2L01A

Solution nmr structure of protein bvu3908 from bacteroides vulgatus, northeast structural genomics consortium target bvr153
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR Structure of protein BVU3908 from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 19
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10771 DUF2582 Winged helix-turn-helix domain (DUF2582)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l01A00
1FPQA 2DPUA 5E8IA 5A2QK 2P5VA 1HSJA 3F8MA 2VT3A 2ESNA 2QBYB 1R5HA 2CYYA 2K27A 1U3EM 4L9NA 2AS5F 1BOAA 2NRAC 1G3WA 4O6JA 2ZBKA 1HKQA 3WTZA 3S2WA 2MBFA 3CO7C 1TLHB 3ZQ7A 4AVPA 3GW2A 3SZTA 3U1DA 1MGTA 4P5OA 4NHJA 3OV8A 2ADUA 3J80K 4LFUA 2YPRA 2Z9OA 1Y0UA 2ISZA 2RNJA 3T8TA 4U7BA 2QUFA 4G7HF 4KN7X 3LQRA 3QPTA 5TRDA 4EJOA 5ILUA 2HEOA 3IWFA 1U78A 3QOPA 4NB5A 3F8NA 3T5XA 4RGXA 3WODF 2VONA 2HFHA 2XKOA 3LA7A 2UZKA 1XD7A 2WC2A 2W57A 2KKOA 2IA0A 4UV9A 3QRFF 3E97A 3HHHA 2Z99A 3FM3A 1G3SA 1S7OA 4XLPF 2Y48A 5DUKA 3T1BA 1QQIA 4EJTA 4MTDA 1ZG3A 4UUVA 4I7HA 3N97A 2X0LA 5BQTA 1UHMA 2R7DA 2ZXJA 5FLXK 1I27A 4ASNA 3K9TA 3QAHA 2FRHA 2MD5A 2QYOA 3ZMVA 4KN4X 5CJ9A 2IA2A 2PBIA 1SFUA 2A6EF 5D8LB 5D5WB 4M9SA 6PAXA 4IRHA 4L0YB 2P7CB 3ML6A 5CVUA 3E6MA 2LSOA 1ZYRF 1BI0A 1Q1HA 4JQFA 4MQVA 3GFMA 3BPXA 2RC4A 3TO7A 2XV4S 3ERED 5LHGA 4G7ZF 2W84A 3DFGA 1XGNA 1I1GA 4LB5A 2H6BA 2JZYA 2HQRA 1S6LA 1V3FA 3DF8A 5FFZA 4BAYA 1AOYA 3HYIA 1U8RA 3Q9SA 1H9TA 4RB3C 4CDGA 3WGHA 1ZRCA 1OYIA 2CQKA 3ZMZA 3ISPA 3RPUA 2ZO4A 1F5TA 4MNUA 4WX9A 2IPQX 3KP2A 1HSTA 3WTWC 1G3YA 4S04A 4A2UA 1R1VA 1W5SA 3TO6A 1V4RA 5CVJA 2UXXA 2PEXA 4LJZF 4G8XA 3QP6A 2COMA 3IWZA 4U88A 1O3SA 3DPLC 1FZPB 2VBYA 5HS8A 2KIFA 3WTVC 2PN6A 3F72A 2FNAA 5K5OA 5D5UB 1KQ8A 4WXCA 5DV5A 4L9VA 4BHCA 2HKOA 3CUQB 1OPCA 3IKVA 1UB9A 2GQQA 1R5GA 2DQLA 1UFMA 3RIRA 4U0WA 1YS6A 2OQRA 4FX0A 4CICA 1FLIA 1WQ2A 3HTSB 2HDCA 2HKXA 3WU1B 2C6YA 1HXDA 2FF4A 5K5QA 2NAZA 3QPHA 2M87A 2H09A 2BYVE 4Y13A 3F3XA 4XSXF 3GFIA 4U0VA 5IT9Z 5ICEA 3KETA 3BROA 1IN6A 3IKTA 2JRTA 4OMYA 2DFIA 3V4GA 5J6XA 2J5OA 2P6TA 1TBXA 2EFPA 2JT1A 2GXBA 2G7HA 2K86A 2VOOA 2MA3A 4UVCA 3WU0A 1D3YA 3G73A 4ESFA 1L3LA 5D6EA 1MKMA 4HX4A 1L0OC 1QZZA 1MZBA 1J7KA 1XSVA 1QGPA 1E17A 1J2XA 1ON2A 3GXOA 4XBFA 2MLKA 1H9GA 1XCVA 5BPDA 4YFNF 4I0AA 4HQMA 5BPIA 4M6YA 2TDXA 5ERIA 4AWXB 3MWMA 4BQAA 1TQMA 2V1DA 4RS8A 1IUYA 3K1NA 2MC3A 2HS5A 2FEZA 4JK1X 4L9TA 4IHTA 3LAPA 3C7JA 1S3JA 2L01A 2FBHA 5FD6A 1YFHA 3MQ0A 1F1ZA 2DW4A 4DQ2A 1P92A 4GYGA 2JSCA 2Z33A 4BXUA 2HQNA 2V9VA 1LDKB 4BH9A 4EJVA 1KYWA 3PQJA 1W5TA 4WF2A 3D0SA 2DTRA 1P4WA 4I09A 2RDPA 5ILSA 3ECHA 1Z6RA 1GXPA 4MTEA 1KYZA 2R3SA 4KFCA 3SZPA 4R1HA 1W7PD 2RN7A 5HLHA 1UHWA 3IL2A 1JHHA 4EVIA 2DT5A 3WGIA 2DLLA 3TGNA 4EV0A 1WI9A 4BHPA 3FX3A 2R7FA 2GA2A 1BI1A 3DPTA 3BPVA 2P5LC 2LF7A 3E5UA 4RB0A 4EQQA 4IF4A 5ICGA 1T6SA 5LHIA 5E18F 4K2EA 2Q2EA 4PZJA 2CSOA 5FLXZ 1K78A 4YG2F 2Y0MA 3QP5A 4MGRA 3Q5FA 3HSRA 3IRRA 2ZMEA 3HOTA 2QQBA 3EYIA 1PUEE 4CGZA 3L00A 4RGRA 4RB1A 1J59A 2QQAA 4YFKF 4Q4ZF 1F9NA 2WWYA 3DXJF 2LNBA 2P8TA 2OD5A 3V7RA 3N4MA 2LDUA 4OMZA 4D0PA 5LLQA 1TQIA 2PFBA 1QNTA 4L0ZB 1RZ4A 5E1ZB 3DEUA 4ESJA 3TOBA 5LBQA 3ABTA 2Y75A 3ULQB 3R6SA 1JHFA 2NYXA 4HDUA 3K1MA 1HW5A 3LSTA 1Z91A 2B0LA 4HLYA 2EFWA 4MHGA 1RUOA 5LEJA 1B9MA 3FF5A 1GXQA 1SD6A 4WWCA 3RYPA 1MJBA 2DPDA 2O0YA 4IXAA 4PCQA 1Z1DA 5H6QA 4CYDA 5DDGA 1ONVA 4A6DA 3T8RA 1T38A 2VOPA 1BIAA 3WTYC 3HHGA 4I98B 4A5MA 3HOSA 2HWVA 4LK1F 1BN5A 4E70A 4ZYDA 4HA8A 1SD5A 3JTGA 3W6KB 2QZ8A 2FOKA 5F1RA 1LB2A 2EV0A 3K2ZA 1IF1A 3ROUA 3CUQC 2DO7A 4GYIA 1R00A 4WCGA 2VT2A 1OKRA 3C1DA 2GXGA 1FC3A 2K7LA 1E2XA 3I64A 3EUHA 1TW2A 5EEGA 4EJWA 1FY7A 1CGPA 2DK5A 3M8FA 4M9ZA 2IVMA 3KEOA 1S7AA 3HRTA 1A04A 1YW8A 3CTAA 3V8KA 3F21A 1IN7A 2EWNA 4CXFA 1ZGAA 1PDNC 2NNNA 2YX4A 2HOEA 5JHUA 5LRSA 1LJ9A 5JR3A 4Z2YA 2O03A 1R1TA 4XLNF 2P4WA 4AD9A 2IRFG 4I01A 4G6DA 1C0WA 2F5DA 2DI3A 2UWMA 1HBXG 4LLLA 3I71A 4KMUX 1TNSA 2A07F 3HRSA 3LAJA 2EFOA 2L4MA 2E7XA 5ILVA 3FMQA 5H6RA 3LWFA 3VFZA 3BJAA 1QBJA 2ZMEB 1SD7A 2BGCA 1HKSA 1NHAA 2DQRA 1EH6A 1HW1A 3JTHA 2M8EA 2VXZA 3JAMK 2ZFWA 1XB4A 3HIFA 1ZG5A 1IXRC 5CVVA 2HR3A 4WXHA 1WSUA 3PQKA 2FQ3A 1KU9A 1T0FA 2W25A 1CF7A 1PP8F 4Q47A 4Q48A 2XROA 2YR2A 5DYMA 1MDMB 1EH8A 2FBIA 3R4KA 1P6RA 2IT0A 2EK5A 3VODA 3L2CA 1GVJA 1K78B 5F6FA 4FT8A 3M9AA 1D8KA 3MCZA 2ETHA 5JFRA 1ZN2A 2HZTA 3TDZC 2MLGA 4LB6B 5CLSA 2XAQA 4F7ZA 5DUIA 1J0RA 3F8CA 3GZ6A 2OA4A 2Q0OA 2G9WA 2FSWA 1D5VA 3NEUA 4OINF 3BZ6A 1KU3A 2VODA 2ZCWA 1BBYA 5JI6A 2QLZA 1YW9A 1ZG1A 4MEYF 4OIPF 1J9IA 3H3ZA 2K02A 3SXYA 5BMZA 3L9FA 5LRRA 3IRQA 4EGYA 4FHTA 3RKYA 4B09A 3WTUC 4MQ9F 1USSA 2M5WA 4UVAA 5A2QZ 2V79A 1Z6TA 1O3RA 3WE3A 3PFIA 4P55A 2QENA 4I02A 3NRVA 3GYHX 3F22A 3RKXA 1T98A 3MZYA 2ISYA 1P4XA 1IXSB 3D5LA 4ETSA 2YU3A 1SAXA 2XAFA 1TW3A 3NQOA 3P7NA 2ZNZA 2EFNA 1SFEA 5FFXA 2JPBA 2QM3A 1IN8A 1KU7A 3VB2A 3EETA 4HF0A 3GFJA 3WTTC 3ELKA 2IP2A 3LQQA 2A61A 1PP7U 3TOAA 3EYYA 2A5YB 2M45A 2BE5F 2ZJ2A 2E1NA 1FSEA 4KT5C 2RQPA 3ZMSA 4UNOA 4EM2A 1YYVA 1VTNC 3KP6A 3T0YA 4L5IA 4P9FA 3R0AA 5LGUA 2V1UA 4M71A 5D5XB 3R0JA 1R23A 3MZHA 4RB2C 5E8GA 4IHSA 4HF1A 1YTYA 3ZMDA 1K7AA 3TQNA 5J8CA 3VEPA 2EFQA 3I59A 3P9CA 4GGGA 4DNCA 4ZZLA 1DUXC 4JBAA 3IHUA 1BM9A 3K1PA 2ELHA 4UXNA 2MH9A 1IN5A 1JXSA 5K1YA 5ICFA 3H3UA 3FXRA 4I2OA 1OYWA 4HW0A 1R58A 3E6DA 1GHCA 4HBLA 3SHFA 3KLNA 1SFXA 3FHZA 3E5QA 2EA2A 1K6OA 1ZGJA 4Y15A 5FO5A 2F5EA 2V1XA 1EH7A 2ACJA 4Q5SF 4KICA 2RVCA 3QU6A 2F5FA 4QWQA 4QLCU 2QWWA 1FBUA 1YW7A 3F6OA 2ZKZA 1HQCA 2VN2A 1IRFA 4IVNA 4OOIA 2IW5A 2K4BA 3GX4X 1CF7B 4KYWA 4KIFA 3E6BA 4L9JA 2KJCA 3P9IA 2D45A 4WXDA 4AIJA 1W7PB 1YLFA 2EV5A 2L54A 1DPRA 3J81Z 3R60A 5D4SA 1SMYF 1ZREA 4O5VA 2L4AA 5E20A 1KU2A 2YSRA 2D1VA 3I59B 1G6NA 4N9HA 4S05A 2GZWA 2PG4A 1O3TA 5ICCA 3ZN1A 1P2FA 1OMIA 2PI0A 4TV7A 4HX7A 3WTXC 2L3DA 1IZ1A 3MEXA 1DDNA 5KK1A 5LHHA 4ON0A 3KE2A 2O6GE 1QZYA 1T39A 1TTYA 5FGMA 1OYYA 2CGPA 1XGOA 3ZMUA 5HVQC 2M1BA 1MD0A 5K5RA 1LQ1A 3BWGA 1U5TA 5JVTA 2CFXA 3BOQA 3EQLF 1UCRA 3HTUA 5HOOA 2PJPA 4WK8F 2EJRA 1BC7C 2XHKA 1YG2A 2DBBA 4GCVA 1QPMA 1REPC 3AAFA 2H27A 4FX4A 2M30A 3KP5A 4LMYA 1G3TA 2BBYA 4KIBA 3WG9A 1YS7A 3KP4A 3BP8A 2DK8A 4G6QA 2AXLA 5L3GA 4NQWA 2J5PA 1LVAA 2K4JA 2F2EA 3GFLA 5HLGA 2RKHA 2P5KA 5BS6A 1STZA 1FYKA 1WKMA 1XSDA 2DU9A 3F8FA 5L3EA 2STTA 1RUNA 1F4KA 3ZPLA 1YO5C 4I0BA 4RGSA 3B02A 4CZZA 1WWXA 1HKTA 3REOA 4G7OF 3DKWA 4CO8A 3HRMA 1FWZA 3KEQA 4EM0B 4M6XA 4A12A 4AIKA 5E1WA 3LFKA 5CVIA 5J8FA 1D8JA 1LDDA 4HV6A 2FA5A 3KP3A 4ENNA 1S29A 4PDKA 2CO5A 2Q8KA 1R36A 5D5VB 3I0TA 3RI4A 4CHUA 2LKPA 3FMRA 1SD4A 3JSOA 2CW0F 1K79A 1U6GA 3ZP5A 1XMAA 2KIMA 1YIOA 3B73A 3BJ6A 3U2RA 1W4MA 5CVRA 3TDUC 4YFXF 2A3SA 2D1HA 4YIIA 2EV6A 2STWA 4GO1A 3FMSA 1ZLJA 1ON1A 4IPAA 4YIFA 3CJNA 1T2KA 1FBSA 5L3CA 1WRJA 2A69F 3I4PA 1B1BA 2GA1A 1ZH5A 3JW4A 3E3VA 2HYFA 5AIPA 3CO6C 2ZNYA 1XN7A 5LEKA 1O7LA 2GWRA 1ULYA 3CDHA 3RDIA 1BIBA 1FSHA 2IJLA 5L3FA 1RNLA 3O6BB 4HV5A 4G9YA 4KMFA 1EV7A 4OIOF 2OZUA 3KZZA 1XDUA 5E17F 2KRFA 3HUGA 2VC1A 2Z5UA 3DV8A 3KP7A 3R61A 1IAWA 2HTJA 4L5JA 1YQAA 4R8HA 4MEXF 5HS9A 1R22A 2IA1A 3J81K 3BDDA 3I5UA 3EDPA 2CG4A 4PGHA 1FOKA 1G4DA 2PMUA 2O8XA 2A68F 4P96A 4HAMA 1FYMA 4LGWA 3FXQA 1XCBA 3L09A 3COAC 3GO5A 2Z3YA 4OU0A 5HDGA 1JE8A 4ZYGA 2VBZA 4HX8A 4XSZF 3JSPA 2OU2A 2XASA 4EGZA 5HDNA 1MJ9A 3ZN0A 5LGTA 1OR7A 1HW2A 2P6SA 4A5NA 3KZYA 5DCMA 1FNNA 4ENJA 2BV6A 3U9GA 5F64A 1XGMA 4GXOA 5DD4A 2QVOA 3HSEA 1FX7A 2VBWA 1J75A 1I5ZA 1KGSA 2XGXA 3E5XA 1XMKA 2QBYA 4EMSA 5HDKA 4ENKA 4KIGA 2XKPA 1AWCA 5HLIA 3I54A 4RAZA 2OAZA 4KA4A 5DEQA 5E1XA 3MFKA 4LLGF 4HZFA 3LA2A 5D4RA 1TNTA 4BYYA 1KA8A 4LG0A 2HYGD 2FU4A 2H6CA 1KQ0A 2JTVA 1B6AA 4EM1A 5ED4A 3RJPA 5D6FA 1O57A 4IJAA 4KDPA 4IRIA 1TQPA 2VE9A 2LF8A 1LEAA 2WV0A 4ZYHA 1H0MA 1FBQA 2W24A 3LA3A 4BHBA 2JPCA 3GEZA 2NNYA 4HQEA 5FB2A 2F5CA 4HF2A 3K69A 2FBKA 2V6CA 3VOEA 4U7DA 4O3MA 3L7WA 1LNWA 3O2PE 4OIQF 2KJBA 3P9KA 1ZRDA 2G7UA 2GIVA 5D8KB 4ENMA 3GUDA 4A0XA 1MJAA 2XAHA 1IN4A 2KIUA 3Q9VA 4A6EA 3I58A 1IW7F 5DCFA 5EEHA 1P4AA 2HGCA 3H92A 3V8JA 1FP1D 4HDVA 5KVRA 4M74A 1B9NA 3KCCA 2BEOA 3RPQA 3F8BA 4M73A 1W7PA 4UV8A 1RIOH 3ECOA 2EA4A 2MH2A 4M72A 2A6HF 1IXCA 4RGUA 3GVAA 2O3FA 1ZARA 5HS7A 3ZMTA 4Y17A 4M9XA 4LK0F 2FNPA 3G3ZA 2L02A 3BY6A 2OBPA 3GF2A 3OOPA 1KQ9A 1RI7A 1BC8C 4EJUA 3V7SA 1ZRFA 3I53A 2XAGA 2VC0A 1U2WA 2X4HA 4HOBA 3J7AO 2XVCA 2UXNA 3CLOA 5H20A 1S8NA 4H0EA 2H94A 3KFWX 5FD5A 3RKWA 3M8EA 3FZVA 3V7CA 3K0LA 4UHTA 2FE3A 3W6JB 5L3BA 1B59A 4ZH4F 2VBXA 2W85A 5IT9K 2EB7A 1X3UA 3MAJA 3RTRA 3WTSC 2FXAA 2O61A 1XDSA 2D2WA 3F6VA 1BJAA 1LDJA 4AIHA 2CWEA 3F23A 3SQNA 3SFZA 2PLYA 2XIGA 1Z7UA 3KLOA 3C3WA 1J5YA 4LD5A 3O3KA 2OQGA 3WE2A 3GWZA 1IRGA 4HLXA 1MDMA 4N9IA 1U5TB 2OZ6A 4UVBA 3E6CC 2GAUA 1FYLA 4L18B 3M1EA 4G94A 1SMTA 1ODDA 4IRGA 2XRNA 5AONA 5BOXA 1FT9A 1DPUA 3CUOA 4ZZDA 1XSXA 3J80Z 2HTSA 4PGGA 3FWEA 2PMHA 5LGNA 5TJJA 2RV8A 4R79A 4LLNA 4ESBA 3HRUA 4HYEA 2P7VB 3GZ5A 2RGVA 3WGGA 4A0ZA 2QQ9A 3BJOA 1ZAOA 4U0YA 4OIRF 4KNYA 3FXUA 1ZLKA 3DP7A 5AIQA 1LEBA 2E1CA 3V8LA 2DAOA 4P9UA 1B4AA 3HSFA 3JAMZ 1FP2A 3C18A 4LG0B 3FM5A 1JGSA 2PQ8A 2NS0A 1O3QA 4A0YA 3CUQA 3GLXA 3RYRA 1I1SA 1Z05A 1BI3A 2E7WA 2VE8A 3IC7A 4XRFA 3TKYA 4N0BA 1BI2A 5CYVA 3ABUA 4B8XA 1XGSA 2WTEA 3DQVC 1Z9CA 2XAJA 2XUBA 5DCMB 1I6XA 5DD8A 5L3DA 4ZYEA 1R1UA 1R7JA 3TO9A 1ZHFA 1USTA 1DP7P 2YX7A 4KUMA 1O7FA 4BNCA 3QU3A 5IT3A 2FMYA 2FMLA 1QO0D 1U5TC 4RAYA 3M7GA 2ESHA
chains in the Genus database with same CATH superfamily
3BLYA 2R7TA 1FPQA 2DPUA 4BEHA 4EEFG 3TBIA 4CCMA 5E8IA 2JA2A 4GRIA 5A2QK 2V9PA 1D1BA 2P5VA 1HSJA 1JT0A 3F8MA 2VT3A 2ESNA 5M5YJ 1GV2A 2E1MC 2RREA 1WJFA 3IV5A 5M5XJ 2OCCH 3H9QA 2FD5A 2QBYB 3VYRB 4E6KG 5TISC 1R5HA 2CYYA 1BL0A 2K27A 1U3EM 3PNYA 2W82A 3ONQA 4L9NA 2AS5F 4FQGA 1BOAA 2NRAC 1G3WA 4O6JA 1M1EB 5H2FC 2ZBKA 4I6ZA 3DTEA 3JR9A 1HKQA 3Q0UA 3G4SI 3WTZA 1SVMA 4CCNA 3S2WA 2MBFA 2LKXA 2QF7A 3CO7C 1TLHB 3ZQ7A 2DDAA 4AVPA 2ID3A 3FDYA 5KNLA 1OCPA 3GW2A 3SZTA 3U1DA 2V1NA 2WB1A 1MGTA 3B6AA 4JP0A 4P5OA 2LOOA 4BJ6C 4NHJA 2DXIA 3OV8A 2KRHA 3N05A 2JVGA 2ADUA 3J80K 3OS0A 4LFUA 2YPRA 2ZSHB 3OYJA 2Z9OA 2L2OA 1Y0UA 1YJNI 4GFBA 2VKDA 5C4JJ 2ISZA 2LTPA 2RNJA 3T8TA 4U7BA 2W1OA 2PMZN 4A3EJ 3RQ4A 5B3SH 2QUFA 4G7HF 4IHWA 1A35A 4KN7X 3LQRA 2CV1A 3QPTA 1EJ9A 5TRDA 1X3ZB 1N75A 4EJOA 5ILUA 2HEOA 3IWFA 1U78A 3QOPA 4NB5A 5FKKA 1JGGA 1ACIA 1V5FA 3F8NA 1U8BA 3T5XA 4BJTA 4RGXA 3WODF 2QCOA 1OLTA 1ETWA 2VONA 2HFHA 1KONA 2XKOA 3LA7A 2UZKA 1B8IA 3C2HA 1BR4A 1XD7A 1OR7C 2WC2A 3LSIA 2W57A 3FIWA 2H1LA 2KKOA 1R49A 2DTZA 4JX5A 2IA0A 3OMYA 4UV9A 3QRFF 2LR8A 3E97A 2MW8A 5F08A 2LD5A 3HHHA 2Z99A 3FM3A 1G3SA 1UHSA 2WAQN 2H1KA 1S7OA 4XRSA 4XLPF 4E4HA 2Y48A 5DUKA 3FHNA 3EUHC 1FOXA 1W1WE 4ABZA 5EDNA 3T1BA 1QQIA 4EJTA 2X6WA 5LD2C 4MTDA 1YI2I 2VQCA 1ZG3A 3ZQHA 2Q1ZB 2OCEA 4UUVA 3S2DJ 4I7HA 3LOCA 3N97A 1MBEA 2X0LA 2KL4A 3VSLA 2Z1DA 5BQTA 1UHMA 2R7DA 2ZXJA 5FLXK 3EPZA 4G6TB 3WU2C 1FMVA 1I27A 2IS1A 2HOTA 1BR2A 4XN3A 2LRDA 2VJJA 4ASNA 4IQJA 3K9TA 3M4OJ 1FEXA 2LP0A 4BQQA 4Y7NJ 3QAHA 3CCYA 2FRHA 2LVSA 2MD5A 2QYOA 3H35A 3HBLA 4KN4X 5CJ9A 2IA2A 2PBIA 4ZDLA 2A6EF 5D8LB 1SFUA 1JKOC 5D5WB 2E1OA 4M9SA 4BQOA 3W2VA 2BVMA 2DYSH 2BOLA 2BY2A 2E5NA 3V42A 6PAXA 4I99C 3SDGA 2M9HA 4IRHA 3RCOA 2WY8Q 2PJRB 4BACA 2O8KA 3S1QJ 4L0YB 2P7CB 1IRZA 3ML6A 5CVUA 3JRAA 3E6MA 2LSOA 3KZIC 3CQZJ 1ZYRF 1BI0A 1Q1HA 2LFBA 2K9SA 4JQFA 4MQVA 3GFMA 2NVXJ 4QIWN 3PIOF 1E0EA 2BXYA 2GIZA 2JK3A 3BPXA 2RC4A 3TO7A 2XV4S 3MKLA 5B1AH 3KYDB 5IY5H 3ERED 5LHGA 4G7ZF 2EINH 3I9V2 2ME6A 2QSHX 1I6HJ 2W84A 4RLFA 3DFGA 4AUXA 1F43A 1IC8A 2GBYA 1XGNA 2VPLA 1DGWY 2KDZA 1I1GA 3HPHA 2H6BA 4XR6A 3ZCOA 1R4NB 4LB5A 2JZYA 2HQRA 1S6LA 1V3FA 3DF8A 5FFZA 2XB0X 1Z7LA 5J1RA 3OSFA 2HXOA 3NWSA 4BAYA 1AOYA 1SVLA 2LH9A 3HYIA 1U8RA 1WH5A 2LY2A 2OPTA 3Q9SA 3S3NA 3O8GA 1H9TA 4RB3C 4CDGA 2R7UA 3WGHA 1RR7A 3GLLA 1ZRCA 2F4IA 1E3PA 3CMEI 1OYIA 4M3BA 2CQKA 3ZMZA 1RPWA 4BXFA 2EH3A 2X6YA 2Y31A 4F91B 3S2HJ 3ISPA 3RPUA 2ZO4A 1F5TA 4C2TA 4MNUA 4WX9A 2IPQX 3KP2A 1HSTA 4FETA 3WTWC 1G3YA 1I3QJ 4A2UA 4S04A 4KISA 3J7YJ 2R5ZB 1R1VA 1W5SA 2BW3B 2KQRA 3TO6A 4JX4A 1V4RA 5CVJA 3BR1A 3ERMA 2UXXA 2PEXA 1BA5A 4LJZF 3D1NI 2M0MA 4C2UA 4PJLA 4IOCF 3GTKJ 4OWRB 1UELB 1D5YA 1A6IA 4G8XA 3K2AA 3QP6A 3AL0C 2EIMH 2COMA 3BTIA 3IWZA 4U88A 1O3SA 3DPLC 1R5ID 1FZPB 2VBYA 3JCUC 5HS8A 1JKRC 2KIFA 1NG7A 4QPOA 3ZQCA 3WTVC 2PN6A 3F72A 2OTLI 2FNAA 3IH4A 4D5CA 5K5OA 5D5UB 4XRMA 1IGNA 1KQ8A 4WXCA 5DV5A 4YIRX 4L9VA 5EF6A 4BHCA 2CQ7A 2CUEA 3TL4X 4JYKA 2WAFA 3MMYB 2HKOA 3CUQB 1OPCA 2WV1A 3IKVA 1UB9A 1P7IA 4IQ4A 2GQQA 1R5GA 1UG0A 2VPRA 2DQLA 2K9QA 3BG7A 1UFMA 3RIRA 4NNJA 2HQ5A 4CYCA 1TP4A 2F4OB 5GADJ 1Q1VA 1Z0XA 2KHMA 2K3FA 9ANTA 4U0WA 1YS6A 2OQRA 1X1PA 4W1UA 3CD6I 3HPGA 4FX0A 1VQ5I 4CICA 1FLIA 3A03A 1WQ2A 3HTSB 4Y4RA 2CUFA 3A01A 2HDCA 5IOZA 5J3LA 2HKXA 3BCAA 3HM5A 3WU1B 2C6YA 1HXDA 2FF4A 1OCTC 5K5QA 1UG2A 2NAZA 4IX7A 1PJRA 2L9RA 1NG6A 3OR2C 1VQOI 3QPHA 4BEHB 2WAEA 3PUBA 4BE2A 2M87A 2H09A 3JREA 2BYVE 5FLMJ 4Y13A 5J1YA 4XNFA 3F3XA 4XSXF 3GFIA 2NOGA 4U0VA 5IT9Z 4AC0A 2ZMEC 2UV1A 5ICEA 3KETA 1P9QC 3BROA 1ZTRA 3L2RA 3TW7A 1IN6A 3IKTA 2JRTA 4OMYA 2GOXB 2DFIA 5E3OA 5IPAA 3KX2A 2JQ7A 3V4GA 3UR3C 3MN2A 3VYUB 1SEUA 1LUJB 2J5OA 5J6XA 2P6TA 1TBXA 1F36A 2EFPA 1ZQ3P 2JT1A 2GXBA 2L7ZA 3FXKA 2G7HA 2K86A 2VOOA 4ZDPA 3OOUA 2MA3A 4UVCA 3WU0A 1D3YA 3G73A 4ESFA 3H0DA 5FKMA 2XGDA 5HNHA 2EBIA 1L3LA 2FQ4A 2XRLA 5D6EA 1MKMA 4HX4A 1L0OC 3S93A 4AYBN 1QZZA 1MZBA 5FLVA 1J7KA 1XSVA 1QGPA 1E17A 1WJDA 1J2XA 4IEJA 3MKYB 1ON2A 3GXOA 2DA1A 4XOPA 4XBFA 2MLKA 2E5ZA 1YX3A 1H9GA 2R5ZA 3TW6A 2TCTA 3PO3J 1XCVA 5BPDA 4YFNF 4I0AA 4G12A 1LFUP 3LSGA 4HQMA 5BPIA 4M6YA 3GTOJ 2ZJPF 2TDXA 4RDUA 5ERIA 4AWXB 4BUPA 3GZNB 3MWMA 2ECBA 1YJWI 4BQAA 4ZYAA 1TQMA 2V1DA 4RS8A 3ZQLA 1IUYA 2F5VA 4B3XA 3O8HA 1MBFA 3K1NA 2E36A 3RZOJ 2MC3A 2HS5A 2FEZA 1W36D 5GAHJ 2VKEA 4JK1X 4L9TA 5E3MA 4IHTA 3FKIJ 4A3CJ 3LAPA 2V6EA 3C7JA 1S3JA 3S1NJ 2L01A 2FBHA 1FIPA 2CJJA 5FD6A 1YFHA 3GTMJ 3MQ0A 1F1ZA 2DW4A 2Y0SA 3DTKA 4DQ2A 1H8AC 1P92A 3SYTA 3ZQGA 4GYGA 1QZEA 2JSCA 2Z33A 4BXUA 2HQNA 2V9VA 1LDKB 4BY1J 4BH9A 2NOJB 4EJVA 1KYWA 3PQJA 4E7SA 1W5TA 5IYBJ 4M3FA 4WF2A 1VQPI 3D0SA 3ZOBA 3ZQQA 2DTRA 1P4WA 3CJTB 4I09A 2DMNA 2RDPA 5ILSA 3ECHA 3L2UA 1Z6RA 3QPLA 5F0FA 1GXPA 3SEQA 2AQFA 4MTEA 4IOAF 2E34A 1KYZA 1NH3A 4F55A 2R3SA 3PSFA 4KFCA 1JTXA 3SZPA 4R1HA 1W7PD 2RN7A 5HLHA 2MGQA 1UHWA 2CW7A 3IL2A 1JHHA 4DGWB 4EVIA 2DT5A 3WGIA 2PJRA 2WADA 2X51A 2DLLA 3TGNA 1CQTA 4EV0A 3M3YJ 1WI9A 4BHPA 2HVRA 3L1PA 3CC2I 3NARA 4V2GA 1HF0A 3FX3A 2XDVA 4E7KA 4ZTJA 1GDTA 2R7FA 2GA2A 3CDIA 3S14J 1BI1A 5FKLA 3DPTA 2X9DA 3BPVA 2P5LC 1T08B 2LF7A 3E5UA 4RB0A 1U0JA 2BZTA 4EQQA 4IF4A 5ICGA 1T6SA 2WA0A 5LHIA 2R7OA 2DDBA 4K2EA 5E18F 2Q2EA 4PZJA 2CSOA 5FLXZ 1K78A 4YG2F 3S17J 2V7FA 2Y0MA 3A1YA 2EILH 3QP5A 3HOUJ 4MGRA 1PVEA 2XAUA 3HSRA 3Q5FA 1TL8A 1QVTA 4E7JA 3IRRA 3OS1A 2ZMEA 1YHQI 3MVPA 4PFOA 3ABLH 3HOTA 3QYFA 2QQBA 2KRCA 3HOXJ 1OQYA 1UZCA 1UAAA 5J4VA 3EYIA 2HU9A 5JLXA 1PUEE 4CGZA 3L00A 4RGRA 4RB1A 3I56I 1J59A 3OIOA 2M3AA 1X4OA 2QQAA 4YFKF 2B7EA 4Q4ZF 1F9NA 2WWYA 1LFBA 4A3DJ 1ZGWA 3DXJF 2I10A 2LNBA 2P8TA 2OD5A 1VI0A 3V7RA 1IJWC 3N4MA 2LDUA 3HOVJ 4Y3OA 3HUGB 4OMZA 3H1CA 3QODA 4PJNA 4XLEA 3K10A 3I55I 3JRGA 4D0PA 4F52A 5LLQA 1TQIA 2CH0A 2PFBA 3TMOA 4NBQA 1QNTA 3CC7I 4L0ZB 1X1BA 3G1LA 2CMPA 3S3OA 4CZCA 1RZ4A 5E1ZB 3DEUA 4UUSA 1TC3C 3VSKA 4ESJA 3TOBA 4D9JA 5LBQA 3NWTA 3ABTA 2IAIA 2Y75A 3ULQB 3OYAA 3R6SA 1JHFA 1JTYA 2NYXA 5EG0A 4LIVA 4HDUA 3K1MA 1HW5A 2G0EA 3LSTA 5EZGA 1Z91A 4IHYA 2B0LA 4HLYA 2EFWA 4DW6A 2LBFA 4MHGA 1RUOA 1YRNA 2XF7A 5LEJA 2RAEA 3LSJA 1B9MA 2XGEA 3AG2H 3FF5A 1GXQA 1SD6A 3BR0A 4WWCA 3HXLA 3DPUA 3RYPA 4XLCA 1D0XA 3LSKA 3CDLA 1MJBA 5HLTA 2DPDA 2O0YA 4IXAA 2ZJRF 4PCQA 3OYKA 4D1QA 1Z1DA 3BTCA 5H6QA 4CYDA 5DDGA 4EATA 5EGOA 1ONVA 2A05A 4A6DA 3T8RA 1T38A 2VOPA 3OWTA 2CUZA 1MSFC 1BIAA 3WTYC 3HHGA 4I98B 3CP2A 3LFUA 1D0ZA 4A5MA 3HOSA 2HWVA 1Y8QB 4LK1F 1BN5A 1Z67A 4A3IJ 4DYRA 4E70A 4NC8A 2K5CA 4ZYDA 5TGTA 4ZTFA 4HA8A 4IL6C 1SD5A 2HZDA 4KJZA 3JTGA 3W6KB 4BDYA 2MFZA 2QZ8A 3HOZJ 2EPFA 2FOKA 5F1RA 1LB2A 2EV0A 2FX0A 3K2ZA 2Y30A 3AG4H 1XG1A 2OV7A 2WY7Q 1IF1A 3ROUA 3CUQC 1QPIA 2DO7A 3JRHA 2JA8J 4GYIA 3PJRA 1R00A 2VJ4A 2VT2A 1OKRA 4E7ZA 4WCGA 2IS2A 2W48A 3C1DA 2GXGA 2Y9ZA 1FC3A 2K7LA 4CH7A 1E2XA 3BG6A 4FCYA 1LFPA 3I64A 3EUHA 1TW2A 5EEGA 4EJWA 2HDWA 1R71A 1FY7A 1CGPA 4BL0B 3WHBA 2DK5A 3M8FA 4M9ZA 2XPUA 4X6AJ 2IVMA 3KEOA 4PJMA 1S7AA 3HRTA 1A04A 1VQ9I 2RQQA 1YW8A 3CTAA 3V8KA 3F21A 4E7LA 5K7FA 4AM3A 2Z2SB 1IN7A 2EWNA 3LSRA 4CXFA 1MBHA 1ZGAA 2R4GA 3C2GA 1PDNC 1NK2P 2NNNA 2YX4A 2HOEA 4JX6A 5JHUA 4FTHA 5LRSA 5JHFA 1LJ9A 5JR3A 4Z2YA 2E1MB 1OCZH 2DA4A 1K61A 1HDDC 2O03A 2ID6A 2Y69H 1R1TA 4XLNF 2Y0SN 2P4WA 4AD9A 2IRFG 1X4PA 3BG9A 1IDYA 4I01A 3W2WA 5GAEJ 5EYRA 4G6DA 4CYCB 1XX5A 2HOSA 2LYCA 2H8WA 1C0WA 2GOMA 2F5DA 1E3OC 3I4MJ 2DI3A 2UWMA 2GM4A 1HBXG 4LLLA 3I71A 4CCLA 3RZDJ 2JUGA 1I3AA 4KMUX 4B47A 1TNSA 1YRNB 2A07F 3HRSA 3LAJA 2VASA 2EFOA 2L4MA 2E7XA 5ILVA 1G59A 3FMQA 3MZ8A 3PSIA 5H6RA 3OYCA 3LWFA 3VFZA 3BJAA 1FIAA 5GTIC 3GCMA 2ZMEB 2ZXHA 1MSEC 1QBJA 1SD7A 3A0BC 1BR1A 2BGCA 3HGYA 1HKSA 1NHAA 1LVKA 1EH6A 2DQRA 4LOCA 1HW1A 4FASD 3JTHA 2M8EA 4OAZA 4DJAA 2VXZA 3JAMK 5CPRB 1GT0C 2ZFWA 4IHXA 1XB4A 3HIFA 1PUFB 1ZG5A 1IXRC 5CVVA 2HR3A 4WXHA 2ZFUA 1WSUA 3OL4A 3PQKA 5GPAA 2FQ3A 1KU9A 2F6CA 3IP4B 5CQEA 2HOAA 3BZCA 1T0FA 2R7WA 2W25A 1CF7A 1N25A 1OCRH 3F0CA 1PP8F 4Q47A 1G8XA 4Q48A 1JKPC 1NTCA 2OF7A 3KYCB 2XROA 1TT5B 2YR2A 3CLQA 3QYEA 1MNMC 2HNHA 5DYMA 2YUSA 1MDMB 1POGA 1QVUA 1ORKA 1EH8A 2FBIA 3R4KA 4BJ5C 1P6RA 2KZGA 2IT0A 2EK5A 3VODA 4Y52J 5DTDA 4NUBA 3L2CA 3ASOH 1GVJA 3GTPJ 1U9NA 1K78B 5F6FA 4V19K 4FT8A 1LPQA 3J7ZI 4C9YA 3M9AA 3NAUA 1FJLA 2QKLB 2FJ1A 1D8KA 1JKQC 2EIJH 5M5WJ 3PO2J 1A36A 2XPVA 3MCZA 2ETHA 2VI6A 1MH4A 3BTJA 5JFRA 2W7NA 1ZN2A 2HZTA 1RKWA 3TDZC 2MLGA 2VJIA 4C3HJ 4DBQA 2IGNA 3DLAA 4LB6B 2ZXWH 3PIPF 5CLSA 2XAQA 2DCEA 3E0JB 1J0RA 4F7ZA 3F8CA 5DUIA 1X1AA 3GZ6A 2W00A 4C2MJ 3G71I 2OA4A 2R7SA 2Q0OA 3ZR8X 2IBDA 3QYBA 2G9WA 3HKZA 2FSWA 1D5VA 4XONA 5GTHC 3NEUA 5JLWA 2HPIA 4OINF 2KFDA 1TWGJ 3BZ6A 1KU3A 3JRDA 2VODA 2NVQJ 2ZCWA 1BBYA 2VL8A 1IUFA 5JI6A 3IAS2 2QLZA 1YW9A 1ZG1A 3CP8A 2KPMA 2E35A 4KITB 4MEYF 2R7RA 2ZC2A 2DJIA 4OIPF 3K4NA 3W2AA 1J9IA 3H3ZA 2K02A 3SXYA 3CCRI 5BMZA 3L9FA 5LRRA 3IRQA 4EGYA 4FHTA 3RKYA 4B09A 3FXLA 1TZLA 3WTUC 4I76A 1JJ6C 3FKJA 4MQ9F 1USSA 2M5WA 4UVAA 5IOYA 5B5EC 5A2QZ 2V79A 1Z6TA 1O3RA 4XLHA 3OYLA 2VUMJ 3K4MA 3WE3A 3PFIA 2VQLA 2M4GA 4RBOA 4P55A 4J00A 2QENA 4I02A 3NRVA 3GYHX 3F22A 3RKXA 3Q0VA 2UUZA 1T98A 3A4CA 2X6XA 3MZYA 2ISYA 1ZKGA 3CCMI 2E60A 1P4XA 2R7XA 1IXSB 3D5LA 4ETSA 2YU3A 5F04A 4NC6A 2XAFA 1SAXA 1TW3A 3NQOA 3P7NA 2DMTA 4NQWB 2R5YA 1HC8A 3SJMA 4XORA 2ZNZA 3BCBA 1FOWA 2EFNA 1SFEA 5IP6A 5FFXA 2JPBA 1DGRM 1UJ8A 2QM3A 1TWHJ 1QU3A 4XLFA 5FKOA 2DODA 3H3VK 2IGOA 1IN8A 2DJNA 1KU7A 2F48A 3VB2A 3EETA 3G2BA 3OYEA 4HF0A 3GFJA 4BBRJ 3WTTC 3ELKA 1ZR2A 2IP2A 3H0GJ 4C30A 1BW5A 3LSMA 4A3MJ 1S5LC 3OYFA 3A01B 1MMGA 3LQQA 4UB8C 4H4KC 2A61A 5M3FJ 1PP7U 4RMNA 3TOAA 2DOFA 3EYYA 2A5YB 2M45A 2OC6A 2BE5F 3FK7A 1FTZA 2ZJ2A 2DMQA 2E1NA 1FSEA 4KT5C 1MBJA 3EUKL 1YJ9I 2RQPA 3ZMSA 4UNOA 2WAQA 4EM2A 1YYVA 2JWTA 2LY9A 3KP6A 1VTNC 1B72B 3OL3A 1XC5A 3T0YA 4L5IA 1MMDA 4P9FA 3R0AA 4P1WA 5LGUA 1Z3YA 2BY1A 3W3CA 2V1UA 3OYIA 1AKHA 1WPKA 3JRBA 2JSPA 2X85A 2KMUA 3CF5F 4M71A 1P7JA 3ASNH 5GPCA 1MH3A 2OUMA 5D5XB 3R0JA 1R23A 3MZHA 4RB2C 5E8GA 4IHSA 2MG4A 1UMQA 4HF1A 1YTYA 3ZMDA 1K7AA 1Y6IA 3A0HC 1R6RA 4QPQA 3TQNA 5J8CA 3VEPA 2EFQA 3I59A 3P9CA 2LMDA 4C3IJ 2CRGA 5BNGA 3BR5A 4GGGA 1SAUA 4XM3A 2GXAA 4DNCA 3B6CA 4ZZLA 5IP7J 3RKQA 1DUXC 2LREA 4JBAA 3IHUA 2M34A 1SFOJ 3KYLA 4A3LJ 1BM9A 2AHQA 3K1PA 3PUFA 2ELHA 3ZGKA 3DU6A 3I4NJ 4UXNA 4DZJA 2VKHA 5B66C 2MH9A 5FRMA 4UUTA 3OS2A 2DT6A 1EKEA 1X1CA 2PX9A 1IN5A 2KDOA 1JXSA 5K1YA 5ICFA 1VQKI 2JN6A 3H3UA 3FXRA 4B1RA 4I2OA 2EZHA 1OYWA 1Y8RB 3HKZN 4HW0A 1R58A 3E6DA 3WHCA 4HBLA 1GHCA 3PFYA 3SHFA 3KLNA 4C3JJ 3S1RJ 2HVSA 1ETVA 1SFXA 1MIJA 1WJBA 2DN0A 4N4NB 3FHZA 3E5QA 2EA2A 1K6OA 4CUGA 1ZGJA 4Y15A 5FO5A 4E7IA 4A3JJ 1S9HA 5FROA 2DMUA 2F5EA 2V1XA 2K3PA 1JUSA 1QA6A 1EH7A 1SFKA 2ACJA 4Q5SF 2L0KA 4KICA 1D0YA 2RVCA 4B43A 3QU6A 4CA0A 2HPMA 2JUCA 3BTLA 1D1CA 2F5FA 2EQRA 4QWQA 4QLCU 1QHGA 2QWWA 1FBUA 3G1MA 2JA7J 1YW7A 1AKHB 4GDFA 3F6OA 2ZKZA 1GV5A 1HQCA 4ITVA 2OTJI 2VN2A 4D7NA 1IRFA 4IVNA 4NC7A 4OOIA 4N4OB 1DU0A 2IW5A 2K4BA 3IH2A 3U21A 1ETQA 1V5EA 1WJCA 3GX4X 2QEXI 1CF7B 4KYWA 2QSGX 3CF2A 4KIFA 3E6BA 4L9JA 2KJCA 3P9IA 2D45A 4RM3A 4WXDA 5F1JA 3HZJA 4AIJA 2TRTA 2ELJA 2D5VA 3ESWB 4HRIA 1MBKA 4HNTA 2ZJQF 1W7PB 3BR3A 1YLFA 2EV5A 2L54A 2ICWG 4XICA 1DPRA 3J81Z 4A3FJ 3R60A 1JUPA 2M2EA 5D4SA 2L7KA 1SMYF 1V5GA 3JRIA 1ZREA 4O5VA 2K9MA 2L4AA 1WVRA 2W4SA 5E20A 1EA3A 1WFXA 1KU2A 2YSRA 3CZ6A 3S32A 3K4JA 2ME0A 3CCJI 1QHHD 2D1VA 1G6NA 3I59B 4N9HA 1X58A 2O7OA 4S05A 2GZWA 2PG4A 2DFFA 2DA6A 4HNVA 1MMAA 1O3TA 5ICCA 3ZN1A 1P2FA 1OMIA 2K40A 3AG1H 1K83J 3K6GA 4F3QA 2PI0A 1AA7A 4TV7A 1B72A 3HL2A 4HX7A 1OCCH 3WTXC 1MNEA 3S16J 2L3DA 1IZ1A 3DEWA 3MEXA 1DDNA 5KK1A 5LHHA 4ON0A 3MKZA 5K7HA 3KE2A 3M1CA 2O6GE 4A93J 1QZYA 1T39A 1TTYA 5FGMA 1JT6A 1OYYA 1XGOA 2CGPA 3HDDA 3ZMUA 5HVQC 1Y0NA 2M1BA 2B63J 2NVYJ 1MD0A 5K5RA 2V4JC 3DBHB 3KIOA 1LQ1A 1MNDA 4XLAA 3CCEI 2XSDC 4II3A 1IV8A 3BWGA 1WZ2A 1U5TA 1ITYA 5JVTA 2CFXA 2JRMA 3BOQA 3EQLF 1UCRA 3HTUA 4AU7A 3CCSI 3JRFA 1ETYA 5HOOA 2PJPA 2AXTC 1WJAA 4B4CA 4WK8F 2EJRA 1BC7C 3AL0B 2XHKA 2I5UA 2VKVA 4B3AA 1YG2A 1VQMI 2N8GA 2DBBA 1LKXA 2XF6A 4XRSG 4GCVA 1GUUA 1QPMA 3L2WA 3AAFA 1REPC 1YIJI 2H27A 1RETA 4FX4A 2M30A 3KP5A 4II2A 4HG2A 4LMYA 1ENHA 1G3TA 2BBYA 1D1AA 3H9GA 3FXJA 4KIBA 2COBA 1YS7A 3CMMA 3KP4A 3WG9A 1A31A 3BP8A 2CQQA 2DK8A 4BGDA 4G6QA 2AXLA 5L3GA 4XKVA 2AO9A 4PUSA 4BU2A 1WJEA 3GBGA 4NQWA 2J5PA 1LVAA 5E79C 3GTQJ 1MMNA 3DKXA 2K4JA 2F2EA 2IXSA 3GFLA 5HLGA 5HODA 3DKYA 2RKHA 4IKFA 1TWCJ 2JMWA 4B44A 3CJRB 1W5CC 1Y1VJ 1KZHA 2P5KA 3DCFA 5BS6A 3DWLE 1GLNA 1DP3A 1STZA 1FYKA 1WKMA 1XSDA 4D7MA 1Y39A 2VLAA 2DU9A 3F8FA 5L3EA 3DLLF 2MC4A 2XC7A 1OJLA 2STTA 4XIDA 1RUNA 1F4KA 3ZPLA 3KEYA 1YO5C 4FE7A 4I0BA 5J47A 4RGSA 3JRCA 3AKZA 3D5SC 3B02A 4CZZA 3TEDA 1WWXA 1HKTA 2L5QA 5F0CA 3REOA 1K4SA 3SFIA 1PYVA 2X48A 4J01A 4M6VA 4G7OF 2FOWA 3DKWA 4CO8A 1ERDA 1T56A 2H8RA 5CQGA 3UKGA 3HRMA 1FWZA 5EGOB 2IGKA 3KEQA 2CS3A 4EM0B 4M6XA 4A12A 4AIKA 5E1WA 3ZQIA 4A3BJ 3LFKA 5CVIA 5J8FA 2CQNA 4CCOA 4BE0A 1D8JA 1LDDA 4YRVA 4HV6A 3G6EI 2FA5A 3KP3A 2LLKA 4CSWA 3OYDA 1WH7A 4BBSJ 4YELA 5GP9A 3VPRA 4ENNA 2E2IJ 2CV0A 1S29A 1FOYA 2CO5A 4PDKA 1VQLI 2Q8KA 1R36A 4DIQA 4NDLA 5D5VB 3I0TA 2QGUA 1EF4A 3RI4A 2KLOA 5M3MJ 2LKPA 3FMRA 2CQXA 1A6QA 4CHUA 1SD4A 3JSOA 1APLC 2CW0F 1K79A 1ETOA 1U6GA 2KP6A 2MYSA 4UUSB 3ZP5A 1XMAA 2KIMA 1YIOA 1DQUA 2L9VA 4PJ0C 3B73A 3BJ6A 3U2RA 1J09A 1V55H 1W4MA 2DFEA 5CVRA 3TDUC 4YFXF 5K7ZA 5IYDJ 2ELKA 2A3SA 2D1HA 4YIIA 1S7EA 2JA5J 2EV6A 1SVOA 2JVHA 2STWA 2M8GX 4GO1A 3FMSA 3Q3SA 3ZRGA 1HCRA 2K85A 5CKTA 5LFAA 3SZGA 5GAGJ 4HSRA 1ZLJA 5C44J 1ON1A 4XKBA 4IPAA 1T95A 4YIFA 1N77A 3EUAA 3S15J 1E3HA 3OIPA 2M0CA 3FXOA 4QTRA 4X0GA 2DYRH 2HVQA 3CJNA 1T2KA 2XB5A 1FBSA 3IH3A 5L3CA 1WRJA 5DS9A 2A69F 3I4PA 1B1BA 3LNQA 2V26A 2GA1A 1RR8C 1ZH5A 3JW4A 4BE1A 1T0FC 5J4YA 3E3VA 2HYFA 5AIPA 1PUFA 3KPHA 3M07A 5FRNA 1WI3A 3CO6C 2ZNYA 3GTGJ 1XN7A 1N78A 5J40A 5LEKA 2L7MP 2R7ZJ 1O7LA 2CUJA 2GWRA 1ULYA 2ECCA 5E3LA 3MKWB 1W36C 5EG0B 3CDHA 3RDIA 1BIBA 3BZKA 1FSHA 2IJLA 5L3FA 1RNLA 2VQHA 4X1EA 1VZ0A 3O6BB 3VYSB 4HV5A 4XK4A 4G9YA 4KMFA 1EV7A 1MBGA 4LG3A 3HOWJ 3CJQB 2OZUA 3UNGC 4OIOF 3KZZA 1XDUA 5E17F 3OYHA 3CMYA 1AHDP 4XMYA 1WGXA 2BHYA 2BHZA 3MD2A 2KRFA 3HUGA 3IAM2 2VC1A 2Z5UA 4D5FA 4JOMA 3DV8A 3KP7A 3R61A 2DA3A 4BY7J 1IAWA 1HOMA 2HTJA 4RAFA 4L5JA 1YQAA 4R8HA 4MEXF 5HS9A 2DT7B 1R22A 2IA1A 3F9KA 4V2FA 2E19A 3D5RC 3J81K 2R92J 5C4XJ 3BDDA 3K70D 3BG3A 2DOEA 2HYJA 3I5UA 2EZIA 1IV6A 3EDPA 1XTAA 1OFCX 3HEFA 1AU7A 5F27A 4DYCA 2CG4A 4DZPA 3S3MA 4PGHA 2AQEA 2VQGA 1Z21A 1FOKA 1G4DA 5FKNA 1Z3XA 2R0QC 3BC8A 2O8XA 2PMUA 2A68F 3CESA 3LSHA 4P96A 3VWBA 4HAMA 1FYMA 2LY1A 1X19A 3ABKH 2BW3A 4UY8I 2K9LA 3ZQFA 2KIQA 1VQ7I 3M8JA 2O5RA 3E7LA 4BXXJ 5EJCA 4LGWA 3TP0A 2PMZA 3FXQA 1HDPA 1XCBA 3L09A 4PSWA 3ZMVA 3COAC 4E7HA 3GO5A 1XMXA 2Z3YA 4L5EA 4OU0A 5HDGA 1JE8A 3FBNB 3K4LA 4ZYGA 2VBZA 4HX8A 4F93B 1LE8A 4XSZF 3CCQI 3JSPA 2OU2A 2XASA 4EGZA 5HDNA 1OISA 2RNGA 1MJ9A 3OY9A 3ZN0A 5LGTA 1OR7A 1HW2A 2P6SA 3FISA 3KZYA 4A5NA 5DCMA 4BKXA 1FNNA 4ENJA 2BV6A 3U9GA 5F64A 3PL8A 3CC4I 1ZK8A 2EZKA 1XGMA 3HJEA 1ZR4A 3GTJJ 5FJ8J 4XOTA 4GXOA 1RRJA 5DD4A 2QVOA 3HSEA 3I3LA 1FX7A 2VBWA 4LIUA 4DOZA 5EEAA 1Z77A 1SANA 1J75A 2HI3A 2YS9A 1JJ8C 1I5ZA 1KGSA 2XGXA 5HNFA 3E5XA 5JVGF 3K4KA 1XMKA 1YITI 2YU9J 2QBYA 1R9TJ 4EMSA 4ZDOA 5HDKA 1SC7A 4ENKA 2CV2A 4KIGA 2Z16A 2XKPA 1X2MA 2IGMA 1AWCA 1ZELA 1XS9A 2ZSIB 5HLIA 2QKMB 4XN0A 2XF5A 3I54A 4MIMA 4RAZA 2OAZA 1I39A 4KA4A 2MD0A 5DEQA 5E1XA 3VDXA 2DA7A 3MFKA 4LLGF 2R7VA 1V54H 1FMWA 4HZFA 4ZJZA 1WJ5A 1X2NA 3LA2A 1WCMJ 3FK6A 5D4RA 2IS6A 1TNTA 3SEZA 2DOAA 4BYYA 1KA8A 1FTTA 2X6OA 4IO9F 4LG0A 4KT6A 3BT9A 3H5AA 4BQNA 2HYGD 2FU4A 2H6CA 1KQ0A 1RKTA 2JTVA 1B6AA 2E2HJ 4EM1A 3LSPA 1VQNI 3X2QH 5ED4A 4IHVA 3RJPA 5D6FA 1O57A 3RQIA 3H5NA 4A3KJ 4IJAA 4KDPA 4IRIA 2XSJC 1T33A 1TQPA 3OR1C 4FE4A 3IUOA 2VE9A 4XKWA 2NVUB 3LMMA 2VJ5A 2LF8A 1LEAA 2WV0A 4CCKA 4ZYHA 2BVLA 1K4TA 2B9SA 3ZXSA 4PK4A 5KHDA 1DU6A 1H0MA 1FBQA 4A69C 2W24A 3LA3A 4Z6YA 4BHBA 3QWLA 2JPCA 2OJED 1TT0A 3GEZA 2NNYA 4HQEA 3OYMA 5C3EJ 3Q0WA 1VQ6I 5FB2A 3U1KA 1O4XA 2F5CA 4HF2A 3K69A 2FBKA 2V6CA 3CCLI 3VOEA 4U7DA 4O3MA 1Y56A 3L7WA 1LNWA 2HQAA 2K9NA 2KISA 3O2PE 1VQ8I 4RAGA 4OIQF 2KJBA 3P9KA 2X1CA 2DA2A 1ZRDA 3DEEA 5KCMA 2G7UA 1BW6A 1W0TA 2GIVA 5D8KB 3DBLB 4ENMA 4XKCA 3GUDA 1X3WB 1VFCA 4A0XA 3G1OA 1MJAA 2XAHA 4DYQA 1IN4A 2KIUA 3Q9VA 4A6EA 1H88C 3I58A 3L2QA 3CMAI 1IW7F 4S0HB 2Q2EB 2E71A 5DCFA 3PM1A 3K7AJ 2M7AA 5EEHA 1P4AA 2HGCA 3H92A 2MSYA 3BG5A 3RSNA 4W97A 3V8JA 1FP1D 2GLOA 1G2HA 4HDVA 5KVRA 4CCJA 4M74A 1B9NA 3KCCA 2BEOA 2QQ8A 4ZC3A 2M7BA 3RPQA 3HG9A 3F8BA 4M3DA 4M73A 1W7PA 4UV8A 5KAFC 1RIOH 2LG4A 3ECOA 2EA4A 2F4MB 2MH2A 4M72A 2HXIA 2A6HF 3W6VA 3S8PA 1IXCA 1LE8B 4RGUA 3GVAA 4Y33A 2O3FA 1ZARA 5HS7A 4HEA2 3ZMTA 4Y17A 4M9XA 4LK0F 2FNPA 3G3ZA 2L02A 3QPSA 3BY6A 3FXMA 2NS8A 2OBPA 3PNVA 1TWAJ 1B8IB 1VNDA 3GF2A 3OOPA 3CCUI 5J1UA 1KQ9A 1RI7A 1BC8C 4EJUA 2ZXIA 2QA4I 2Y9YA 3V7SA 1W0UA 1ZRFA 4M3EA 3I53A 3S1MJ 4MLOA 2XAGA 2VC0A 1U2WA 2X4HA 4ANJA 4HOBA 3J7AO 2XVCA 2UXNA 1IDZA 3OYBA 1VF9A 3CLOA 1HA8A 4MFDA 3K4BA 5H20A 2EZLA 1S8NA 2ZB9A 2KT0A 4QSHA 4MO7A 1I50J 4H0EA 1YX5A 2H94A 3KFWX 5FD5A 3BR6A 3RKWA 3OSGA 1Y1WJ 3GTLJ 3M8EA 3FZVA 3V7CA 2CU7A 2P81A 3K0LA 4UHTA 2FE3A 3W6JB 4RA2A 5L3BA 1B59A 3AFHA 4ZH4F 2VBXA 3K4CA 2L7FP 2W85A 1JUMA 5IT9K 1A5JA 2EB7A 1X3UA 2L9NA 3MAJA 3RTRA 2L9SA 1QRYA 3WTSC 3A2KA 2FXAA 3J7AY 2O61A 3ABMH 1XDSA 2LBFB 2D2WA 3F6VA 1BJAA 1LDJA 4AIHA 2CWEA 1X1DA 3F23A 3PNTA 4MFEA 3SQNA 2QSFX 2X1DA 4YEJA 3SFZA 1NK3P 1IRXA 2PLYA 3H9JA 3E1SA 2XIGA 2R93J 2DMPA 1TWFJ 3GMEA 1Z7UA 3KLOA 2CW8A 2VB6A 4PFPA 5IYCJ 3C3WA 1J5YA 1ETKA 4B48A 3FBIB 4LD5A 4RM2A 1YOVB 3O3KA 2OQGA 3SDBA 3WE2A 3GWZA 4AIDA 2IEKA 3CCVI 1IRGA 4HLXA 1MDMA 4AVZA 1XPXA 2LC2A 5KAIC 4N9IA 1U5TB 2OZ6A 2MABA 3A02A 4UVBA 3E6CC 4HSTA 2JJ7A 2GAUA 1FYLA 2EIKH 4LITA 3TP3A 4L18B 3M1EA 3DBRB 4G94A 1SMTA 1ODDA 4IRGA 1S72I 3HB9A 2XRNA 2FUG2 5AONA 3H5RA 2DA5A 3VYTB 1H89C 5BOXA 1GVDA 1FT9A 2A6TA 1DPUA 5E3NA 1R4MB 5DM6F 3CUOA 4ZZDA 1IG7A 1XSXA 4FISA 3J80Z 5EZHA 4J19A 2DFHA 1HLVA 1RC9A 2HTSA 2M4KA 1BOBA 3FWEA 4PGGA 5DM7F 2PMHA 5LGNA 5TJJA 2RV8A 4R79A 4LLNA 4F92B 1OCOH 2V9KA 4ESBA 3HRUA 3HGGA 4HYEA 4U87A 2XPWA 2P7VB 4DBRA 3GZ5A 4OAYA 2RGVA 1YE9A 2O9LA 3WGGA 4A0ZA 2QQ9A 2Y2ZA 4XQFA 3LL7A 2NVTJ 2R5YB 3BJOA 1ZAOA 3QOEA 4U0YA 2LKSA 4OIRF 4KNYA 3FXUA 4HNUA 1ZLKA 3DP7A 5AIQA 1LEBA 2E1CA 2BY3A 1ETXA 3V8LA 2DAOA 4P9UA 3DU5A 2VXDA 3AG3H 1T8IA 1B4AA 3OYGA 3HSFA 3JAMZ 3H36A 1FP2A 3C18A 1WHUA 4LG0B 3FM5A 2E2JJ 3OIQA 2BY0A 1JGSA 2PQ8A 2NS0A 4XL9A 4BDZA 4UB6C 4BS9A 4A0YA 1O3QA 1JI8A 3CUQA 5B1BH 3BQYA 3K70C 3GLXA 1IO2A 1BJZA 3RYRA 3QQAA 4A3GJ 1I1SA 1Z05A 1BI3A 2E7WA 3HC7A 2VE8A 3IC7A 4XRFA 3C2BA 3TKYA 2NS7A 1K6YA 2R7QA 4N0BA 1BI2A 1U9OA 4M3GA 5CYVA 2VIXA 3ABUA 2JA6J 4PSXA 2WBMA 3P5JA 4RLQA 1RESA 4B8XA 3RPUD 1XGSA 4AYBA 2WTEA 3DQVC 5IP9J 1Z9CA 2XAJA 2XUBA 4IZZA 2HDDA 5DCMB 3OYNA 1I6XA 5DD8A 2KZVA 2IS4A 5L3DA 4ZYEA 2WB1N 1R1UA 3L2VA 1R7JA 3TO9A 2P0WA 5F0HA 1ZHFA 4HPQA 2A5WA 2LK2A 4PJJA 1USTA 1DP7P 3BR2A 2YX7A 3DTIA 4KUMA 1O7FA 2I8DA 3HOYJ 4BNCA 1VQ4I 1MW7A 3BQZA 3QU3A 5IT3A 2XGCA 2FMYA 2BXZA 2CFOA 2FMLA 1QO0D 1U5TC 2NXNB 2X1EA 4RAYA 3WG7H 3M7GA 2ESHA 1MMSA
chains in the Genus database with same CATH topology
1FPQA 2DPUA 5E8IA 5A2QK 2P5VA 1HSJA 3F8MA 2VT3A 2ESNA 2QBYB 1R5HA 2CYYA 2K27A 1U3EM 4L9NA 2AS5F 1BOAA 2NRAC 1G3WA 4O6JA 2ZBKA 1HKQA 3WTZA 3S2WA 2MBFA 3CO7C 1TLHB 3ZQ7A 4AVPA 3GW2A 3SZTA 3U1DA 1MGTA 4P5OA 4NHJA 3OV8A 2ADUA 3J80K 4LFUA 2YPRA 2Z9OA 1Y0UA 2ISZA 2RNJA 3T8TA 4U7BA 2QUFA 4G7HF 4KN7X 3LQRA 3QPTA 5TRDA 4EJOA 5ILUA 2HEOA 3IWFA 1U78A 3QOPA 4NB5A 3F8NA 3T5XA 4RGXA 3WODF 2VONA 2HFHA 2XKOA 3LA7A 2UZKA 1XD7A 2WC2A 2W57A 2KKOA 2IA0A 4UV9A 3QRFF 3E97A 3HHHA 2Z99A 3FM3A 1G3SA 1S7OA 4XLPF 2Y48A 5DUKA 3T1BA 1QQIA 4EJTA 4MTDA 1ZG3A 4UUVA 4I7HA 3N97A 2X0LA 5BQTA 1UHMA 2R7DA 2ZXJA 5FLXK 1I27A 4ASNA 3K9TA 3QAHA 2FRHA 2MD5A 2QYOA 3ZMVA 4KN4X 5CJ9A 2IA2A 2PBIA 1SFUA 2A6EF 5D8LB 5D5WB 4M9SA 6PAXA 4IRHA 4L0YB 2P7CB 3ML6A 5CVUA 3E6MA 2LSOA 1ZYRF 1BI0A 1Q1HA 4JQFA 4MQVA 3GFMA 3BPXA 2RC4A 3TO7A 2XV4S 3ERED 5LHGA 4G7ZF 2W84A 3DFGA 1XGNA 1I1GA 4LB5A 2H6BA 2JZYA 2HQRA 1S6LA 1V3FA 3DF8A 5FFZA 4BAYA 1AOYA 3HYIA 1U8RA 3Q9SA 1H9TA 4RB3C 4CDGA 3WGHA 1ZRCA 1OYIA 2CQKA 3ZMZA 3ISPA 3RPUA 2ZO4A 1F5TA 4MNUA 4WX9A 2IPQX 3KP2A 1HSTA 3WTWC 1G3YA 4S04A 4A2UA 1R1VA 1W5SA 3TO6A 1V4RA 5CVJA 2UXXA 2PEXA 4LJZF 4G8XA 3QP6A 2COMA 3IWZA 4U88A 1O3SA 3DPLC 1FZPB 2VBYA 5HS8A 2KIFA 3WTVC 2PN6A 3F72A 2FNAA 5K5OA 5D5UB 1KQ8A 4WXCA 5DV5A 4L9VA 4BHCA 2HKOA 3CUQB 1OPCA 3IKVA 1UB9A 2GQQA 1R5GA 2DQLA 1UFMA 3RIRA 4U0WA 1YS6A 2OQRA 4FX0A 4CICA 1FLIA 1WQ2A 3HTSB 2HDCA 2HKXA 3WU1B 2C6YA 1HXDA 2FF4A 5K5QA 2NAZA 3QPHA 2M87A 2H09A 2BYVE 4Y13A 3F3XA 4XSXF 3GFIA 4U0VA 5IT9Z 5ICEA 3KETA 3BROA 1IN6A 3IKTA 2JRTA 4OMYA 2DFIA 3V4GA 5J6XA 2J5OA 2P6TA 1TBXA 2EFPA 2JT1A 2GXBA 2G7HA 2K86A 2VOOA 2MA3A 4UVCA 3WU0A 1D3YA 3G73A 4ESFA 1L3LA 5D6EA 1MKMA 4HX4A 1L0OC 1QZZA 1MZBA 1J7KA 1XSVA 1QGPA 1E17A 1J2XA 1ON2A 3GXOA 4XBFA 2MLKA 1H9GA 1XCVA 5BPDA 4YFNF 4I0AA 4HQMA 5BPIA 4M6YA 2TDXA 5ERIA 4AWXB 3MWMA 4BQAA 1TQMA 2V1DA 4RS8A 1IUYA 3K1NA 2MC3A 2HS5A 2FEZA 4JK1X 4L9TA 4IHTA 3LAPA 3C7JA 1S3JA 2L01A 2FBHA 5FD6A 1YFHA 3MQ0A 1F1ZA 2DW4A 4DQ2A 1P92A 4GYGA 2JSCA 2Z33A 4BXUA 2HQNA 2V9VA 1LDKB 4BH9A 4EJVA 1KYWA 3PQJA 1W5TA 4WF2A 3D0SA 2DTRA 1P4WA 4I09A 2RDPA 5ILSA 3ECHA 1Z6RA 1GXPA 4MTEA 1KYZA 2R3SA 4KFCA 3SZPA 4R1HA 1W7PD 2RN7A 5HLHA 1UHWA 3IL2A 1JHHA 4EVIA 2DT5A 3WGIA 2DLLA 3TGNA 4EV0A 1WI9A 4BHPA 3FX3A 2R7FA 2GA2A 1BI1A 3DPTA 3BPVA 2P5LC 2LF7A 3E5UA 4RB0A 4EQQA 4IF4A 5ICGA 1T6SA 5LHIA 5E18F 4K2EA 2Q2EA 4PZJA 2CSOA 5FLXZ 1K78A 4YG2F 2Y0MA 3QP5A 4MGRA 3Q5FA 3HSRA 3IRRA 2ZMEA 3HOTA 2QQBA 3EYIA 1PUEE 4CGZA 3L00A 4RGRA 4RB1A 1J59A 2QQAA 4YFKF 4Q4ZF 1F9NA 2WWYA 3DXJF 2LNBA 2P8TA 2OD5A 3V7RA 3N4MA 2LDUA 4OMZA 4D0PA 5LLQA 1TQIA 2PFBA 1QNTA 4L0ZB 1RZ4A 5E1ZB 3DEUA 4ESJA 3TOBA 5LBQA 3ABTA 2Y75A 3ULQB 3R6SA 1JHFA 2NYXA 4HDUA 3K1MA 1HW5A 3LSTA 1Z91A 2B0LA 4HLYA 2EFWA 4MHGA 1RUOA 5LEJA 1B9MA 3FF5A 1GXQA 1SD6A 4WWCA 3RYPA 1MJBA 2DPDA 2O0YA 4IXAA 4PCQA 1Z1DA 5H6QA 4CYDA 5DDGA 1ONVA 4A6DA 3T8RA 1T38A 2VOPA 1BIAA 3WTYC 3HHGA 4I98B 4A5MA 3HOSA 2HWVA 4LK1F 1BN5A 4E70A 4ZYDA 4HA8A 1SD5A 3JTGA 3W6KB 2QZ8A 2FOKA 5F1RA 1LB2A 2EV0A 3K2ZA 1IF1A 3ROUA 3CUQC 2DO7A 4GYIA 1R00A 4WCGA 2VT2A 1OKRA 3C1DA 2GXGA 1FC3A 2K7LA 1E2XA 3I64A 3EUHA 1TW2A 5EEGA 4EJWA 1FY7A 1CGPA 2DK5A 3M8FA 4M9ZA 2IVMA 3KEOA 1S7AA 3HRTA 1A04A 1YW8A 3CTAA 3V8KA 3F21A 1IN7A 2EWNA 4CXFA 1ZGAA 1PDNC 2NNNA 2YX4A 2HOEA 5JHUA 5LRSA 1LJ9A 5JR3A 4Z2YA 2O03A 1R1TA 4XLNF 2P4WA 4AD9A 2IRFG 4I01A 4G6DA 1C0WA 2F5DA 2DI3A 2UWMA 1HBXG 4LLLA 3I71A 4KMUX 1TNSA 2A07F 3HRSA 3LAJA 2EFOA 2L4MA 2E7XA 5ILVA 3FMQA 5H6RA 3LWFA 3VFZA 3BJAA 1QBJA 2ZMEB 1SD7A 2BGCA 1HKSA 1NHAA 2DQRA 1EH6A 1HW1A 3JTHA 2M8EA 2VXZA 3JAMK 2ZFWA 1XB4A 3HIFA 1ZG5A 1IXRC 5CVVA 2HR3A 4WXHA 1WSUA 3PQKA 2FQ3A 1KU9A 1T0FA 2W25A 1CF7A 1PP8F 4Q47A 4Q48A 2XROA 2YR2A 5DYMA 1MDMB 1EH8A 2FBIA 3R4KA 1P6RA 2IT0A 2EK5A 3VODA 3L2CA 1GVJA 1K78B 5F6FA 4FT8A 3M9AA 1D8KA 3MCZA 2ETHA 5JFRA 1ZN2A 2HZTA 3TDZC 2MLGA 4LB6B 5CLSA 2XAQA 4F7ZA 5DUIA 1J0RA 3F8CA 3GZ6A 2OA4A 2Q0OA 2G9WA 2FSWA 1D5VA 3NEUA 4OINF 3BZ6A 1KU3A 2VODA 2ZCWA 1BBYA 5JI6A 2QLZA 1YW9A 1ZG1A 4MEYF 4OIPF 1J9IA 3H3ZA 2K02A 3SXYA 5BMZA 3L9FA 5LRRA 3IRQA 4EGYA 4FHTA 3RKYA 4B09A 3WTUC 4MQ9F 1USSA 2M5WA 4UVAA 5A2QZ 2V79A 1Z6TA 1O3RA 3WE3A 3PFIA 4P55A 2QENA 4I02A 3NRVA 3GYHX 3F22A 3RKXA 1T98A 3MZYA 2ISYA 1P4XA 1IXSB 3D5LA 4ETSA 2YU3A 1SAXA 2XAFA 1TW3A 3NQOA 3P7NA 2ZNZA 2EFNA 1SFEA 5FFXA 2JPBA 2QM3A 1IN8A 1KU7A 3VB2A 3EETA 4HF0A 3GFJA 3WTTC 3ELKA 2IP2A 3LQQA 2A61A 1PP7U 3TOAA 3EYYA 2A5YB 2M45A 2BE5F 2ZJ2A 2E1NA 1FSEA 4KT5C 2RQPA 3ZMSA 4UNOA 4EM2A 1YYVA 1VTNC 3KP6A 3T0YA 4L5IA 4P9FA 3R0AA 5LGUA 2V1UA 4M71A 5D5XB 3R0JA 1R23A 3MZHA 4RB2C 5E8GA 4IHSA 4HF1A 1YTYA 3ZMDA 1K7AA 3TQNA 5J8CA 3VEPA 2EFQA 3I59A 3P9CA 4GGGA 4DNCA 4ZZLA 1DUXC 4JBAA 3IHUA 1BM9A 3K1PA 2ELHA 4UXNA 2MH9A 1IN5A 1JXSA 5K1YA 5ICFA 3H3UA 3FXRA 4I2OA 1OYWA 4HW0A 1R58A 3E6DA 1GHCA 4HBLA 3SHFA 3KLNA 1SFXA 3FHZA 3E5QA 2EA2A 1K6OA 1ZGJA 4Y15A 5FO5A 2F5EA 2V1XA 1EH7A 2ACJA 4Q5SF 4KICA 2RVCA 3QU6A 2F5FA 4QWQA 4QLCU 2QWWA 1FBUA 1YW7A 3F6OA 2ZKZA 1HQCA 2VN2A 1IRFA 4IVNA 4OOIA 2IW5A 2K4BA 3GX4X 1CF7B 4KYWA 4KIFA 3E6BA 4L9JA 2KJCA 3P9IA 2D45A 4WXDA 4AIJA 1W7PB 1YLFA 2EV5A 2L54A 1DPRA 3J81Z 3R60A 5D4SA 1SMYF 1ZREA 4O5VA 2L4AA 5E20A 1KU2A 2YSRA 2D1VA 3I59B 1G6NA 4N9HA 4S05A 2GZWA 2PG4A 1O3TA 5ICCA 3ZN1A 1P2FA 1OMIA 2PI0A 4TV7A 4HX7A 3WTXC 2L3DA 1IZ1A 3MEXA 1DDNA 5KK1A 5LHHA 4ON0A 3KE2A 2O6GE 1QZYA 1T39A 1TTYA 5FGMA 1OYYA 2CGPA 1XGOA 3ZMUA 5HVQC 2M1BA 1MD0A 5K5RA 1LQ1A 3BWGA 1U5TA 5JVTA 2CFXA 3BOQA 3EQLF 1UCRA 3HTUA 5HOOA 2PJPA 4WK8F 2EJRA 1BC7C 2XHKA 1YG2A 2DBBA 4GCVA 1QPMA 1REPC 3AAFA 2H27A 4FX4A 2M30A 3KP5A 4LMYA 1G3TA 2BBYA 4KIBA 3WG9A 1YS7A 3KP4A 3BP8A 2DK8A 4G6QA 2AXLA 5L3GA 4NQWA 2J5PA 1LVAA 2K4JA 2F2EA 3GFLA 5HLGA 2RKHA 2P5KA 5BS6A 1STZA 1FYKA 1WKMA 1XSDA 2DU9A 3F8FA 5L3EA 2STTA 1RUNA 1F4KA 3ZPLA 1YO5C 4I0BA 4RGSA 3B02A 4CZZA 1WWXA 1HKTA 3REOA 4G7OF 3DKWA 4CO8A 3HRMA 1FWZA 3KEQA 4EM0B 4M6XA 4A12A 4AIKA 5E1WA 3LFKA 5CVIA 5J8FA 1D8JA 1LDDA 4HV6A 2FA5A 3KP3A 4ENNA 1S29A 4PDKA 2CO5A 2Q8KA 1R36A 5D5VB 3I0TA 3RI4A 4CHUA 2LKPA 3FMRA 1SD4A 3JSOA 2CW0F 1K79A 1U6GA 3ZP5A 1XMAA 2KIMA 1YIOA 3B73A 3BJ6A 3U2RA 1W4MA 5CVRA 3TDUC 4YFXF 2A3SA 2D1HA 4YIIA 2EV6A 2STWA 4GO1A 3FMSA 1ZLJA 1ON1A 4IPAA 4YIFA 3CJNA 1T2KA 1FBSA 5L3CA 1WRJA 2A69F 3I4PA 1B1BA 2GA1A 1ZH5A 3JW4A 3E3VA 2HYFA 5AIPA 3CO6C 2ZNYA 1XN7A 5LEKA 1O7LA 2GWRA 1ULYA 3CDHA 3RDIA 1BIBA 1FSHA 2IJLA 5L3FA 1RNLA 3O6BB 4HV5A 4G9YA 4KMFA 1EV7A 4OIOF 2OZUA 3KZZA 1XDUA 5E17F 2KRFA 3HUGA 2VC1A 2Z5UA 3DV8A 3KP7A 3R61A 1IAWA 2HTJA 4L5JA 1YQAA 4R8HA 4MEXF 5HS9A 1R22A 2IA1A 3J81K 3BDDA 3I5UA 3EDPA 2CG4A 4PGHA 1FOKA 1G4DA 2PMUA 2O8XA 2A68F 4P96A 4HAMA 1FYMA 4LGWA 3FXQA 1XCBA 3L09A 3COAC 3GO5A 2Z3YA 4OU0A 5HDGA 1JE8A 4ZYGA 2VBZA 4HX8A 4XSZF 3JSPA 2OU2A 2XASA 4EGZA 5HDNA 1MJ9A 3ZN0A 5LGTA 1OR7A 1HW2A 2P6SA 4A5NA 3KZYA 5DCMA 1FNNA 4ENJA 2BV6A 3U9GA 5F64A 1XGMA 4GXOA 5DD4A 2QVOA 3HSEA 1FX7A 2VBWA 1J75A 1I5ZA 1KGSA 2XGXA 3E5XA 1XMKA 2QBYA 4EMSA 5HDKA 4ENKA 4KIGA 2XKPA 1AWCA 5HLIA 3I54A 4RAZA 2OAZA 4KA4A 5DEQA 5E1XA 3MFKA 4LLGF 4HZFA 3LA2A 5D4RA 1TNTA 4BYYA 1KA8A 4LG0A 2HYGD 2FU4A 2H6CA 1KQ0A 2JTVA 1B6AA 4EM1A 5ED4A 3RJPA 5D6FA 1O57A 4IJAA 4KDPA 4IRIA 1TQPA 2VE9A 2LF8A 1LEAA 2WV0A 4ZYHA 1H0MA 1FBQA 2W24A 3LA3A 4BHBA 2JPCA 3GEZA 2NNYA 4HQEA 5FB2A 2F5CA 4HF2A 3K69A 2FBKA 2V6CA 3VOEA 4U7DA 4O3MA 3L7WA 1LNWA 3O2PE 4OIQF 2KJBA 3P9KA 1ZRDA 2G7UA 2GIVA 5D8KB 4ENMA 3GUDA 4A0XA 1MJAA 2XAHA 1IN4A 2KIUA 3Q9VA 4A6EA 3I58A 1IW7F 5DCFA 5EEHA 1P4AA 2HGCA 3H92A 3V8JA 1FP1D 4HDVA 5KVRA 4M74A 1B9NA 3KCCA 2BEOA 3RPQA 3F8BA 4M73A 1W7PA 4UV8A 1RIOH 3ECOA 2EA4A 2MH2A 4M72A 2A6HF 1IXCA 4RGUA 3GVAA 2O3FA 1ZARA 5HS7A 3ZMTA 4Y17A 4M9XA 4LK0F 2FNPA 3G3ZA 2L02A 3BY6A 2OBPA 3GF2A 3OOPA 1KQ9A 1RI7A 1BC8C 4EJUA 3V7SA 1ZRFA 3I53A 2XAGA 2VC0A 1U2WA 2X4HA 4HOBA 3J7AO 2XVCA 2UXNA 3CLOA 5H20A 1S8NA 4H0EA 2H94A 3KFWX 5FD5A 3RKWA 3M8EA 3FZVA 3V7CA 3K0LA 4UHTA 2FE3A 3W6JB 5L3BA 1B59A 4ZH4F 2VBXA 2W85A 5IT9K 2EB7A 1X3UA 3MAJA 3RTRA 3WTSC 2FXAA 2O61A 1XDSA 2D2WA 3F6VA 1BJAA 1LDJA 4AIHA 2CWEA 3F23A 3SQNA 3SFZA 2PLYA 2XIGA 1Z7UA 3KLOA 3C3WA 1J5YA 4LD5A 3O3KA 2OQGA 3WE2A 3GWZA 1IRGA 4HLXA 1MDMA 4N9IA 1U5TB 2OZ6A 4UVBA 3E6CC 2GAUA 1FYLA 4L18B 3M1EA 4G94A 1SMTA 1ODDA 4IRGA 2XRNA 5AONA 5BOXA 1FT9A 1DPUA 3CUOA 4ZZDA 1XSXA 3J80Z 2HTSA 4PGGA 3FWEA 2PMHA 5LGNA 5TJJA 2RV8A 4R79A 4LLNA 4ESBA 3HRUA 4HYEA 2P7VB 3GZ5A 2RGVA 3WGGA 4A0ZA 2QQ9A 3BJOA 1ZAOA 4U0YA 4OIRF 4KNYA 3FXUA 1ZLKA 3DP7A 5AIQA 1LEBA 2E1CA 3V8LA 2DAOA 4P9UA 1B4AA 3HSFA 3JAMZ 1FP2A 3C18A 4LG0B 3FM5A 1JGSA 2PQ8A 2NS0A 1O3QA 4A0YA 3CUQA 3GLXA 3RYRA 1I1SA 1Z05A 1BI3A 2E7WA 2VE8A 3IC7A 4XRFA 3TKYA 4N0BA 1BI2A 5CYVA 3ABUA 4B8XA 1XGSA 2WTEA 3DQVC 1Z9CA 2XAJA 2XUBA 5DCMB 1I6XA 5DD8A 5L3DA 4ZYEA 1R1UA 1R7JA 3TO9A 1ZHFA 1USTA 1DP7P 2YX7A 4KUMA 1O7FA 4BNCA 3QU3A 5IT3A 2FMYA 2FMLA 1QO0D 1U5TC 4RAYA 3M7GA 2ESHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPQ A;  2DPU A;  5E8I A;  5A2Q K;  2P5V A;  1HSJ A;  3F8M A;  2VT3 A;  2ESN A;  2QBY B;  1R5H A;  2CYY A;  2K27 A;  1U3E M;  4L9N A;  2AS5 F;  1BOA A;  2NRA C;  1G3W A;  4O6J A;  2ZBK A;  1HKQ A;  3WTZ A;  3S2W A;  2MBF A;  3CO7 C;  1TLH B;  3ZQ7 A;  4AVP A;  3GW2 A;  3SZT A;  3U1D A;  1MGT A;  4P5O A;  4NHJ A;  3OV8 A;  2ADU A;  3J80 K;  4LFU A;  2YPR A;  2Z9O A;  1Y0U A;  2ISZ A;  2RNJ A;  3T8T A;  4U7B A;  2QUF A;  4G7H F;  4KN7 X;  3LQR A;  3QPT A;  5TRD A;  4EJO A;  5ILU A;  2HEO A;  3IWF A;  1U78 A;  3QOP A;  4NB5 A;  3F8N A;  3T5X A;  4RGX A;  3WOD F;  2VON A;  2HFH A;  2XKO A;  3LA7 A;  2UZK A;  1XD7 A;  2WC2 A;  2W57 A;  2KKO A;  2IA0 A;  4UV9 A;  3QRF F;  3E97 A;  3HHH A;  2Z99 A;  3FM3 A;  1G3S A;  1S7O A;  4XLP F;  2Y48 A;  5DUK A;  3T1B A;  1QQI A;  4EJT A;  4MTD A;  1ZG3 A;  4UUV A;  4I7H A;  3N97 A;  2X0L A;  5BQT A;  1UHM A;  2R7D A;  2ZXJ A;  5FLX K;  1I27 A;  4ASN A;  3K9T A;  3QAH A;  2FRH A;  2MD5 A;  2QYO A;  3ZMV A;  4KN4 X;  5CJ9 A;  2IA2 A;  2PBI A;  1SFU A;  2A6E F;  5D8L B;  5D5W B;  4M9S A;  6PAX A;  4IRH A;  4L0Y B;  2P7C B;  3ML6 A;  5CVU A;  3E6M A;  2LSO A;  1ZYR F;  1BI0 A;  1Q1H A;  4JQF A;  4MQV A;  3GFM A;  3BPX A;  2RC4 A;  3TO7 A;  2XV4 S;  3ERE D;  5LHG A;  4G7Z F;  2W84 A;  3DFG A;  1XGN A;  1I1G A;  4LB5 A;  2H6B A;  2JZY A;  2HQR A;  1S6L A;  1V3F A;  3DF8 A;  5FFZ A;  4BAY A;  1AOY A;  3HYI A;  1U8R A;  3Q9S A;  1H9T A;  4RB3 C;  4CDG A;  3WGH A;  1ZRC A;  1OYI A;  2CQK A;  3ZMZ A;  3ISP A;  3RPU A;  2ZO4 A;  1F5T A;  4MNU A;  4WX9 A;  2IPQ X;  3KP2 A;  1HST A;  3WTW C;  1G3Y A;  4S04 A;  4A2U A;  1R1V A;  1W5S A;  3TO6 A;  1V4R A;  5CVJ A;  2UXX A;  2PEX A;  4LJZ F;  4G8X A;  3QP6 A;  2COM A;  3IWZ A;  4U88 A;  1O3S A;  3DPL C;  1FZP B;  2VBY A;  5HS8 A;  2KIF A;  3WTV C;  2PN6 A;  3F72 A;  2FNA A;  5K5O A;  5D5U B;  1KQ8 A;  4WXC A;  5DV5 A;  4L9V A;  4BHC A;  2HKO A;  3CUQ B;  1OPC A;  3IKV A;  1UB9 A;  2GQQ A;  1R5G A;  2DQL A;  1UFM A;  3RIR A;  4U0W A;  1YS6 A;  2OQR A;  4FX0 A;  4CIC A;  1FLI A;  1WQ2 A;  3HTS B;  2HDC A;  2HKX A;  3WU1 B;  2C6Y A;  1HXD A;  2FF4 A;  5K5Q A;  2NAZ A;  3QPH A;  2M87 A;  2H09 A;  2BYV E;  4Y13 A;  3F3X A;  4XSX F;  3GFI A;  4U0V A;  5IT9 Z;  5ICE A;  3KET A;  3BRO A;  1IN6 A;  3IKT A;  2JRT A;  4OMY A;  2DFI A;  3V4G A;  5J6X A;  2J5O A;  2P6T A;  1TBX A;  2EFP A;  2JT1 A;  2GXB A;  2G7H A;  2K86 A;  2VOO A;  2MA3 A;  4UVC A;  3WU0 A;  1D3Y A;  3G73 A;  4ESF A;  1L3L A;  5D6E A;  1MKM A;  4HX4 A;  1L0O C;  1QZZ A;  1MZB A;  1J7K A;  1XSV A;  1QGP A;  1E17 A;  1J2X A;  1ON2 A;  3GXO A;  4XBF A;  2MLK A;  1H9G A;  1XCV A;  5BPD A;  4YFN F;  4I0A A;  4HQM A;  5BPI A;  4M6Y A;  2TDX A;  5ERI A;  4AWX B;  3MWM A;  4BQA A;  1TQM A;  2V1D A;  4RS8 A;  1IUY A;  3K1N A;  2MC3 A;  2HS5 A;  2FEZ A;  4JK1 X;  4L9T A;  4IHT A;  3LAP A;  3C7J A;  1S3J A;  2L01 A;  2FBH A;  5FD6 A;  1YFH A;  3MQ0 A;  1F1Z A;  2DW4 A;  4DQ2 A;  1P92 A;  4GYG A;  2JSC A;  2Z33 A;  4BXU A;  2HQN A;  2V9V A;  1LDK B;  4BH9 A;  4EJV A;  1KYW A;  3PQJ A;  1W5T A;  4WF2 A;  3D0S A;  2DTR A;  1P4W A;  4I09 A;  2RDP A;  5ILS A;  3ECH A;  1Z6R A;  1GXP A;  4MTE A;  1KYZ A;  2R3S A;  4KFC A;  3SZP A;  4R1H A;  1W7P D;  2RN7 A;  5HLH A;  1UHW A;  3IL2 A;  1JHH A;  4EVI A;  2DT5 A;  3WGI A;  2DLL A;  3TGN A;  4EV0 A;  1WI9 A;  4BHP A;  3FX3 A;  2R7F A;  2GA2 A;  1BI1 A;  3DPT A;  3BPV A;  2P5L C;  2LF7 A;  3E5U A;  4RB0 A;  4EQQ A;  4IF4 A;  5ICG A;  1T6S A;  5LHI A;  5E18 F;  4K2E A;  2Q2E A;  4PZJ A;  2CSO A;  5FLX Z;  1K78 A;  4YG2 F;  2Y0M A;  3QP5 A;  4MGR A;  3Q5F A;  3HSR A;  3IRR A;  2ZME A;  3HOT A;  2QQB A;  3EYI A;  1PUE E;  4CGZ A;  3L00 A;  4RGR A;  4RB1 A;  1J59 A;  2QQA A;  4YFK F;  4Q4Z F;  1F9N A;  2WWY A;  3DXJ F;  2LNB A;  2P8T A;  2OD5 A;  3V7R A;  3N4M A;  2LDU A;  4OMZ A;  4D0P A;  5LLQ A;  1TQI A;  2PFB A;  1QNT A;  4L0Z B;  1RZ4 A;  5E1Z B;  3DEU A;  4ESJ A;  3TOB A;  5LBQ A;  3ABT A;  2Y75 A;  3ULQ B;  3R6S A;  1JHF A;  2NYX A;  4HDU A;  3K1M A;  1HW5 A;  3LST A;  1Z91 A;  2B0L A;  4HLY A;  2EFW A;  4MHG A;  1RUO A;  5LEJ A;  1B9M A;  3FF5 A;  1GXQ A;  1SD6 A;  4WWC A;  3RYP A;  1MJB A;  2DPD A;  2O0Y A;  4IXA A;  4PCQ A;  1Z1D A;  5H6Q A;  4CYD A;  5DDG A;  1ONV A;  4A6D A;  3T8R A;  1T38 A;  2VOP A;  1BIA A;  3WTY C;  3HHG A;  4I98 B;  4A5M A;  3HOS A;  2HWV A;  4LK1 F;  1BN5 A;  4E70 A;  4ZYD A;  4HA8 A;  1SD5 A;  3JTG A;  3W6K B;  2QZ8 A;  2FOK A;  5F1R A;  1LB2 A;  2EV0 A;  3K2Z A;  1IF1 A;  3ROU A;  3CUQ C;  2DO7 A;  4GYI A;  1R00 A;  4WCG A;  2VT2 A;  1OKR A;  3C1D A;  2GXG A;  1FC3 A;  2K7L A;  1E2X A;  3I64 A;  3EUH A;  1TW2 A;  5EEG A;  4EJW A;  1FY7 A;  1CGP A;  2DK5 A;  3M8F A;  4M9Z A;  2IVM A;  3KEO A;  1S7A A;  3HRT A;  1A04 A;  1YW8 A;  3CTA A;  3V8K A;  3F21 A;  1IN7 A;  2EWN A;  4CXF A;  1ZGA A;  1PDN C;  2NNN A;  2YX4 A;  2HOE A;  5JHU A;  5LRS A;  1LJ9 A;  5JR3 A;  4Z2Y A;  2O03 A;  1R1T A;  4XLN F;  2P4W A;  4AD9 A;  2IRF G;  4I01 A;  4G6D A;  1C0W A;  2F5D A;  2DI3 A;  2UWM A;  1HBX G;  4LLL A;  3I71 A;  4KMU X;  1TNS A;  2A07 F;  3HRS A;  3LAJ A;  2EFO A;  2L4M A;  2E7X A;  5ILV A;  3FMQ A;  5H6R A;  3LWF A;  3VFZ A;  3BJA A;  1QBJ A;  2ZME B;  1SD7 A;  2BGC A;  1HKS A;  1NHA A;  2DQR A;  1EH6 A;  1HW1 A;  3JTH A;  2M8E A;  2VXZ A;  3JAM K;  2ZFW A;  1XB4 A;  3HIF A;  1ZG5 A;  1IXR C;  5CVV A;  2HR3 A;  4WXH A;  1WSU A;  3PQK A;  2FQ3 A;  1KU9 A;  1T0F A;  2W25 A;  1CF7 A;  1PP8 F;  4Q47 A;  4Q48 A;  2XRO A;  2YR2 A;  5DYM A;  1MDM B;  1EH8 A;  2FBI A;  3R4K A;  1P6R A;  2IT0 A;  2EK5 A;  3VOD A;  3L2C A;  1GVJ A;  1K78 B;  5F6F A;  4FT8 A;  3M9A A;  1D8K A;  3MCZ A;  2ETH A;  5JFR A;  1ZN2 A;  2HZT A;  3TDZ C;  2MLG A;  4LB6 B;  5CLS A;  2XAQ A;  4F7Z A;  5DUI A;  1J0R A;  3F8C A;  3GZ6 A;  2OA4 A;  2Q0O A;  2G9W A;  2FSW A;  1D5V A;  3NEU A;  4OIN F;  3BZ6 A;  1KU3 A;  2VOD A;  2ZCW A;  1BBY A;  5JI6 A;  2QLZ A;  1YW9 A;  1ZG1 A;  4MEY F;  4OIP F;  1J9I A;  3H3Z A;  2K02 A;  3SXY A;  5BMZ A;  3L9F A;  5LRR A;  3IRQ A;  4EGY A;  4FHT A;  3RKY A;  4B09 A;  3WTU C;  4MQ9 F;  1USS A;  2M5W A;  4UVA A;  5A2Q Z;  2V79 A;  1Z6T A;  1O3R A;  3WE3 A;  3PFI A;  4P55 A;  2QEN A;  4I02 A;  3NRV A;  3GYH X;  3F22 A;  3RKX A;  1T98 A;  3MZY A;  2ISY A;  1P4X A;  1IXS B;  3D5L A;  4ETS A;  2YU3 A;  1SAX A;  2XAF A;  1TW3 A;  3NQO A;  3P7N A;  2ZNZ A;  2EFN A;  1SFE A;  5FFX A;  2JPB A;  2QM3 A;  1IN8 A;  1KU7 A;  3VB2 A;  3EET A;  4HF0 A;  3GFJ A;  3WTT C;  3ELK A;  2IP2 A;  3LQQ A;  2A61 A;  1PP7 U;  3TOA A;  3EYY A;  2A5Y B;  2M45 A;  2BE5 F;  2ZJ2 A;  2E1N A;  1FSE A;  4KT5 C;  2RQP A;  3ZMS A;  4UNO A;  4EM2 A;  1YYV A;  1VTN C;  3KP6 A;  3T0Y A;  4L5I A;  4P9F A;  3R0A A;  5LGU A;  2V1U A;  4M71 A;  5D5X B;  3R0J A;  1R23 A;  3MZH A;  4RB2 C;  5E8G A;  4IHS A;  4HF1 A;  1YTY A;  3ZMD A;  1K7A A;  3TQN A;  5J8C A;  3VEP A;  2EFQ A;  3I59 A;  3P9C A;  4GGG A;  4DNC A;  4ZZL A;  1DUX C;  4JBA A;  3IHU A;  1BM9 A;  3K1P A;  2ELH A;  4UXN A;  2MH9 A;  1IN5 A;  1JXS A;  5K1Y A;  5ICF A;  3H3U A;  3FXR A;  4I2O A;  1OYW A;  4HW0 A;  1R58 A;  3E6D A;  1GHC A;  4HBL A;  3SHF A;  3KLN A;  1SFX A;  3FHZ A;  3E5Q A;  2EA2 A;  1K6O A;  1ZGJ A;  4Y15 A;  5FO5 A;  2F5E A;  2V1X A;  1EH7 A;  2ACJ A;  4Q5S F;  4KIC A;  2RVC A;  3QU6 A;  2F5F A;  4QWQ A;  4QLC U;  2QWW A;  1FBU A;  1YW7 A;  3F6O A;  2ZKZ A;  1HQC A;  2VN2 A;  1IRF A;  4IVN A;  4OOI A;  2IW5 A;  2K4B A;  3GX4 X;  1CF7 B;  4KYW A;  4KIF A;  3E6B A;  4L9J A;  2KJC A;  3P9I A;  2D45 A;  4WXD A;  4AIJ A;  1W7P B;  1YLF A;  2EV5 A;  2L54 A;  1DPR A;  3J81 Z;  3R60 A;  5D4S A;  1SMY F;  1ZRE A;  4O5V A;  2L4A A;  5E20 A;  1KU2 A;  2YSR A;  2D1V A;  3I59 B;  1G6N A;  4N9H A;  4S05 A;  2GZW A;  2PG4 A;  1O3T A;  5ICC A;  3ZN1 A;  1P2F A;  1OMI A;  2PI0 A;  4TV7 A;  4HX7 A;  3WTX C;  2L3D A;  1IZ1 A;  3MEX A;  1DDN A;  5KK1 A;  5LHH A;  4ON0 A;  3KE2 A;  2O6G E;  1QZY A;  1T39 A;  1TTY A;  5FGM A;  1OYY A;  2CGP A;  1XGO A;  3ZMU A;  5HVQ C;  2M1B A;  1MD0 A;  5K5R A;  1LQ1 A;  3BWG A;  1U5T A;  5JVT A;  2CFX A;  3BOQ A;  3EQL F;  1UCR A;  3HTU A;  5HOO A;  2PJP A;  4WK8 F;  2EJR A;  1BC7 C;  2XHK A;  1YG2 A;  2DBB A;  4GCV A;  1QPM A;  1REP C;  3AAF A;  2H27 A;  4FX4 A;  2M30 A;  3KP5 A;  4LMY A;  1G3T A;  2BBY A;  4KIB A;  3WG9 A;  1YS7 A;  3KP4 A;  3BP8 A;  2DK8 A;  4G6Q A;  2AXL A;  5L3G A;  4NQW A;  2J5P A;  1LVA A;  2K4J A;  2F2E A;  3GFL A;  5HLG A;  2RKH A;  2P5K A;  5BS6 A;  1STZ A;  1FYK A;  1WKM A;  1XSD A;  2DU9 A;  3F8F A;  5L3E A;  2STT A;  1RUN A;  1F4K A;  3ZPL A;  1YO5 C;  4I0B A;  4RGS A;  3B02 A;  4CZZ A;  1WWX A;  1HKT A;  3REO A;  4G7O F;  3DKW A;  4CO8 A;  3HRM A;  1FWZ A;  3KEQ A;  4EM0 B;  4M6X A;  4A12 A;  4AIK A;  5E1W A;  3LFK A;  5CVI A;  5J8F A;  1D8J A;  1LDD A;  4HV6 A;  2FA5 A;  3KP3 A;  4ENN A;  1S29 A;  4PDK A;  2CO5 A;  2Q8K A;  1R36 A;  5D5V B;  3I0T A;  3RI4 A;  4CHU A;  2LKP A;  3FMR A;  1SD4 A;  3JSO A;  2CW0 F;  1K79 A;  1U6G A;  3ZP5 A;  1XMA A;  2KIM A;  1YIO A;  3B73 A;  3BJ6 A;  3U2R A;  1W4M A;  5CVR A;  3TDU C;  4YFX F;  2A3S A;  2D1H A;  4YII A;  2EV6 A;  2STW A;  4GO1 A;  3FMS A;  1ZLJ A;  1ON1 A;  4IPA A;  4YIF A;  3CJN A;  1T2K A;  1FBS A;  5L3C A;  1WRJ A;  2A69 F;  3I4P A;  1B1B A;  2GA1 A;  1ZH5 A;  3JW4 A;  3E3V A;  2HYF A;  5AIP A;  3CO6 C;  2ZNY A;  1XN7 A;  5LEK A;  1O7L A;  2GWR A;  1ULY A;  3CDH A;  3RDI A;  1BIB A;  1FSH A;  2IJL A;  5L3F A;  1RNL A;  3O6B B;  4HV5 A;  4G9Y A;  4KMF A;  1EV7 A;  4OIO F;  2OZU A;  3KZZ A;  1XDU A;  5E17 F;  2KRF A;  3HUG A;  2VC1 A;  2Z5U A;  3DV8 A;  3KP7 A;  3R61 A;  1IAW A;  2HTJ A;  4L5J A;  1YQA A;  4R8H A;  4MEX F;  5HS9 A;  1R22 A;  2IA1 A;  3J81 K;  3BDD A;  3I5U A;  3EDP A;  2CG4 A;  4PGH A;  1FOK A;  1G4D A;  2PMU A;  2O8X A;  2A68 F;  4P96 A;  4HAM A;  1FYM A;  4LGW A;  3FXQ A;  1XCB A;  3L09 A;  3COA C;  3GO5 A;  2Z3Y A;  4OU0 A;  5HDG A;  1JE8 A;  4ZYG A;  2VBZ A;  4HX8 A;  4XSZ F;  3JSP A;  2OU2 A;  2XAS A;  4EGZ A;  5HDN A;  1MJ9 A;  3ZN0 A;  5LGT A;  1OR7 A;  1HW2 A;  2P6S A;  4A5N A;  3KZY A;  5DCM A;  1FNN A;  4ENJ A;  2BV6 A;  3U9G A;  5F64 A;  1XGM A;  4GXO A;  5DD4 A;  2QVO A;  3HSE A;  1FX7 A;  2VBW A;  1J75 A;  1I5Z A;  1KGS A;  2XGX A;  3E5X A;  1XMK A;  2QBY A;  4EMS A;  5HDK A;  4ENK A;  4KIG A;  2XKP A;  1AWC A;  5HLI A;  3I54 A;  4RAZ A;  2OAZ A;  4KA4 A;  5DEQ A;  5E1X A;  3MFK A;  4LLG F;  4HZF A;  3LA2 A;  5D4R A;  1TNT A;  4BYY A;  1KA8 A;  4LG0 A;  2HYG D;  2FU4 A;  2H6C A;  1KQ0 A;  2JTV A;  1B6A A;  4EM1 A;  5ED4 A;  3RJP A;  5D6F A;  1O57 A;  4IJA A;  4KDP A;  4IRI A;  1TQP A;  2VE9 A;  2LF8 A;  1LEA A;  2WV0 A;  4ZYH A;  1H0M A;  1FBQ A;  2W24 A;  3LA3 A;  4BHB A;  2JPC A;  3GEZ A;  2NNY A;  4HQE A;  5FB2 A;  2F5C A;  4HF2 A;  3K69 A;  2FBK A;  2V6C A;  3VOE A;  4U7D A;  4O3M A;  3L7W A;  1LNW A;  3O2P E;  4OIQ F;  2KJB A;  3P9K A;  1ZRD A;  2G7U A;  2GIV A;  5D8K B;  4ENM A;  3GUD A;  4A0X A;  1MJA A;  2XAH A;  1IN4 A;  2KIU A;  3Q9V A;  4A6E A;  3I58 A;  1IW7 F;  5DCF A;  5EEH A;  1P4A A;  2HGC A;  3H92 A;  3V8J A;  1FP1 D;  4HDV A;  5KVR A;  4M74 A;  1B9N A;  3KCC A;  2BEO A;  3RPQ A;  3F8B A;  4M73 A;  1W7P A;  4UV8 A;  1RIO H;  3ECO A;  2EA4 A;  2MH2 A;  4M72 A;  2A6H F;  1IXC A;  4RGU A;  3GVA A;  2O3F A;  1ZAR A;  5HS7 A;  3ZMT A;  4Y17 A;  4M9X A;  4LK0 F;  2FNP A;  3G3Z A;  2L02 A;  3BY6 A;  2OBP A;  3GF2 A;  3OOP A;  1KQ9 A;  1RI7 A;  1BC8 C;  4EJU A;  3V7S A;  1ZRF A;  3I53 A;  2XAG A;  2VC0 A;  1U2W A;  2X4H A;  4HOB A;  3J7A O;  2XVC A;  2UXN A;  3CLO A;  5H20 A;  1S8N A;  4H0E A;  2H94 A;  3KFW X;  5FD5 A;  3RKW A;  3M8E A;  3FZV A;  3V7C A;  3K0L A;  4UHT A;  2FE3 A;  3W6J B;  5L3B A;  1B59 A;  4ZH4 F;  2VBX A;  2W85 A;  5IT9 K;  2EB7 A;  1X3U A;  3MAJ A;  3RTR A;  3WTS C;  2FXA A;  2O61 A;  1XDS A;  2D2W A;  3F6V A;  1BJA A;  1LDJ A;  4AIH A;  2CWE A;  3F23 A;  3SQN A;  3SFZ A;  2PLY A;  2XIG A;  1Z7U A;  3KLO A;  3C3W A;  1J5Y A;  4LD5 A;  3O3K A;  2OQG A;  3WE2 A;  3GWZ A;  1IRG A;  4HLX A;  1MDM A;  4N9I A;  1U5T B;  2OZ6 A;  4UVB A;  3E6C C;  2GAU A;  1FYL A;  4L18 B;  3M1E A;  4G94 A;  1SMT A;  1ODD A;  4IRG A;  2XRN A;  5AON A;  5BOX A;  1FT9 A;  1DPU A;  3CUO A;  4ZZD A;  1XSX A;  3J80 Z;  2HTS A;  4PGG A;  3FWE A;  2PMH A;  5LGN A;  5TJJ A;  2RV8 A;  4R79 A;  4LLN A;  4ESB A;  3HRU A;  4HYE A;  2P7V B;  3GZ5 A;  2RGV A;  3WGG A;  4A0Z A;  2QQ9 A;  3BJO A;  1ZAO A;  4U0Y A;  4OIR F;  4KNY A;  3FXU A;  1ZLK A;  3DP7 A;  5AIQ A;  1LEB A;  2E1C A;  3V8L A;  2DAO A;  4P9U A;  1B4A A;  3HSF A;  3JAM Z;  1FP2 A;  3C18 A;  4LG0 B;  3FM5 A;  1JGS A;  2PQ8 A;  2NS0 A;  1O3Q A;  4A0Y A;  3CUQ A;  3GLX A;  3RYR A;  1I1S A;  1Z05 A;  1BI3 A;  2E7W A;  2VE8 A;  3IC7 A;  4XRF A;  3TKY A;  4N0B A;  1BI2 A;  5CYV A;  3ABU A;  4B8X A;  1XGS A;  2WTE A;  3DQV C;  1Z9C A;  2XAJ A;  2XUB A;  5DCM B;  1I6X A;  5DD8 A;  5L3D A;  4ZYE A;  1R1U A;  1R7J A;  3TO9 A;  1ZHF A;  1UST A;  1DP7 P;  2YX7 A;  4KUM A;  1O7F A;  4BNC A;  3QU3 A;  5IT3 A;  2FMY A;  2FML A;  1QO0 D;  1U5T C;  4RAY A;  3M7G A;  2ESH A; 
#chains in the Genus database with same CATH topology
 3BLY A;  2R7T A;  1FPQ A;  2DPU A;  4BEH A;  4EEF G;  3TBI A;  4CCM A;  5E8I A;  2JA2 A;  4GRI A;  5A2Q K;  2V9P A;  1D1B A;  2P5V A;  1HSJ A;  1JT0 A;  3F8M A;  2VT3 A;  2ESN A;  5M5Y J;  1GV2 A;  2E1M C;  2RRE A;  1WJF A;  3IV5 A;  5M5X J;  2OCC H;  3H9Q A;  2FD5 A;  2QBY B;  3VYR B;  4E6K G;  5TIS C;  1R5H A;  2CYY A;  1BL0 A;  2K27 A;  1U3E M;  3PNY A;  2W82 A;  3ONQ A;  4L9N A;  2AS5 F;  4FQG A;  1BOA A;  2NRA C;  1G3W A;  4O6J A;  1M1E B;  5H2F C;  2ZBK A;  4I6Z A;  3DTE A;  3JR9 A;  1HKQ A;  3Q0U A;  3G4S I;  3WTZ A;  1SVM A;  4CCN A;  3S2W A;  2MBF A;  2LKX A;  2QF7 A;  3CO7 C;  1TLH B;  3ZQ7 A;  2DDA A;  4AVP A;  2ID3 A;  3FDY A;  5KNL A;  1OCP A;  3GW2 A;  3SZT A;  3U1D A;  2V1N A;  2WB1 A;  1MGT A;  3B6A A;  4JP0 A;  4P5O A;  2LOO A;  4BJ6 C;  4NHJ A;  2DXI A;  3OV8 A;  2KRH A;  3N05 A;  2JVG A;  2ADU A;  3J80 K;  3OS0 A;  4LFU A;  2YPR A;  2ZSH B;  3OYJ A;  2Z9O A;  2L2O A;  1Y0U A;  1YJN I;  4GFB A;  2VKD A;  5C4J J;  2ISZ A;  2LTP A;  2RNJ A;  3T8T A;  4U7B A;  2W1O A;  2PMZ N;  4A3E J;  3RQ4 A;  5B3S H;  2QUF A;  4G7H F;  4IHW A;  1A35 A;  4KN7 X;  3LQR A;  2CV1 A;  3QPT A;  1EJ9 A;  5TRD A;  1X3Z B;  1N75 A;  4EJO A;  5ILU A;  2HEO A;  3IWF A;  1U78 A;  3QOP A;  4NB5 A;  5FKK A;  1JGG A;  1ACI A;  1V5F A;  3F8N A;  1U8B A;  3T5X A;  4BJT A;  4RGX A;  3WOD F;  2QCO A;  1OLT A;  1ETW A;  2VON A;  2HFH A;  1KON A;  2XKO A;  3LA7 A;  2UZK A;  1B8I A;  3C2H A;  1BR4 A;  1XD7 A;  1OR7 C;  2WC2 A;  3LSI A;  2W57 A;  3FIW A;  2H1L A;  2KKO A;  1R49 A;  2DTZ A;  4JX5 A;  2IA0 A;  3OMY A;  4UV9 A;  3QRF F;  2LR8 A;  3E97 A;  2MW8 A;  5F08 A;  2LD5 A;  3HHH A;  2Z99 A;  3FM3 A;  1G3S A;  1UHS A;  2WAQ N;  2H1K A;  1S7O A;  4XRS A;  4XLP F;  4E4H A;  2Y48 A;  5DUK A;  3FHN A;  3EUH C;  1FOX A;  1W1W E;  4ABZ A;  5EDN A;  3T1B A;  1QQI A;  4EJT A;  2X6W A;  5LD2 C;  4MTD A;  1YI2 I;  2VQC A;  1ZG3 A;  3ZQH A;  2Q1Z B;  2OCE A;  4UUV A;  3S2D J;  4I7H A;  3LOC A;  3N97 A;  1MBE A;  2X0L A;  2KL4 A;  3VSL A;  2Z1D A;  5BQT A;  1UHM A;  2R7D A;  2ZXJ A;  5FLX K;  3EPZ A;  4G6T B;  3WU2 C;  1FMV A;  1I27 A;  2IS1 A;  2HOT A;  1BR2 A;  4XN3 A;  2LRD A;  2VJJ A;  4ASN A;  4IQJ A;  3K9T A;  3M4O J;  1FEX A;  2LP0 A;  4BQQ A;  4Y7N J;  3QAH A;  3CCY A;  2FRH A;  2LVS A;  2MD5 A;  2QYO A;  3H35 A;  3HBL A;  4KN4 X;  5CJ9 A;  2IA2 A;  2PBI A;  4ZDL A;  2A6E F;  5D8L B;  1SFU A;  1JKO C;  5D5W B;  2E1O A;  4M9S A;  4BQO A;  3W2V A;  2BVM A;  2DYS H;  2BOL A;  2BY2 A;  2E5N A;  3V42 A;  6PAX A;  4I99 C;  3SDG A;  2M9H A;  4IRH A;  3RCO A;  2WY8 Q;  2PJR B;  4BAC A;  2O8K A;  3S1Q J;  4L0Y B;  2P7C B;  1IRZ A;  3ML6 A;  5CVU A;  3JRA A;  3E6M A;  2LSO A;  3KZI C;  3CQZ J;  1ZYR F;  1BI0 A;  1Q1H A;  2LFB A;  2K9S A;  4JQF A;  4MQV A;  3GFM A;  2NVX J;  4QIW N;  3PIO F;  1E0E A;  2BXY A;  2GIZ A;  2JK3 A;  3BPX A;  2RC4 A;  3TO7 A;  2XV4 S;  3MKL A;  5B1A H;  3KYD B;  5IY5 H;  3ERE D;  5LHG A;  4G7Z F;  2EIN H;  3I9V 2;  2ME6 A;  2QSH X;  1I6H J;  2W84 A;  4RLF A;  3DFG A;  4AUX A;  1F43 A;  1IC8 A;  2GBY A;  1XGN A;  2VPL A;  1DGW Y;  2KDZ A;  1I1G A;  3HPH A;  2H6B A;  4XR6 A;  3ZCO A;  1R4N B;  4LB5 A;  2JZY A;  2HQR A;  1S6L A;  1V3F A;  3DF8 A;  5FFZ A;  2XB0 X;  1Z7L A;  5J1R A;  3OSF A;  2HXO A;  3NWS A;  4BAY A;  1AOY A;  1SVL A;  2LH9 A;  3HYI A;  1U8R A;  1WH5 A;  2LY2 A;  2OPT A;  3Q9S A;  3S3N A;  3O8G A;  1H9T A;  4RB3 C;  4CDG A;  2R7U A;  3WGH A;  1RR7 A;  3GLL A;  1ZRC A;  2F4I A;  1E3P A;  3CME I;  1OYI A;  4M3B A;  2CQK A;  3ZMZ A;  1RPW A;  4BXF A;  2EH3 A;  2X6Y A;  2Y31 A;  4F91 B;  3S2H J;  3ISP A;  3RPU A;  2ZO4 A;  1F5T A;  4C2T A;  4MNU A;  4WX9 A;  2IPQ X;  3KP2 A;  1HST A;  4FET A;  3WTW C;  1G3Y A;  1I3Q J;  4A2U A;  4S04 A;  4KIS A;  3J7Y J;  2R5Z B;  1R1V A;  1W5S A;  2BW3 B;  2KQR A;  3TO6 A;  4JX4 A;  1V4R A;  5CVJ A;  3BR1 A;  3ERM A;  2UXX A;  2PEX A;  1BA5 A;  4LJZ F;  3D1N I;  2M0M A;  4C2U A;  4PJL A;  4IOC F;  3GTK J;  4OWR B;  1UEL B;  1D5Y A;  1A6I A;  4G8X A;  3K2A A;  3QP6 A;  3AL0 C;  2EIM H;  2COM A;  3BTI A;  3IWZ A;  4U88 A;  1O3S A;  3DPL C;  1R5I D;  1FZP B;  2VBY A;  3JCU C;  5HS8 A;  1JKR C;  2KIF A;  1NG7 A;  4QPO A;  3ZQC A;  3WTV C;  2PN6 A;  3F72 A;  2OTL I;  2FNA A;  3IH4 A;  4D5C A;  5K5O A;  5D5U B;  4XRM A;  1IGN A;  1KQ8 A;  4WXC A;  5DV5 A;  4YIR X;  4L9V A;  5EF6 A;  4BHC A;  2CQ7 A;  2CUE A;  3TL4 X;  4JYK A;  2WAF A;  3MMY B;  2HKO A;  3CUQ B;  1OPC A;  2WV1 A;  3IKV A;  1UB9 A;  1P7I A;  4IQ4 A;  2GQQ A;  1R5G A;  1UG0 A;  2VPR A;  2DQL A;  2K9Q A;  3BG7 A;  1UFM A;  3RIR A;  4NNJ A;  2HQ5 A;  4CYC A;  1TP4 A;  2F4O B;  5GAD J;  1Q1V A;  1Z0X A;  2KHM A;  2K3F A;  9ANT A;  4U0W A;  1YS6 A;  2OQR A;  1X1P A;  4W1U A;  3CD6 I;  3HPG A;  4FX0 A;  1VQ5 I;  4CIC A;  1FLI A;  3A03 A;  1WQ2 A;  3HTS B;  4Y4R A;  2CUF A;  3A01 A;  2HDC A;  5IOZ A;  5J3L A;  2HKX A;  3BCA A;  3HM5 A;  3WU1 B;  2C6Y A;  1HXD A;  2FF4 A;  1OCT C;  5K5Q A;  1UG2 A;  2NAZ A;  4IX7 A;  1PJR A;  2L9R A;  1NG6 A;  3OR2 C;  1VQO I;  3QPH A;  4BEH B;  2WAE A;  3PUB A;  4BE2 A;  2M87 A;  2H09 A;  3JRE A;  2BYV E;  5FLM J;  4Y13 A;  5J1Y A;  4XNF A;  3F3X A;  4XSX F;  3GFI A;  2NOG A;  4U0V A;  5IT9 Z;  4AC0 A;  2ZME C;  2UV1 A;  5ICE A;  3KET A;  1P9Q C;  3BRO A;  1ZTR A;  3L2R A;  3TW7 A;  1IN6 A;  3IKT A;  2JRT A;  4OMY A;  2GOX B;  2DFI A;  5E3O A;  5IPA A;  3KX2 A;  2JQ7 A;  3V4G A;  3UR3 C;  3MN2 A;  3VYU B;  1SEU A;  1LUJ B;  2J5O A;  5J6X A;  2P6T A;  1TBX A;  1F36 A;  2EFP A;  1ZQ3 P;  2JT1 A;  2GXB A;  2L7Z A;  3FXK A;  2G7H A;  2K86 A;  2VOO A;  4ZDP A;  3OOU A;  2MA3 A;  4UVC A;  3WU0 A;  1D3Y A;  3G73 A;  4ESF A;  3H0D A;  5FKM A;  2XGD A;  5HNH A;  2EBI A;  1L3L A;  2FQ4 A;  2XRL A;  5D6E A;  1MKM A;  4HX4 A;  1L0O C;  3S93 A;  4AYB N;  1QZZ A;  1MZB A;  5FLV A;  1J7K A;  1XSV A;  1QGP A;  1E17 A;  1WJD A;  1J2X A;  4IEJ A;  3MKY B;  1ON2 A;  3GXO A;  2DA1 A;  4XOP A;  4XBF A;  2MLK A;  2E5Z A;  1YX3 A;  1H9G A;  2R5Z A;  3TW6 A;  2TCT A;  3PO3 J;  1XCV A;  5BPD A;  4YFN F;  4I0A A;  4G12 A;  1LFU P;  3LSG A;  4HQM A;  5BPI A;  4M6Y A;  3GTO J;  2ZJP F;  2TDX A;  4RDU A;  5ERI A;  4AWX B;  4BUP A;  3GZN B;  3MWM A;  2ECB A;  1YJW I;  4BQA A;  4ZYA A;  1TQM A;  2V1D A;  4RS8 A;  3ZQL A;  1IUY A;  2F5V A;  4B3X A;  3O8H A;  1MBF A;  3K1N A;  2E36 A;  3RZO J;  2MC3 A;  2HS5 A;  2FEZ A;  1W36 D;  5GAH J;  2VKE A;  4JK1 X;  4L9T A;  5E3M A;  4IHT A;  3FKI J;  4A3C J;  3LAP A;  2V6E A;  3C7J A;  1S3J A;  3S1N J;  2L01 A;  2FBH A;  1FIP A;  2CJJ A;  5FD6 A;  1YFH A;  3GTM J;  3MQ0 A;  1F1Z A;  2DW4 A;  2Y0S A;  3DTK A;  4DQ2 A;  1H8A C;  1P92 A;  3SYT A;  3ZQG A;  4GYG A;  1QZE A;  2JSC A;  2Z33 A;  4BXU A;  2HQN A;  2V9V A;  1LDK B;  4BY1 J;  4BH9 A;  2NOJ B;  4EJV A;  1KYW A;  3PQJ A;  4E7S A;  1W5T A;  5IYB J;  4M3F A;  4WF2 A;  1VQP I;  3D0S A;  3ZOB A;  3ZQQ A;  2DTR A;  1P4W A;  3CJT B;  4I09 A;  2DMN A;  2RDP A;  5ILS A;  3ECH A;  3L2U A;  1Z6R A;  3QPL A;  5F0F A;  1GXP A;  3SEQ A;  2AQF A;  4MTE A;  4IOA F;  2E34 A;  1KYZ A;  1NH3 A;  4F55 A;  2R3S A;  3PSF A;  4KFC A;  1JTX A;  3SZP A;  4R1H A;  1W7P D;  2RN7 A;  5HLH A;  2MGQ A;  1UHW A;  2CW7 A;  3IL2 A;  1JHH A;  4DGW B;  4EVI A;  2DT5 A;  3WGI A;  2PJR A;  2WAD A;  2X51 A;  2DLL A;  3TGN A;  1CQT A;  4EV0 A;  3M3Y J;  1WI9 A;  4BHP A;  2HVR A;  3L1P A;  3CC2 I;  3NAR A;  4V2G A;  1HF0 A;  3FX3 A;  2XDV A;  4E7K A;  4ZTJ A;  1GDT A;  2R7F A;  2GA2 A;  3CDI A;  3S14 J;  1BI1 A;  5FKL A;  3DPT A;  2X9D A;  3BPV A;  2P5L C;  1T08 B;  2LF7 A;  3E5U A;  4RB0 A;  1U0J A;  2BZT A;  4EQQ A;  4IF4 A;  5ICG A;  1T6S A;  2WA0 A;  5LHI A;  2R7O A;  2DDB A;  4K2E A;  5E18 F;  2Q2E A;  4PZJ A;  2CSO A;  5FLX Z;  1K78 A;  4YG2 F;  3S17 J;  2V7F A;  2Y0M A;  3A1Y A;  2EIL H;  3QP5 A;  3HOU J;  4MGR A;  1PVE A;  2XAU A;  3HSR A;  3Q5F A;  1TL8 A;  1QVT A;  4E7J A;  3IRR A;  3OS1 A;  2ZME A;  1YHQ I;  3MVP A;  4PFO A;  3ABL H;  3HOT A;  3QYF A;  2QQB A;  2KRC A;  3HOX J;  1OQY A;  1UZC A;  1UAA A;  5J4V A;  3EYI A;  2HU9 A;  5JLX A;  1PUE E;  4CGZ A;  3L00 A;  4RGR A;  4RB1 A;  3I56 I;  1J59 A;  3OIO A;  2M3A A;  1X4O A;  2QQA A;  4YFK F;  2B7E A;  4Q4Z F;  1F9N A;  2WWY A;  1LFB A;  4A3D J;  1ZGW A;  3DXJ F;  2I10 A;  2LNB A;  2P8T A;  2OD5 A;  1VI0 A;  3V7R A;  1IJW C;  3N4M A;  2LDU A;  3HOV J;  4Y3O A;  3HUG B;  4OMZ A;  3H1C A;  3QOD A;  4PJN A;  4XLE A;  3K10 A;  3I55 I;  3JRG A;  4D0P A;  4F52 A;  5LLQ A;  1TQI A;  2CH0 A;  2PFB A;  3TMO A;  4NBQ A;  1QNT A;  3CC7 I;  4L0Z B;  1X1B A;  3G1L A;  2CMP A;  3S3O A;  4CZC A;  1RZ4 A;  5E1Z B;  3DEU A;  4UUS A;  1TC3 C;  3VSK A;  4ESJ A;  3TOB A;  4D9J A;  5LBQ A;  3NWT A;  3ABT A;  2IAI A;  2Y75 A;  3ULQ B;  3OYA A;  3R6S A;  1JHF A;  1JTY A;  2NYX A;  5EG0 A;  4LIV A;  4HDU A;  3K1M A;  1HW5 A;  2G0E A;  3LST A;  5EZG A;  1Z91 A;  4IHY A;  2B0L A;  4HLY A;  2EFW A;  4DW6 A;  2LBF A;  4MHG A;  1RUO A;  1YRN A;  2XF7 A;  5LEJ A;  2RAE A;  3LSJ A;  1B9M A;  2XGE A;  3AG2 H;  3FF5 A;  1GXQ A;  1SD6 A;  3BR0 A;  4WWC A;  3HXL A;  3DPU A;  3RYP A;  4XLC A;  1D0X A;  3LSK A;  3CDL A;  1MJB A;  5HLT A;  2DPD A;  2O0Y A;  4IXA A;  2ZJR F;  4PCQ A;  3OYK A;  4D1Q A;  1Z1D A;  3BTC A;  5H6Q A;  4CYD A;  5DDG A;  4EAT A;  5EGO A;  1ONV A;  2A05 A;  4A6D A;  3T8R A;  1T38 A;  2VOP A;  3OWT A;  2CUZ A;  1MSF C;  1BIA A;  3WTY C;  3HHG A;  4I98 B;  3CP2 A;  3LFU A;  1D0Z A;  4A5M A;  3HOS A;  2HWV A;  1Y8Q B;  4LK1 F;  1BN5 A;  1Z67 A;  4A3I J;  4DYR A;  4E70 A;  4NC8 A;  2K5C A;  4ZYD A;  5TGT A;  4ZTF A;  4HA8 A;  4IL6 C;  1SD5 A;  2HZD A;  4KJZ A;  3JTG A;  3W6K B;  4BDY A;  2MFZ A;  2QZ8 A;  3HOZ J;  2EPF A;  2FOK A;  5F1R A;  1LB2 A;  2EV0 A;  2FX0 A;  3K2Z A;  2Y30 A;  3AG4 H;  1XG1 A;  2OV7 A;  2WY7 Q;  1IF1 A;  3ROU A;  3CUQ C;  1QPI A;  2DO7 A;  3JRH A;  2JA8 J;  4GYI A;  3PJR A;  1R00 A;  2VJ4 A;  2VT2 A;  1OKR A;  4E7Z A;  4WCG A;  2IS2 A;  2W48 A;  3C1D A;  2GXG A;  2Y9Z A;  1FC3 A;  2K7L A;  4CH7 A;  1E2X A;  3BG6 A;  4FCY A;  1LFP A;  3I64 A;  3EUH A;  1TW2 A;  5EEG A;  4EJW A;  2HDW A;  1R71 A;  1FY7 A;  1CGP A;  4BL0 B;  3WHB A;  2DK5 A;  3M8F A;  4M9Z A;  2XPU A;  4X6A J;  2IVM A;  3KEO A;  4PJM A;  1S7A A;  3HRT A;  1A04 A;  1VQ9 I;  2RQQ A;  1YW8 A;  3CTA A;  3V8K A;  3F21 A;  4E7L A;  5K7F A;  4AM3 A;  2Z2S B;  1IN7 A;  2EWN A;  3LSR A;  4CXF A;  1MBH A;  1ZGA A;  2R4G A;  3C2G A;  1PDN C;  1NK2 P;  2NNN A;  2YX4 A;  2HOE A;  4JX6 A;  5JHU A;  4FTH A;  5LRS A;  5JHF A;  1LJ9 A;  5JR3 A;  4Z2Y A;  2E1M B;  1OCZ H;  2DA4 A;  1K61 A;  1HDD C;  2O03 A;  2ID6 A;  2Y69 H;  1R1T A;  4XLN F;  2Y0S N;  2P4W A;  4AD9 A;  2IRF G;  1X4P A;  3BG9 A;  1IDY A;  4I01 A;  3W2W A;  5GAE J;  5EYR A;  4G6D A;  4CYC B;  1XX5 A;  2HOS A;  2LYC A;  2H8W A;  1C0W A;  2GOM A;  2F5D A;  1E3O C;  3I4M J;  2DI3 A;  2UWM A;  2GM4 A;  1HBX G;  4LLL A;  3I71 A;  4CCL A;  3RZD J;  2JUG A;  1I3A A;  4KMU X;  4B47 A;  1TNS A;  1YRN B;  2A07 F;  3HRS A;  3LAJ A;  2VAS A;  2EFO A;  2L4M A;  2E7X A;  5ILV A;  1G59 A;  3FMQ A;  3MZ8 A;  3PSI A;  5H6R A;  3OYC A;  3LWF A;  3VFZ A;  3BJA A;  1FIA A;  5GTI C;  3GCM A;  2ZME B;  2ZXH A;  1MSE C;  1QBJ A;  1SD7 A;  3A0B C;  1BR1 A;  2BGC A;  3HGY A;  1HKS A;  1NHA A;  1LVK A;  1EH6 A;  2DQR A;  4LOC A;  1HW1 A;  4FAS D;  3JTH A;  2M8E A;  4OAZ A;  4DJA A;  2VXZ A;  3JAM K;  5CPR B;  1GT0 C;  2ZFW A;  4IHX A;  1XB4 A;  3HIF A;  1PUF B;  1ZG5 A;  1IXR C;  5CVV A;  2HR3 A;  4WXH A;  2ZFU A;  1WSU A;  3OL4 A;  3PQK A;  5GPA A;  2FQ3 A;  1KU9 A;  2F6C A;  3IP4 B;  5CQE A;  2HOA A;  3BZC A;  1T0F A;  2R7W A;  2W25 A;  1CF7 A;  1N25 A;  1OCR H;  3F0C A;  1PP8 F;  4Q47 A;  1G8X A;  4Q48 A;  1JKP C;  1NTC A;  2OF7 A;  3KYC B;  2XRO A;  1TT5 B;  2YR2 A;  3CLQ A;  3QYE A;  1MNM C;  2HNH A;  5DYM A;  2YUS A;  1MDM B;  1POG A;  1QVU A;  1ORK A;  1EH8 A;  2FBI A;  3R4K A;  4BJ5 C;  1P6R A;  2KZG A;  2IT0 A;  2EK5 A;  3VOD A;  4Y52 J;  5DTD A;  4NUB A;  3L2C A;  3ASO H;  1GVJ A;  3GTP J;  1U9N A;  1K78 B;  5F6F A;  4V19 K;  4FT8 A;  1LPQ A;  3J7Z I;  4C9Y A;  3M9A A;  3NAU A;  1FJL A;  2QKL B;  2FJ1 A;  1D8K A;  1JKQ C;  2EIJ H;  5M5W J;  3PO2 J;  1A36 A;  2XPV A;  3MCZ A;  2ETH A;  2VI6 A;  1MH4 A;  3BTJ A;  5JFR A;  2W7N A;  1ZN2 A;  2HZT A;  1RKW A;  3TDZ C;  2MLG A;  2VJI A;  4C3H J;  4DBQ A;  2IGN A;  3DLA A;  4LB6 B;  2ZXW H;  3PIP F;  5CLS A;  2XAQ A;  2DCE A;  3E0J B;  1J0R A;  4F7Z A;  3F8C A;  5DUI A;  1X1A A;  3GZ6 A;  2W00 A;  4C2M J;  3G71 I;  2OA4 A;  2R7S A;  2Q0O A;  3ZR8 X;  2IBD A;  3QYB A;  2G9W A;  3HKZ A;  2FSW A;  1D5V A;  4XON A;  5GTH C;  3NEU A;  5JLW A;  2HPI A;  4OIN F;  2KFD A;  1TWG J;  3BZ6 A;  1KU3 A;  3JRD A;  2VOD A;  2NVQ J;  2ZCW A;  1BBY A;  2VL8 A;  1IUF A;  5JI6 A;  3IAS 2;  2QLZ A;  1YW9 A;  1ZG1 A;  3CP8 A;  2KPM A;  2E35 A;  4KIT B;  4MEY F;  2R7R A;  2ZC2 A;  2DJI A;  4OIP F;  3K4N A;  3W2A A;  1J9I A;  3H3Z A;  2K02 A;  3SXY A;  3CCR I;  5BMZ A;  3L9F A;  5LRR A;  3IRQ A;  4EGY A;  4FHT A;  3RKY A;  4B09 A;  3FXL A;  1TZL A;  3WTU C;  4I76 A;  1JJ6 C;  3FKJ A;  4MQ9 F;  1USS A;  2M5W A;  4UVA A;  5IOY A;  5B5E C;  5A2Q Z;  2V79 A;  1Z6T A;  1O3R A;  4XLH A;  3OYL A;  2VUM J;  3K4M A;  3WE3 A;  3PFI A;  2VQL A;  2M4G A;  4RBO A;  4P55 A;  4J00 A;  2QEN A;  4I02 A;  3NRV A;  3GYH X;  3F22 A;  3RKX A;  3Q0V A;  2UUZ A;  1T98 A;  3A4C A;  2X6X A;  3MZY A;  2ISY A;  1ZKG A;  3CCM I;  2E60 A;  1P4X A;  2R7X A;  1IXS B;  3D5L A;  4ETS A;  2YU3 A;  5F04 A;  4NC6 A;  2XAF A;  1SAX A;  1TW3 A;  3NQO A;  3P7N A;  2DMT A;  4NQW B;  2R5Y A;  1HC8 A;  3SJM A;  4XOR A;  2ZNZ A;  3BCB A;  1FOW A;  2EFN A;  1SFE A;  5IP6 A;  5FFX A;  2JPB A;  1DGR M;  1UJ8 A;  2QM3 A;  1TWH J;  1QU3 A;  4XLF A;  5FKO A;  2DOD A;  3H3V K;  2IGO A;  1IN8 A;  2DJN A;  1KU7 A;  2F48 A;  3VB2 A;  3EET A;  3G2B A;  3OYE A;  4HF0 A;  3GFJ A;  4BBR J;  3WTT C;  3ELK A;  1ZR2 A;  2IP2 A;  3H0G J;  4C30 A;  1BW5 A;  3LSM A;  4A3M J;  1S5L C;  3OYF A;  3A01 B;  1MMG A;  3LQQ A;  4UB8 C;  4H4K C;  2A61 A;  5M3F J;  1PP7 U;  4RMN A;  3TOA A;  2DOF A;  3EYY A;  2A5Y B;  2M45 A;  2OC6 A;  2BE5 F;  3FK7 A;  1FTZ A;  2ZJ2 A;  2DMQ A;  2E1N A;  1FSE A;  4KT5 C;  1MBJ A;  3EUK L;  1YJ9 I;  2RQP A;  3ZMS A;  4UNO A;  2WAQ A;  4EM2 A;  1YYV A;  2JWT A;  2LY9 A;  3KP6 A;  1VTN C;  1B72 B;  3OL3 A;  1XC5 A;  3T0Y A;  4L5I A;  1MMD A;  4P9F A;  3R0A A;  4P1W A;  5LGU A;  1Z3Y A;  2BY1 A;  3W3C A;  2V1U A;  3OYI A;  1AKH A;  1WPK A;  3JRB A;  2JSP A;  2X85 A;  2KMU A;  3CF5 F;  4M71 A;  1P7J A;  3ASN H;  5GPC A;  1MH3 A;  2OUM A;  5D5X B;  3R0J A;  1R23 A;  3MZH A;  4RB2 C;  5E8G A;  4IHS A;  2MG4 A;  1UMQ A;  4HF1 A;  1YTY A;  3ZMD A;  1K7A A;  1Y6I A;  3A0H C;  1R6R A;  4QPQ A;  3TQN A;  5J8C A;  3VEP A;  2EFQ A;  3I59 A;  3P9C A;  2LMD A;  4C3I J;  2CRG A;  5BNG A;  3BR5 A;  4GGG A;  1SAU A;  4XM3 A;  2GXA A;  4DNC A;  3B6C A;  4ZZL A;  5IP7 J;  3RKQ A;  1DUX C;  2LRE A;  4JBA A;  3IHU A;  2M34 A;  1SFO J;  3KYL A;  4A3L J;  1BM9 A;  2AHQ A;  3K1P A;  3PUF A;  2ELH A;  3ZGK A;  3DU6 A;  3I4N J;  4UXN A;  4DZJ A;  2VKH A;  5B66 C;  2MH9 A;  5FRM A;  4UUT A;  3OS2 A;  2DT6 A;  1EKE A;  1X1C A;  2PX9 A;  1IN5 A;  2KDO A;  1JXS A;  5K1Y A;  5ICF A;  1VQK I;  2JN6 A;  3H3U A;  3FXR A;  4B1R A;  4I2O A;  2EZH A;  1OYW A;  1Y8R B;  3HKZ N;  4HW0 A;  1R58 A;  3E6D A;  3WHC A;  4HBL A;  1GHC A;  3PFY A;  3SHF A;  3KLN A;  4C3J J;  3S1R J;  2HVS A;  1ETV A;  1SFX A;  1MIJ A;  1WJB A;  2DN0 A;  4N4N B;  3FHZ A;  3E5Q A;  2EA2 A;  1K6O A;  4CUG A;  1ZGJ A;  4Y15 A;  5FO5 A;  4E7I A;  4A3J J;  1S9H A;  5FRO A;  2DMU A;  2F5E A;  2V1X A;  2K3P A;  1JUS A;  1QA6 A;  1EH7 A;  1SFK A;  2ACJ A;  4Q5S F;  2L0K A;  4KIC A;  1D0Y A;  2RVC A;  4B43 A;  3QU6 A;  4CA0 A;  2HPM A;  2JUC A;  3BTL A;  1D1C A;  2F5F A;  2EQR A;  4QWQ A;  4QLC U;  1QHG A;  2QWW A;  1FBU A;  3G1M A;  2JA7 J;  1YW7 A;  1AKH B;  4GDF A;  3F6O A;  2ZKZ A;  1GV5 A;  1HQC A;  4ITV A;  2OTJ I;  2VN2 A;  4D7N A;  1IRF A;  4IVN A;  4NC7 A;  4OOI A;  4N4O B;  1DU0 A;  2IW5 A;  2K4B A;  3IH2 A;  3U21 A;  1ETQ A;  1V5E A;  1WJC A;  3GX4 X;  2QEX I;  1CF7 B;  4KYW A;  2QSG X;  3CF2 A;  4KIF A;  3E6B A;  4L9J A;  2KJC A;  3P9I A;  2D45 A;  4RM3 A;  4WXD A;  5F1J A;  3HZJ A;  4AIJ A;  2TRT A;  2ELJ A;  2D5V A;  3ESW B;  4HRI A;  1MBK A;  4HNT A;  2ZJQ F;  1W7P B;  3BR3 A;  1YLF A;  2EV5 A;  2L54 A;  2ICW G;  4XIC A;  1DPR A;  3J81 Z;  4A3F J;  3R60 A;  1JUP A;  2M2E A;  5D4S A;  2L7K A;  1SMY F;  1V5G A;  3JRI A;  1ZRE A;  4O5V A;  2K9M A;  2L4A A;  1WVR A;  2W4S A;  5E20 A;  1EA3 A;  1WFX A;  1KU2 A;  2YSR A;  3CZ6 A;  3S32 A;  3K4J A;  2ME0 A;  3CCJ I;  1QHH D;  2D1V A;  1G6N A;  3I59 B;  4N9H A;  1X58 A;  2O7O A;  4S05 A;  2GZW A;  2PG4 A;  2DFF A;  2DA6 A;  4HNV A;  1MMA A;  1O3T A;  5ICC A;  3ZN1 A;  1P2F A;  1OMI A;  2K40 A;  3AG1 H;  1K83 J;  3K6G A;  4F3Q A;  2PI0 A;  1AA7 A;  4TV7 A;  1B72 A;  3HL2 A;  4HX7 A;  1OCC H;  3WTX C;  1MNE A;  3S16 J;  2L3D A;  1IZ1 A;  3DEW A;  3MEX A;  1DDN A;  5KK1 A;  5LHH A;  4ON0 A;  3MKZ A;  5K7H A;  3KE2 A;  3M1C A;  2O6G E;  4A93 J;  1QZY A;  1T39 A;  1TTY A;  5FGM A;  1JT6 A;  1OYY A;  1XGO A;  2CGP A;  3HDD A;  3ZMU A;  5HVQ C;  1Y0N A;  2M1B A;  2B63 J;  2NVY J;  1MD0 A;  5K5R A;  2V4J C;  3DBH B;  3KIO A;  1LQ1 A;  1MND A;  4XLA A;  3CCE I;  2XSD C;  4II3 A;  1IV8 A;  3BWG A;  1WZ2 A;  1U5T A;  1ITY A;  5JVT A;  2CFX A;  2JRM A;  3BOQ A;  3EQL F;  1UCR A;  3HTU A;  4AU7 A;  3CCS I;  3JRF A;  1ETY A;  5HOO A;  2PJP A;  2AXT C;  1WJA A;  4B4C A;  4WK8 F;  2EJR A;  1BC7 C;  3AL0 B;  2XHK A;  2I5U A;  2VKV A;  4B3A A;  1YG2 A;  1VQM I;  2N8G A;  2DBB A;  1LKX A;  2XF6 A;  4XRS G;  4GCV A;  1GUU A;  1QPM A;  3L2W A;  3AAF A;  1REP C;  1YIJ I;  2H27 A;  1RET A;  4FX4 A;  2M30 A;  3KP5 A;  4II2 A;  4HG2 A;  4LMY A;  1ENH A;  1G3T A;  2BBY A;  1D1A A;  3H9G A;  3FXJ A;  4KIB A;  2COB A;  1YS7 A;  3CMM A;  3KP4 A;  3WG9 A;  1A31 A;  3BP8 A;  2CQQ A;  2DK8 A;  4BGD A;  4G6Q A;  2AXL A;  5L3G A;  4XKV A;  2AO9 A;  4PUS A;  4BU2 A;  1WJE A;  3GBG A;  4NQW A;  2J5P A;  1LVA A;  5E79 C;  3GTQ J;  1MMN A;  3DKX A;  2K4J A;  2F2E A;  2IXS A;  3GFL A;  5HLG A;  5HOD A;  3DKY A;  2RKH A;  4IKF A;  1TWC J;  2JMW A;  4B44 A;  3CJR B;  1W5C C;  1Y1V J;  1KZH A;  2P5K A;  3DCF A;  5BS6 A;  3DWL E;  1GLN A;  1DP3 A;  1STZ A;  1FYK A;  1WKM A;  1XSD A;  4D7M A;  1Y39 A;  2VLA A;  2DU9 A;  3F8F A;  5L3E A;  3DLL F;  2MC4 A;  2XC7 A;  1OJL A;  2STT A;  4XID A;  1RUN A;  1F4K A;  3ZPL A;  3KEY A;  1YO5 C;  4FE7 A;  4I0B A;  5J47 A;  4RGS A;  3JRC A;  3AKZ A;  3D5S C;  3B02 A;  4CZZ A;  3TED A;  1WWX A;  1HKT A;  2L5Q A;  5F0C A;  3REO A;  1K4S A;  3SFI A;  1PYV A;  2X48 A;  4J01 A;  4M6V A;  4G7O F;  2FOW A;  3DKW A;  4CO8 A;  1ERD A;  1T56 A;  2H8R A;  5CQG A;  3UKG A;  3HRM A;  1FWZ A;  5EGO B;  2IGK A;  3KEQ A;  2CS3 A;  4EM0 B;  4M6X A;  4A12 A;  4AIK A;  5E1W A;  3ZQI A;  4A3B J;  3LFK A;  5CVI A;  5J8F A;  2CQN A;  4CCO A;  4BE0 A;  1D8J A;  1LDD A;  4YRV A;  4HV6 A;  3G6E I;  2FA5 A;  3KP3 A;  2LLK A;  4CSW A;  3OYD A;  1WH7 A;  4BBS J;  4YEL A;  5GP9 A;  3VPR A;  4ENN A;  2E2I J;  2CV0 A;  1S29 A;  1FOY A;  2CO5 A;  4PDK A;  1VQL I;  2Q8K A;  1R36 A;  4DIQ A;  4NDL A;  5D5V B;  3I0T A;  2QGU A;  1EF4 A;  3RI4 A;  2KLO A;  5M3M J;  2LKP A;  3FMR A;  2CQX A;  1A6Q A;  4CHU A;  1SD4 A;  3JSO A;  1APL C;  2CW0 F;  1K79 A;  1ETO A;  1U6G A;  2KP6 A;  2MYS A;  4UUS B;  3ZP5 A;  1XMA A;  2KIM A;  1YIO A;  1DQU A;  2L9V A;  4PJ0 C;  3B73 A;  3BJ6 A;  3U2R A;  1J09 A;  1V55 H;  1W4M A;  2DFE A;  5CVR A;  3TDU C;  4YFX F;  5K7Z A;  5IYD J;  2ELK A;  2A3S A;  2D1H A;  4YII A;  1S7E A;  2JA5 J;  2EV6 A;  1SVO A;  2JVH A;  2STW A;  2M8G X;  4GO1 A;  3FMS A;  3Q3S A;  3ZRG A;  1HCR A;  2K85 A;  5CKT A;  5LFA A;  3SZG A;  5GAG J;  4HSR A;  1ZLJ A;  5C44 J;  1ON1 A;  4XKB A;  4IPA A;  1T95 A;  4YIF A;  1N77 A;  3EUA A;  3S15 J;  1E3H A;  3OIP A;  2M0C A;  3FXO A;  4QTR A;  4X0G A;  2DYR H;  2HVQ A;  3CJN A;  1T2K A;  2XB5 A;  1FBS A;  3IH3 A;  5L3C A;  1WRJ A;  5DS9 A;  2A69 F;  3I4P A;  1B1B A;  3LNQ A;  2V26 A;  2GA1 A;  1RR8 C;  1ZH5 A;  3JW4 A;  4BE1 A;  1T0F C;  5J4Y A;  3E3V A;  2HYF A;  5AIP A;  1PUF A;  3KPH A;  3M07 A;  5FRN A;  1WI3 A;  3CO6 C;  2ZNY A;  3GTG J;  1XN7 A;  1N78 A;  5J40 A;  5LEK A;  2L7M P;  2R7Z J;  1O7L A;  2CUJ A;  2GWR A;  1ULY A;  2ECC A;  5E3L A;  3MKW B;  1W36 C;  5EG0 B;  3CDH A;  3RDI A;  1BIB A;  3BZK A;  1FSH A;  2IJL A;  5L3F A;  1RNL A;  2VQH A;  4X1E A;  1VZ0 A;  3O6B B;  3VYS B;  4HV5 A;  4XK4 A;  4G9Y A;  4KMF A;  1EV7 A;  1MBG A;  4LG3 A;  3HOW J;  3CJQ B;  2OZU A;  3UNG C;  4OIO F;  3KZZ A;  1XDU A;  5E17 F;  3OYH A;  3CMY A;  1AHD P;  4XMY A;  1WGX A;  2BHY A;  2BHZ A;  3MD2 A;  2KRF A;  3HUG A;  3IAM 2;  2VC1 A;  2Z5U A;  4D5F A;  4JOM A;  3DV8 A;  3KP7 A;  3R61 A;  2DA3 A;  4BY7 J;  1IAW A;  1HOM A;  2HTJ A;  4RAF A;  4L5J A;  1YQA A;  4R8H A;  4MEX F;  5HS9 A;  2DT7 B;  1R22 A;  2IA1 A;  3F9K A;  4V2F A;  2E19 A;  3D5R C;  3J81 K;  2R92 J;  5C4X J;  3BDD A;  3K70 D;  3BG3 A;  2DOE A;  2HYJ A;  3I5U A;  2EZI A;  1IV6 A;  3EDP A;  1XTA A;  1OFC X;  3HEF A;  1AU7 A;  5F27 A;  4DYC A;  2CG4 A;  4DZP A;  3S3M A;  4PGH A;  2AQE A;  2VQG A;  1Z21 A;  1FOK A;  1G4D A;  5FKN A;  1Z3X A;  2R0Q C;  3BC8 A;  2O8X A;  2PMU A;  2A68 F;  3CES A;  3LSH A;  4P96 A;  3VWB A;  4HAM A;  1FYM A;  2LY1 A;  1X19 A;  3ABK H;  2BW3 A;  4UY8 I;  2K9L A;  3ZQF A;  2KIQ A;  1VQ7 I;  3M8J A;  2O5R A;  3E7L A;  4BXX J;  5EJC A;  4LGW A;  3TP0 A;  2PMZ A;  3FXQ A;  1HDP A;  1XCB A;  3L09 A;  4PSW A;  3ZMV A;  3COA C;  4E7H A;  3GO5 A;  1XMX A;  2Z3Y A;  4L5E A;  4OU0 A;  5HDG A;  1JE8 A;  3FBN B;  3K4L A;  4ZYG A;  2VBZ A;  4HX8 A;  4F93 B;  1LE8 A;  4XSZ F;  3CCQ I;  3JSP A;  2OU2 A;  2XAS A;  4EGZ A;  5HDN A;  1OIS A;  2RNG A;  1MJ9 A;  3OY9 A;  3ZN0 A;  5LGT A;  1OR7 A;  1HW2 A;  2P6S A;  3FIS A;  3KZY A;  4A5N A;  5DCM A;  4BKX A;  1FNN A;  4ENJ A;  2BV6 A;  3U9G A;  5F64 A;  3PL8 A;  3CC4 I;  1ZK8 A;  2EZK A;  1XGM A;  3HJE A;  1ZR4 A;  3GTJ J;  5FJ8 J;  4XOT A;  4GXO A;  1RRJ A;  5DD4 A;  2QVO A;  3HSE A;  3I3L A;  1FX7 A;  2VBW A;  4LIU A;  4DOZ A;  5EEA A;  1Z77 A;  1SAN A;  1J75 A;  2HI3 A;  2YS9 A;  1JJ8 C;  1I5Z A;  1KGS A;  2XGX A;  5HNF A;  3E5X A;  5JVG F;  3K4K A;  1XMK A;  1YIT I;  2YU9 J;  2QBY A;  1R9T J;  4EMS A;  4ZDO A;  5HDK A;  1SC7 A;  4ENK A;  2CV2 A;  4KIG A;  2Z16 A;  2XKP A;  1X2M A;  2IGM A;  1AWC A;  1ZEL A;  1XS9 A;  2ZSI B;  5HLI A;  2QKM B;  4XN0 A;  2XF5 A;  3I54 A;  4MIM A;  4RAZ A;  2OAZ A;  1I39 A;  4KA4 A;  2MD0 A;  5DEQ A;  5E1X A;  3VDX A;  2DA7 A;  3MFK A;  4LLG F;  2R7V A;  1V54 H;  1FMW A;  4HZF A;  4ZJZ A;  1WJ5 A;  1X2N A;  3LA2 A;  1WCM J;  3FK6 A;  5D4R A;  2IS6 A;  1TNT A;  3SEZ A;  2DOA A;  4BYY A;  1KA8 A;  1FTT A;  2X6O A;  4IO9 F;  4LG0 A;  4KT6 A;  3BT9 A;  3H5A A;  4BQN A;  2HYG D;  2FU4 A;  2H6C A;  1KQ0 A;  1RKT A;  2JTV A;  1B6A A;  2E2H J;  4EM1 A;  3LSP A;  1VQN I;  3X2Q H;  5ED4 A;  4IHV A;  3RJP A;  5D6F A;  1O57 A;  3RQI A;  3H5N A;  4A3K J;  4IJA A;  4KDP A;  4IRI A;  2XSJ C;  1T33 A;  1TQP A;  3OR1 C;  4FE4 A;  3IUO A;  2VE9 A;  4XKW A;  2NVU B;  3LMM A;  2VJ5 A;  2LF8 A;  1LEA A;  2WV0 A;  4CCK A;  4ZYH A;  2BVL A;  1K4T A;  2B9S A;  3ZXS A;  4PK4 A;  5KHD A;  1DU6 A;  1H0M A;  1FBQ A;  4A69 C;  2W24 A;  3LA3 A;  4Z6Y A;  4BHB A;  3QWL A;  2JPC A;  2OJE D;  1TT0 A;  3GEZ A;  2NNY A;  4HQE A;  3OYM A;  5C3E J;  3Q0W A;  1VQ6 I;  5FB2 A;  3U1K A;  1O4X A;  2F5C A;  4HF2 A;  3K69 A;  2FBK A;  2V6C A;  3CCL I;  3VOE A;  4U7D A;  4O3M A;  1Y56 A;  3L7W A;  1LNW A;  2HQA A;  2K9N A;  2KIS A;  3O2P E;  1VQ8 I;  4RAG A;  4OIQ F;  2KJB A;  3P9K A;  2X1C A;  2DA2 A;  1ZRD A;  3DEE A;  5KCM A;  2G7U A;  1BW6 A;  1W0T A;  2GIV A;  5D8K B;  3DBL B;  4ENM A;  4XKC A;  3GUD A;  1X3W B;  1VFC A;  4A0X A;  3G1O A;  1MJA A;  2XAH A;  4DYQ A;  1IN4 A;  2KIU A;  3Q9V A;  4A6E A;  1H88 C;  3I58 A;  3L2Q A;  3CMA I;  1IW7 F;  4S0H B;  2Q2E B;  2E71 A;  5DCF A;  3PM1 A;  3K7A J;  2M7A A;  5EEH A;  1P4A A;  2HGC A;  3H92 A;  2MSY A;  3BG5 A;  3RSN A;  4W97 A;  3V8J A;  1FP1 D;  2GLO A;  1G2H A;  4HDV A;  5KVR A;  4CCJ A;  4M74 A;  1B9N A;  3KCC A;  2BEO A;  2QQ8 A;  4ZC3 A;  2M7B A;  3RPQ A;  3HG9 A;  3F8B A;  4M3D A;  4M73 A;  1W7P A;  4UV8 A;  5KAF C;  1RIO H;  2LG4 A;  3ECO A;  2EA4 A;  2F4M B;  2MH2 A;  4M72 A;  2HXI A;  2A6H F;  3W6V A;  3S8P A;  1IXC A;  1LE8 B;  4RGU A;  3GVA A;  4Y33 A;  2O3F A;  1ZAR A;  5HS7 A;  4HEA 2;  3ZMT A;  4Y17 A;  4M9X A;  4LK0 F;  2FNP A;  3G3Z A;  2L02 A;  3QPS A;  3BY6 A;  3FXM A;  2NS8 A;  2OBP A;  3PNV A;  1TWA J;  1B8I B;  1VND A;  3GF2 A;  3OOP A;  3CCU I;  5J1U A;  1KQ9 A;  1RI7 A;  1BC8 C;  4EJU A;  2ZXI A;  2QA4 I;  2Y9Y A;  3V7S A;  1W0U A;  1ZRF A;  4M3E A;  3I53 A;  3S1M J;  4MLO A;  2XAG A;  2VC0 A;  1U2W A;  2X4H A;  4ANJ A;  4HOB A;  3J7A O;  2XVC A;  2UXN A;  1IDZ A;  3OYB A;  1VF9 A;  3CLO A;  1HA8 A;  4MFD A;  3K4B A;  5H20 A;  2EZL A;  1S8N A;  2ZB9 A;  2KT0 A;  4QSH A;  4MO7 A;  1I50 J;  4H0E A;  1YX5 A;  2H94 A;  3KFW X;  5FD5 A;  3BR6 A;  3RKW A;  3OSG A;  1Y1W J;  3GTL J;  3M8E A;  3FZV A;  3V7C A;  2CU7 A;  2P81 A;  3K0L A;  4UHT A;  2FE3 A;  3W6J B;  4RA2 A;  5L3B A;  1B59 A;  3AFH A;  4ZH4 F;  2VBX A;  3K4C A;  2L7F P;  2W85 A;  1JUM A;  5IT9 K;  1A5J A;  2EB7 A;  1X3U A;  2L9N A;  3MAJ A;  3RTR A;  2L9S A;  1QRY A;  3WTS C;  3A2K A;  2FXA A;  3J7A Y;  2O61 A;  3ABM H;  1XDS A;  2LBF B;  2D2W A;  3F6V A;  1BJA A;  1LDJ A;  4AIH A;  2CWE A;  1X1D A;  3F23 A;  3PNT A;  4MFE A;  3SQN A;  2QSF X;  2X1D A;  4YEJ A;  3SFZ A;  1NK3 P;  1IRX A;  2PLY A;  3H9J A;  3E1S A;  2XIG A;  2R93 J;  2DMP A;  1TWF J;  3GME A;  1Z7U A;  3KLO A;  2CW8 A;  2VB6 A;  4PFP A;  5IYC J;  3C3W A;  1J5Y A;  1ETK A;  4B48 A;  3FBI B;  4LD5 A;  4RM2 A;  1YOV B;  3O3K A;  2OQG A;  3SDB A;  3WE2 A;  3GWZ A;  4AID A;  2IEK A;  3CCV I;  1IRG A;  4HLX A;  1MDM A;  4AVZ A;  1XPX A;  2LC2 A;  5KAI C;  4N9I A;  1U5T B;  2OZ6 A;  2MAB A;  3A02 A;  4UVB A;  3E6C C;  4HST A;  2JJ7 A;  2GAU A;  1FYL A;  2EIK H;  4LIT A;  3TP3 A;  4L18 B;  3M1E A;  3DBR B;  4G94 A;  1SMT A;  1ODD A;  4IRG A;  1S72 I;  3HB9 A;  2XRN A;  2FUG 2;  5AON A;  3H5R A;  2DA5 A;  3VYT B;  1H89 C;  5BOX A;  1GVD A;  1FT9 A;  2A6T A;  1DPU A;  5E3N A;  1R4M B;  5DM6 F;  3CUO A;  4ZZD A;  1IG7 A;  1XSX A;  4FIS A;  3J80 Z;  5EZH A;  4J19 A;  2DFH A;  1HLV A;  1RC9 A;  2HTS A;  2M4K A;  1BOB A;  3FWE A;  4PGG A;  5DM7 F;  2PMH A;  5LGN A;  5TJJ A;  2RV8 A;  4R79 A;  4LLN A;  4F92 B;  1OCO H;  2V9K A;  4ESB A;  3HRU A;  3HGG A;  4HYE A;  4U87 A;  2XPW A;  2P7V B;  4DBR A;  3GZ5 A;  4OAY A;  2RGV A;  1YE9 A;  2O9L A;  3WGG A;  4A0Z A;  2QQ9 A;  2Y2Z A;  4XQF A;  3LL7 A;  2NVT J;  2R5Y B;  3BJO A;  1ZAO A;  3QOE A;  4U0Y A;  2LKS A;  4OIR F;  4KNY A;  3FXU A;  4HNU A;  1ZLK A;  3DP7 A;  5AIQ A;  1LEB A;  2E1C A;  2BY3 A;  1ETX A;  3V8L A;  2DAO A;  4P9U A;  3DU5 A;  2VXD A;  3AG3 H;  1T8I A;  1B4A A;  3OYG A;  3HSF A;  3JAM Z;  3H36 A;  1FP2 A;  3C18 A;  1WHU A;  4LG0 B;  3FM5 A;  2E2J J;  3OIQ A;  2BY0 A;  1JGS A;  2PQ8 A;  2NS0 A;  4XL9 A;  4BDZ A;  4UB6 C;  4BS9 A;  4A0Y A;  1O3Q A;  1JI8 A;  3CUQ A;  5B1B H;  3BQY A;  3K70 C;  3GLX A;  1IO2 A;  1BJZ A;  3RYR A;  3QQA A;  4A3G J;  1I1S A;  1Z05 A;  1BI3 A;  2E7W A;  3HC7 A;  2VE8 A;  3IC7 A;  4XRF A;  3C2B A;  3TKY A;  2NS7 A;  1K6Y A;  2R7Q A;  4N0B A;  1BI2 A;  1U9O A;  4M3G A;  5CYV A;  2VIX A;  3ABU A;  2JA6 J;  4PSX A;  2WBM A;  3P5J A;  4RLQ A;  1RES A;  4B8X A;  3RPU D;  1XGS A;  4AYB A;  2WTE A;  3DQV C;  5IP9 J;  1Z9C A;  2XAJ A;  2XUB A;  4IZZ A;  2HDD A;  5DCM B;  3OYN A;  1I6X A;  5DD8 A;  2KZV A;  2IS4 A;  5L3D A;  4ZYE A;  2WB1 N;  1R1U A;  3L2V A;  1R7J A;  3TO9 A;  2P0W A;  5F0H A;  1ZHF A;  4HPQ A;  2A5W A;  2LK2 A;  4PJJ A;  1UST A;  1DP7 P;  3BR2 A;  2YX7 A;  3DTI A;  4KUM A;  1O7F A;  2I8D A;  3HOY J;  4BNC A;  1VQ4 I;  1MW7 A;  3BQZ A;  3QU3 A;  5IT3 A;  2XGC A;  2FMY A;  2BXZ A;  2CFO A;  2FML A;  1QO0 D;  1U5T C;  2NXN B;  2X1E A;  4RAY A;  3WG7 H;  3M7G A;  2ESH A;  1MMS A; 
#chains in the Genus database with same CATH homology
 1FPQ A;  2DPU A;  5E8I A;  5A2Q K;  2P5V A;  1HSJ A;  3F8M A;  2VT3 A;  2ESN A;  2QBY B;  1R5H A;  2CYY A;  2K27 A;  1U3E M;  4L9N A;  2AS5 F;  1BOA A;  2NRA C;  1G3W A;  4O6J A;  2ZBK A;  1HKQ A;  3WTZ A;  3S2W A;  2MBF A;  3CO7 C;  1TLH B;  3ZQ7 A;  4AVP A;  3GW2 A;  3SZT A;  3U1D A;  1MGT A;  4P5O A;  4NHJ A;  3OV8 A;  2ADU A;  3J80 K;  4LFU A;  2YPR A;  2Z9O A;  1Y0U A;  2ISZ A;  2RNJ A;  3T8T A;  4U7B A;  2QUF A;  4G7H F;  4KN7 X;  3LQR A;  3QPT A;  5TRD A;  4EJO A;  5ILU A;  2HEO A;  3IWF A;  1U78 A;  3QOP A;  4NB5 A;  3F8N A;  3T5X A;  4RGX A;  3WOD F;  2VON A;  2HFH A;  2XKO A;  3LA7 A;  2UZK A;  1XD7 A;  2WC2 A;  2W57 A;  2KKO A;  2IA0 A;  4UV9 A;  3QRF F;  3E97 A;  3HHH A;  2Z99 A;  3FM3 A;  1G3S A;  1S7O A;  4XLP F;  2Y48 A;  5DUK A;  3T1B A;  1QQI A;  4EJT A;  4MTD A;  1ZG3 A;  4UUV A;  4I7H A;  3N97 A;  2X0L A;  5BQT A;  1UHM A;  2R7D A;  2ZXJ A;  5FLX K;  1I27 A;  4ASN A;  3K9T A;  3QAH A;  2FRH A;  2MD5 A;  2QYO A;  3ZMV A;  4KN4 X;  5CJ9 A;  2IA2 A;  2PBI A;  1SFU A;  2A6E F;  5D8L B;  5D5W B;  4M9S A;  6PAX A;  4IRH A;  4L0Y B;  2P7C B;  3ML6 A;  5CVU A;  3E6M A;  2LSO A;  1ZYR F;  1BI0 A;  1Q1H A;  4JQF A;  4MQV A;  3GFM A;  3BPX A;  2RC4 A;  3TO7 A;  2XV4 S;  3ERE D;  5LHG A;  4G7Z F;  2W84 A;  3DFG A;  1XGN A;  1I1G A;  4LB5 A;  2H6B A;  2JZY A;  2HQR A;  1S6L A;  1V3F A;  3DF8 A;  5FFZ A;  4BAY A;  1AOY A;  3HYI A;  1U8R A;  3Q9S A;  1H9T A;  4RB3 C;  4CDG A;  3WGH A;  1ZRC A;  1OYI A;  2CQK A;  3ZMZ A;  3ISP A;  3RPU A;  2ZO4 A;  1F5T A;  4MNU A;  4WX9 A;  2IPQ X;  3KP2 A;  1HST A;  3WTW C;  1G3Y A;  4S04 A;  4A2U A;  1R1V A;  1W5S A;  3TO6 A;  1V4R A;  5CVJ A;  2UXX A;  2PEX A;  4LJZ F;  4G8X A;  3QP6 A;  2COM A;  3IWZ A;  4U88 A;  1O3S A;  3DPL C;  1FZP B;  2VBY A;  5HS8 A;  2KIF A;  3WTV C;  2PN6 A;  3F72 A;  2FNA A;  5K5O A;  5D5U B;  1KQ8 A;  4WXC A;  5DV5 A;  4L9V A;  4BHC A;  2HKO A;  3CUQ B;  1OPC A;  3IKV A;  1UB9 A;  2GQQ A;  1R5G A;  2DQL A;  1UFM A;  3RIR A;  4U0W A;  1YS6 A;  2OQR A;  4FX0 A;  4CIC A;  1FLI A;  1WQ2 A;  3HTS B;  2HDC A;  2HKX A;  3WU1 B;  2C6Y A;  1HXD A;  2FF4 A;  5K5Q A;  2NAZ A;  3QPH A;  2M87 A;  2H09 A;  2BYV E;  4Y13 A;  3F3X A;  4XSX F;  3GFI A;  4U0V A;  5IT9 Z;  5ICE A;  3KET A;  3BRO A;  1IN6 A;  3IKT A;  2JRT A;  4OMY A;  2DFI A;  3V4G A;  5J6X A;  2J5O A;  2P6T A;  1TBX A;  2EFP A;  2JT1 A;  2GXB A;  2G7H A;  2K86 A;  2VOO A;  2MA3 A;  4UVC A;  3WU0 A;  1D3Y A;  3G73 A;  4ESF A;  1L3L A;  5D6E A;  1MKM A;  4HX4 A;  1L0O C;  1QZZ A;  1MZB A;  1J7K A;  1XSV A;  1QGP A;  1E17 A;  1J2X A;  1ON2 A;  3GXO A;  4XBF A;  2MLK A;  1H9G A;  1XCV A;  5BPD A;  4YFN F;  4I0A A;  4HQM A;  5BPI A;  4M6Y A;  2TDX A;  5ERI A;  4AWX B;  3MWM A;  4BQA A;  1TQM A;  2V1D A;  4RS8 A;  1IUY A;  3K1N A;  2MC3 A;  2HS5 A;  2FEZ A;  4JK1 X;  4L9T A;  4IHT A;  3LAP A;  3C7J A;  1S3J A;  2L01 A;  2FBH A;  5FD6 A;  1YFH A;  3MQ0 A;  1F1Z A;  2DW4 A;  4DQ2 A;  1P92 A;  4GYG A;  2JSC A;  2Z33 A;  4BXU A;  2HQN A;  2V9V A;  1LDK B;  4BH9 A;  4EJV A;  1KYW A;  3PQJ A;  1W5T A;  4WF2 A;  3D0S A;  2DTR A;  1P4W A;  4I09 A;  2RDP A;  5ILS A;  3ECH A;  1Z6R A;  1GXP A;  4MTE A;  1KYZ A;  2R3S A;  4KFC A;  3SZP A;  4R1H A;  1W7P D;  2RN7 A;  5HLH A;  1UHW A;  3IL2 A;  1JHH A;  4EVI A;  2DT5 A;  3WGI A;  2DLL A;  3TGN A;  4EV0 A;  1WI9 A;  4BHP A;  3FX3 A;  2R7F A;  2GA2 A;  1BI1 A;  3DPT A;  3BPV A;  2P5L C;  2LF7 A;  3E5U A;  4RB0 A;  4EQQ A;  4IF4 A;  5ICG A;  1T6S A;  5LHI A;  5E18 F;  4K2E A;  2Q2E A;  4PZJ A;  2CSO A;  5FLX Z;  1K78 A;  4YG2 F;  2Y0M A;  3QP5 A;  4MGR A;  3Q5F A;  3HSR A;  3IRR A;  2ZME A;  3HOT A;  2QQB A;  3EYI A;  1PUE E;  4CGZ A;  3L00 A;  4RGR A;  4RB1 A;  1J59 A;  2QQA A;  4YFK F;  4Q4Z F;  1F9N A;  2WWY A;  3DXJ F;  2LNB A;  2P8T A;  2OD5 A;  3V7R A;  3N4M A;  2LDU A;  4OMZ A;  4D0P A;  5LLQ A;  1TQI A;  2PFB A;  1QNT A;  4L0Z B;  1RZ4 A;  5E1Z B;  3DEU A;  4ESJ A;  3TOB A;  5LBQ A;  3ABT A;  2Y75 A;  3ULQ B;  3R6S A;  1JHF A;  2NYX A;  4HDU A;  3K1M A;  1HW5 A;  3LST A;  1Z91 A;  2B0L A;  4HLY A;  2EFW A;  4MHG A;  1RUO A;  5LEJ A;  1B9M A;  3FF5 A;  1GXQ A;  1SD6 A;  4WWC A;  3RYP A;  1MJB A;  2DPD A;  2O0Y A;  4IXA A;  4PCQ A;  1Z1D A;  5H6Q A;  4CYD A;  5DDG A;  1ONV A;  4A6D A;  3T8R A;  1T38 A;  2VOP A;  1BIA A;  3WTY C;  3HHG A;  4I98 B;  4A5M A;  3HOS A;  2HWV A;  4LK1 F;  1BN5 A;  4E70 A;  4ZYD A;  4HA8 A;  1SD5 A;  3JTG A;  3W6K B;  2QZ8 A;  2FOK A;  5F1R A;  1LB2 A;  2EV0 A;  3K2Z A;  1IF1 A;  3ROU A;  3CUQ C;  2DO7 A;  4GYI A;  1R00 A;  4WCG A;  2VT2 A;  1OKR A;  3C1D A;  2GXG A;  1FC3 A;  2K7L A;  1E2X A;  3I64 A;  3EUH A;  1TW2 A;  5EEG A;  4EJW A;  1FY7 A;  1CGP A;  2DK5 A;  3M8F A;  4M9Z A;  2IVM A;  3KEO A;  1S7A A;  3HRT A;  1A04 A;  1YW8 A;  3CTA A;  3V8K A;  3F21 A;  1IN7 A;  2EWN A;  4CXF A;  1ZGA A;  1PDN C;  2NNN A;  2YX4 A;  2HOE A;  5JHU A;  5LRS A;  1LJ9 A;  5JR3 A;  4Z2Y A;  2O03 A;  1R1T A;  4XLN F;  2P4W A;  4AD9 A;  2IRF G;  4I01 A;  4G6D A;  1C0W A;  2F5D A;  2DI3 A;  2UWM A;  1HBX G;  4LLL A;  3I71 A;  4KMU X;  1TNS A;  2A07 F;  3HRS A;  3LAJ A;  2EFO A;  2L4M A;  2E7X A;  5ILV A;  3FMQ A;  5H6R A;  3LWF A;  3VFZ A;  3BJA A;  1QBJ A;  2ZME B;  1SD7 A;  2BGC A;  1HKS A;  1NHA A;  2DQR A;  1EH6 A;  1HW1 A;  3JTH A;  2M8E A;  2VXZ A;  3JAM K;  2ZFW A;  1XB4 A;  3HIF A;  1ZG5 A;  1IXR C;  5CVV A;  2HR3 A;  4WXH A;  1WSU A;  3PQK A;  2FQ3 A;  1KU9 A;  1T0F A;  2W25 A;  1CF7 A;  1PP8 F;  4Q47 A;  4Q48 A;  2XRO A;  2YR2 A;  5DYM A;  1MDM B;  1EH8 A;  2FBI A;  3R4K A;  1P6R A;  2IT0 A;  2EK5 A;  3VOD A;  3L2C A;  1GVJ A;  1K78 B;  5F6F A;  4FT8 A;  3M9A A;  1D8K A;  3MCZ A;  2ETH A;  5JFR A;  1ZN2 A;  2HZT A;  3TDZ C;  2MLG A;  4LB6 B;  5CLS A;  2XAQ A;  4F7Z A;  5DUI A;  1J0R A;  3F8C A;  3GZ6 A;  2OA4 A;  2Q0O A;  2G9W A;  2FSW A;  1D5V A;  3NEU A;  4OIN F;  3BZ6 A;  1KU3 A;  2VOD A;  2ZCW A;  1BBY A;  5JI6 A;  2QLZ A;  1YW9 A;  1ZG1 A;  4MEY F;  4OIP F;  1J9I A;  3H3Z A;  2K02 A;  3SXY A;  5BMZ A;  3L9F A;  5LRR A;  3IRQ A;  4EGY A;  4FHT A;  3RKY A;  4B09 A;  3WTU C;  4MQ9 F;  1USS A;  2M5W A;  4UVA A;  5A2Q Z;  2V79 A;  1Z6T A;  1O3R A;  3WE3 A;  3PFI A;  4P55 A;  2QEN A;  4I02 A;  3NRV A;  3GYH X;  3F22 A;  3RKX A;  1T98 A;  3MZY A;  2ISY A;  1P4X A;  1IXS B;  3D5L A;  4ETS A;  2YU3 A;  1SAX A;  2XAF A;  1TW3 A;  3NQO A;  3P7N A;  2ZNZ A;  2EFN A;  1SFE A;  5FFX A;  2JPB A;  2QM3 A;  1IN8 A;  1KU7 A;  3VB2 A;  3EET A;  4HF0 A;  3GFJ A;  3WTT C;  3ELK A;  2IP2 A;  3LQQ A;  2A61 A;  1PP7 U;  3TOA A;  3EYY A;  2A5Y B;  2M45 A;  2BE5 F;  2ZJ2 A;  2E1N A;  1FSE A;  4KT5 C;  2RQP A;  3ZMS A;  4UNO A;  4EM2 A;  1YYV A;  1VTN C;  3KP6 A;  3T0Y A;  4L5I A;  4P9F A;  3R0A A;  5LGU A;  2V1U A;  4M71 A;  5D5X B;  3R0J A;  1R23 A;  3MZH A;  4RB2 C;  5E8G A;  4IHS A;  4HF1 A;  1YTY A;  3ZMD A;  1K7A A;  3TQN A;  5J8C A;  3VEP A;  2EFQ A;  3I59 A;  3P9C A;  4GGG A;  4DNC A;  4ZZL A;  1DUX C;  4JBA A;  3IHU A;  1BM9 A;  3K1P A;  2ELH A;  4UXN A;  2MH9 A;  1IN5 A;  1JXS A;  5K1Y A;  5ICF A;  3H3U A;  3FXR A;  4I2O A;  1OYW A;  4HW0 A;  1R58 A;  3E6D A;  1GHC A;  4HBL A;  3SHF A;  3KLN A;  1SFX A;  3FHZ A;  3E5Q A;  2EA2 A;  1K6O A;  1ZGJ A;  4Y15 A;  5FO5 A;  2F5E A;  2V1X A;  1EH7 A;  2ACJ A;  4Q5S F;  4KIC A;  2RVC A;  3QU6 A;  2F5F A;  4QWQ A;  4QLC U;  2QWW A;  1FBU A;  1YW7 A;  3F6O A;  2ZKZ A;  1HQC A;  2VN2 A;  1IRF A;  4IVN A;  4OOI A;  2IW5 A;  2K4B A;  3GX4 X;  1CF7 B;  4KYW A;  4KIF A;  3E6B A;  4L9J A;  2KJC A;  3P9I A;  2D45 A;  4WXD A;  4AIJ A;  1W7P B;  1YLF A;  2EV5 A;  2L54 A;  1DPR A;  3J81 Z;  3R60 A;  5D4S A;  1SMY F;  1ZRE A;  4O5V A;  2L4A A;  5E20 A;  1KU2 A;  2YSR A;  2D1V A;  3I59 B;  1G6N A;  4N9H A;  4S05 A;  2GZW A;  2PG4 A;  1O3T A;  5ICC A;  3ZN1 A;  1P2F A;  1OMI A;  2PI0 A;  4TV7 A;  4HX7 A;  3WTX C;  2L3D A;  1IZ1 A;  3MEX A;  1DDN A;  5KK1 A;  5LHH A;  4ON0 A;  3KE2 A;  2O6G E;  1QZY A;  1T39 A;  1TTY A;  5FGM A;  1OYY A;  2CGP A;  1XGO A;  3ZMU A;  5HVQ C;  2M1B A;  1MD0 A;  5K5R A;  1LQ1 A;  3BWG A;  1U5T A;  5JVT A;  2CFX A;  3BOQ A;  3EQL F;  1UCR A;  3HTU A;  5HOO A;  2PJP A;  4WK8 F;  2EJR A;  1BC7 C;  2XHK A;  1YG2 A;  2DBB A;  4GCV A;  1QPM A;  1REP C;  3AAF A;  2H27 A;  4FX4 A;  2M30 A;  3KP5 A;  4LMY A;  1G3T A;  2BBY A;  4KIB A;  3WG9 A;  1YS7 A;  3KP4 A;  3BP8 A;  2DK8 A;  4G6Q A;  2AXL A;  5L3G A;  4NQW A;  2J5P A;  1LVA A;  2K4J A;  2F2E A;  3GFL A;  5HLG A;  2RKH A;  2P5K A;  5BS6 A;  1STZ A;  1FYK A;  1WKM A;  1XSD A;  2DU9 A;  3F8F A;  5L3E A;  2STT A;  1RUN A;  1F4K A;  3ZPL A;  1YO5 C;  4I0B A;  4RGS A;  3B02 A;  4CZZ A;  1WWX A;  1HKT A;  3REO A;  4G7O F;  3DKW A;  4CO8 A;  3HRM A;  1FWZ A;  3KEQ A;  4EM0 B;  4M6X A;  4A12 A;  4AIK A;  5E1W A;  3LFK A;  5CVI A;  5J8F A;  1D8J A;  1LDD A;  4HV6 A;  2FA5 A;  3KP3 A;  4ENN A;  1S29 A;  4PDK A;  2CO5 A;  2Q8K A;  1R36 A;  5D5V B;  3I0T A;  3RI4 A;  4CHU A;  2LKP A;  3FMR A;  1SD4 A;  3JSO A;  2CW0 F;  1K79 A;  1U6G A;  3ZP5 A;  1XMA A;  2KIM A;  1YIO A;  3B73 A;  3BJ6 A;  3U2R A;  1W4M A;  5CVR A;  3TDU C;  4YFX F;  2A3S A;  2D1H A;  4YII A;  2EV6 A;  2STW A;  4GO1 A;  3FMS A;  1ZLJ A;  1ON1 A;  4IPA A;  4YIF A;  3CJN A;  1T2K A;  1FBS A;  5L3C A;  1WRJ A;  2A69 F;  3I4P A;  1B1B A;  2GA1 A;  1ZH5 A;  3JW4 A;  3E3V A;  2HYF A;  5AIP A;  3CO6 C;  2ZNY A;  1XN7 A;  5LEK A;  1O7L A;  2GWR A;  1ULY A;  3CDH A;  3RDI A;  1BIB A;  1FSH A;  2IJL A;  5L3F A;  1RNL A;  3O6B B;  4HV5 A;  4G9Y A;  4KMF A;  1EV7 A;  4OIO F;  2OZU A;  3KZZ A;  1XDU A;  5E17 F;  2KRF A;  3HUG A;  2VC1 A;  2Z5U A;  3DV8 A;  3KP7 A;  3R61 A;  1IAW A;  2HTJ A;  4L5J A;  1YQA A;  4R8H A;  4MEX F;  5HS9 A;  1R22 A;  2IA1 A;  3J81 K;  3BDD A;  3I5U A;  3EDP A;  2CG4 A;  4PGH A;  1FOK A;  1G4D A;  2PMU A;  2O8X A;  2A68 F;  4P96 A;  4HAM A;  1FYM A;  4LGW A;  3FXQ A;  1XCB A;  3L09 A;  3COA C;  3GO5 A;  2Z3Y A;  4OU0 A;  5HDG A;  1JE8 A;  4ZYG A;  2VBZ A;  4HX8 A;  4XSZ F;  3JSP A;  2OU2 A;  2XAS A;  4EGZ A;  5HDN A;  1MJ9 A;  3ZN0 A;  5LGT A;  1OR7 A;  1HW2 A;  2P6S A;  4A5N A;  3KZY A;  5DCM A;  1FNN A;  4ENJ A;  2BV6 A;  3U9G A;  5F64 A;  1XGM A;  4GXO A;  5DD4 A;  2QVO A;  3HSE A;  1FX7 A;  2VBW A;  1J75 A;  1I5Z A;  1KGS A;  2XGX A;  3E5X A;  1XMK A;  2QBY A;  4EMS A;  5HDK A;  4ENK A;  4KIG A;  2XKP A;  1AWC A;  5HLI A;  3I54 A;  4RAZ A;  2OAZ A;  4KA4 A;  5DEQ A;  5E1X A;  3MFK A;  4LLG F;  4HZF A;  3LA2 A;  5D4R A;  1TNT A;  4BYY A;  1KA8 A;  4LG0 A;  2HYG D;  2FU4 A;  2H6C A;  1KQ0 A;  2JTV A;  1B6A A;  4EM1 A;  5ED4 A;  3RJP A;  5D6F A;  1O57 A;  4IJA A;  4KDP A;  4IRI A;  1TQP A;  2VE9 A;  2LF8 A;  1LEA A;  2WV0 A;  4ZYH A;  1H0M A;  1FBQ A;  2W24 A;  3LA3 A;  4BHB A;  2JPC A;  3GEZ A;  2NNY A;  4HQE A;  5FB2 A;  2F5C A;  4HF2 A;  3K69 A;  2FBK A;  2V6C A;  3VOE A;  4U7D A;  4O3M A;  3L7W A;  1LNW A;  3O2P E;  4OIQ F;  2KJB A;  3P9K A;  1ZRD A;  2G7U A;  2GIV A;  5D8K B;  4ENM A;  3GUD A;  4A0X A;  1MJA A;  2XAH A;  1IN4 A;  2KIU A;  3Q9V A;  4A6E A;  3I58 A;  1IW7 F;  5DCF A;  5EEH A;  1P4A A;  2HGC A;  3H92 A;  3V8J A;  1FP1 D;  4HDV A;  5KVR A;  4M74 A;  1B9N A;  3KCC A;  2BEO A;  3RPQ A;  3F8B A;  4M73 A;  1W7P A;  4UV8 A;  1RIO H;  3ECO A;  2EA4 A;  2MH2 A;  4M72 A;  2A6H F;  1IXC A;  4RGU A;  3GVA A;  2O3F A;  1ZAR A;  5HS7 A;  3ZMT A;  4Y17 A;  4M9X A;  4LK0 F;  2FNP A;  3G3Z A;  2L02 A;  3BY6 A;  2OBP A;  3GF2 A;  3OOP A;  1KQ9 A;  1RI7 A;  1BC8 C;  4EJU A;  3V7S A;  1ZRF A;  3I53 A;  2XAG A;  2VC0 A;  1U2W A;  2X4H A;  4HOB A;  3J7A O;  2XVC A;  2UXN A;  3CLO A;  5H20 A;  1S8N A;  4H0E A;  2H94 A;  3KFW X;  5FD5 A;  3RKW A;  3M8E A;  3FZV A;  3V7C A;  3K0L A;  4UHT A;  2FE3 A;  3W6J B;  5L3B A;  1B59 A;  4ZH4 F;  2VBX A;  2W85 A;  5IT9 K;  2EB7 A;  1X3U A;  3MAJ A;  3RTR A;  3WTS C;  2FXA A;  2O61 A;  1XDS A;  2D2W A;  3F6V A;  1BJA A;  1LDJ A;  4AIH A;  2CWE A;  3F23 A;  3SQN A;  3SFZ A;  2PLY A;  2XIG A;  1Z7U A;  3KLO A;  3C3W A;  1J5Y A;  4LD5 A;  3O3K A;  2OQG A;  3WE2 A;  3GWZ A;  1IRG A;  4HLX A;  1MDM A;  4N9I A;  1U5T B;  2OZ6 A;  4UVB A;  3E6C C;  2GAU A;  1FYL A;  4L18 B;  3M1E A;  4G94 A;  1SMT A;  1ODD A;  4IRG A;  2XRN A;  5AON A;  5BOX A;  1FT9 A;  1DPU A;  3CUO A;  4ZZD A;  1XSX A;  3J80 Z;  2HTS A;  4PGG A;  3FWE A;  2PMH A;  5LGN A;  5TJJ A;  2RV8 A;  4R79 A;  4LLN A;  4ESB A;  3HRU A;  4HYE A;  2P7V B;  3GZ5 A;  2RGV A;  3WGG A;  4A0Z A;  2QQ9 A;  3BJO A;  1ZAO A;  4U0Y A;  4OIR F;  4KNY A;  3FXU A;  1ZLK A;  3DP7 A;  5AIQ A;  1LEB A;  2E1C A;  3V8L A;  2DAO A;  4P9U A;  1B4A A;  3HSF A;  3JAM Z;  1FP2 A;  3C18 A;  4LG0 B;  3FM5 A;  1JGS A;  2PQ8 A;  2NS0 A;  1O3Q A;  4A0Y A;  3CUQ A;  3GLX A;  3RYR A;  1I1S A;  1Z05 A;  1BI3 A;  2E7W A;  2VE8 A;  3IC7 A;  4XRF A;  3TKY A;  4N0B A;  1BI2 A;  5CYV A;  3ABU A;  4B8X A;  1XGS A;  2WTE A;  3DQV C;  1Z9C A;  2XAJ A;  2XUB A;  5DCM B;  1I6X A;  5DD8 A;  5L3D A;  4ZYE A;  1R1U A;  1R7J A;  3TO9 A;  1ZHF A;  1UST A;  1DP7 P;  2YX7 A;  4KUM A;  1O7F A;  4BNC A;  3QU3 A;  5IT3 A;  2FMY A;  2FML A;  1QO0 D;  1U5T C;  4RAY A;  3M7G A;  2ESH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...