2KZUA

Daxx helical bundle (dhb) domain / rassf1c complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
94
structure length
94
Chain Sequence
GSHMGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of the DAXX N-Terminal Helical Bundle Domain and Its Complex with Rassf1C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Death-associated protein 6
total genus 31
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2010-06-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.810 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2kzuA00
2KZUA 2KZSA
chains in the Genus database with same CATH superfamily
1XB2B 3GO8A 3WHLA 4AG6A 3HY5A 2CHQA 4FWGA 4IBEA 3SHGB 1OKSA 1SXJD 4NC6A 4JI0M 1L2DA 3C3EA 2D7HA 4G6ZA 4IBBA 1E32A 4LJ6A 4LFBM 3EIEA 5C18A 4ITQA 5FTNA 1TGUA 3GQ3A 5ITXA 4GRIA 2KA6B 1N32M 2MGWA 1IQPA 3H4JA 3HU2A 1NNUC 3SFZA 4M9XA 1IN8A 2XFSA 2D7EA 4B3MM 1HT1E 1VEJA 1LV7A 4MM3B 3ZQJA 4AQYM 1KFVA 7CATA 1AUAA 1DGHA 1W5SA 4ANRA 2M60A 2ZTCA 3B89A 2LHGA 3J27B 2MROB 5LMNM 1XMOM 3SATA 4PT5A 1JB0F 1NY6A 3J7BA 5ITYA 4LCBA 4RF0A 1IBMM 3I04M 2QENA 2E5LM 1OTRA 1X37A 4JI7M 2JY7A 3A98B 2C99A 1N77A 4QOZC 1NHWC 3U5ZB 3SBJA 3W0LB 3TPZA 3AJIB 4NRWA 3K92A 3B7ZA 1PJJA 3IECA 4QHSA 1G59A 3E4RA 3QWLA 2LBCA 1Z5BA 4L8RC 2FOIC 2XSZD 3UZUA 2OPFA 3IHPA 2WSCF 4QOSA 3GRUA 4MGZE 1J5EM 2LHCA 3T15A 2XLJA 2KZSA 2ZAOA 1Q39A 3FKEA 1PJIA 2KNZA 2L7HA 1QDRA 4L15A 4JXJA 2UXDM 1OAOC 2W82A 2JXNA 2RRUA 2V6ZM 3KOWE 3GLGB 4FVMA 2CV1A 2KXEA 2BNKA 1GJSA 2R62A 1TDZA 1IXRC 3WHKA 2NQ8C 5EP1A 2FE8A 3SAVA 4REZA 2BJWA 2L4FA 1IY0A 2DHYA 3NWLA 4GMQA 1Z5AA 1TH3A 5FSWA 4DV7M 4Z6YA 4KHPM 5ITTA 4G4RA 1BVSA 2HAKA 3JR5A 3SAUA 4JN6A 3CF2A 3PXGA 8CATA 1F4IA 2FNAA 4JI5M 3LCUA 3FUWA 4KT0F 4KO8A 4CISA 2XEPA 3KS4A 1CUKA 4L4UA 1C7YA 4M0DA 2R65A 3FRHA 5C1BA 1ZAEA 1MU5A 4OU7A 3FTFA 4LJAA 2KRUA 2LVOC 3KOZE 3RGSA 1K3XA 3SYKA 4BBAA 1IY2A 1NO1A 2UU9M 1JR3D 3HHXA 2CV2A 1SXJA 3R9XB 1OAIA 3OTOM 3I51A 3B74A 3W68A 1N75A 1QANA 1R5LA 2YFQA 2WZJA 3HHZA 4B3SM 2ZANA 5FTMA 1C1KA 1GVNA 4LJ9A 2HWJA 3GLGE 2XH9A 2LVAA 1WGNA 1D0LA 1QUSA 3C58A 3UGJA 1DGBA 1QVRA 1IXZA 1SG9A 3UMMA 3NBXX 3U6QA 2F5QA 4JI4M 1XNQM 2Z3XA 3J80S 3U6LA 2KDLA 5FTJA 1VEKA 1QQWA 2BJVA 1L2BA 2DAMA 5FTLA 1GLNA 3MHVC 1L1ZA 1YSYA 4NRVA 2J7NA 1DGGA 1OQYA 4HLQA 3KOYE 2R44A 3U60A 2KEBA 3GLFE 2K9DA 3B7QA 4LG2A 3IG8A 1Z59A 4ZPXA 3U6SA 3U6OA 3CGWA 2DI0A 3NBIA 4Q7JA 5GKNA 1D0MA 4L6V6 4LF8M 4DV0M 1IBLM 1MN3A 4B08A 4LF5M 1KSFX 1E94E 3PVSA 3JR4A 1OIZA 2L09A 2XF3A 2Q2EB 4WW0A 5FLXS 3R8FA 4DR4M 2OOBA 1XXHB 4M9SA 2DNAA 4S12A 1R2YA 3GLIE 1K3WA 4XK8F 1QAMA 1OIPA 2GNOA 1QZEA 3SHFA 4GKJM 4PD2A 1IN4A 2MR9A 4X66M 3VKGA 4NSOB 2LWXA 4AKHA 4GEWA 2ZBKB 1JR3A 3SMSA 2JWSA 3VK8A 2D7GA 2L2DA 2R45A 2XGNA 1K82A 2CV0A 2CFOA 2KHHA 1NHGC 4DR2M 1UM8A 3AL0C 2UUAM 3TWKA 1HR0M 3V76A 2C9CA 3GLFB 1J09A 4PCZA 3AOEA 4IIWA 1WGLA 3L27A 4D81A 4DV6M 1PGYA 1DGHB 3HJSA 2Z4SA 3LVVA 3QYEA 2QBYA 4LF7M 2HHHM 4OX9M 1XNRM 1WIVA 1JQJC 4GC5A 5BPVA 4DR5M 3KS8A 2HCBA 1L2CA 2GQFA 2CE7A 4YY3M 1N78A 2R18A 1LTMA 1T6OA 3FD9A 2L6OA 4QNRA 2F4VM 3U6DA 1NJFA 2BWEA 4GHAA 4G4QA 3TE6A 2G3QA 2KNVA 3K9OA 4QNMA 1PM5A 2JP7A 4NXMM 1G3IA 2KRKA 4FD2A 4AKGA 3D8BA 4MGIE 3DZDA 2YQZA 1T43A 5JI2E 1G4AE 2JY5A 3FRIA 1NSFA 5JI3E 1QAQA 5DYGA 3VLFB 4G4OA 3GQ4A 1PJTA 1N34M 3TL4X 5DNYA 3SYLA 1HJPA 3PNYA 1FJGM 2DVWB 2APLA 3L2AA 5KO3A 2WSFF 4QHTA 3K8ZA 2LXEA 3VKHA 4B3RM 1GKIA 3LQQA 4DR3M 4LZJA 2BWBA 3A45A 1R7RA 5EP2A 1HNXM 2JY6B 2UXBM 2VQEM 3LW5F 5EP4A 2V1UA 5IWAM 4RF1A 3D8LA 2V1CA 2EUCA 2VDBB 1FNNA 2DXIA 3AFHA 3KFUG 4B3TM 1WJ7A 4NSRA 1TH4A 4GH9A 1RU3A 1TTEA 2H1RA 4D82A 1ZV1A 2VQFM 4BLCA 4MGKE 3KOXE 1S3SA 4IJFA 4FW9A 2A5YB 1VDDA 4XGIA 3GP1A 3A46A 4TUWA 4AG5A 1PJQA 3FYDA 3TWMA 4JYAM 5E6JA 2QSFX 2X4AA 4LY6A 3VDUA 1ORYB 3VDPA 3U6CA 5L8RF 2LVQD 4LGYA 1AIPC 3E46A 4IBIA 4Z8XA 1HQYE 3HU3A 1Y8GA 2DWZB 4G3OA 3I01M 2B3TA 1J7KA 3SARA 1TF0B 4PDIA 3KXEC 2JA2A 2OOAA 2AHMA 3GLHE 3M0EA 4A3VB 5ITQA 1IN5A 3KDSE 2EA0A 2DKLA 4NOOB 3LQRA 4DR1M 2YNMD 3FUUA 2Y0QA 4B7GA 4JV5M 4M9ZA 4NXNM 2VIIA 4LF4M 2OQ4A 1L8QA 1QZMA 5IREB 1PRBA 3T6PA 3Q8XA 3AKZA 5ITRA 4MH0E 3FTCA 2FH0A 4JI6M 2DENA 3W67A 2CHGA 1DO2A 2DZLA 3AV0A 3LCVB 5EXTA 3FYCA 1SXJE 2XSZA 2MJ5B 4LF9M 4DR6M 3LVWA 1VQ1A 3VFDA 3U61A 3GPUA 4LFAM 4AW4A 1DGFA 2VF8A 4RNAA 3HJQA 2DWMA 3E21A 4LRTA 5A2QS 3MK6A 1E9SA 2DAIA 3TQSA 2KZUA 1XXHA 4OVZB 1OJLA 3ZH9B 4CIZA 3L26A 1NJGA 3THGA 1IFYA 1V33A 2R46A 3U6EA 2G5GX 3ZC7B 2R6FA 1XWIA 1IN7A 2QCUA 2Z7JA 4XBOA 5H37D 2QP9X 3CF0A 1VG5A 5E26A 4M0WA 1DV0A 4LJ7A 1HNWM 4L78A 2DAGA 2G8LA 1WHCA 3E9SA 3SAWA 4X65M 2F5OA 4JI2M 2C9OA 3HWSA 5ITUA 4UN2B 4FCTA 1VEGA 4YHHM 4IBJA 5ITXE 1UFZA 4R71A 2L4EA 3DFZA 1IBKM 2LVNC 2K0BX 3U6MA 1JR3E 4F1IA 1G8PA 3PFIA 4DV3M 1R4GA 3C9PA 4AI6A 3RFWA 2C96A 2O25A 1QDTA 1IY1A 4I4LA 4DV2M 3GLIA 5KPRA 5LMUM 5KQ8A 3F92A 2J7OA 3K1JA 1XHBA 2LNHC 3VK7A 2R4JA 3UJNA 1T3TA 2CP8A 2L7IA 1G41A 3HHWA 2Z4RA 3KSJA 4OVZA 3GRYA 3PNVA 4LJ5A 3Q8GA 4LRSA 2UUCM 2DWLA 4IBFA 3H4MA 2I7NA 3FE3A 2RGOA 4DR7M 2OO9A 3GRVA 2KW0A 1HNZM 1IXSA 2ZAMA 4MGHA 2WSEF 2UUBM 2JY8A 3SASA 1EE8A 3AOGA 3B9PA 2EO2A 3GPPA 3RGPA 1NVMA 3T1HM 4EIWA 3KSXA 3HHYA 3LMMA 1Z6TA 3HU1A 2F5PA 3IG5A 1VDLA 1V34A 5KPTA 5DFLA 4GHLA 4RKUF 4I5SA 4GC9A 3AOEC 2QZ4A 1XC8A 2CRUA 3KP0E 1NV9A 3HZJA 4LGMA 1R6BX 3GLFA 3GLGA 5KQDA 1GJTA 4LJ4A 2RKOA 3CTWB 2ZTDA 2N35A 4WURA 1QAOA 2R0IA 1IN6A 1SXJC 1WR1B 4JI8M 4FWDA 2JNHA 4B7HA 3FUTA 3BOSA 3QYBA 3FTEA 3ZCBB 2X8AA 4GITA 2DZOB 2RGHA 2Y0TA 4CHTB 3GPXA 2JUJA 2ZM6M 3J81S 4DUZM 3BBZA 1I4WA 2EKFA 1QYRA 2FFJA 2HKJA 4CGYB 5KPZA 1R2ZA 3QAUA 5EQTA 1Q3BA 3TWLA 1IXSB 2Y20A 2CWBA 2MH8A 2LH0A 3U5ZA 4F2LA 4GKKM 5IT9S 1MJGM 3KVWA 4LJ8A 5DYIA 1Q3CA 3L28A 2CHVA 2C98A 4NL4H 3KP1E 1ZMVA 3L29A 1D2NA 1KYIA 3M7GA 1GL6A 3K2LA 1IM2A 3MMPA 1HT2E 2K6BA 2KNAA 2ERCA 2DZNB 3I4YA 4HEOA 3B7NA 5BR8M 2JZ1A 2FS1A 4IJEA 4BB9A 2DAEA 4GIPA 4JI1M 4JI3M 3MJ5A 2DWNA 3CF6E 3T38A 3SC3A 3SMPA 3DOAA 1NV8A 1PJSA 5EXSA 3L25A 3K9PA 4P17A 3GPYA 1H6UA 2EKKA 3M6AA 3J2PB 1NY5A 2XFTA 3FUXA 4G4NA 1N36M 4HL4A 3FUVA 3HX3A 1NNJA 4DV4M 2QHOB 2LVPC 1YLAA 3C3DA 3GQ5A 3GLHB 4R7GA 3HGIA 3U60B 2J5YA 2CEAA 2HL7A 3I4VA 4AKIA 1OFIA 2JZ0A 4DUYM 3EIHA 4X62M 5IZ7D 5EJCA 2K47A 3GRRA 2F5SA 1N33M 1D0KA 2H5XA 4WP2A 2LTUA 2M5ZA 2X49A 3A42A 3FTDA 1TH2A 5EXXA 4R3DA 3UK6A 2C5RA 1TR8A 3DA1A 1MX0A 4KLNA 4FWHA 3J7AS 3ILKA 3RE8A 2EJSA 2YR0A 2Z8YM 1A5TA 4DV5M 2I7PA 3BXWA 1SXJB 4FCWA 2DHRA 1Q02A 1WXQA 4D80A 3KW6A 4IBKA 4DV1M 3U6PA 4IBCA 4AZFA 1Z5CA 2O5RA 4Y28F 1ZMUA 1ZMWA 1W5TA 2QPAA 1GABA 2Y21A 2XZUA 4FCVA 2UXCM 4X64M 5EP3A 5EXPA 1YE9A 4W5WA 3GLHA 1E9RA 5F3WA 4PDGA 1ZQ9A 2XZFA 1DO0A 1XXHE 2QQ8A 4LF6M 4LFCM 2O01F 2R4EA 4OW0A 4L16A 4MB7A 3JAMS 3GLIB 4I8OA 1HQCA 2QBYB 2CUZA 1OFHA 3U61B 1V92A 2QNJA 4IBDA 1EFUB 5FTKA 4P16A 2F5NA 4CJ6A 1YUBA 1EIJA 4KODA 4LZZA 3HJ8A 1P3QQ 4I81A 1GO5A 3W0FA 1G71A 4MGYE 1L1TA 2DAKA 2VF7A 4IBGA 1I94M 1GL7A 4K0KM 1QUTA 2P5TA 3HKPA 4B7FA 4DBGB 3T1YM 4II7A 1TDHA 1XMQM
chains in the Genus database with same CATH topology
3GO8A 3WHLA 4AG6A 2CHQA 4FWGA 4IBEA 3SHGB 1SXJD 4JI0M 1L2DA 4G6ZA 2D7HA 4IBBA 1E32A 4LJ6A 4LFBM 3EIEA 5C18A 4ITQA 5FTNA 1TGUA 3GQ3A 5ITXA 4GRIA 2KA6B 1N32M 1IQPA 3HU2A 1NNUC 3SFZA 4M9XA 1IN8A 2XFSA 2D7EA 4B3MM 1HT1E 1LV7A 4MM3B 4AQYM 1KFVA 7CATA 1DGHA 1W5SA 2M60A 3J27B 5LMNM 1XMOM 3SATA 4PT5A 1NY6A 3J7BA 5ITYA 4LCBA 4RF0A 1IBMM 2QENA 2E5LM 4JI7M 1X37A 3A98B 2C99A 1N77A 4QOZC 1NHWC 3U5ZB 3SBJA 3W0LB 3TPZA 3AJIB 4NRWA 3K92A 1PJJA 4QHSA 1G59A 3E4RA 3QWLA 1Z5BA 4L8RC 2FOIC 2XSZD 3UZUA 2OPFA 4QOSA 3GRUA 4MGZE 1J5EM 3T15A 2XLJA 2KZSA 2ZAOA 1Q39A 3FKEA 1PJIA 2L7HA 4L15A 2UXDM 4JXJA 2W82A 2V6ZM 3KOWE 3GLGB 4FVMA 2CV1A 2KXEA 2BNKA 2R62A 1TDZA 1IXRC 3WHKA 2NQ8C 5EP1A 2FE8A 3SAVA 4REZA 2BJWA 1IY0A 3NWLA 4GMQA 1Z5AA 1TH3A 5FSWA 4DV7M 4Z6YA 4KHPM 5ITTA 4G4RA 3SAUA 3JR5A 4JN6A 3CF2A 3PXGA 8CATA 2FNAA 4JI5M 3FUWA 4KO8A 4CISA 2XEPA 3KS4A 4L4UA 4M0DA 2R65A 5C1BA 1ZAEA 1MU5A 4OU7A 3FTFA 4LJAA 2KRUA 1K3XA 3KOZE 3RGSA 3SYKA 4BBAA 1IY2A 2UU9M 1JR3D 3HHXA 2CV2A 1SXJA 3R9XB 3OTOM 3I51A 1QANA 1N75A 2YFQA 3HHZA 4B3SM 2ZANA 5FTMA 1C1KA 1GVNA 4LJ9A 2XH9A 3C58A 3UGJA 1DGBA 1QVRA 1IXZA 3U6QA 3UMMA 4JI4M 2F5QA 1XNQM 2Z3XA 3J80S 3U6LA 5FTJA 1QQWA 2BJVA 1L2BA 5FTLA 1GLNA 3MHVC 1L1ZA 1YSYA 4NRVA 2J7NA 1DGGA 4HLQA 3KOYE 3U60A 2KEBA 4LG2A 3IG8A 1Z59A 4ZPXA 3U6SA 3U6OA 3NBIA 5GKNA 4LF8M 4DV0M 1IBLM 4B08A 4LF5M 1KSFX 1E94E 3PVSA 3JR4A 2L09A 2XF3A 2Q2EB 4WW0A 5FLXS 3R8FA 4DR4M 1XXHB 4M9SA 4S12A 1R2YA 1K3WA 1QAMA 3SHFA 4GKJM 4PD2A 1IN4A 4X66M 3VKGA 4NSOB 2LWXA 4AKHA 2ZBKB 1JR3A 3SMSA 3VK8A 2D7GA 2R45A 2XGNA 1K82A 2CFOA 1NHGC 4DR2M 1UM8A 3AL0C 2UUAM 3TWKA 1HR0M 2C9CA 3GLFB 1J09A 4PCZA 3AOEA 4IIWA 4D81A 3L27A 4DV6M 1DGHB 3HJSA 2Z4SA 3LVVA 2QBYA 4LF7M 2HHHM 4OX9M 1XNRM 4GC5A 1JQJC 5BPVA 4DR5M 3KS8A 2HCBA 1L2CA 2CE7A 4YY3M 1N78A 2R18A 3FD9A 2L6OA 4QNRA 2F4VM 3U6DA 1NJFA 4GHAA 4G4QA 3TE6A 1PM5A 4QNMA 4NXMM 4FD2A 1G3IA 2KRKA 4AKGA 3D8BA 4MGIE 3DZDA 2YQZA 5JI2E 1G4AE 1NSFA 5JI3E 1QAQA 5DYGA 3VLFB 4G4OA 3GQ4A 1N34M 3TL4X 5DNYA 3SYLA 1FJGM 3PNYA 2DVWB 3L2AA 5KO3A 4QHTA 3K8ZA 2LXEA 3VKHA 4B3RM 1GKIA 3LQQA 4DR3M 4LZJA 3A45A 1R7RA 5EP2A 1HNXM 2UXBM 2VQEM 5EP4A 2V1UA 5IWAM 4RF1A 3D8LA 2V1CA 2EUCA 2DXIA 1FNNA 3AFHA 3KFUG 4B3TM 4NSRA 1TH4A 4GH9A 2H1RA 4D82A 2VQFM 4BLCA 4MGKE 3KOXE 1S3SA 4IJFA 4FW9A 2A5YB 1VDDA 4XGIA 3GP1A 3A46A 4TUWA 4AG5A 3FYDA 3TWMA 4JYAM 5E6JA 2X4AA 4LY6A 3VDUA 1ORYB 3VDPA 3U6CA 4LGYA 4IBIA 4Z8XA 3HU3A 1HQYE 2DWZB 1J7KA 3SARA 4PDIA 3KXEC 2JA2A 2AHMA 3M0EA 4A3VB 5ITQA 1IN5A 3KDSE 2EA0A 4NOOB 3LQRA 4DR1M 2YNMD 3FUUA 2Y0QA 4B7GA 4JV5M 4M9ZA 4NXNM 2VIIA 4LF4M 2OQ4A 1L8QA 1QZMA 5IREB 3Q8XA 3AKZA 5ITRA 4MH0E 3FTCA 4JI6M 2CHGA 1DO2A 3AV0A 5EXTA 3FYCA 1SXJE 2XSZA 4LF9M 4DR6M 3LVWA 3VFDA 3U61A 3GPUA 4LFAM 4AW4A 1DGFA 4RNAA 3HJQA 2DWMA 4LRTA 5A2QS 3MK6A 1E9SA 3TQSA 2KZUA 1XXHA 4OVZB 1OJLA 3ZH9B 3L26A 1NJGA 3THGA 2R46A 3U6EA 2G5GX 3ZC7B 1XWIA 1IN7A 2QCUA 2Z7JA 4XBOA 5H37D 2QP9X 3CF0A 5E26A 4M0WA 4LJ7A 1HNWM 4L78A 2G8LA 3E9SA 3SAWA 4X65M 2F5OA 4JI2M 2C9OA 3HWSA 5ITUA 4FCTA 4YHHM 4IBJA 5ITXE 1IBKM 3DFZA 3U6MA 4DV3M 4AI6A 1G8PA 3PFIA 3RFWA 2C96A 1IY1A 4I4LA 4DV2M 3GLIA 5KPRA 5LMUM 5KQ8A 2J7OA 3K1JA 1XHBA 2LNHC 3VK7A 2R4JA 3UJNA 1T3TA 2L7IA 1G41A 3HHWA 2Z4RA 3KSJA 4OVZA 3GRYA 3PNVA 4LJ5A 4LRSA 2UUCM 2DWLA 4IBFA 3H4MA 2I7NA 2RGOA 4DR7M 3GRVA 2KW0A 1HNZM 2ZAMA 4MGHA 2UUBM 3SASA 1EE8A 3AOGA 3B9PA 2EO2A 3GPPA 3RGPA 1NVMA 3T1HM 4EIWA 3KSXA 3HHYA 3LMMA 1Z6TA 3HU1A 2F5PA 3IG5A 5KPTA 4GHLA 4I5SA 4GC9A 3AOEC 2QZ4A 1XC8A 3KP0E 4LGMA 3GLFA 3GLGA 1R6BX 5KQDA 4LJ4A 2RKOA 3CTWB 4WURA 1QAOA 1IN6A 1SXJC 4JI8M 4FWDA 4B7HA 3FUTA 3BOSA 3FTEA 3ZCBB 2X8AA 4GITA 2DZOB 2RGHA 2Y0TA 4CHTB 3GPXA 2ZM6M 3J81S 4DUZM 2CV0A 1I4WA 1R2ZA 1QYRA 2FFJA 2HKJA 4CGYB 5KPZA 3QAUA 5EQTA 1Q3BA 3TWLA 1IXSB 2Y20A 3U5ZA 2LH0A 4GKKM 5IT9S 3KVWA 4LJ8A 5DYIA 1Q3CA 3L28A 2CHVA 2C98A 4NL4H 3KP1E 3L29A 1D2NA 1KYIA 3M7GA 1GL6A 3K2LA 1IM2A 1HT2E 2ERCA 2DZNB 3I4YA 5BR8M 4IJEA 4BB9A 4GIPA 4JI1M 4JI3M 3MJ5A 2DWNA 3CF6E 3T38A 3SC3A 3SMPA 3DOAA 5EXSA 3L25A 3GPYA 1H6UA 3M6AA 4G4NA 3J2PB 1NY5A 2XFTA 3FUXA 1N36M 4HL4A 3FUVA 1NNJA 4DV4M 3GQ5A 3GLHB 4R7GA 3HGIA 3U60B 3I4VA 2CEAA 2HL7A 4AKIA 1OFIA 4DUYM 3EIHA 4X62M 5IZ7D 5EJCA 2K47A 3GRRA 2F5SA 1N33M 2C5RA 2M5ZA 2X49A 3A42A 3FTDA 1TH2A 5EXXA 4R3DA 3UK6A 3DA1A 1MX0A 4KLNA 4FWHA 3J7AS 3ILKA 3RE8A 2YR0A 4DV5M 2I7PA 1SXJB 4FCWA 2DHRA 1WXQA 4D80A 3KW6A 4IBKA 4DV1M 3U6PA 4IBCA 4AZFA 1Z5CA 2O5RA 1W5TA 2QPAA 2Y21A 2XZUA 4FCVA 2UXCM 4X64M 5EP3A 5EXPA 1YE9A 4W5WA 3GLHA 1E9RA 5F3WA 4PDGA 1ZQ9A 2XZFA 1DO0A 4LF6M 4LFCM 2R4EA 4OW0A 4L16A 4MB7A 3JAMS 3GLIB 4I8OA 1HQCA 2QBYB 2CUZA 1OFHA 3U61B 4IBDA 5FTKA 4P16A 2F5NA 1YUBA 4KODA 4LZZA 3HJ8A 4I81A 3W0FA 4MGYE 1L1TA 4IBGA 1I94M 1GL7A 4K0KM 2P5TA 3HKPA 4B7FA 3T1YM 4II7A 1TDHA 1XMQM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZU A;  2KZS A; 
#chains in the Genus database with same CATH topology
 1XB2 B;  3GO8 A;  3WHL A;  4AG6 A;  3HY5 A;  2CHQ A;  4FWG A;  4IBE A;  3SHG B;  1OKS A;  1SXJ D;  4NC6 A;  4JI0 M;  1L2D A;  3C3E A;  2D7H A;  4G6Z A;  4IBB A;  1E32 A;  4LJ6 A;  4LFB M;  3EIE A;  5C18 A;  4ITQ A;  5FTN A;  1TGU A;  3GQ3 A;  5ITX A;  4GRI A;  2KA6 B;  1N32 M;  2MGW A;  1IQP A;  3H4J A;  3HU2 A;  1NNU C;  3SFZ A;  4M9X A;  1IN8 A;  2XFS A;  2D7E A;  4B3M M;  1HT1 E;  1VEJ A;  1LV7 A;  4MM3 B;  3ZQJ A;  4AQY M;  1KFV A;  7CAT A;  1AUA A;  1DGH A;  1W5S A;  4ANR A;  2M60 A;  2ZTC A;  3B89 A;  2LHG A;  3J27 B;  2MRO B;  5LMN M;  1XMO M;  3SAT A;  4PT5 A;  1JB0 F;  1NY6 A;  3J7B A;  5ITY A;  4LCB A;  4RF0 A;  1IBM M;  3I04 M;  2QEN A;  2E5L M;  1OTR A;  1X37 A;  4JI7 M;  2JY7 A;  3A98 B;  2C99 A;  1N77 A;  4QOZ C;  1NHW C;  3U5Z B;  3SBJ A;  3W0L B;  3TPZ A;  3AJI B;  4NRW A;  3K92 A;  3B7Z A;  1PJJ A;  3IEC A;  4QHS A;  1G59 A;  3E4R A;  3QWL A;  2LBC A;  1Z5B A;  4L8R C;  2FOI C;  2XSZ D;  3UZU A;  2OPF A;  3IHP A;  2WSC F;  4QOS A;  3GRU A;  4MGZ E;  1J5E M;  2LHC A;  3T15 A;  2XLJ A;  2KZS A;  2ZAO A;  1Q39 A;  3FKE A;  1PJI A;  2KNZ A;  2L7H A;  1QDR A;  4L15 A;  4JXJ A;  2UXD M;  1OAO C;  2W82 A;  2JXN A;  2RRU A;  2V6Z M;  3KOW E;  3GLG B;  4FVM A;  2CV1 A;  2KXE A;  2BNK A;  1GJS A;  2R62 A;  1TDZ A;  1IXR C;  3WHK A;  2NQ8 C;  5EP1 A;  2FE8 A;  3SAV A;  4REZ A;  2BJW A;  2L4F A;  1IY0 A;  2DHY A;  3NWL A;  4GMQ A;  1Z5A A;  1TH3 A;  5FSW A;  4DV7 M;  4Z6Y A;  4KHP M;  5ITT A;  4G4R A;  1BVS A;  2HAK A;  3JR5 A;  3SAU A;  4JN6 A;  3CF2 A;  3PXG A;  8CAT A;  1F4I A;  2FNA A;  4JI5 M;  3LCU A;  3FUW A;  4KT0 F;  4KO8 A;  4CIS A;  2XEP A;  3KS4 A;  1CUK A;  4L4U A;  1C7Y A;  4M0D A;  2R65 A;  3FRH A;  5C1B A;  1ZAE A;  1MU5 A;  4OU7 A;  3FTF A;  4LJA A;  2KRU A;  2LVO C;  3KOZ E;  3RGS A;  1K3X A;  3SYK A;  4BBA A;  1IY2 A;  1NO1 A;  2UU9 M;  1JR3 D;  3HHX A;  2CV2 A;  1SXJ A;  3R9X B;  1OAI A;  3OTO M;  3I51 A;  3B74 A;  3W68 A;  1N75 A;  1QAN A;  1R5L A;  2YFQ A;  2WZJ A;  3HHZ A;  4B3S M;  2ZAN A;  5FTM A;  1C1K A;  1GVN A;  4LJ9 A;  2HWJ A;  3GLG E;  2XH9 A;  2LVA A;  1WGN A;  1D0L A;  1QUS A;  3C58 A;  3UGJ A;  1DGB A;  1QVR A;  1IXZ A;  1SG9 A;  3UMM A;  3NBX X;  3U6Q A;  2F5Q A;  4JI4 M;  1XNQ M;  2Z3X A;  3J80 S;  3U6L A;  2KDL A;  5FTJ A;  1VEK A;  1QQW A;  2BJV A;  1L2B A;  2DAM A;  5FTL A;  1GLN A;  3MHV C;  1L1Z A;  1YSY A;  4NRV A;  2J7N A;  1DGG A;  1OQY A;  4HLQ A;  3KOY E;  2R44 A;  3U60 A;  2KEB A;  3GLF E;  2K9D A;  3B7Q A;  4LG2 A;  3IG8 A;  1Z59 A;  4ZPX A;  3U6S A;  3U6O A;  3CGW A;  2DI0 A;  3NBI A;  4Q7J A;  5GKN A;  1D0M A;  4L6V 6;  4LF8 M;  4DV0 M;  1IBL M;  1MN3 A;  4B08 A;  4LF5 M;  1KSF X;  1E94 E;  3PVS A;  3JR4 A;  1OIZ A;  2L09 A;  2XF3 A;  2Q2E B;  4WW0 A;  5FLX S;  3R8F A;  4DR4 M;  2OOB A;  1XXH B;  4M9S A;  2DNA A;  4S12 A;  1R2Y A;  3GLI E;  1K3W A;  4XK8 F;  1QAM A;  1OIP A;  2GNO A;  1QZE A;  3SHF A;  4GKJ M;  4PD2 A;  1IN4 A;  2MR9 A;  4X66 M;  3VKG A;  4NSO B;  2LWX A;  4AKH A;  4GEW A;  2ZBK B;  1JR3 A;  3SMS A;  2JWS A;  3VK8 A;  2D7G A;  2L2D A;  2R45 A;  2XGN A;  1K82 A;  2CV0 A;  2CFO A;  2KHH A;  1NHG C;  4DR2 M;  1UM8 A;  3AL0 C;  2UUA M;  3TWK A;  1HR0 M;  3V76 A;  2C9C A;  3GLF B;  1J09 A;  4PCZ A;  3AOE A;  4IIW A;  1WGL A;  3L27 A;  4D81 A;  4DV6 M;  1PGY A;  1DGH B;  3HJS A;  2Z4S A;  3LVV A;  3QYE A;  2QBY A;  4LF7 M;  2HHH M;  4OX9 M;  1XNR M;  1WIV A;  1JQJ C;  4GC5 A;  5BPV A;  4DR5 M;  3KS8 A;  2HCB A;  1L2C A;  2GQF A;  2CE7 A;  4YY3 M;  1N78 A;  2R18 A;  1LTM A;  1T6O A;  3FD9 A;  2L6O A;  4QNR A;  2F4V M;  3U6D A;  1NJF A;  2BWE A;  4GHA A;  4G4Q A;  3TE6 A;  2G3Q A;  2KNV A;  3K9O A;  4QNM A;  1PM5 A;  2JP7 A;  4NXM M;  1G3I A;  2KRK A;  4FD2 A;  4AKG A;  3D8B A;  4MGI E;  3DZD A;  2YQZ A;  1T43 A;  5JI2 E;  1G4A E;  2JY5 A;  3FRI A;  1NSF A;  5JI3 E;  1QAQ A;  5DYG A;  3VLF B;  4G4O A;  3GQ4 A;  1PJT A;  1N34 M;  3TL4 X;  5DNY A;  3SYL A;  1HJP A;  3PNY A;  1FJG M;  2DVW B;  2APL A;  3L2A A;  5KO3 A;  2WSF F;  4QHT A;  3K8Z A;  2LXE A;  3VKH A;  4B3R M;  1GKI A;  3LQQ A;  4DR3 M;  4LZJ A;  2BWB A;  3A45 A;  1R7R A;  5EP2 A;  1HNX M;  2JY6 B;  2UXB M;  2VQE M;  3LW5 F;  5EP4 A;  2V1U A;  5IWA M;  4RF1 A;  3D8L A;  2V1C A;  2EUC A;  2VDB B;  1FNN A;  2DXI A;  3AFH A;  3KFU G;  4B3T M;  1WJ7 A;  4NSR A;  1TH4 A;  4GH9 A;  1RU3 A;  1TTE A;  2H1R A;  4D82 A;  1ZV1 A;  2VQF M;  4BLC A;  4MGK E;  3KOX E;  1S3S A;  4IJF A;  4FW9 A;  2A5Y B;  1VDD A;  4XGI A;  3GP1 A;  3A46 A;  4TUW A;  4AG5 A;  1PJQ A;  3FYD A;  3TWM A;  4JYA M;  5E6J A;  2QSF X;  2X4A A;  4LY6 A;  3VDU A;  1ORY B;  3VDP A;  3U6C A;  5L8R F;  2LVQ D;  4LGY A;  1AIP C;  3E46 A;  4IBI A;  4Z8X A;  1HQY E;  3HU3 A;  1Y8G A;  2DWZ B;  4G3O A;  3I01 M;  2B3T A;  1J7K A;  3SAR A;  1TF0 B;  4PDI A;  3KXE C;  2JA2 A;  2OOA A;  2AHM A;  3GLH E;  3M0E A;  4A3V B;  5ITQ A;  1IN5 A;  3KDS E;  2EA0 A;  2DKL A;  4NOO B;  3LQR A;  4DR1 M;  2YNM D;  3FUU A;  2Y0Q A;  4B7G A;  4JV5 M;  4M9Z A;  4NXN M;  2VII A;  4LF4 M;  2OQ4 A;  1L8Q A;  1QZM A;  5IRE B;  1PRB A;  3T6P A;  3Q8X A;  3AKZ A;  5ITR A;  4MH0 E;  3FTC A;  2FH0 A;  4JI6 M;  2DEN A;  3W67 A;  2CHG A;  1DO2 A;  2DZL A;  3AV0 A;  3LCV B;  5EXT A;  3FYC A;  1SXJ E;  2XSZ A;  2MJ5 B;  4LF9 M;  4DR6 M;  3LVW A;  1VQ1 A;  3VFD A;  3U61 A;  3GPU A;  4LFA M;  4AW4 A;  1DGF A;  2VF8 A;  4RNA A;  3HJQ A;  2DWM A;  3E21 A;  4LRT A;  5A2Q S;  3MK6 A;  1E9S A;  2DAI A;  3TQS A;  2KZU A;  1XXH A;  4OVZ B;  1OJL A;  3ZH9 B;  4CIZ A;  3L26 A;  1NJG A;  3THG A;  1IFY A;  1V33 A;  2R46 A;  3U6E A;  2G5G X;  3ZC7 B;  2R6F A;  1XWI A;  1IN7 A;  2QCU A;  2Z7J A;  4XBO A;  5H37 D;  2QP9 X;  3CF0 A;  1VG5 A;  5E26 A;  4M0W A;  1DV0 A;  4LJ7 A;  1HNW M;  4L78 A;  2DAG A;  2G8L A;  1WHC A;  3E9S A;  3SAW A;  4X65 M;  2F5O A;  4JI2 M;  2C9O A;  3HWS A;  5ITU A;  4UN2 B;  4FCT A;  1VEG A;  4YHH M;  4IBJ A;  5ITX E;  1UFZ A;  4R71 A;  2L4E A;  3DFZ A;  1IBK M;  2LVN C;  2K0B X;  3U6M A;  1JR3 E;  4F1I A;  1G8P A;  3PFI A;  4DV3 M;  1R4G A;  3C9P A;  4AI6 A;  3RFW A;  2C96 A;  2O25 A;  1QDT A;  1IY1 A;  4I4L A;  4DV2 M;  3GLI A;  5KPR A;  5LMU M;  5KQ8 A;  3F92 A;  2J7O A;  3K1J A;  1XHB A;  2LNH C;  3VK7 A;  2R4J A;  3UJN A;  1T3T A;  2CP8 A;  2L7I A;  1G41 A;  3HHW A;  2Z4R A;  3KSJ A;  4OVZ A;  3GRY A;  3PNV A;  4LJ5 A;  3Q8G A;  4LRS A;  2UUC M;  2DWL A;  4IBF A;  3H4M A;  2I7N A;  3FE3 A;  2RGO A;  4DR7 M;  2OO9 A;  3GRV A;  2KW0 A;  1HNZ M;  1IXS A;  2ZAM A;  4MGH A;  2WSE F;  2UUB M;  2JY8 A;  3SAS A;  1EE8 A;  3AOG A;  3B9P A;  2EO2 A;  3GPP A;  3RGP A;  1NVM A;  3T1H M;  4EIW A;  3KSX A;  3HHY A;  3LMM A;  1Z6T A;  3HU1 A;  2F5P A;  3IG5 A;  1VDL A;  1V34 A;  5KPT A;  5DFL A;  4GHL A;  4RKU F;  4I5S A;  4GC9 A;  3AOE C;  2QZ4 A;  1XC8 A;  2CRU A;  3KP0 E;  1NV9 A;  3HZJ A;  4LGM A;  1R6B X;  3GLF A;  3GLG A;  5KQD A;  1GJT A;  4LJ4 A;  2RKO A;  3CTW B;  2ZTD A;  2N35 A;  4WUR A;  1QAO A;  2R0I A;  1IN6 A;  1SXJ C;  1WR1 B;  4JI8 M;  4FWD A;  2JNH A;  4B7H A;  3FUT A;  3BOS A;  3QYB A;  3FTE A;  3ZCB B;  2X8A A;  4GIT A;  2DZO B;  2RGH A;  2Y0T A;  4CHT B;  3GPX A;  2JUJ A;  2ZM6 M;  3J81 S;  4DUZ M;  3BBZ A;  1I4W A;  2EKF A;  1QYR A;  2FFJ A;  2HKJ A;  4CGY B;  5KPZ A;  1R2Z A;  3QAU A;  5EQT A;  1Q3B A;  3TWL A;  1IXS B;  2Y20 A;  2CWB A;  2MH8 A;  2LH0 A;  3U5Z A;  4F2L A;  4GKK M;  5IT9 S;  1MJG M;  3KVW A;  4LJ8 A;  5DYI A;  1Q3C A;  3L28 A;  2CHV A;  2C98 A;  4NL4 H;  3KP1 E;  1ZMV A;  3L29 A;  1D2N A;  1KYI A;  3M7G A;  1GL6 A;  3K2L A;  1IM2 A;  3MMP A;  1HT2 E;  2K6B A;  2KNA A;  2ERC A;  2DZN B;  3I4Y A;  4HEO A;  3B7N A;  5BR8 M;  2JZ1 A;  2FS1 A;  4IJE A;  4BB9 A;  2DAE A;  4GIP A;  4JI1 M;  4JI3 M;  3MJ5 A;  2DWN A;  3CF6 E;  3T38 A;  3SC3 A;  3SMP A;  3DOA A;  1NV8 A;  1PJS A;  5EXS A;  3L25 A;  3K9P A;  4P17 A;  3GPY A;  1H6U A;  2EKK A;  3M6A A;  3J2P B;  1NY5 A;  2XFT A;  3FUX A;  4G4N A;  1N36 M;  4HL4 A;  3FUV A;  3HX3 A;  1NNJ A;  4DV4 M;  2QHO B;  2LVP C;  1YLA A;  3C3D A;  3GQ5 A;  3GLH B;  4R7G A;  3HGI A;  3U60 B;  2J5Y A;  2CEA A;  2HL7 A;  3I4V A;  4AKI A;  1OFI A;  2JZ0 A;  4DUY M;  3EIH A;  4X62 M;  5IZ7 D;  5EJC A;  2K47 A;  3GRR A;  2F5S A;  1N33 M;  1D0K A;  2H5X A;  4WP2 A;  2LTU A;  2M5Z A;  2X49 A;  3A42 A;  3FTD A;  1TH2 A;  5EXX A;  4R3D A;  3UK6 A;  2C5R A;  1TR8 A;  3DA1 A;  1MX0 A;  4KLN A;  4FWH A;  3J7A S;  3ILK A;  3RE8 A;  2EJS A;  2YR0 A;  2Z8Y M;  1A5T A;  4DV5 M;  2I7P A;  3BXW A;  1SXJ B;  4FCW A;  2DHR A;  1Q02 A;  1WXQ A;  4D80 A;  3KW6 A;  4IBK A;  4DV1 M;  3U6P A;  4IBC A;  4AZF A;  1Z5C A;  2O5R A;  4Y28 F;  1ZMU A;  1ZMW A;  1W5T A;  2QPA A;  1GAB A;  2Y21 A;  2XZU A;  4FCV A;  2UXC M;  4X64 M;  5EP3 A;  5EXP A;  1YE9 A;  4W5W A;  3GLH A;  1E9R A;  5F3W A;  4PDG A;  1ZQ9 A;  2XZF A;  1DO0 A;  1XXH E;  2QQ8 A;  4LF6 M;  4LFC M;  2O01 F;  2R4E A;  4OW0 A;  4L16 A;  4MB7 A;  3JAM S;  3GLI B;  4I8O A;  1HQC A;  2QBY B;  2CUZ A;  1OFH A;  3U61 B;  1V92 A;  2QNJ A;  4IBD A;  1EFU B;  5FTK A;  4P16 A;  2F5N A;  4CJ6 A;  1YUB A;  1EIJ A;  4KOD A;  4LZZ A;  3HJ8 A;  1P3Q Q;  4I81 A;  1GO5 A;  3W0F A;  1G71 A;  4MGY E;  1L1T A;  2DAK A;  2VF7 A;  4IBG A;  1I94 M;  1GL7 A;  4K0K M;  1QUT A;  2P5T A;  3HKP A;  4B7F A;  4DBG B;  3T1Y M;  4II7 A;  1TDH A;  1XMQ M; 
#chains in the Genus database with same CATH homology
 3GO8 A;  3WHL A;  4AG6 A;  2CHQ A;  4FWG A;  4IBE A;  3SHG B;  1SXJ D;  4JI0 M;  1L2D A;  4G6Z A;  2D7H A;  4IBB A;  1E32 A;  4LJ6 A;  4LFB M;  3EIE A;  5C18 A;  4ITQ A;  5FTN A;  1TGU A;  3GQ3 A;  5ITX A;  4GRI A;  2KA6 B;  1N32 M;  1IQP A;  3HU2 A;  1NNU C;  3SFZ A;  4M9X A;  1IN8 A;  2XFS A;  2D7E A;  4B3M M;  1HT1 E;  1LV7 A;  4MM3 B;  4AQY M;  1KFV A;  7CAT A;  1DGH A;  1W5S A;  2M60 A;  3J27 B;  5LMN M;  1XMO M;  3SAT A;  4PT5 A;  1NY6 A;  3J7B A;  5ITY A;  4LCB A;  4RF0 A;  1IBM M;  2QEN A;  2E5L M;  4JI7 M;  1X37 A;  3A98 B;  2C99 A;  1N77 A;  4QOZ C;  1NHW C;  3U5Z B;  3SBJ A;  3W0L B;  3TPZ A;  3AJI B;  4NRW A;  3K92 A;  1PJJ A;  4QHS A;  1G59 A;  3E4R A;  3QWL A;  1Z5B A;  4L8R C;  2FOI C;  2XSZ D;  3UZU A;  2OPF A;  4QOS A;  3GRU A;  4MGZ E;  1J5E M;  3T15 A;  2XLJ A;  2KZS A;  2ZAO A;  1Q39 A;  3FKE A;  1PJI A;  2L7H A;  4L15 A;  2UXD M;  4JXJ A;  2W82 A;  2V6Z M;  3KOW E;  3GLG B;  4FVM A;  2CV1 A;  2KXE A;  2BNK A;  2R62 A;  1TDZ A;  1IXR C;  3WHK A;  2NQ8 C;  5EP1 A;  2FE8 A;  3SAV A;  4REZ A;  2BJW A;  1IY0 A;  3NWL A;  4GMQ A;  1Z5A A;  1TH3 A;  5FSW A;  4DV7 M;  4Z6Y A;  4KHP M;  5ITT A;  4G4R A;  3SAU A;  3JR5 A;  4JN6 A;  3CF2 A;  3PXG A;  8CAT A;  2FNA A;  4JI5 M;  3FUW A;  4KO8 A;  4CIS A;  2XEP A;  3KS4 A;  4L4U A;  4M0D A;  2R65 A;  5C1B A;  1ZAE A;  1MU5 A;  4OU7 A;  3FTF A;  4LJA A;  2KRU A;  1K3X A;  3KOZ E;  3RGS A;  3SYK A;  4BBA A;  1IY2 A;  2UU9 M;  1JR3 D;  3HHX A;  2CV2 A;  1SXJ A;  3R9X B;  3OTO M;  3I51 A;  1QAN A;  1N75 A;  2YFQ A;  3HHZ A;  4B3S M;  2ZAN A;  5FTM A;  1C1K A;  1GVN A;  4LJ9 A;  2XH9 A;  3C58 A;  3UGJ A;  1DGB A;  1QVR A;  1IXZ A;  3U6Q A;  3UMM A;  4JI4 M;  2F5Q A;  1XNQ M;  2Z3X A;  3J80 S;  3U6L A;  5FTJ A;  1QQW A;  2BJV A;  1L2B A;  5FTL A;  1GLN A;  3MHV C;  1L1Z A;  1YSY A;  4NRV A;  2J7N A;  1DGG A;  4HLQ A;  3KOY E;  3U60 A;  2KEB A;  4LG2 A;  3IG8 A;  1Z59 A;  4ZPX A;  3U6S A;  3U6O A;  3NBI A;  5GKN A;  4LF8 M;  4DV0 M;  1IBL M;  4B08 A;  4LF5 M;  1KSF X;  1E94 E;  3PVS A;  3JR4 A;  2L09 A;  2XF3 A;  2Q2E B;  4WW0 A;  5FLX S;  3R8F A;  4DR4 M;  1XXH B;  4M9S A;  4S12 A;  1R2Y A;  1K3W A;  1QAM A;  3SHF A;  4GKJ M;  4PD2 A;  1IN4 A;  4X66 M;  3VKG A;  4NSO B;  2LWX A;  4AKH A;  2ZBK B;  1JR3 A;  3SMS A;  3VK8 A;  2D7G A;  2R45 A;  2XGN A;  1K82 A;  2CFO A;  1NHG C;  4DR2 M;  1UM8 A;  3AL0 C;  2UUA M;  3TWK A;  1HR0 M;  2C9C A;  3GLF B;  1J09 A;  4PCZ A;  3AOE A;  4IIW A;  4D81 A;  3L27 A;  4DV6 M;  1DGH B;  3HJS A;  2Z4S A;  3LVV A;  2QBY A;  4LF7 M;  2HHH M;  4OX9 M;  1XNR M;  4GC5 A;  1JQJ C;  5BPV A;  4DR5 M;  3KS8 A;  2HCB A;  1L2C A;  2CE7 A;  4YY3 M;  1N78 A;  2R18 A;  3FD9 A;  2L6O A;  4QNR A;  2F4V M;  3U6D A;  1NJF A;  4GHA A;  4G4Q A;  3TE6 A;  1PM5 A;  4QNM A;  4NXM M;  4FD2 A;  1G3I A;  2KRK A;  4AKG A;  3D8B A;  4MGI E;  3DZD A;  2YQZ A;  5JI2 E;  1G4A E;  1NSF A;  5JI3 E;  1QAQ A;  5DYG A;  3VLF B;  4G4O A;  3GQ4 A;  1N34 M;  3TL4 X;  5DNY A;  3SYL A;  1FJG M;  3PNY A;  2DVW B;  3L2A A;  5KO3 A;  4QHT A;  3K8Z A;  2LXE A;  3VKH A;  4B3R M;  1GKI A;  3LQQ A;  4DR3 M;  4LZJ A;  3A45 A;  1R7R A;  5EP2 A;  1HNX M;  2UXB M;  2VQE M;  5EP4 A;  2V1U A;  5IWA M;  4RF1 A;  3D8L A;  2V1C A;  2EUC A;  2DXI A;  1FNN A;  3AFH A;  3KFU G;  4B3T M;  4NSR A;  1TH4 A;  4GH9 A;  2H1R A;  4D82 A;  2VQF M;  4BLC A;  4MGK E;  3KOX E;  1S3S A;  4IJF A;  4FW9 A;  2A5Y B;  1VDD A;  4XGI A;  3GP1 A;  3A46 A;  4TUW A;  4AG5 A;  3FYD A;  3TWM A;  4JYA M;  5E6J A;  2X4A A;  4LY6 A;  3VDU A;  1ORY B;  3VDP A;  3U6C A;  4LGY A;  4IBI A;  4Z8X A;  3HU3 A;  1HQY E;  2DWZ B;  1J7K A;  3SAR A;  4PDI A;  3KXE C;  2JA2 A;  2AHM A;  3M0E A;  4A3V B;  5ITQ A;  1IN5 A;  3KDS E;  2EA0 A;  4NOO B;  3LQR A;  4DR1 M;  2YNM D;  3FUU A;  2Y0Q A;  4B7G A;  4JV5 M;  4M9Z A;  4NXN M;  2VII A;  4LF4 M;  2OQ4 A;  1L8Q A;  1QZM A;  5IRE B;  3Q8X A;  3AKZ A;  5ITR A;  4MH0 E;  3FTC A;  4JI6 M;  2CHG A;  1DO2 A;  3AV0 A;  5EXT A;  3FYC A;  1SXJ E;  2XSZ A;  4LF9 M;  4DR6 M;  3LVW A;  3VFD A;  3U61 A;  3GPU A;  4LFA M;  4AW4 A;  1DGF A;  4RNA A;  3HJQ A;  2DWM A;  4LRT A;  5A2Q S;  3MK6 A;  1E9S A;  3TQS A;  2KZU A;  1XXH A;  4OVZ B;  1OJL A;  3ZH9 B;  3L26 A;  1NJG A;  3THG A;  2R46 A;  3U6E A;  2G5G X;  3ZC7 B;  1XWI A;  1IN7 A;  2QCU A;  2Z7J A;  4XBO A;  5H37 D;  2QP9 X;  3CF0 A;  5E26 A;  4M0W A;  4LJ7 A;  1HNW M;  4L78 A;  2G8L A;  3E9S A;  3SAW A;  4X65 M;  2F5O A;  4JI2 M;  2C9O A;  3HWS A;  5ITU A;  4FCT A;  4YHH M;  4IBJ A;  5ITX E;  1IBK M;  3DFZ A;  3U6M A;  4DV3 M;  4AI6 A;  1G8P A;  3PFI A;  3RFW A;  2C96 A;  1IY1 A;  4I4L A;  4DV2 M;  3GLI A;  5KPR A;  5LMU M;  5KQ8 A;  2J7O A;  3K1J A;  1XHB A;  2LNH C;  3VK7 A;  2R4J A;  3UJN A;  1T3T A;  2L7I A;  1G41 A;  3HHW A;  2Z4R A;  3KSJ A;  4OVZ A;  3GRY A;  3PNV A;  4LJ5 A;  4LRS A;  2UUC M;  2DWL A;  4IBF A;  3H4M A;  2I7N A;  2RGO A;  4DR7 M;  3GRV A;  2KW0 A;  1HNZ M;  2ZAM A;  4MGH A;  2UUB M;  3SAS A;  1EE8 A;  3AOG A;  3B9P A;  2EO2 A;  3GPP A;  3RGP A;  1NVM A;  3T1H M;  4EIW A;  3KSX A;  3HHY A;  3LMM A;  1Z6T A;  3HU1 A;  2F5P A;  3IG5 A;  5KPT A;  4GHL A;  4I5S A;  4GC9 A;  3AOE C;  2QZ4 A;  1XC8 A;  3KP0 E;  4LGM A;  3GLF A;  3GLG A;  1R6B X;  5KQD A;  4LJ4 A;  2RKO A;  3CTW B;  4WUR A;  1QAO A;  1IN6 A;  1SXJ C;  4JI8 M;  4FWD A;  4B7H A;  3FUT A;  3BOS A;  3FTE A;  3ZCB B;  2X8A A;  4GIT A;  2DZO B;  2RGH A;  2Y0T A;  4CHT B;  3GPX A;  2ZM6 M;  3J81 S;  4DUZ M;  2CV0 A;  1I4W A;  1R2Z A;  1QYR A;  2FFJ A;  2HKJ A;  4CGY B;  5KPZ A;  3QAU A;  5EQT A;  1Q3B A;  3TWL A;  1IXS B;  2Y20 A;  3U5Z A;  2LH0 A;  4GKK M;  5IT9 S;  3KVW A;  4LJ8 A;  5DYI A;  1Q3C A;  3L28 A;  2CHV A;  2C98 A;  4NL4 H;  3KP1 E;  3L29 A;  1D2N A;  1KYI A;  3M7G A;  1GL6 A;  3K2L A;  1IM2 A;  1HT2 E;  2ERC A;  2DZN B;  3I4Y A;  5BR8 M;  4IJE A;  4BB9 A;  4GIP A;  4JI1 M;  4JI3 M;  3MJ5 A;  2DWN A;  3CF6 E;  3T38 A;  3SC3 A;  3SMP A;  3DOA A;  5EXS A;  3L25 A;  3GPY A;  1H6U A;  3M6A A;  4G4N A;  3J2P B;  1NY5 A;  2XFT A;  3FUX A;  1N36 M;  4HL4 A;  3FUV A;  1NNJ A;  4DV4 M;  3GQ5 A;  3GLH B;  4R7G A;  3HGI A;  3U60 B;  3I4V A;  2CEA A;  2HL7 A;  4AKI A;  1OFI A;  4DUY M;  3EIH A;  4X62 M;  5IZ7 D;  5EJC A;  2K47 A;  3GRR A;  2F5S A;  1N33 M;  2C5R A;  2M5Z A;  2X49 A;  3A42 A;  3FTD A;  1TH2 A;  5EXX A;  4R3D A;  3UK6 A;  3DA1 A;  1MX0 A;  4KLN A;  4FWH A;  3J7A S;  3ILK A;  3RE8 A;  2YR0 A;  4DV5 M;  2I7P A;  1SXJ B;  4FCW A;  2DHR A;  1WXQ A;  4D80 A;  3KW6 A;  4IBK A;  4DV1 M;  3U6P A;  4IBC A;  4AZF A;  1Z5C A;  2O5R A;  1W5T A;  2QPA A;  2Y21 A;  2XZU A;  4FCV A;  2UXC M;  4X64 M;  5EP3 A;  5EXP A;  1YE9 A;  4W5W A;  3GLH A;  1E9R A;  5F3W A;  4PDG A;  1ZQ9 A;  2XZF A;  1DO0 A;  4LF6 M;  4LFC M;  2R4E A;  4OW0 A;  4L16 A;  4MB7 A;  3JAM S;  3GLI B;  4I8O A;  1HQC A;  2QBY B;  2CUZ A;  1OFH A;  3U61 B;  4IBD A;  5FTK A;  4P16 A;  2F5N A;  1YUB A;  4KOD A;  4LZZ A;  3HJ8 A;  4I81 A;  3W0F A;  4MGY E;  1L1T A;  4IBG A;  1I94 M;  1GL7 A;  4K0K M;  2P5T A;  3HKP A;  4B7F A;  3T1Y M;  4II7 A;  1TDH A;  1XMQ M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...