2KZUA

Daxx helical bundle (dhb) domain / rassf1c complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Death-associated protein 6
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzuA00
2KZSA 2KZUA
chains in the Genus database with same CATH superfamily
2DHYA 1E9RA 2MROB 4FWGA 1NY6A 4B08A 4DV3M 4IBCA 4OW0A 1RU3A 2G5GX 4NRWA 1PM5A 2BJVA 4PDIA 4B3RM 1QVRA 3GLFE 4LFCM 3DFZA 2Z8YM 3HY5A 5EP3A 3BXWA 2OPFA 1IXSA 3SHGB 3TPZA 2DVWB 4BLCA 4FWHA 1VEGA 2X49A 5DYIA 4DV2M 5KQ8A 3RGPA 4LFBM 2F4VM 2L4FA 3HKPA 2JZ0A 2HHHM 2DZLA 3KDSE 3LCUA 2DXIA 3VKHA 1N33M 3HHYA 1IBKM 1A5TA 1T3TA 2QNJA 4JI3M 1R2YA 5EQTA 2C99A 2HL7A 3VK7A 4MGYE 1YE9A 2LVAA 3I01M 3KSXA 3FUXA 4I5SA 3ILKA 3AKZA 2QPAA 3HJQA 4LFAM 2X4AA 4IJFA 4AQYM 1N78A 2GQFA 2DWZB 3L28A 2Z3XA 3HWSA 4P16A 3R9XB 3R8FA 2O25A 4LJ7A 3ZQJA 2XZFA 4LG2A 1EE8A 1TDZA 1X37A 2FFJA 4MGIE 1G41A 5EJCA 2LWXA 2DAGA 3B7ZA 2F5OA 3JAMS 4REZA 2EUCA 3LQRA 3ZCBB 2ZAMA 3FYCA 1J5EM 4DR6M 1PJTA 2DHRA 3HZJA 4LZZA 3GPUA 3GLFA 1Q3CA 1AUAA 5BR8M 1VEJA 3NBIA 3THGA 1BVSA 2UXBM 4L16A 3A45A 3B7NA 2JY6B 2Y0TA 4L15A 4ZPXA 4PD2A 4AKIA 1JQJC 2L2DA 5IZ7D 2UUBM 3C3EA 5FTKA 1HNZM 4F2LA 2DZOB 1XMOM 2Q2EB 1K82A 4JI0M 1IY1A 1R7RA 3U6PA 1L2BA 3A98B 3L26A 2E5LM 2KDLA 5E6JA 1IN6A 3SARA 1QANA 2LH0A 1IXRC 2XEPA 3FKEA 1IFYA 1D0KA 1PJJA 1NY5A 2R6FA 5ITXE 2D7HA 4FVMA 3GP1A 1QUSA 3U61B 4LY6A 3VK8A 4AG6A 3TE6A 3WHLA 3GPYA 1PRBA 1W5SA 2N35A 2MJ5B 3IG8A 3J80S 4R71A 1IN4A 2O5RA 3U6OA 2BNKA 1MJGM 2QQ8A 3FUTA 1DGHB 3L27A 4LRSA 1OKSA 2EJSA 1LV7A 2EO2A 4AW4A 3D8LA 2DWMA 1PJSA 2LNHC 4HL4A 5FLXS 2KRKA 3KOYE 1IY0A 4LF5M 1IXZA 3DZDA 3TQSA 2M60A 3PXGA 2LXEA 4LCBA 4A3VB 4II7A 4DV0M 1WJ7A 1GJSA 1PJQA 2G8LA 2QHOB 3EIHA 3M7GA 4IBKA 4PCZA 2V1UA 3FRIA 3U5ZA 3AJIB 4LJ6A 4DUYM 3W0FA 3Q8GA 3HJSA 3KSJA 1E94E 3FTEA 4Z6YA 3J7BA 5C1BA 3GLGE 2MGWA 3IHPA 1NO1A 3L2AA 4M9XA 1HQCA 1K3XA 2UUAM 3U61A 3EIEA 2XF3A 4WP2A 2XGNA 3LMMA 3A46A 2MH8A 2M5ZA 4MGKE 1IM2A 3BOSA 2QSFX 4M0DA 7CATA 1L8QA 4R3DA 1L1TA 1XNRM 4GRIA 1T43A 1GKIA 4TUWA 4FD2A 3VFDA 2DENA 4M9SA 1ZMWA 2JY7A 2LHGA 2D7EA 1QAOA 4IBFA 3UGJA 3I4YA 3JR5A 3T1YM 2HKJA 2Z4SA 5EXXA 2R46A 4JYAM 1ZQ9A 4DV7M 2Z7JA 2DWNA 2Z4RA 3GLGA 3SAWA 3I04M 1QUTA 1H6UA 3HU3A 3KVWA 5FSWA 5IT9S 3E21A 2MR9A 1NV9A 3IECA 4IIWA 4LJ9A 3T38A 1SXJB 4BB9A 2J7NA 4AKGA 3KS8A 3C58A 2CEAA 1GVNA 2K47A 3D8BA 2KZUA 2R0IA 3VDUA 3GQ5A 2XFSA 1XC8A 2VDBB 1V34A 4GKKM 4LJ5A 2EKKA 3SASA 3GLHA 1JR3A 4IBJA 3WHKA 3GQ3A 4JI2M 3T15A 2QBYB 3U6DA 3C3DA 1HNWM 3F92A 2JNHA 3GRYA 3KOXE 1GL6A 1OAOC 4B3SM 4FCTA 3I51A 2R4EA 3U60A 1SXJD 2HAKA 3QYBA 4MH0E 5KPRA 2HWJA 3KOZE 3HU1A 2XSZD 1GLNA 3SMSA 1Z5AA 3KFUG 5KPZA 4LJ4A 3FYDA 1TF0B 4OVZB 4X64M 3SYKA 3RFWA 1HT1E 1N75A 2DAEA 1YLAA 1R4GA 3A42A 4G4RA 4LF8M 1NNJA 3C9PA 1TH4A 4XGIA 1DO2A 4I4LA 4JXJA 2YQZA 1J09A 2VF8A 3HHXA 4JI7M 2FE8A 4JI1M 5ITRA 5ITQA 3BBZA 2BWEA 2JWSA 1V33A 4Z8XA 2LTUA 1XXHB 5EP4A 1IBMM 2KXEA 2CV2A 2FNAA 1QAQA 1JB0F 2ZAOA 1Q39A 1Q02A 2LVNC 4DBGB 4DV6M 4QHSA 3B89A 2W82A 4DR4M 1I94M 5F3WA 4RF0A 1DGGA 5FTLA 2JY5A 2Y21A 4NSRA 4NSOB 2Y20A 4P17A 4X62M 2JXNA 4GIPA 1N34M 2WZJA 3H4MA 1IN7A 1J7KA 1YSYA 2JP7A 4IJEA 1DV0A 1TDHA 2YR0A 2RGHA 3LW5F 2ZBKB 3HX3A 2UXCM 5DYGA 1G59A 2C9OA 3SAUA 2KNZA 2D7GA 1N36M 2V6ZM 3SYLA 3MHVC 4YY3M 1UFZA 3AFHA 3FUVA 4L8RC 2KW0A 4LRTA 1NJGA 2X8AA 1E9SA 1VDDA 1NV8A 2WSEF 4QNRA 5IREB 3E46A 1NHGC 1Z6TA 1Q3BA 2LVQD 3HJ8A 4NXMM 1V92A 2P5TA 1R6BX 2LHCA 1TGUA 3CF2A 3GO8A 2OQ4A 3HHZA 3W67A 4DV4M 2DAKA 1D0LA 4MGZE 1HR0M 4GITA 2LVPC 5IWAM 1NNUC 4L4UA 1TH2A 1PGYA 4KODA 4DR3M 3KP1E 5KPTA 1EIJA 1R2ZA 3MMPA 1IN8A 2L4EA 4NRVA 3CF0A 3K1JA 3B9PA 3OTOM 3U6CA 1Z5BA 2R44A 3FTFA 4NOOB 1EFUB 5DNYA 4LF9M 4GKJM 4GHAA 2DNAA 4PT5A 4XBOA 3U6EA 2UU9M 4CGYB 1I4WA 2L09A 4Y28F 4DV5M 2APLA 3PVSA 4FCVA 2CE7A 5ITXA 3DA1A 2KZSA 5DFLA 1MN3A 2KEBA 1ZMVA 4QHTA 2F5PA 3IG5A 4IBGA 1DGHA 3Q8XA 4JI4M 3SC3A 3GRUA 2AHMA 5EXTA 2O01F 3SFZA 4OU7A 4S12A 4NC6A 2KNAA 4QOSA 4MM3B 5ITTA 4F1IA 1T6OA 2J5YA 4D82A 4IBDA 2R62A 3FTCA 3AV0A 4KO8A 1SXJC 2JZ1A 5C18A 5EXPA 1TTEA 5EP2A 3E4RA 1YUBA 2RGOA 3TL4X 1WHCA 5GKNA 3MJ5A 4EIWA 1HQYE 3CGWA 4PDGA 4IBEA 1VEKA 1SXJE 1WGLA 1ZV1A 3HGIA 2RRUA 3U6SA 3L25A 2L7IA 1WXQA 1IXSB 2R18A 1GJTA 4FWDA 1QDRA 3B74A 5JI3E 4L78A 3L29A 3KXEC 3T1HM 1LTMA 1OIPA 2KHHA 4GH9A 1IN5A 4LF6M 3KP0E 2CWBA 2R45A 3HU2A 3K2LA 3K92A 4I81A 2VIIA 2DAMA 1AIPC 3SBJA 2L7HA 2C5RA 1ZAEA 4NXNM 3U6MA 4OX9M 2L6OA 4AG5A 2CFOA 3SHFA 4D80A 1VDLA 4RNAA 1FNNA 4LGYA 3TWKA 4CIZA 2QP9X 3LVVA 4FW9A 3FRHA 4WURA 3FE3A 4G4QA 1OFIA 2KNVA 3HHWA 1QQWA 4GC5A 1QZMA 1UM8A 3U6LA 2QENA 3UMMA 5ITUA 4DR7M 2C98A 4IBBA 4BBAA 1WGNA 2R65A 2FS1A 3NWLA 1F4IA 5E26A 4LF7M 1R5LA 1SXJA 3DOAA 5JI2E 3GLFB 3CTWB 3K9OA 2CRUA 2XSZA 3E9SA 3RGSA 1IQPA 3AOEC 2DKLA 1TH3A 3I4VA 3M6AA 4W5WA 1QDTA 5KQDA 3J7AS 2CV1A 1NHWC 2JA2A 4JI5M 1XXHE 4G6ZA 3J27B 3GRVA 1P3QQ 2F5QA 3VDPA 2QBYA 1XMQM 3B7QA 2A5YB 1D2NA 3TWLA 1L1ZA 4XK8F 4AKHA 2Y0QA 3PFIA 2J7OA 1S3SA 3H4JA 4R7GA 2XZUA 2F5SA 4AZFA 2H1RA 1KSFX 3QAUA 4CISA 3KW6A 2ZTCA 2DZNB 2NQ8C 2CHGA 4B7FA 3K8ZA 3SMPA 3CF6E 4G4NA 2YNMD 1G3IA 1WIVA 2HCBA 1KFVA 2UXDM 3ZH9B 2CHQA 2K9DA 4CHTB 1VQ1A 4OVZA 4DUZM 4AI6A 2ZANA 3NBXX 2B3TA 1OQYA 3KS4A 1QAMA 4LGMA 3LVWA 3VKGA 2OOBA 5FTJA 1G71A 4UN2B 1HT2E 4DR1M 4CJ6A 1Z59A 4MGHA 3SAVA 2F5NA 2WSCF 2FOIC 3U5ZB 4RKUF 1XXHA 4IBIA 4M9ZA 2K6BA 5LMUM 1SG9A 3MK6A 2DAIA 3LCVB 2LBCA 4HLQA 2GNOA 2BWBA 2KA6B 3AOEA 2JUJA 2QCUA 5ITYA 3W68A 3ZC7B 4QNMA 4D81A 1GL7A 4ANRA 1FJGM 2WSFF 1G8PA 4GC9A 2CV0A 2K0BX 2VQEM 1PJIA 2LVOC 4GMQA 3J81S 3GRRA 4B3MM 1XHBA 3RE8A 4L6V6 2EKFA 5L8RF 3UJNA 4NL4H 3GPPA 4GHLA 1DGFA 1KYIA 1XWIA 4YHHM 3U6QA 4M0WA 4KLNA 1L2CA 2V1CA 4GEWA 3JR4A 3GPXA 3AL0C 3FUUA 1NSFA 4B3TM 2ZM6M 4DR5M 3GLIE 4DR2M 3GLIB 2R4JA 1C1KA 5BPVA 2ERCA 1XNQM 4G4OA 1HJPA 1VG5A 5EP1A 4Q7JA 4FCWA 3TWMA 3KOWE 2BJWA 1DO0A 2UUCM 1OFHA 4LJ8A 1HNXM 4JI8M 1E32A 3PNVA 3FD9A 1DGBA 4X66M 4RF1A 3FUWA 8CATA 4LJAA 3GLGB 2DWLA 2OO9A 3SATA 1OTRA 2CP8A 1WR1B 3QWLA 3UZUA 2C96A 1OJLA 1GO5A 1OIZA 4MB7A 4B7GA 4ITQA 4HEOA 4JN6A 1L2DA 2VQFM 3W0LB 5LMNM 4KT0F 2CHVA 1NVMA 2OOAA 3AOGA 4WW0A 5EXSA 3GLHE 1JR3E 1ORYB 1ZMUA 3GLHB 1N77A 1IY2A 1MX0A 1QZEA 2C9CA 3GLIA 1Z5CA 2I7PA 3J2PB 2XFTA 1XB2B 1D0MA 2XH9A 2FH0A 3FTDA 3LQQA 2XLJA 4DV1M 5H37D 3PNYA 1Y8GA 1GABA 2G3QA 2H5XA 4G3OA 2VF7A 5FTMA 3V76A 1G4AE 5KO3A 1C7YA 3T6PA 1MU5A 3U60B 2JY8A 4JI6M 2KRUA 1W5TA 5FTNA 2RKOA 1K3WA 2CUZA 4KHPM 1NJFA 2EA0A 3UK6A 4QOZC 3VLFB 2DI0A 4X65M 3GQ4A 4K0KM 4LZJA 1QYRA 2YFQA 3M0EA 2I7NA 4LF4M 2QZ4A 1JR3D 1N32M 4I8OA 3K9PA 1CUKA 1TR8A 3QYEA 5A2QS 1OAIA 4B7HA 2ZTDA 1IBLM 4JV5M
chains in the Genus database with same CATH topology
1E9RA 4FWGA 1NY6A 4B08A 4DV3M 4IBCA 4OW0A 2G5GX 4NRWA 1PM5A 2BJVA 4PDIA 4B3RM 1QVRA 4LFCM 3DFZA 5EP3A 2OPFA 3SHGB 3TPZA 2DVWB 4BLCA 4FWHA 2X49A 5DYIA 4DV2M 5KQ8A 3RGPA 2F4VM 3HKPA 2HHHM 3KDSE 2DXIA 3VKHA 1N33M 3HHYA 1IBKM 1T3TA 4JI3M 1R2YA 5EQTA 2C99A 2HL7A 3VK7A 4MGYE 1YE9A 3KSXA 4I5SA 3FUXA 3AKZA 3ILKA 2QPAA 3HJQA 4LFAM 2X4AA 4IJFA 4AQYM 1N78A 3L28A 2DWZB 2Z3XA 3HWSA 4P16A 3R9XB 3R8FA 2XZFA 4LJ7A 4LG2A 1EE8A 1TDZA 1X37A 2FFJA 4MGIE 1G41A 5EJCA 2LWXA 2F5OA 3JAMS 4REZA 2EUCA 3LQRA 3ZCBB 2ZAMA 3FYCA 1J5EM 4DR6M 2DHRA 4LZZA 3GPUA 3GLFA 1Q3CA 5BR8M 3THGA 3NBIA 2UXBM 4L16A 3A45A 4AKIA 4L15A 2Y0TA 4ZPXA 4PD2A 1JQJC 5IZ7D 2UUBM 5FTKA 1HNZM 2DZOB 1XMOM 2Q2EB 1K82A 4JI0M 1IY1A 1R7RA 3U6PA 1L2BA 3A98B 3L26A 2E5LM 5E6JA 1IN6A 3SARA 1QANA 2LH0A 1IXRC 2XEPA 3FKEA 1PJJA 1NY5A 5ITXE 3GP1A 2D7HA 4FVMA 3U61B 4LY6A 3VK8A 4AG6A 3TE6A 3WHLA 3GPYA 1W5SA 3IG8A 2DWLA 3J80S 1IN4A 2O5RA 3U6OA 2BNKA 3FUTA 1DGHB 3L27A 4LRSA 2EO2A 1LV7A 4AW4A 2DWMA 3D8LA 2LNHC 4HL4A 5FLXS 2KRKA 3KOYE 1IY0A 4LF5M 1IXZA 3DZDA 3TQSA 2M60A 3PXGA 2LXEA 4LCBA 4A3VB 4II7A 4DV0M 2G8LA 3M7GA 4PCZA 3EIHA 4IBKA 2V1UA 3U5ZA 3AJIB 4LJ6A 4DUYM 3W0FA 3HJSA 3KSJA 1E94E 3FTEA 4Z6YA 3J7BA 5C1BA 3L2AA 4M9XA 1HQCA 1K3XA 2UUAM 3U61A 3EIEA 2XF3A 2XGNA 3LMMA 3A46A 2M5ZA 4MGKE 1IM2A 3BOSA 4M0DA 7CATA 1L8QA 4R3DA 1L1TA 1XNRM 4GRIA 1GKIA 4TUWA 4FD2A 3VFDA 4M9SA 2D7EA 1QAOA 4IBFA 3UGJA 3I4YA 3JR5A 3T1YM 2HKJA 2Z4SA 5EXXA 2R46A 4JYAM 1ZQ9A 4DV7M 2Z7JA 2DWNA 2Z4RA 3GLGA 3SAWA 1H6UA 3HU3A 3KVWA 5FSWA 5IT9S 4LJ9A 4IIWA 3T38A 1SXJB 4BB9A 2J7NA 4AKGA 3KS8A 3C58A 2CEAA 1GVNA 2K47A 3D8BA 2KZUA 3VDUA 3GQ5A 2XFSA 1XC8A 4GKKM 4LJ5A 3SASA 3GLHA 1JR3A 4IBJA 3WHKA 3GQ3A 4JI2M 3T15A 2QBYB 3U6DA 1HNWM 3GRYA 3KOXE 1GL6A 4B3SM 4FCTA 3I51A 2R4EA 3U60A 1SXJD 4MH0E 5KPRA 3KOZE 3HU1A 2XSZD 1GLNA 3SMSA 1Z5AA 3KFUG 5KPZA 4LJ4A 3FYDA 4OVZB 4X64M 3SYKA 3RFWA 1HT1E 1N75A 4G4RA 3A42A 4LF8M 1NNJA 1TH4A 4XGIA 1DO2A 4I4LA 4JXJA 2YQZA 1J09A 3HHXA 4JI7M 4JI1M 2FE8A 5ITRA 5ITQA 4Z8XA 1IBMM 1XXHB 5EP4A 2KXEA 2CV2A 2FNAA 1QAQA 2ZAOA 1Q39A 4DV6M 4QHSA 4DR4M 2W82A 1I94M 5F3WA 4RF0A 1DGGA 5FTLA 2Y21A 4NSRA 4NSOB 2Y20A 4X62M 4GIPA 1N34M 3H4MA 1IN7A 1J7KA 1YSYA 4IJEA 1TDHA 2YR0A 2RGHA 2ZBKB 2UXCM 5DYGA 1G59A 2C9OA 3SAUA 1N36M 2D7GA 2V6ZM 3SYLA 3MHVC 4YY3M 3AFHA 3FUVA 4L8RC 2KW0A 4LRTA 1NJGA 2X8AA 1E9SA 1VDDA 5IREB 4QNRA 1NHGC 1Z6TA 1Q3BA 3HJ8A 4NXMM 2P5TA 1R6BX 1TGUA 3CF2A 3GO8A 2OQ4A 3HHZA 4DV4M 4MGZE 1HR0M 4GITA 5IWAM 1NNUC 4L4UA 1TH2A 4KODA 4DR3M 3KP1E 5KPTA 1R2ZA 4NRVA 1IN8A 3CF0A 3K1JA 3B9PA 3OTOM 3U6CA 1Z5BA 3FTFA 4GKJM 4NOOB 5DNYA 4LF9M 4GHAA 4PT5A 4XBOA 3U6EA 2UU9M 4CGYB 1I4WA 2L09A 4DV5M 3PVSA 4FCVA 2CE7A 5ITXA 3DA1A 2KZSA 2KEBA 4QHTA 2F5PA 3IG5A 4IBGA 1DGHA 3Q8XA 4JI4M 3SC3A 3GRUA 2AHMA 5EXTA 3SFZA 4OU7A 4S12A 4QOSA 4MM3B 5ITTA 4D82A 4IBDA 2R62A 3FTCA 3AV0A 4KO8A 1SXJC 5C18A 5EXPA 5EP2A 3E4RA 1YUBA 2RGOA 3TL4X 5GKNA 4EIWA 3MJ5A 1HQYE 4PDGA 4IBEA 1SXJE 3HGIA 3U6SA 3L25A 2L7IA 1WXQA 1IXSB 2R18A 4FWDA 5JI3E 4L78A 3L29A 3KXEC 3T1HM 4GH9A 1IN5A 4LF6M 3KP0E 2R45A 3HU2A 3K2LA 3K92A 4I81A 2VIIA 3SBJA 2C5RA 2L7HA 1ZAEA 4NXNM 3U6MA 4OX9M 2L6OA 4AG5A 2CFOA 3SHFA 4D80A 4RNAA 1FNNA 4LGYA 3TWKA 2QP9X 3LVVA 4FW9A 4WURA 4G4QA 1OFIA 3HHWA 1QQWA 4GC5A 1QZMA 1UM8A 3U6LA 2QENA 3UMMA 5ITUA 4DR7M 2C98A 4IBBA 4BBAA 2R65A 3NWLA 5E26A 4LF7M 1SXJA 3DOAA 5JI2E 3GLFB 3CTWB 3RGSA 2XSZA 3E9SA 1IQPA 3AOEC 1TH3A 3I4VA 3M6AA 4W5WA 5KQDA 3J7AS 2CV1A 1NHWC 2JA2A 4JI5M 4G6ZA 3J27B 3GRVA 2F5QA 3VDPA 2QBYA 1XMQM 2A5YB 1D2NA 3TWLA 1L1ZA 4AKHA 2Y0QA 3PFIA 2J7OA 1S3SA 2XZUA 4R7GA 2F5SA 4CISA 4AZFA 2H1RA 1KSFX 3QAUA 3KW6A 2DZNB 2NQ8C 2CHGA 4B7FA 3K8ZA 3SMPA 3CF6E 4G4NA 2YNMD 1G3IA 2HCBA 1KFVA 2UXDM 3ZH9B 2CHQA 4CHTB 4OVZA 4DUZM 4AI6A 2ZANA 3KS4A 1QAMA 4LGMA 3LVWA 3VKGA 5FTJA 1HT2E 4DR1M 1Z59A 4MGHA 3SAVA 2F5NA 2FOIC 3U5ZB 1XXHA 4IBIA 4M9ZA 5LMUM 3MK6A 4HLQA 5ITYA 2KA6B 3ZC7B 3AOEA 2QCUA 4QNMA 4D81A 1GL7A 1FJGM 4GC9A 1G8PA 2CV0A 2VQEM 1PJIA 4GMQA 3J81S 3GRRA 4B3MM 1XHBA 3RE8A 3UJNA 4NL4H 3GPPA 4GHLA 1DGFA 1KYIA 1XWIA 4YHHM 3U6QA 4M0WA 4KLNA 1L2CA 2V1CA 3JR4A 3AL0C 3GPXA 3FUUA 1NSFA 4B3TM 2ZM6M 4DR5M 4DR2M 3GLIB 2R4JA 1C1KA 5BPVA 2ERCA 1XNQM 4G4OA 5EP1A 3TWMA 4FCWA 3KOWE 2BJWA 1DO0A 2UUCM 1OFHA 4LJ8A 1HNXM 4JI8M 1E32A 3PNVA 3FD9A 1DGBA 4X66M 4RF1A 3FUWA 8CATA 4LJAA 3GLGB 3SATA 3QWLA 3UZUA 2C96A 1OJLA 4MB7A 4B7GA 4ITQA 1L2DA 4JN6A 2VQFM 3W0LB 5LMNM 2CHVA 1NVMA 3AOGA 4WW0A 5EXSA 1ORYB 3GLHB 1N77A 1IY2A 1MX0A 2C9CA 4LFBM 3GLIA 1Z5CA 2I7PA 3J2PB 2XFTA 2XH9A 3LQQA 3FTDA 4DV1M 2XLJA 5H37D 3PNYA 5FTMA 1G4AE 5KO3A 1MU5A 3U60B 4JI6M 2KRUA 1W5TA 5FTNA 2RKOA 1K3WA 2CUZA 4KHPM 1NJFA 2EA0A 3UK6A 4QOZC 3VLFB 4X65M 3GQ4A 4K0KM 4LZJA 1QYRA 2YFQA 3M0EA 2I7NA 4LF4M 2QZ4A 1JR3D 1N32M 4I8OA 5A2QS 4B7HA 1IBLM 4JV5M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZS A;  2KZU A; 
#chains in the Genus database with same CATH topology
 2DHY A;  1E9R A;  2MRO B;  4FWG A;  1NY6 A;  4B08 A;  4DV3 M;  4IBC A;  4OW0 A;  1RU3 A;  2G5G X;  4NRW A;  1PM5 A;  2BJV A;  4PDI A;  4B3R M;  1QVR A;  3GLF E;  4LFC M;  3DFZ A;  2Z8Y M;  3HY5 A;  5EP3 A;  3BXW A;  2OPF A;  1IXS A;  3SHG B;  3TPZ A;  2DVW B;  4BLC A;  4FWH A;  1VEG A;  2X49 A;  5DYI A;  4DV2 M;  5KQ8 A;  3RGP A;  4LFB M;  2F4V M;  2L4F A;  3HKP A;  2JZ0 A;  2HHH M;  2DZL A;  3KDS E;  3LCU A;  2DXI A;  3VKH A;  1N33 M;  3HHY A;  1IBK M;  1A5T A;  1T3T A;  2QNJ A;  4JI3 M;  1R2Y A;  5EQT A;  2C99 A;  2HL7 A;  3VK7 A;  4MGY E;  1YE9 A;  2LVA A;  3I01 M;  3KSX A;  3FUX A;  4I5S A;  3ILK A;  3AKZ A;  2QPA A;  3HJQ A;  4LFA M;  2X4A A;  4IJF A;  4AQY M;  1N78 A;  2GQF A;  2DWZ B;  3L28 A;  2Z3X A;  3HWS A;  4P16 A;  3R9X B;  3R8F A;  2O25 A;  4LJ7 A;  3ZQJ A;  2XZF A;  4LG2 A;  1EE8 A;  1TDZ A;  1X37 A;  2FFJ A;  4MGI E;  1G41 A;  5EJC A;  2LWX A;  2DAG A;  3B7Z A;  2F5O A;  3JAM S;  4REZ A;  2EUC A;  3LQR A;  3ZCB B;  2ZAM A;  3FYC A;  1J5E M;  4DR6 M;  1PJT A;  2DHR A;  3HZJ A;  4LZZ A;  3GPU A;  3GLF A;  1Q3C A;  1AUA A;  5BR8 M;  1VEJ A;  3NBI A;  3THG A;  1BVS A;  2UXB M;  4L16 A;  3A45 A;  3B7N A;  2JY6 B;  2Y0T A;  4L15 A;  4ZPX A;  4PD2 A;  4AKI A;  1JQJ C;  2L2D A;  5IZ7 D;  2UUB M;  3C3E A;  5FTK A;  1HNZ M;  4F2L A;  2DZO B;  1XMO M;  2Q2E B;  1K82 A;  4JI0 M;  1IY1 A;  1R7R A;  3U6P A;  1L2B A;  3A98 B;  3L26 A;  2E5L M;  2KDL A;  5E6J A;  1IN6 A;  3SAR A;  1QAN A;  2LH0 A;  1IXR C;  2XEP A;  3FKE A;  1IFY A;  1D0K A;  1PJJ A;  1NY5 A;  2R6F A;  5ITX E;  2D7H A;  4FVM A;  3GP1 A;  1QUS A;  3U61 B;  4LY6 A;  3VK8 A;  4AG6 A;  3TE6 A;  3WHL A;  3GPY A;  1PRB A;  1W5S A;  2N35 A;  2MJ5 B;  3IG8 A;  3J80 S;  4R71 A;  1IN4 A;  2O5R A;  3U6O A;  2BNK A;  1MJG M;  2QQ8 A;  3FUT A;  1DGH B;  3L27 A;  4LRS A;  1OKS A;  2EJS A;  1LV7 A;  2EO2 A;  4AW4 A;  3D8L A;  2DWM A;  1PJS A;  2LNH C;  4HL4 A;  5FLX S;  2KRK A;  3KOY E;  1IY0 A;  4LF5 M;  1IXZ A;  3DZD A;  3TQS A;  2M60 A;  3PXG A;  2LXE A;  4LCB A;  4A3V B;  4II7 A;  4DV0 M;  1WJ7 A;  1GJS A;  1PJQ A;  2G8L A;  2QHO B;  3EIH A;  3M7G A;  4IBK A;  4PCZ A;  2V1U A;  3FRI A;  3U5Z A;  3AJI B;  4LJ6 A;  4DUY M;  3W0F A;  3Q8G A;  3HJS A;  3KSJ A;  1E94 E;  3FTE A;  4Z6Y A;  3J7B A;  5C1B A;  3GLG E;  2MGW A;  3IHP A;  1NO1 A;  3L2A A;  4M9X A;  1HQC A;  1K3X A;  2UUA M;  3U61 A;  3EIE A;  2XF3 A;  4WP2 A;  2XGN A;  3LMM A;  3A46 A;  2MH8 A;  2M5Z A;  4MGK E;  1IM2 A;  3BOS A;  2QSF X;  4M0D A;  7CAT A;  1L8Q A;  4R3D A;  1L1T A;  1XNR M;  4GRI A;  1T43 A;  1GKI A;  4TUW A;  4FD2 A;  3VFD A;  2DEN A;  4M9S A;  1ZMW A;  2JY7 A;  2LHG A;  2D7E A;  1QAO A;  4IBF A;  3UGJ A;  3I4Y A;  3JR5 A;  3T1Y M;  2HKJ A;  2Z4S A;  5EXX A;  2R46 A;  4JYA M;  1ZQ9 A;  4DV7 M;  2Z7J A;  2DWN A;  2Z4R A;  3GLG A;  3SAW A;  3I04 M;  1QUT A;  1H6U A;  3HU3 A;  3KVW A;  5FSW A;  5IT9 S;  3E21 A;  2MR9 A;  1NV9 A;  3IEC A;  4IIW A;  4LJ9 A;  3T38 A;  1SXJ B;  4BB9 A;  2J7N A;  4AKG A;  3KS8 A;  3C58 A;  2CEA A;  1GVN A;  2K47 A;  3D8B A;  2KZU A;  2R0I A;  3VDU A;  3GQ5 A;  2XFS A;  1XC8 A;  2VDB B;  1V34 A;  4GKK M;  4LJ5 A;  2EKK A;  3SAS A;  3GLH A;  1JR3 A;  4IBJ A;  3WHK A;  3GQ3 A;  4JI2 M;  3T15 A;  2QBY B;  3U6D A;  3C3D A;  1HNW M;  3F92 A;  2JNH A;  3GRY A;  3KOX E;  1GL6 A;  1OAO C;  4B3S M;  4FCT A;  3I51 A;  2R4E A;  3U60 A;  1SXJ D;  2HAK A;  3QYB A;  4MH0 E;  5KPR A;  2HWJ A;  3KOZ E;  3HU1 A;  2XSZ D;  1GLN A;  3SMS A;  1Z5A A;  3KFU G;  5KPZ A;  4LJ4 A;  3FYD A;  1TF0 B;  4OVZ B;  4X64 M;  3SYK A;  3RFW A;  1HT1 E;  1N75 A;  2DAE A;  1YLA A;  1R4G A;  3A42 A;  4G4R A;  4LF8 M;  1NNJ A;  3C9P A;  1TH4 A;  4XGI A;  1DO2 A;  4I4L A;  4JXJ A;  2YQZ A;  1J09 A;  2VF8 A;  3HHX A;  4JI7 M;  2FE8 A;  4JI1 M;  5ITR A;  5ITQ A;  3BBZ A;  2BWE A;  2JWS A;  1V33 A;  4Z8X A;  2LTU A;  1XXH B;  5EP4 A;  1IBM M;  2KXE A;  2CV2 A;  2FNA A;  1QAQ A;  1JB0 F;  2ZAO A;  1Q39 A;  1Q02 A;  2LVN C;  4DBG B;  4DV6 M;  4QHS A;  3B89 A;  2W82 A;  4DR4 M;  1I94 M;  5F3W A;  4RF0 A;  1DGG A;  5FTL A;  2JY5 A;  2Y21 A;  4NSR A;  4NSO B;  2Y20 A;  4P17 A;  4X62 M;  2JXN A;  4GIP A;  1N34 M;  2WZJ A;  3H4M A;  1IN7 A;  1J7K A;  1YSY A;  2JP7 A;  4IJE A;  1DV0 A;  1TDH A;  2YR0 A;  2RGH A;  3LW5 F;  2ZBK B;  3HX3 A;  2UXC M;  5DYG A;  1G59 A;  2C9O A;  3SAU A;  2KNZ A;  2D7G A;  1N36 M;  2V6Z M;  3SYL A;  3MHV C;  4YY3 M;  1UFZ A;  3AFH A;  3FUV A;  4L8R C;  2KW0 A;  4LRT A;  1NJG A;  2X8A A;  1E9S A;  1VDD A;  1NV8 A;  2WSE F;  4QNR A;  5IRE B;  3E46 A;  1NHG C;  1Z6T A;  1Q3B A;  2LVQ D;  3HJ8 A;  4NXM M;  1V92 A;  2P5T A;  1R6B X;  2LHC A;  1TGU A;  3CF2 A;  3GO8 A;  2OQ4 A;  3HHZ A;  3W67 A;  4DV4 M;  2DAK A;  1D0L A;  4MGZ E;  1HR0 M;  4GIT A;  2LVP C;  5IWA M;  1NNU C;  4L4U A;  1TH2 A;  1PGY A;  4KOD A;  4DR3 M;  3KP1 E;  5KPT A;  1EIJ A;  1R2Z A;  3MMP A;  1IN8 A;  2L4E A;  4NRV A;  3CF0 A;  3K1J A;  3B9P A;  3OTO M;  3U6C A;  1Z5B A;  2R44 A;  3FTF A;  4NOO B;  1EFU B;  5DNY A;  4LF9 M;  4GKJ M;  4GHA A;  2DNA A;  4PT5 A;  4XBO A;  3U6E A;  2UU9 M;  4CGY B;  1I4W A;  2L09 A;  4Y28 F;  4DV5 M;  2APL A;  3PVS A;  4FCV A;  2CE7 A;  5ITX A;  3DA1 A;  2KZS A;  5DFL A;  1MN3 A;  2KEB A;  1ZMV A;  4QHT A;  2F5P A;  3IG5 A;  4IBG A;  1DGH A;  3Q8X A;  4JI4 M;  3SC3 A;  3GRU A;  2AHM A;  5EXT A;  2O01 F;  3SFZ A;  4OU7 A;  4S12 A;  4NC6 A;  2KNA A;  4QOS A;  4MM3 B;  5ITT A;  4F1I A;  1T6O A;  2J5Y A;  4D82 A;  4IBD A;  2R62 A;  3FTC A;  3AV0 A;  4KO8 A;  1SXJ C;  2JZ1 A;  5C18 A;  5EXP A;  1TTE A;  5EP2 A;  3E4R A;  1YUB A;  2RGO A;  3TL4 X;  1WHC A;  5GKN A;  3MJ5 A;  4EIW A;  1HQY E;  3CGW A;  4PDG A;  4IBE A;  1VEK A;  1SXJ E;  1WGL A;  1ZV1 A;  3HGI A;  2RRU A;  3U6S A;  3L25 A;  2L7I A;  1WXQ A;  1IXS B;  2R18 A;  1GJT A;  4FWD A;  1QDR A;  3B74 A;  5JI3 E;  4L78 A;  3L29 A;  3KXE C;  3T1H M;  1LTM A;  1OIP A;  2KHH A;  4GH9 A;  1IN5 A;  4LF6 M;  3KP0 E;  2CWB A;  2R45 A;  3HU2 A;  3K2L A;  3K92 A;  4I81 A;  2VII A;  2DAM A;  1AIP C;  3SBJ A;  2L7H A;  2C5R A;  1ZAE A;  4NXN M;  3U6M A;  4OX9 M;  2L6O A;  4AG5 A;  2CFO A;  3SHF A;  4D80 A;  1VDL A;  4RNA A;  1FNN A;  4LGY A;  3TWK A;  4CIZ A;  2QP9 X;  3LVV A;  4FW9 A;  3FRH A;  4WUR A;  3FE3 A;  4G4Q A;  1OFI A;  2KNV A;  3HHW A;  1QQW A;  4GC5 A;  1QZM A;  1UM8 A;  3U6L A;  2QEN A;  3UMM A;  5ITU A;  4DR7 M;  2C98 A;  4IBB A;  4BBA A;  1WGN A;  2R65 A;  2FS1 A;  3NWL A;  1F4I A;  5E26 A;  4LF7 M;  1R5L A;  1SXJ A;  3DOA A;  5JI2 E;  3GLF B;  3CTW B;  3K9O A;  2CRU A;  2XSZ A;  3E9S A;  3RGS A;  1IQP A;  3AOE C;  2DKL A;  1TH3 A;  3I4V A;  3M6A A;  4W5W A;  1QDT A;  5KQD A;  3J7A S;  2CV1 A;  1NHW C;  2JA2 A;  4JI5 M;  1XXH E;  4G6Z A;  3J27 B;  3GRV A;  1P3Q Q;  2F5Q A;  3VDP A;  2QBY A;  1XMQ M;  3B7Q A;  2A5Y B;  1D2N A;  3TWL A;  1L1Z A;  4XK8 F;  4AKH A;  2Y0Q A;  3PFI A;  2J7O A;  1S3S A;  3H4J A;  4R7G A;  2XZU A;  2F5S A;  4AZF A;  2H1R A;  1KSF X;  3QAU A;  4CIS A;  3KW6 A;  2ZTC A;  2DZN B;  2NQ8 C;  2CHG A;  4B7F A;  3K8Z A;  3SMP A;  3CF6 E;  4G4N A;  2YNM D;  1G3I A;  1WIV A;  2HCB A;  1KFV A;  2UXD M;  3ZH9 B;  2CHQ A;  2K9D A;  4CHT B;  1VQ1 A;  4OVZ A;  4DUZ M;  4AI6 A;  2ZAN A;  3NBX X;  2B3T A;  1OQY A;  3KS4 A;  1QAM A;  4LGM A;  3LVW A;  3VKG A;  2OOB A;  5FTJ A;  1G71 A;  4UN2 B;  1HT2 E;  4DR1 M;  4CJ6 A;  1Z59 A;  4MGH A;  3SAV A;  2F5N A;  2WSC F;  2FOI C;  3U5Z B;  4RKU F;  1XXH A;  4IBI A;  4M9Z A;  2K6B A;  5LMU M;  1SG9 A;  3MK6 A;  2DAI A;  3LCV B;  2LBC A;  4HLQ A;  2GNO A;  2BWB A;  2KA6 B;  3AOE A;  2JUJ A;  2QCU A;  5ITY A;  3W68 A;  3ZC7 B;  4QNM A;  4D81 A;  1GL7 A;  4ANR A;  1FJG M;  2WSF F;  1G8P A;  4GC9 A;  2CV0 A;  2K0B X;  2VQE M;  1PJI A;  2LVO C;  4GMQ A;  3J81 S;  3GRR A;  4B3M M;  1XHB A;  3RE8 A;  4L6V 6;  2EKF A;  5L8R F;  3UJN A;  4NL4 H;  3GPP A;  4GHL A;  1DGF A;  1KYI A;  1XWI A;  4YHH M;  3U6Q A;  4M0W A;  4KLN A;  1L2C A;  2V1C A;  4GEW A;  3JR4 A;  3GPX A;  3AL0 C;  3FUU A;  1NSF A;  4B3T M;  2ZM6 M;  4DR5 M;  3GLI E;  4DR2 M;  3GLI B;  2R4J A;  1C1K A;  5BPV A;  2ERC A;  1XNQ M;  4G4O A;  1HJP A;  1VG5 A;  5EP1 A;  4Q7J A;  4FCW A;  3TWM A;  3KOW E;  2BJW A;  1DO0 A;  2UUC M;  1OFH A;  4LJ8 A;  1HNX M;  4JI8 M;  1E32 A;  3PNV A;  3FD9 A;  1DGB A;  4X66 M;  4RF1 A;  3FUW A;  8CAT A;  4LJA A;  3GLG B;  2DWL A;  2OO9 A;  3SAT A;  1OTR A;  2CP8 A;  1WR1 B;  3QWL A;  3UZU A;  2C96 A;  1OJL A;  1GO5 A;  1OIZ A;  4MB7 A;  4B7G A;  4ITQ A;  4HEO A;  4JN6 A;  1L2D A;  2VQF M;  3W0L B;  5LMN M;  4KT0 F;  2CHV A;  1NVM A;  2OOA A;  3AOG A;  4WW0 A;  5EXS A;  3GLH E;  1JR3 E;  1ORY B;  1ZMU A;  3GLH B;  1N77 A;  1IY2 A;  1MX0 A;  1QZE A;  2C9C A;  3GLI A;  1Z5C A;  2I7P A;  3J2P B;  2XFT A;  1XB2 B;  1D0M A;  2XH9 A;  2FH0 A;  3FTD A;  3LQQ A;  2XLJ A;  4DV1 M;  5H37 D;  3PNY A;  1Y8G A;  1GAB A;  2G3Q A;  2H5X A;  4G3O A;  2VF7 A;  5FTM A;  3V76 A;  1G4A E;  5KO3 A;  1C7Y A;  3T6P A;  1MU5 A;  3U60 B;  2JY8 A;  4JI6 M;  2KRU A;  1W5T A;  5FTN A;  2RKO A;  1K3W A;  2CUZ A;  4KHP M;  1NJF A;  2EA0 A;  3UK6 A;  4QOZ C;  3VLF B;  2DI0 A;  4X65 M;  3GQ4 A;  4K0K M;  4LZJ A;  1QYR A;  2YFQ A;  3M0E A;  2I7N A;  4LF4 M;  2QZ4 A;  1JR3 D;  1N32 M;  4I8O A;  3K9P A;  1CUK A;  1TR8 A;  3QYE A;  5A2Q S;  1OAI A;  4B7H A;  2ZTD A;  1IBL M;  4JV5 M; 
#chains in the Genus database with same CATH homology
 1E9R A;  4FWG A;  1NY6 A;  4B08 A;  4DV3 M;  4IBC A;  4OW0 A;  2G5G X;  4NRW A;  1PM5 A;  2BJV A;  4PDI A;  4B3R M;  1QVR A;  4LFC M;  3DFZ A;  5EP3 A;  2OPF A;  3SHG B;  3TPZ A;  2DVW B;  4BLC A;  4FWH A;  2X49 A;  5DYI A;  4DV2 M;  5KQ8 A;  3RGP A;  2F4V M;  3HKP A;  2HHH M;  3KDS E;  2DXI A;  3VKH A;  1N33 M;  3HHY A;  1IBK M;  1T3T A;  4JI3 M;  1R2Y A;  5EQT A;  2C99 A;  2HL7 A;  3VK7 A;  4MGY E;  1YE9 A;  3KSX A;  4I5S A;  3FUX A;  3AKZ A;  3ILK A;  2QPA A;  3HJQ A;  4LFA M;  2X4A A;  4IJF A;  4AQY M;  1N78 A;  3L28 A;  2DWZ B;  2Z3X A;  3HWS A;  4P16 A;  3R9X B;  3R8F A;  2XZF A;  4LJ7 A;  4LG2 A;  1EE8 A;  1TDZ A;  1X37 A;  2FFJ A;  4MGI E;  1G41 A;  5EJC A;  2LWX A;  2F5O A;  3JAM S;  4REZ A;  2EUC A;  3LQR A;  3ZCB B;  2ZAM A;  3FYC A;  1J5E M;  4DR6 M;  2DHR A;  4LZZ A;  3GPU A;  3GLF A;  1Q3C A;  5BR8 M;  3THG A;  3NBI A;  2UXB M;  4L16 A;  3A45 A;  4AKI A;  4L15 A;  2Y0T A;  4ZPX A;  4PD2 A;  1JQJ C;  5IZ7 D;  2UUB M;  5FTK A;  1HNZ M;  2DZO B;  1XMO M;  2Q2E B;  1K82 A;  4JI0 M;  1IY1 A;  1R7R A;  3U6P A;  1L2B A;  3A98 B;  3L26 A;  2E5L M;  5E6J A;  1IN6 A;  3SAR A;  1QAN A;  2LH0 A;  1IXR C;  2XEP A;  3FKE A;  1PJJ A;  1NY5 A;  5ITX E;  3GP1 A;  2D7H A;  4FVM A;  3U61 B;  4LY6 A;  3VK8 A;  4AG6 A;  3TE6 A;  3WHL A;  3GPY A;  1W5S A;  3IG8 A;  2DWL A;  3J80 S;  1IN4 A;  2O5R A;  3U6O A;  2BNK A;  3FUT A;  1DGH B;  3L27 A;  4LRS A;  2EO2 A;  1LV7 A;  4AW4 A;  2DWM A;  3D8L A;  2LNH C;  4HL4 A;  5FLX S;  2KRK A;  3KOY E;  1IY0 A;  4LF5 M;  1IXZ A;  3DZD A;  3TQS A;  2M60 A;  3PXG A;  2LXE A;  4LCB A;  4A3V B;  4II7 A;  4DV0 M;  2G8L A;  3M7G A;  4PCZ A;  3EIH A;  4IBK A;  2V1U A;  3U5Z A;  3AJI B;  4LJ6 A;  4DUY M;  3W0F A;  3HJS A;  3KSJ A;  1E94 E;  3FTE A;  4Z6Y A;  3J7B A;  5C1B A;  3L2A A;  4M9X A;  1HQC A;  1K3X A;  2UUA M;  3U61 A;  3EIE A;  2XF3 A;  2XGN A;  3LMM A;  3A46 A;  2M5Z A;  4MGK E;  1IM2 A;  3BOS A;  4M0D A;  7CAT A;  1L8Q A;  4R3D A;  1L1T A;  1XNR M;  4GRI A;  1GKI A;  4TUW A;  4FD2 A;  3VFD A;  4M9S A;  2D7E A;  1QAO A;  4IBF A;  3UGJ A;  3I4Y A;  3JR5 A;  3T1Y M;  2HKJ A;  2Z4S A;  5EXX A;  2R46 A;  4JYA M;  1ZQ9 A;  4DV7 M;  2Z7J A;  2DWN A;  2Z4R A;  3GLG A;  3SAW A;  1H6U A;  3HU3 A;  3KVW A;  5FSW A;  5IT9 S;  4LJ9 A;  4IIW A;  3T38 A;  1SXJ B;  4BB9 A;  2J7N A;  4AKG A;  3KS8 A;  3C58 A;  2CEA A;  1GVN A;  2K47 A;  3D8B A;  2KZU A;  3VDU A;  3GQ5 A;  2XFS A;  1XC8 A;  4GKK M;  4LJ5 A;  3SAS A;  3GLH A;  1JR3 A;  4IBJ A;  3WHK A;  3GQ3 A;  4JI2 M;  3T15 A;  2QBY B;  3U6D A;  1HNW M;  3GRY A;  3KOX E;  1GL6 A;  4B3S M;  4FCT A;  3I51 A;  2R4E A;  3U60 A;  1SXJ D;  4MH0 E;  5KPR A;  3KOZ E;  3HU1 A;  2XSZ D;  1GLN A;  3SMS A;  1Z5A A;  3KFU G;  5KPZ A;  4LJ4 A;  3FYD A;  4OVZ B;  4X64 M;  3SYK A;  3RFW A;  1HT1 E;  1N75 A;  4G4R A;  3A42 A;  4LF8 M;  1NNJ A;  1TH4 A;  4XGI A;  1DO2 A;  4I4L A;  4JXJ A;  2YQZ A;  1J09 A;  3HHX A;  4JI7 M;  4JI1 M;  2FE8 A;  5ITR A;  5ITQ A;  4Z8X A;  1IBM M;  1XXH B;  5EP4 A;  2KXE A;  2CV2 A;  2FNA A;  1QAQ A;  2ZAO A;  1Q39 A;  4DV6 M;  4QHS A;  4DR4 M;  2W82 A;  1I94 M;  5F3W A;  4RF0 A;  1DGG A;  5FTL A;  2Y21 A;  4NSR A;  4NSO B;  2Y20 A;  4X62 M;  4GIP A;  1N34 M;  3H4M A;  1IN7 A;  1J7K A;  1YSY A;  4IJE A;  1TDH A;  2YR0 A;  2RGH A;  2ZBK B;  2UXC M;  5DYG A;  1G59 A;  2C9O A;  3SAU A;  1N36 M;  2D7G A;  2V6Z M;  3SYL A;  3MHV C;  4YY3 M;  3AFH A;  3FUV A;  4L8R C;  2KW0 A;  4LRT A;  1NJG A;  2X8A A;  1E9S A;  1VDD A;  5IRE B;  4QNR A;  1NHG C;  1Z6T A;  1Q3B A;  3HJ8 A;  4NXM M;  2P5T A;  1R6B X;  1TGU A;  3CF2 A;  3GO8 A;  2OQ4 A;  3HHZ A;  4DV4 M;  4MGZ E;  1HR0 M;  4GIT A;  5IWA M;  1NNU C;  4L4U A;  1TH2 A;  4KOD A;  4DR3 M;  3KP1 E;  5KPT A;  1R2Z A;  4NRV A;  1IN8 A;  3CF0 A;  3K1J A;  3B9P A;  3OTO M;  3U6C A;  1Z5B A;  3FTF A;  4GKJ M;  4NOO B;  5DNY A;  4LF9 M;  4GHA A;  4PT5 A;  4XBO A;  3U6E A;  2UU9 M;  4CGY B;  1I4W A;  2L09 A;  4DV5 M;  3PVS A;  4FCV A;  2CE7 A;  5ITX A;  3DA1 A;  2KZS A;  2KEB A;  4QHT A;  2F5P A;  3IG5 A;  4IBG A;  1DGH A;  3Q8X A;  4JI4 M;  3SC3 A;  3GRU A;  2AHM A;  5EXT A;  3SFZ A;  4OU7 A;  4S12 A;  4QOS A;  4MM3 B;  5ITT A;  4D82 A;  4IBD A;  2R62 A;  3FTC A;  3AV0 A;  4KO8 A;  1SXJ C;  5C18 A;  5EXP A;  5EP2 A;  3E4R A;  1YUB A;  2RGO A;  3TL4 X;  5GKN A;  4EIW A;  3MJ5 A;  1HQY E;  4PDG A;  4IBE A;  1SXJ E;  3HGI A;  3U6S A;  3L25 A;  2L7I A;  1WXQ A;  1IXS B;  2R18 A;  4FWD A;  5JI3 E;  4L78 A;  3L29 A;  3KXE C;  3T1H M;  4GH9 A;  1IN5 A;  4LF6 M;  3KP0 E;  2R45 A;  3HU2 A;  3K2L A;  3K92 A;  4I81 A;  2VII A;  3SBJ A;  2C5R A;  2L7H A;  1ZAE A;  4NXN M;  3U6M A;  4OX9 M;  2L6O A;  4AG5 A;  2CFO A;  3SHF A;  4D80 A;  4RNA A;  1FNN A;  4LGY A;  3TWK A;  2QP9 X;  3LVV A;  4FW9 A;  4WUR A;  4G4Q A;  1OFI A;  3HHW A;  1QQW A;  4GC5 A;  1QZM A;  1UM8 A;  3U6L A;  2QEN A;  3UMM A;  5ITU A;  4DR7 M;  2C98 A;  4IBB A;  4BBA A;  2R65 A;  3NWL A;  5E26 A;  4LF7 M;  1SXJ A;  3DOA A;  5JI2 E;  3GLF B;  3CTW B;  3RGS A;  2XSZ A;  3E9S A;  1IQP A;  3AOE C;  1TH3 A;  3I4V A;  3M6A A;  4W5W A;  5KQD A;  3J7A S;  2CV1 A;  1NHW C;  2JA2 A;  4JI5 M;  4G6Z A;  3J27 B;  3GRV A;  2F5Q A;  3VDP A;  2QBY A;  1XMQ M;  2A5Y B;  1D2N A;  3TWL A;  1L1Z A;  4AKH A;  2Y0Q A;  3PFI A;  2J7O A;  1S3S A;  2XZU A;  4R7G A;  2F5S A;  4CIS A;  4AZF A;  2H1R A;  1KSF X;  3QAU A;  3KW6 A;  2DZN B;  2NQ8 C;  2CHG A;  4B7F A;  3K8Z A;  3SMP A;  3CF6 E;  4G4N A;  2YNM D;  1G3I A;  2HCB A;  1KFV A;  2UXD M;  3ZH9 B;  2CHQ A;  4CHT B;  4OVZ A;  4DUZ M;  4AI6 A;  2ZAN A;  3KS4 A;  1QAM A;  4LGM A;  3LVW A;  3VKG A;  5FTJ A;  1HT2 E;  4DR1 M;  1Z59 A;  4MGH A;  3SAV A;  2F5N A;  2FOI C;  3U5Z B;  1XXH A;  4IBI A;  4M9Z A;  5LMU M;  3MK6 A;  4HLQ A;  5ITY A;  2KA6 B;  3ZC7 B;  3AOE A;  2QCU A;  4QNM A;  4D81 A;  1GL7 A;  1FJG M;  4GC9 A;  1G8P A;  2CV0 A;  2VQE M;  1PJI A;  4GMQ A;  3J81 S;  3GRR A;  4B3M M;  1XHB A;  3RE8 A;  3UJN A;  4NL4 H;  3GPP A;  4GHL A;  1DGF A;  1KYI A;  1XWI A;  4YHH M;  3U6Q A;  4M0W A;  4KLN A;  1L2C A;  2V1C A;  3JR4 A;  3AL0 C;  3GPX A;  3FUU A;  1NSF A;  4B3T M;  2ZM6 M;  4DR5 M;  4DR2 M;  3GLI B;  2R4J A;  1C1K A;  5BPV A;  2ERC A;  1XNQ M;  4G4O A;  5EP1 A;  3TWM A;  4FCW A;  3KOW E;  2BJW A;  1DO0 A;  2UUC M;  1OFH A;  4LJ8 A;  1HNX M;  4JI8 M;  1E32 A;  3PNV A;  3FD9 A;  1DGB A;  4X66 M;  4RF1 A;  3FUW A;  8CAT A;  4LJA A;  3GLG B;  3SAT A;  3QWL A;  3UZU A;  2C96 A;  1OJL A;  4MB7 A;  4B7G A;  4ITQ A;  1L2D A;  4JN6 A;  2VQF M;  3W0L B;  5LMN M;  2CHV A;  1NVM A;  3AOG A;  4WW0 A;  5EXS A;  1ORY B;  3GLH B;  1N77 A;  1IY2 A;  1MX0 A;  2C9C A;  4LFB M;  3GLI A;  1Z5C A;  2I7P A;  3J2P B;  2XFT A;  2XH9 A;  3LQQ A;  3FTD A;  4DV1 M;  2XLJ A;  5H37 D;  3PNY A;  5FTM A;  1G4A E;  5KO3 A;  1MU5 A;  3U60 B;  4JI6 M;  2KRU A;  1W5T A;  5FTN A;  2RKO A;  1K3W A;  2CUZ A;  4KHP M;  1NJF A;  2EA0 A;  3UK6 A;  4QOZ C;  3VLF B;  4X65 M;  3GQ4 A;  4K0K M;  4LZJ A;  1QYR A;  2YFQ A;  3M0E A;  2I7N A;  4LF4 M;  2QZ4 A;  1JR3 D;  1N32 M;  4I8O A;  5A2Q S;  4B7H A;  1IBL M;  4JV5 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...