WIV A;  2KDL A;  3A45 A;  2I7P A;  3U6S A;  1H6U A;  1IXZ A;  1ZMU A;  3HWS A;  2KZU A;  3U6L A;  3RGS A;  1IFY A;  1GL6 A;  4B3M M;  2EA0 A;  1IBL M;  2XSZ D;  2DAM A;  2Z8Y M;  3AOE C;  3IG5 A;  4IBB A;  4IJF A;  3T6P A;  4CJ6 A;  2F5N A;  2UUA M;  1HQY E;  4JI1 M;  4PCZ A;  4M0W A;  2VII A;  3FUW A;  3FD9 A;  1X37 A;  4KLN A;  1NY6 A;  4NC6 A;  5E26 A;  3GQ3 A;  3HHW A;  2K6B A;  4G3O A;  4LFB M;  3U60 B;  4ZPX A;  4DV4 M;  3GLG E;  1IXS A;  1AUA A;  1ZAE A;  4IBJ A;  1PGY A;  3B7Q A;  1GAB A;  5LMU M;  4L4U A;  2O5R A;  3SYK A;  4FWD A;  2JY5 A;  3AKZ A;  2CHQ A;  2HCB A;  2JNH A;  2XFS A;  2XSZ A;  4IBC A;  3K9O A;  2O01 F;  2FS1 A;  3HKP A;  4QNR A;  2CV0 A;  5EQT A;  3AOE A;  3SBJ A;  4IBE A;  1Z5A A;  2Y20 A;  1PJT A;  5ITU A;  3HHZ A;  1QVR A;  2NQ8 C;  2KRK A;  4LGY A;  3UZU A;  4JI6 M;  1NVM A;  2H1R A;  3KOW E;  2DWZ B;  3E46 A;  3T15 A;  3C58 A;  1P3Q Q;  5IWA M;  2VDB B;  5FTM A;  3VKG A;  2QPA A;  3C3E A;  4XK8 F;  2R44 A;  4Q7J A;  4UN2 B;  2LVA A;  2CP8 A;  3B9P A;  3HU3 A;  4WUR A;  3SHF A;  1HNZ M;  1OAI A;  4OVZ A;  1R5L A;  4A3V B;  1L2C A;  1OJL A;  3I4V A;  2YNM D;  4JYA M;  2G3Q A;  1IN8 A;  1N75 A;  2BJW A;  1QDT A;  1NNU C;  2JUJ A;  1NSF A;  4MH0 E;  5FLX S;  4G4R A;  2GNO A;  2C96 A;  1DGB A;  2DZN B;  3WHK A;  1MN3 A;  1G4A E;  1IN5 A;  3K1J A;  4FCW A;  1G8P A;  2L4F A;  2DWN A;  3SMP A;  4M9S A;  4XBO A;  2EUC A;  1SG9 A;  2Z7J A;  5JI2 E;  4G6Z A;  4MM3 B;  3HGI A;  2LWX A;  3ZC7 B;  1L2D A;  3PNV A;  3GLH A;  4FVM A;  2G8L A;  3JR4 A;  3AJI B;  3W0F A;  4LG2 A;  3OTO M;  3QAU A;  3T38 A;  2K9D A;  4JI8 M;  2V1C A;  1N34 M;  2Y0Q A;  4AG5 A;  5EP1 A;  3J7B A;  3U5Z A;  3UJN A;  3Q8G A;  2JWS A;  4X64 M;  4B08 A;  3TWM A;  3SAS A;  4LF6 M;  3B74 A;  4GKK M;  3LQR A;  4I5S A;  3KP0 E;  4YHH M;  1E32 A;  1EE8 A;  1G71 A;  2D7E A;  2CV1 A;  3AOG A;  3QYB A;  2MR9 A;  3VDP A;  1PJI A;  3DA1 A;  3LVV A;  2XLJ A;  4BLC A;  4QOZ C;  1LTM A;  1PJJ A;  4MGH A;  3J27 B;  1XC8 A;  3QYE A;  1Q02 A;  4LJ5 A;  3PXG A;  4P16 A;  3E4R A;  2E5L M;  1C1K A;  4I4L A;  4IIW A;  3E21 A;  3KDS E;  7CAT A;  2VQF M;  1ZMV A;  4AKG A;  3GRY A;  2FNA A;  2DWM A;  3I4Y A;  2LHC A;  1K3X A;  3BXW A;  3SC3 A;  2R4E A;  2W82 A;  2M5Z A;  1TF0 B;  3TWL A;  1IBK M;  3NBX X;  4MGY E;  4PDG A;  2BJV A;  4G4O A;  1JR3 D;  4NRW A;  3VK7 A;  2KZS A;  3EIH A;  2ZAM A;  2DXI A;  3FTC A;  4GC9 A;  4PT5 A;  3FTF A;  1MU5 A;  2V6Z M;  2H5X A;  3L27 A;  3NBI A;  3GP1 A;  3L28 A;  1WJ7 A;  5DYI A;  3QWL A;  3GPY A;  4B3S M;  3LW5 F;  1IXS B;  3KOX E;  1MX0 A;  1VQ1 A;  4KHP M;  3KS8 A;  1SXJ C;  1EFU B;  3PFI A;  3KOZ E;  5E6J A;  5EXS A;  3KFU G;  3IG8 A;  2OOA A;  3HY5 A;  1SXJ D;  1HQC A;  2O25 A;  2KNZ A;  2VF8 A;  3LMM A;  4CHT B;  3U61 A;  4AW4 A;  3T1H M;  3ZQJ A;  5ITQ A;  4R3D A;  1NY5 A;  5FTJ A;  4DV1 M;  1ZMW A;  2XGN A;  2DKL A;  5IRE B;  1XXH E;  3ILK A;  4RKU F;  2DNA A;  3GPX A;  3B7Z A;  3BBZ A;  1QUS A;  2C9O A;  1NHG C;  2CHG A;  1TDZ A;  2QEN A;  1VDL A;  1A5T A;  4IBK A;  1VG5 A;  3F92 A;  2LNH C;  1N32 M;  4RF1 A;  3TWK A;  1TDH A;  4AKH A;  5FTL A;  1QZE A;  2LHG A;  5ITX A;  2L7H A;  3L29 A;  2LVN C;  1OAO C;  1TH2 A;  4GMQ A;  4D80 A;  4R71 A;  2KRU A;  1SXJ A;  2LXE A;  4OVZ B;  3K2L A;  3TPZ A;  3FRH A;  1VEJ A;  5KQD A;  3SAV A;  1T3T A;  1Z59 A;  1R6B X;  4TUW A;  5KPZ A;  2KA6 B;  2V1U A;  2HAK A;  3HHX A;  1FJG M;  3U6O A;  1D0M A;  2EKK A;  3GLI E;  3M6A A;  1DO0 A;  1D0L A;  5BR8 M;  2R0I A;  3JAM S;  5H37 D;  1L2B A;  5DYG A;  2JZ0 A;  3KSX A;  4L6V 6;  3KP1 E;  4LF8 M;  2R4J A;  4B7H A;  2MH8 A;  3GLH B;  3U6P A;  1TR8 A;  1C7Y A;  3CF6 E;  4CIZ A;  4LF5 M;  1G3I A;  2ZAN A;  5C18 A;  2C5R A;  1IY0 A;  2ZBK B;  4ITQ A;  2JXN A;  5EP4 A;  5L8R F;  3C9P A;  2QCU A;  4GRI A;  3U5Z B;  2L7I A;  3DOA A;  3GLG A;  1GLN A;  3W67 A;  2DZL A;  3KVW A;  3MK6 A;  3FTE A;  4AZF A;  1WGN A;  2DWL A;  5ITY A;  4LJ4 A;  3D8L A;  1N78 A;  4JV5 M;  1WXQ A;  1OFI A;  4DV6 M;  1PRB A;  1XB2 B;  3HHY A;  5EP2 A;  3A46 A;  4DV3 M;  1RU3 A;  2BWB A;  2LVQ D;  2QSF X;  4JN6 A;  4LJA A;  2QBY A;  3B89 A;  1HT1 E;  2JY8 A;  4DR3 M;  1NV9 A;  2FH0 A;  5FTK A;  4HEO A;  1DGH A;  4IJE A;  2HL7 A;  2RRU A;  3EIE A;  4REZ A;  4FWG A;  3HZJ A;  1KSF X;  3VDU A;  1UM8 A;  2QP9 X;  2ZAO A;  2F5S A;  2WSC F;  1E9S A;  4WP2 A;  4Y28 F;  3RE8 A;  2VF7 A;  2UXC M;  3B7N A;  1G59 A;  1VEG A;  3TL4 X;  1HJP A;  4MGZ E;  4ANR A;  4B7G A;  2UXD M;  3Q8X A;  2YR0 A;  4OW0 A; 
#chains in the Genus database with same CATH homology
 2YQZ A;  3KSJ A;  4NL4 H;  1XMO M;  4Z6Y A;  4NXM M;  4I8O A;  4NRV A;  4EIW A;  1YSY A;  1W5S A;  4R7G A;  1FNN A;  3R9X B;  1XHB A;  2R62 A;  2F5Q A;  4IBG A;  1D2N A;  1QYR A;  2CFO A;  3GLF A;  3U61 B;  2RGH A;  3FTD A;  2UUB M;  4FCT A;  1IN7 A;  4LRT A;  2DVW B;  2UXB M;  5KO3 A;  4X66 M;  2CHV A;  3E9S A;  3U6Q A;  2FOI C;  4IBF A;  3SMS A;  4B3T M;  3A42 A;  3DZD A;  3M7G A;  4L78 A;  5FTN A;  4YY3 M;  4DR7 M;  4DUZ M;  4DR2 M;  1IBM M;  4IBD A;  2X8A A;  3FUV A;  3ZH9 B;  5LMN M;  3JR5 A;  2UU9 M;  1TGU A;  3LQQ A;  1N33 M;  4Z8X A;  4CGY B;  2XH9 A;  3ZCB B;  4L15 A;  1SXJ B;  1XNQ M;  1L8Q A;  3WHL A;  1TH3 A;  4LF7 M;  2XFT A;  3SAW A;  4DV2 M;  1IY2 A;  1KYI A;  4KOD A;  1NJF A;  8CAT A;  4WW0 A;  2Y21 A;  3J81 S;  4D82 A;  4LY6 A;  4OU7 A;  3KOY E;  4X65 M;  4FW9 A;  4LFC M;  3GPU A;  4GKJ M;  5IZ7 D;  4KO8 A;  2XEP A;  2I7N A;  1E94 E;  2Z4S A;  3RGP A;  2UUC M;  3KXE C;  2L09 A;  2C9C A;  3HJ8 A;  3K92 A;  1R7R A;  1Q3C A;  4GH9 A;  3J80 S;  1Z5C A;  4G4Q A;  3HJS A;  2XZF A;  1QAM A;  3H4M A;  3GLG B;  4LRS A;  2D7G A;  2X49 A;  5F3W A;  2JA2 A;  3L25 A;  2C99 A;  3DFZ A;  4AI6 A;  2D7H A;  1IN4 A;  5KPT A;  2ZM6 M;  5EXX A;  4GHA A;  3K8Z A;  1NNJ A;  2FE8 A;  4LJ6 A;  4LCB A;  1Z5B A;  3U6E A;  1IY1 A;  4GIT A;  5C1B A;  5A2Q S;  5ITX E;  1XXH A;  1GVN A;  5FSW A;  2QBY B;  4DR4 M;  5KPR A;  2R46 A;  4QHT A;  4X62 M;  1HR0 M;  1XNR M;  3J2P B;  1DGH B;  4LF9 M;  5KQ8 A;  4GHL A;  4AKI A;  3SAU A;  2DZO B;  1Q3B A;  3BOS A;  2A5Y B;  1GKI A;  3FUU A;  1ORY B;  5EP3 A;  3PVS A;  3GPP A;  1R2Z A;  1GL7 A;  4JXJ A;  4GIP A;  2F4V M;  2X4A A;  4MB7 A;  2DHR A;  3GLI A;  3GO8 A;  5ITT A;  3TQS A;  4L8R C;  3I51 A;  1IM2 A;  4PD2 A;  1DO2 A;  3R8F A;  2OPF A;  3VFD A;  3W0L B;  2F5P A;  2G5G X;  4CIS A;  1QAQ A;  1NJG A;  4II7 A;  3A98 B;  4RNA A;  2R65 A;  1OFH A;  3D8B A;  3U6C A;  2C98 A;  3GLF B;  1J7K A;  4FD2 A;  3SHG B;  4HLQ A;  3LVW A;  3FUT A;  1TH4 A;  1YUB A;  4QHS A;  4DR6 M;  3KS4 A;  2XF3 A;  4G4N A;  2Z4R A;  3J7A S;  1XWI A;  2HKJ A;  3FKE A;  4M0D A;  3TE6 A;  2K47 A;  1K3W A;  3U6D A;  3VKH A;  2KXE A;  5IT9 S;  2Q2E B;  1G41 A;  3NWL A;  1S3S A;  1DGF A;  2XZU A;  1VDD A;  2CEA A;  5EXT A;  3SYL A;  3UGJ A;  3UK6 A;  4I81 A;  2KEB A;  4S12 A;  3HJQ A;  4B3R M;  1LV7 A;  2M60 A;  3UMM A;  4IBI A;  4PDI A;  4QOS A;  3GRR A;  4JI4 M;  2RKO A;  4RF0 A;  3VK8 A;  1QAN A;  3AL0 C;  4JI0 M;  2Z3X A;  2P5T A;  3L2A A;  4LJ8 A;  3U60 A;  1Q39 A;  4LJ9 A;  1L1T A;  1YE9 A;  3SFZ A;  4OX9 M;  2QZ4 A;  2LH0 A;  1KFV A;  3L26 A;  4AQY M;  1N36 M;  2J7N A;  5EJC A;  1QAO A;  2YFQ A;  1IQP A;  1L1Z A;  3M0E A;  4DR1 M;  4NSR A;  4B7F A;  3GQ4 A;  3MHV C;  1N77 A;  1R2Y A;  4JI3 M;  1XMQ M;  2J7O A;  1W5T A;  4XGI A;  3T1Y M;  1J5E M;  3HU1 A;  3AFH A;  2FFJ A;  2CUZ A;  1NHW C;  4DR5 M;  5ITR A;  2L6O A;  4DUY M;  1XXH B;  4AG6 A;  3AV0 A;  4BB9 A;  4LGM A;  2ERC A;  4JI7 M;  1QQW A;  3FYD A;  4QNM A;  4MGI E;  1HT2 E;  3KW6 A;  1HNW M;  4DV5 M;  1K82 A;  3VLF B;  2HHH M;  4K0K M;  2CE7 A;  4GC5 A;  4LZZ A;  2Y0T A;  3THG A;  4W5W A;  4JI2 M;  1J09 A;  1E9R A;  4LJ7 A;  4FWH A;  4LFA M;  2CV2 A;  4LF4 M;  4NXN M;  3CF0 A;  3CTW B;  2KW0 A;  1ZQ9 A;  3GLI B;  4DV7 M;  4LZJ A;  4HL4 A;  5BPV A;  5JI3 E;  3U6M A;  4JI5 M;  3GQ5 A;  5DNY A;  1HNX M;  4NSO B;  1I94 M;  3FUX A;  4BBA A;  2AHM A;  1DGG A;  1JQJ C;  3HU2 A;  3GRU A;  4FCV A;  3CF2 A;  3MJ5 A;  3SAR A;  2F5O A;  1IN6 A;  2OQ4 A;  5EXP A;  2VQE M;  2EO2 A;  3FYC A;  3GRV A;  4D81 A;  2R45 A;  3PNY A;  4DV0 M;  2R18 A;  3SAT A;  1SXJ E;  2RGO A;  1JR3 A;  1I4W A;  3RFW A;  4NOO B;  1PM5 A;  4L16 A;  1IXR C;  1Z6T A;  5GKN A;  1QZM A;  4MGK E;  4M9X A;  2BNK A;  4M9Z A;  3U6S A;  3A45 A;  2I7P A;  1H6U A;  1IXZ A;  3HWS A;  2KZU A;  3U6L A;  3RGS A;  1GL6 A;  4B3M M;  2EA0 A;  1IBL M;  2XSZ D;  3AOE C;  4IBB A;  2F5N A;  3IG5 A;  4IJF A;  2UUA M;  1HQY E;  4JI1 M;  4PCZ A;  4M0W A;  2VII A;  3FUW A;  3FD9 A;  1X37 A;  4KLN A;  1NY6 A;  5E26 A;  3GQ3 A;  3HHW A;  4LFB M;  3U60 B;  4ZPX A;  4DV4 M;  1ZAE A;  4IBJ A;  5LMU M;  4L4U A;  2O5R A;  3SYK A;  4FWD A;  3AKZ A;  2CHQ A;  2HCB A;  2XFS A;  2XSZ A;  4IBC A;  4QNR A;  3HKP A;  2CV0 A;  5EQT A;  3AOE A;  3SBJ A;  4IBE A;  1Z5A A;  2Y20 A;  5ITU A;  3HHZ A;  1QVR A;  2NQ8 C;  2KRK A;  4LGY A;  3UZU A;  4JI6 M;  1NVM A;  2H1R A;  3KOW E;  2DWZ B;  3C58 A;  3T15 A;  5IWA M;  3VKG A;  5FTM A;  2QPA A;  3B9P A;  3HU3 A;  4WUR A;  3SHF A;  1HNZ M;  4OVZ A;  4A3V B;  1L2C A;  1OJL A;  3I4V A;  2YNM D;  4JYA M;  1IN8 A;  1N75 A;  2BJW A;  5FLX S;  1NNU C;  4MH0 E;  1NSF A;  4G4R A;  2C96 A;  1DGB A;  2DZN B;  3WHK A;  1G4A E;  1IN5 A;  3K1J A;  4FCW A;  1G8P A;  2DWN A;  3SMP A;  4M9S A;  4XBO A;  2EUC A;  2Z7J A;  5JI2 E;  4G6Z A;  4MM3 B;  3HGI A;  2LWX A;  3ZC7 B;  1L2D A;  3PNV A;  3GLH A;  4FVM A;  2G8L A;  3JR4 A;  3AJI B;  3W0F A;  4LG2 A;  3OTO M;  3QAU A;  3T38 A;  4JI8 M;  2V1C A;  1N34 M;  2Y0Q A;  4AG5 A;  5EP1 A;  3J7B A;  3U5Z A;  3UJN A;  4X64 M;  4B08 A;  3TWM A;  3SAS A;  4LF6 M;  4GKK M;  3LQR A;  4I5S A;  3KP0 E;  4YHH M;  1E32 A;  1EE8 A;  2D7E A;  2CV1 A;  3AOG A;  3VDP A;  1PJI A;  3DA1 A;  3LVV A;  2XLJ A;  4BLC A;  4QOZ C;  1PJJ A;  4MGH A;  3J27 B;  1XC8 A;  4LJ5 A;  3PXG A;  4P16 A;  3E4R A;  2E5L M;  1C1K A;  4I4L A;  4IIW A;  3KDS E;  7CAT A;  2VQF M;  4AKG A;  3GRY A;  2FNA A;  2DWM A;  3I4Y A;  1K3X A;  3SC3 A;  2R4E A;  2W82 A;  2M5Z A;  3TWL A;  1IBK M;  4MGY E;  4PDG A;  2BJV A;  4G4O A;  1JR3 D;  4NRW A;  3VK7 A;  2KZS A;  3EIH A;  2ZAM A;  2DXI A;  3FTC A;  4GC9 A;  4PT5 A;  3FTF A;  1MU5 A;  2V6Z M;  3L27 A;  3NBI A;  3GP1 A;  3L28 A;  5DYI A;  3GPY A;  3QWL A;  4B3S M;  1IXS B;  3KOX E;  1MX0 A;  4KHP M;  3KS8 A;  1SXJ C;  5E6J A;  3PFI A;  3KOZ E;  5EXS A;  3KFU G;  3IG8 A;  1SXJ D;  1HQC A;  3LMM A;  4CHT B;  3U61 A;  4AW4 A;  3T1H M;  5ITQ A;  4R3D A;  1NY5 A;  5FTJ A;  4DV1 M;  2XGN A;  5IRE B;  3ILK A;  3GPX A;  1TDZ A;  2C9O A;  1NHG C;  2CHG A;  2QEN A;  4IBK A;  1N32 M;  4AKH A;  2LNH C;  4RF1 A;  3TWK A;  1TDH A;  5FTL A;  5ITX A;  2L7H A;  3L29 A;  1TH2 A;  4GMQ A;  4D80 A;  2KRU A;  1SXJ A;  2LXE A;  4OVZ B;  3K2L A;  3TPZ A;  5KQD A;  3SAV A;  1T3T A;  1Z59 A;  1R6B X;  4TUW A;  5KPZ A;  2KA6 B;  2V1U A;  3HHX A;  1FJG M;  3U6O A;  3M6A A;  1DO0 A;  5BR8 M;  3JAM S;  5H37 D;  1L2B A;  5DYG A;  3KSX A;  3KP1 E;  4LF8 M;  2R4J A;  4B7H A;  3GLH B;  3U6P A;  4LF5 M;  3CF6 E;  1G3I A;  2ZAN A;  5C18 A;  2C5R A;  1IY0 A;  2ZBK B;  4ITQ A;  5EP4 A;  2QCU A;  4GRI A;  3U5Z B;  2L7I A;  3DOA A;  3GLG A;  1GLN A;  3KVW A;  3MK6 A;  3FTE A;  4AZF A;  2DWL A;  5ITY A;  4LJ4 A;  3D8L A;  1N78 A;  4JV5 M;  1WXQ A;  1OFI A;  4DV6 M;  3HHY A;  5EP2 A;  3A46 A;  4DV3 M;  4LJA A;  4JN6 A;  2QBY A;  1HT1 E;  4DR3 M;  5FTK A;  1DGH A;  4IJE A;  2HL7 A;  3EIE A;  4REZ A;  4FWG A;  1KSF X;  3VDU A;  1UM8 A;  2QP9 X;  2ZAO A;  2F5S A;  1E9S A;  3RE8 A;  2UXC M;  1G59 A;  3TL4 X;  4MGZ E;  4B7G A;  2UXD M;  3Q8X A;  2YR0 A;  4OW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...