2L01A

Solution nmr structure of protein bvu3908 from bacteroides vulgatus, northeast structural genomics consortium target bvr153
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLVLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of protein BVU3908 from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 19
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10771 DUF2582 Winged helix-turn-helix domain (DUF2582)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l01A00
2GQQA 1ZREA 3I4PA 1YTYA 2P6TA 4ENKA 4EJVA 3PQJA 4HDUA 3QPHA 2BE5F 2DU9A 1UFMA 2O03A 1SFXA 4ENNA 5L3FA 3JAMK 4GO1A 3T5XA 1E2XA 3LFKA 2P8TA 4G6DA 1PDNC 5BQTA 3JTHA 3DXJF 4IRGA 4IHTA 3CJNA 4U0YA 4OU0A 3QU6A 1R1UA 2A69F 1ZG1A 1U78A 2EB7A 1XGMA 4RB3C 2BYVE 3Q9SA 1QPMA 3TDUC 4ENMA 1XGNA 5EEGA 3T8TA 4M71A 2LSOA 1IF1A 5FD6A 3SQNA 2QZ8A 2PJPA 1IXCA 1AWCA 3WU1B 2W24A 1FYLA 5A2QZ 1IW7F 2YPRA 1FY7A 1OPCA 4I01A 3EDPA 4ZYDA 3BP8A 2FSWA 1SMTA 1TBXA 5F64A 1GHCA 5FFZA 1YW8A 3ZMTA 2FRHA 1B9NA 2IPQX 2CYYA 2P7VB 4FHTA 3OOPA 3F8FA 4M9ZA 5ILSA 3DQVC 2NAZA 3SHFA 4ASNA 2W57A 5LGTA 1YG2A 5FO5A 2QBYB 2M1BA 2ZNZA 4Q48A 1ZRCA 2PFBA 3COAC 4BAYA 2IT0A 4AIKA 3E5UA 5KK1A 5LGNA 3I59B 2HQNA 2K27A 3TOBA 3E5XA 3OV8A 4XBFA 3SZTA 1A04A 3MWMA 4EGZA 2QVOA 3ERED 2QQBA 1FSEA 4P5OA 5LLQA 3CUOA 4HX7A 5ICGA 2L3DA 5AIPA 4LMYA 4I7HA 4KDPA 2FBIA 1BC7C 1FYKA 3JSPA 2QBYA 1WQ2A 4HOBA 4L9TA 5E1XA 1WKMA 2JSCA 3BWGA 1HW2A 4HF1A 4KN4X 3GYHX 3GFIA 5TRDA 1XCBA 2UXXA 3KP5A 3E3VA 4S04A 2IVMA 3I59A 4AIHA 1SMYF 2Z5UA 3E6DA 4P55A 1HW5A 3F23A 1MJBA 3MFKA 2L4AA 3F8MA 2Q2EA 3M7GA 1B6AA 1O57A 1Z6RA 1GVJA 1LJ9A 1XGSA 1Y0UA 2MBFA 3RKWA 2HS5A 4DQ2A 3LA3A 1PP7U 3DKWA 3K1PA 2VE8A 4MEYF 5LBQA 1SD4A 5L3GA 4LG0A 2FMLA 2PEXA 1FP2A 3IWZA 3K0LA 1I5ZA 1G3YA 3P9KA 4CGZA 1F1ZA 3M1EA 4Y15A 2VXZA 1LVAA 2XUBA 1HSJA 2WTEA 1OMIA 4G9YA 3L7WA 1UCRA 2EK5A 2QQAA 3HUGA 3J80Z 1IUYA 4A6DA 1W5SA 4L9JA 2K02A 1IRFA 2HYFA 2F5CA 4AVPA 4U88A 4R1HA 2ISZA 5DV5A 5A2QK 1PUEE 1UB9A 3E5QA 4HV6A 1FC3A 4MEXF 1IXRC 1HKQA 2J5OA 2EA4A 4OIRF 2XROA 3I54A 2XIGA 4MNUA 5K5QA 1U6GA 1IN7A 3F8BA 3NRVA 4O5VA 5E8GA 2QWWA 5DDGA 6PAXA 2ETHA 4LD5A 3TKYA 5H6RA 3SFZA 3KETA 4P9FA 1QZZA 4LFUA 3O6BB 4RS8A 1BJAA 3VFZA 2GA2A 2EFNA 4MHGA 2PMHA 3I71A 3GZ6A 3ZMDA 4OOIA 4LLLA 1WWXA 1EH8A 2HGCA 2IA2A 3AAFA 1R36A 1XD7A 2KIFA 3FF5A 1H9GA 1TNSA 1T39A 3N97A 1BBYA 2B0LA 2RNJA 4I02A 3DPLC 3L2CA 3CO6C 4PCQA 1R1VA 1OYIA 3R61A 3U9GA 5HOOA 3WTSC 3GX4X 1DP7P 2HQRA 3R60A 2TDXA 1Z1DA 3WGIA 2H6BA 1UHMA 1TTYA 4PGGA 4KIFA 3FXRA 1MKMA 1WSUA 4P96A 2D1VA 3FMSA 4RGXA 1S29A 1T98A 5K5RA 3PQKA 1UHWA 4XLNF 2GAUA 3V8LA 1XMKA 2PQ8A 2YX4A 3H3ZA 3LAJA 3M9AA 5D5UB 4KT5C 3MQ0A 3ROUA 3W6JB 2PLYA 2VOPA 2NNNA 1XN7A 5D4SA 3R4KA 1V3FA 2ZFWA 2QYOA 4OMZA 2ZBKA 5IT9K 3U2RA 2OQGA 2OBPA 1LEAA 5LHIA 2GWRA 1L3LA 4HYEA 2FXAA 5DUIA 3F8NA 1MGTA 3HSRA 2E1NA 4HBLA 3GF2A 2FBHA 1HBXG 4FX0A 4ZZLA 1KU9A 3E6BA 1QQIA 3V4GA 4MQ9F 2EA2A 4MTEA 2UZKA 3RYPA 4FX4A 4GGGA 2H27A 3V7RA 4XRFA 4O3MA 3FM3A 3JTGA 2ELHA 2F2EA 1W7PD 3T0YA 1K7AA 2M8EA 3O3KA 2XHKA 1HSTA 4KNYA 4LK1F 5DCMB 2BV6A 1L0OC 5K5OA 5CVRA 5F6FA 3I58A 2K4BA 2VBZA 3D0SA 1EH6A 4KN7X 5TJJA 2K86A 4EJWA 1KQ8A 1I1GA 1MZBA 1QGPA 2UWMA 1P4WA 2LF7A 3BJAA 3HHGA 2EV6A 1D3YA 4BNCA 1D8KA 4I0AA 2GA1A 3F72A 3HRUA 1IZ1A 5J8CA 1W7PB 2LDUA 4LK0F 1FYMA 1R23A 2YSRA 1YLFA 5ICEA 2F5EA 2EJRA 3HTSB 3CO7C 3HOSA 3GFLA 5DCMA 1U8RA 5L3DA 3EYYA 1FBUA 1HXDA 3S2WA 1TLHB 4A12A 5DEQA 3WTYC 4U0VA 4PGHA 1MDMB 3RPUA 3EQLF 2L02A 3EETA 5F1RA 1P4XA 1S8NA 3G3ZA 4IVNA 2FNPA 3FM5A 4A0ZA 4KUMA 3GLXA 2MH9A 4MTDA 4JK1X 3BPVA 1BI1A 5D8KB 4WWCA 5HS9A 1W7PA 1ZGAA 2CG4A 4HAMA 2HR3A 1JHHA 4L9VA 3J7AO 4CDGA 1KYZA 4I98B 4G94A 1WI9A 2Z99A 4QLCU 4HF0A 2ZXJA 1USTA 2G9WA 2MLKA 1MDMA 4JBAA 1YFHA 3I53A 2IJLA 4L9NA 1SD6A 2IP2A 3H92A 2ADUA 3V8KA 3ZN0A 4UVBA 5LEJA 4BXUA 2VOOA 3WGHA 3IL2A 5HVQC 2CO5A 4IRIA 3F8CA 4HZFA 4G7OF 2V1XA 5ILUA 3K2ZA 4I09A 4Y13A 4RGRA 1OKRA 1F9NA 3IC7A 5E8IA 1KU7A 2RKHA 1YYVA 2PG4A 2L54A 4EGYA 3CUQB 5HDNA 2J5PA 2HEOA 1RZ4A 3TO6A 3MZHA 1ZLKA 2V1DA 4L5JA 2HDCA 1K6OA 1I6XA 3RJPA 1KQ0A 1XGOA 4HX4A 3ZMZA 2HZTA 3ABTA 1BI0A 4BQAA 1OYYA 2QQ9A 2ACJA 3KZYA 3KP2A 2XKOA 2OQRA 3LAPA 4M73A 4UXNA 5D6FA 3VB2A 3ZMSA 3LA7A 3MAJA 3CUQA 3GXOA 2F5DA 2L01A 4EM1A 3ML6A 1RUOA 4KMUX 3BDDA 2A3SA 5L3EA 5CVUA 2E7XA 1BOAA 2IA1A 2K4JA 2H6CA 1U5TC 2FF4A 3ISPA 4G6QA 1U5TB 1P92A 1Z05A 3E6MA 1R5HA 2XAFA 3BROA 3IKTA 4ON0A 3DP7A 3KE2A 1S6LA 2NNYA 1B9MA 2IA0A 1LDKB 5AONA 3REOA 4U7DA 2A6EF 1HW1A 1ZG3A 1ON1A 2FU4A 3GWZA 1T2KA 1O7LA 2ESHA 3HRSA 1XSDA 1IN8A 5IT9Z 3B73A 3ZMUA 3F22A 5JI6A 2UXNA 1KGSA 3G73A 1V4RA 5CVVA 1U5TA 1Z6TA 2AS5F 4WF2A 2KRFA 4OMYA 2OU2A 2E7WA 4OIOF 5LHGA 5AIQA 2VBYA 1ODDA 3HRTA 1H0MA 1R5GA 5D5XB 4EJUA 1YS6A 3K9TA 1PP8F 2D1HA 3TQNA 3Q5FA 5IT3A 1J59A 2W84A 2VBXA 1TW2A 1F5TA 2DT5A 1CGPA 3HHHA 5ICCA 3PFIA 2GIVA 1DPRA 3JW4A 2KIMA 2Z9OA 1ZLJA 3DF8A 2YR2A 4G7HF 1YW9A 2DPUA 4RAZA 3GFMA 5D8LB 4A2UA 3IRQA 3W6KB 1JE8A 1ZYRF 2FA5A 1QBJA 1QNTA 4YIFA 1G3TA 1R7JA 3K69A 3BJOA 1BN5A 1XDUA 4YFKF 2XGXA 4M74A 3RKYA 4KICA 2EFWA 1OR7A 1FT9A 2CWEA 4JQFA 1ON2A 1TQMA 3CDHA 3VOEA 2VODA 2HKXA 4HQEA 4O6JA 2ZO4A 4NQWA 2ZMEB 4M9XA 5FGMA 4ZYGA 2D45A 1W4MA 4UHTA 5D6EA 3RKXA 5FB2A 4R79A 1SAXA 1G6NA 5FLXZ 1KU3A 1FBQA 3KLOA 1QZYA 4Q47A 1LEBA 2G7UA 4EQQA 4FT8A 4KFCA 4N9IA 5E20A 3FMQA 3GFJA 3F6OA 3VEPA 5LGUA 1J7KA 3TGNA 1IRGA 3KZZA 1J5YA 5HLHA 3C3WA 4HV5A 3HOTA 2ZMEA 5CYVA 2DO7A 1BI2A 2PBIA 3QP5A 2RC4A 1S7AA 2P4WA 2W85A 4RAYA 1FNNA 1O3QA 2COMA 4U7BA 2NS0A 4ESJA 4A5MA 5LRRA 2E1CA 3MZYA 1G4DA 3WODF 2VE9A 3L00A 3LSTA 3QRFF 3QP6A 3WGGA 4LJZF 2O61A 3BPXA 3KCCA 1I1SA 4IJAA 1NHAA 2O6GE 1IN5A 2O3FA 3KP4A 3T1BA 1R1TA 2Y75A 2HWVA 3CTAA 2XAJA 2FEZA 3ZPLA 1KU2A 1MJ9A 2IW5A 2JRTA 4L5IA 5EEHA 3WTWC 2EFPA 1IN6A 4A0YA 5FFXA 2WC2A 4LB5A 2DK8A 1VTNC 3WTTC 1LB2A 3V7CA 3WU0A 1JGSA 2XV4S 3ULQB 3NQOA 2OAZA 2LF8A 3B02A 1DPUA 3D5LA 2FMYA 2YU3A 3K1MA 1BIAA 2KKOA 4MGRA 1X3UA 5L3BA 1C0WA 3FHZA 4UVAA 3HYIA 2A68F 4N9HA 2NRAC 4EJTA 3E6CC 1T38A 2EV0A 2BEOA 3U1DA 5JVTA 1XB4A 2DBBA 2PI0A 2XRNA 2A6HF 2K7LA 1G3WA 3R6SA 1XSVA 5J6XA 3EUHA 4OIQF 1EV7A 3IWFA 2CFXA 4EV0A 1IXSB 1KA8A 1U2WA 1P6RA 4HQMA 4RB0A 1BC8C 4RGUA 1HKTA 4XSZF 3SXYA 1FPQA 2G7HA 3ABUA 1K78B 1EH7A 2STWA 5JR3A 1Z9CA 3M8EA 3ECOA 1ZH5A 1O3RA 2X0LA 2HTJA 4HW0A 1MJAA 4N0BA 5CVIA 1ZRFA 2RV8A 4WXDA 3RYRA 1HKSA 1B1BA 3R0AA 4BHBA 2JT1A 4L0YB 4NB5A 2CW0F 2MC3A 2VC0A 3IKVA 3I5UA 4YFNF 2R7FA 3LWFA 3O2PE 3F21A 1JXSA 1YW7A 3GUDA 3J81K 4BYYA 2HOEA 1S7OA 5FLXK 3ELKA 3DPTA 3P9CA 4OINF 5HS7A 3WTVC 1K78A 2V79A 1P2FA 4M9SA 1P4AA 3WTUC 4IRHA 2RN7A 1IAWA 1R00A 2DQRA 5J8FA 4IHSA 4CXFA 3CLOA 1GXPA 1DUXC 1SFEA 1ZN2A 4ZH4F 2IRFG 1HQCA 4LB6B 4A5NA 2BGCA 5HS8A 2HFHA 2ISYA 5DCFA 3P7NA 2MLGA 5DD4A 4ZYHA 1ZAOA 2A07F 2P7CB 2Y48A 1OYWA 1REPC 3FXUA 1ZHFA 5E1WA 3M8FA 4L0ZB 3CUQC 2MA3A 2VN2A 1KQ9A 3KP6A 4ENJA 5LHHA 5K1YA 1J2XA 3KFWX 4RB2C 1WRJA 1G3SA 4YFXF 4EVIA 2EV5A 2Y0MA 2EFOA 3K1NA 5LEKA 2P5VA 4KMFA 3P9IA 4HF2A 2V1UA 2XAGA 4M72A 1D8JA 3FZVA 3RPQA 5L3CA 2FOKA 2CQKA 2M5WA 4CO8A 1KYWA 2OZ6A 4I0BA 2PMUA 4Z2YA 2RGVA 1R22A 1SD5A 3GW2A 2HTSA 4ESBA 3BZ6A 3MCZA 2DTRA 2VT2A 3IRRA 1XCVA 2XAHA 2MD5A 1XMAA 4F7ZA 2QUFA 2XVCA 3LQRA 1J9IA 5CVJA 4B8XA 4ETSA 3GZ5A 3RTRA 3E97A 2CSOA 3FX3A 1B4AA 4A0XA 3GVAA 2P6SA 3DEUA 1SD7A 2JTVA 1ONVA 1FX7A 1DDNA 2STTA 3HTUA 1F4KA 2DW4A 2YX7A 1RI7A 2Q8KA 4WK8F 1Z91A 2EWNA 3FMRA 3C7JA 2DLLA 1TW3A 1O7FA 2VT3A 2ESNA 1LNWA 4AD9A 2JPBA 2OA4A 1TNTA 4EJOA 1BIBA 4GXOA 4WXCA 1O3SA 4LG0B 1B59A 1XSXA 2P5KA 4XLPF 2A61A 2CGPA 2KJCA 2GZWA 4IPAA 1W5TA 2X4HA 4HLXA 4QWQA 2DFIA 4KYWA 2D2WA 2L4MA 3TOAA 5KVRA 4EM0B 1Z7UA 1FSHA 3GEZA 2P5LC 1FP1D 2NYXA 5DYMA 1LDDA 3T8RA 1FBSA 5E18F 2AXLA 4B09A 4ZZDA 2ZJ2A 2M45A 3F3XA 5BS6A 2LNBA 1USSA 1T0FA 3L09A 4WX9A 2ZCWA 4HA8A 3Q9VA 5ED4A 2GXBA 2DI3A 4RB1A 4A6EA 2XASA 2R3SA 1RNLA 3KEQA 1ZARA 1K79A 5ICFA 1RUNA 4IF4A 2O0YA 1CF7B 1T6SA 2H09A 1U3EM 2FBKA 5JHUA 4GYGA 2BBYA 2ZKZA 1I27A 1H9TA 2FQ3A 2A5YB 1ULYA 2V6CA 4GCVA 4HLYA 3BY6A 4OIPF 2M30A 1Q1HA 5JFRA 4G7ZF 3TDZC 2QM3A 2OD5A 3MEXA 5H6QA 4CYDA 1O3TA 3LQQA 3R0JA 5FD5A 5D4RA 3QOPA 3SZPA 2DQLA 4LGWA 3L9FA 3TO9A 2DK5A 1J75A 1BI3A 1AOYA 4H0EA 4EM2A 2RVCA 1CF7A 4LLNA 3J81Z 2DAOA 4P9UA 3DFGA 1S3JA 5D5VB 4KIGA 2VC1A 5BPDA 2WV0A 2LKPA 4EMSA 3IHUA 1FZPB 2H94A 4UV9A 2Z33A 1TQIA 3F6VA 5HLGA 2PN6A 1ZGJA 3C1DA 3WG9A 4BH9A 5BMZA 2KIUA 3BOQA 5ILVA 1MD0A 1STZA 3BJ6A 3QAHA 3JAMZ 4PDKA 4WCGA 4CZZA 5DD8A 4UUVA 3WTZA 3ECHA 3KP7A 2OZUA 5HLIA 3I0TA 1YQAA 2XKPA 4AWXB 4PZJA 1BM9A 3RDIA 1E17A 2HKOA 4M6YA 4LLGF 4Q4ZF 4IXAA 3HSFA 4XSXF 4Y17A 2DPDA 3RIRA 1SFUA 2VONA 2Q0OA 3C18A 4DNCA 1LQ1A 2V9VA 2ZNYA 5DUKA 3N4MA 4UNOA 3WTXC 1YO5C 3KEOA 4CHUA 4CICA 3ZP5A 4WXHA 3WE3A 1YS7A 3ZN1A 4U0WA 4NHJA 2GXGA 1IN4A 3NEUA 4G8XA 1FOKA 3V7SA 5E1ZB 2W25A 1FWZA 3ZMVA 2WWYA 1J0RA 4M6XA 3HRMA 4Q5SF 3DV8A 4YIIA 4S05A 2F5FA 5CJ9A 3KLNA 3ZQ7A 3VODA 3JSOA 4TV7A 3FWEA 2R7DA 5H20A 4KA4A 2RQPA 2C6YA 1GXQA 4ZYEA 2KJBA 4D0PA 5BOXA 1TQPA 4BHCA 4KIBA 3H3UA 4R8HA 3WE2A 2Z3YA 3I64A 4YG2F 5BPIA 2RDPA 2M87A 3TO7A 4UV8A 4RGSA 3HIFA 2MH2A 2XAQA 2JZYA 3GO5A 5HDKA 5D5WB 4BHPA 2JPCA 4E70A 4AIJA 4HX8A 1YIOA 2EFQA 1R58A 2FNAA 3QU3A 2FE3A 3J80K 3RI4A 1ZRDA 2HYGD 1RIOH 1LDJA 3HSEA 1D5VA 3LA2A 4UVCA 4K2EA 1JHFA 3QPTA 4L18B 2QENA 1XDSA 3FXQA 2VBWA 4I2OA 5CLSA 5E17F 3KP3A 5LRSA 1QO0D 3V8JA 2QLZA 5ERIA 1ZG5A 5HDGA 4HDVA 4ESFA 2O8XA 4GYIA 1FLIA 4MQVA 3EYIA
chains in the Genus database with same CATH superfamily
2GQQA 2Y31A 1ZREA 2X48A 3I4PA 1YTYA 4F92B 3OYEA 3HZJA 4MFEA 2P6TA 4RDUA 4ENKA 1HCRA 4EJVA 2X1DA 2DYSH 3PQJA 2DN0A 2WADA 2Y0SA 1HDDC 4HDUA 1WH5A 3QPHA 4RAGA 2BE5F 2DU9A 3OMYA 1UFMA 2O03A 2LR8A 2I10A 1SFXA 1ZGWA 2EZHA 4ENNA 5L3FA 2VQLA 2KT0A 2HVSA 3JAMK 4GO1A 4XN0A 1A36A 3T5XA 1E2XA 2HQ5A 2MC4A 3LFKA 2P8TA 4G6DA 4BBRJ 1PDNC 4V19K 3JR9A 4CYCA 4CCOA 4QPQA 5FROA 5BQTA 3JTHA 3DXJF 4IRGA 4IHTA 2VJ5A 1Y8RB 1BOBA 2OPTA 3CJNA 4OU0A 4U0YA 3QU6A 3OSFA 1R1UA 4BY1J 1MNDA 2A69F 1ZG1A 1D0ZA 2K3PA 1U78A 2EB7A 2E5ZA 1XGMA 1BR2A 5M3MJ 1LPQA 1K83J 1T08B 1PUFB 3C2HA 3VSLA 2F4MB 4RB3C 2BYVE 3Q9SA 1QPMA 2NVXJ 2HZDA 1MBFA 3TDUC 4ENMA 2R93J 3G6EI 2F48A 1XGNA 3HKZA 5EEGA 3T8TA 4M71A 2RAEA 2LSOA 1IF1A 5FD6A 3SQNA 2R7RA 1GVDA 2QZ8A 2UV1A 2M2EA 1F36A 5LD2C 2PJPA 1IXCA 1JUSA 3P5JA 1D1AA 1AWCA 3WU1B 2W24A 4DJAA 1FYLA 5A2QZ 1IW7F 2YPRA 1FY7A 1WJBA 4XNFA 2R7UA 1OPCA 4I01A 5LFAA 1X2MA 2XB0X 3E0JB 3EDPA 4IHYA 4ZYDA 3BP8A 2FSWA 1SMTA 2ECBA 3A03A 1TBXA 3K4JA 3FKIJ 4AVZA 5F64A 1GHCA 4XLFA 2M8GX 5FFZA 1YW8A 4ZTFA 3H5RA 3ZMTA 2FRHA 4E4HA 1B9NA 3JRBA 1RR8C 2IPQX 2CYYA 1MBKA 3G1OA 2P7VB 4FHTA 3OOPA 3HBLA 4C3JJ 2B9SA 1IJWC 3F8FA 4M9ZA 4XR6A 3H5NA 5ILSA 2ZC2A 1YX5A 1BW6A 1X1AA 3DQVC 1MMGA 2NAZA 3SHFA 2E60A 3U1KA 4ASNA 1V5GA 1SVLA 1MBJA 3J7ZI 3ZQCA 5C4JJ 3ZQIA 2W57A 3HOVJ 5LGTA 4C2UA 1Z0XA 1YG2A 5FO5A 1X58A 4F3QA 2QBYB 2M1BA 3Q0UA 2ZNZA 4Q48A 1VQLI 1ZRCA 1QA6A 2PFBA 3COAC 3F0CA 5F27A 4BAYA 5E3LA 4I99C 4A3IJ 4ABZA 2IT0A 2L9VA 4AIKA 4PJMA 1A35A 3E5UA 3UR3C 4II2A 3DBLB 3S16J 2GLOA 5GAHJ 1GV5A 4KJZA 3I3LA 1PVEA 5KK1A 3I59B 2HQNA 2K27A 5LGNA 3A01A 3ABLH 1K4SA 4BS9A 3TOBA 3E5XA 5DTDA 3OV8A 2OJED 4BDZA 2E2JJ 4XBFA 3SZTA 1A04A 3MWMA 4EGZA 2QVOA 3H0GJ 1WZ2A 1I6HJ 2VQHA 3CCQI 3GTLJ 3ERED 2QQBA 1FSEA 4P5OA 2Q2EB 1B8IB 5LLQA 3CUOA 4HX7A 3KZIC 5ICGA 2L3DA 3DEWA 3W3CA 2MG4A 5AIPA 4LMYA 4I7HA 3RQIA 2LY2A 2H8RA 4KDPA 2X1CA 2FBIA 4M3BA 1T0FC 1BC7C 3RCOA 1HDPA 1FYKA 3JSPA 2QBYA 1WQ2A 2M7AA 3S3MA 2BOLA 4HOBA 1R4MB 4L9TA 2DFHA 5E1XA 1WKMA 2BZTA 2JSCA 3BWGA 3OYIA 1HW2A 2NVQJ 2Z16A 4HF1A 2F6CA 2V6EA 4KN4X 3GYHX 2DA2A 2R92J 1R49A 3JRAA 3GFIA 2XPUA 5TRDA 1XCBA 1YHQI 2UXXA 5KHDA 3KP5A 3E3VA 1DGWY 4S04A 1JKOC 2IVMA 3I59A 2E2HJ 4AIHA 1SMYF 2Z5UA 3E6DA 3S17J 4P55A 3BR1A 1SAUA 1Y0NA 3MD2A 4IEJA 1HW5A 1MBEA 2K85A 2Y9YA 1IV8A 1MJBA 3F23A 3MFKA 2EPFA 1D1BA 5JVGF 2L4AA 2CUZA 3F8MA 1Z3YA 4PUSA 2Q2EA 1B8IA 3M7GA 1B6AA 1O57A 1Z6RA 1GVJA 1R4NB 5KAFC 1LJ9A 1XGSA 1Y0UA 2MBFA 3RKWA 2HS5A 4DQ2A 1IO2A 5EEAA 4IOCF 4BE2A 2O8KA 3H9JA 2DA7A 5IYBJ 2XRLA 3LA3A 3HUGB 3DKWA 1RPWA 3K1PA 4NBQA 1PP7U 4BEHB 1Z77A 2VE8A 4MEYF 1A6IA 5LBQA 1SD4A 4XRSA 5L3GA 1FIPA 1ZR2A 3Q0VA 4LG0A 2FMLA 2PEXA 2R7QA 1FP2A 4B1RA 3IWZA 2WB1N 4DBQA 3OS0A 3K0LA 3RSNA 1I5ZA 1G3YA 3P9KA 3CC2I 2R4GA 1OCOH 3ZRGA 4CGZA 3AFHA 3A0HC 2ME0A 1F1ZA 3M1EA 4ZTJA 2VUMJ 4Y15A 2LVSA 2VXZA 1WFXA 3CMMA 1LVAA 2JA2A 2XUBA 5K7FA 1XC5A 1HSJA 2KPMA 1B72B 4NQWB 1QPIA 2WTEA 5KCMA 1OMIA 3FXLA 4G9YA 3SEQA 2DTZA 3L7WA 3SFIA 1UCRA 4EATA 1VQ7I 2EK5A 3ZR8X 4D9JA 1D1CA 2QQAA 5GTHC 4M6VA 5IYDJ 3HUGA 3J80Z 5IOYA 1IUYA 2Y0SN 4BEHA 4A6DA 1W5SA 2V1NA 4L9JA 2VKEA 2QQ8A 5J3LA 5B5EC 2K02A 2JQ7A 3TL4X 1IRFA 1LVKA 2CUEA 2HYFA 3MVPA 2F5CA 2L7FP 4U88A 4AVPA 4R1HA 2ISZA 5DV5A 5A2QK 1PUEE 3JRCA 2CQNA 1UB9A 2R7VA 1UJ8A 1M1EB 4ZDPA 3E5QA 4HV6A 1FC3A 2R7OA 3KIOA 2OCEA 1U9OA 4MEXF 1IDYA 4A3JJ 2NOGA 1IXRC 1HKQA 2ID6A 2EA4A 2J5OA 3AL0C 2CW8A 3QYBA 2HXIA 2M4GA 1BL0A 1ERDA 2GBYA 3IV5A 1S9HA 4CCKA 2A05A 4OIRF 4IQJA 3ZCOA 3CMAI 3AL0B 4II3A 1ZELA 2XROA 2E5NA 4D7MA 3I54A 4B48A 5FKOA 3S1NJ 1FOYA 2XIGA 2ZJQF 4MNUA 5K5QA 1U6GA 1IN7A 3F8BA 3NRVA 3CCLI 4O5VA 4ZC3A 5E8GA 3FXOA 2QWWA 3IH4A 3BG5A 4XK4A 5DDGA 1B72A 6PAXA 1SANA 2ETHA 4LD5A 3DKYA 3GMEA 3TKYA 3SZGA 3HKZN 1I3QJ 5FRNA 2EILH 5FRMA 5H6RA 3IH2A 3SFZA 3CCSI 1JJ8C 2CFOA 1WPKA 5EGOB 3KETA 2GOMA 5FKKA 4P9FA 3EPZA 1QZZA 4LFUA 4ITVA 3O6BB 4RS8A 1BJAA 3VFZA 2GA2A 4ZJZA 2EFNA 1WVRA 4MHGA 2PMHA 3S32A 1TT5B 3I71A 2AQFA 3GZ6A 3ZMDA 2K40A 4OOIA 3DU5A 2LOOA 4LLLA 1WWXA 1RESA 1EH8A 4JX6A 2HGCA 1X4OA 2IA2A 3BR0A 3VSKA 1D5YA 4A3MJ 3W2AA 3AAFA 2JK3A 4X1EA 1R36A 1XD7A 2KIFA 3FF5A 1H9GA 1TNSA 1T39A 3N97A 1BBYA 2B0LA 2RNJA 4I02A 3DPLC 3L2CA 3CO6C 4X0GA 4PCQA 1R1VA 1QU3A 1OYIA 3SDBA 3R61A 3U9GA 1JTXA 3HPHA 5HOOA 3WTSC 3GX4X 4XONA 1DP7P 2HQRA 3R60A 2TDXA 3JRHA 1Z1DA 3WGIA 3VYRB 2JMWA 2H6BA 2V9PA 4DIQA 4M3DA 1UHMA 1TTYA 3Q3SA 3FXRA 4KIFA 4PGGA 1MKMA 1WSUA 4P96A 2D1VA 3FMSA 1IDZA 4RGXA 3BZKA 1FMWA 1S29A 1Y56A 1T98A 4HPQA 4FCYA 5K5RA 3OYCA 4N4NB 3PQKA 4PJLA 5EGOA 1UHWA 4MLOA 4XLNF 2EQRA 1N75A 2CRGA 2M3AA 2GAUA 4BJTA 2LY9A 1V54H 3V8LA 2R7ZJ 1XMKA 2PQ8A 2YX4A 3FIWA 3HEFA 3H3ZA 3LAJA 3M9AA 1VQNI 5D5UB 4KT5C 3S3NA 4ZDLA 3MQ0A 4F93B 3ROUA 3W6JB 2PLYA 2VOPA 2NNNA 2MABA 1XN7A 5D4SA 1NK3P 3MN2A 2X6OA 3R4KA 2KZGA 1V3FA 3LOCA 2ZFWA 2QYOA 4XLCA 4OMZA 2ZBKA 2K9MA 4F55A 5IT9K 3HOYJ 3U2RA 4Z6YA 2OQGA 2OBPA 3V42A 1LEAA 2ZB9A 3ZOBA 4DZJA 2QSFX 5LHIA 3ZQLA 2GWRA 1L3LA 4HYEA 2FXAA 5DUIA 1V5EA 3SEZA 2VQGA 4UY8I 1OQYA 3F8NA 1MGTA 3HSRA 3TMOA 2E1NA 1I39A 2X6YA 3CCYA 4HBLA 2YU9J 3GF2A 3HOUJ 2FBHA 1HBXG 4FX0A 1OCTC 4P1WA 4ZZLA 5M3FJ 1KU9A 3NAUA 1VZ0A 3RPUD 1SFOJ 5FKNA 3E6BA 4FQGA 4CH7A 1QQIA 3V4GA 4MQ9F 5BNGA 2EA2A 4MTEA 2VI6A 2JWTA 3OL3A 4XLEA 4Y52J 2UZKA 4RMNA 3RYPA 4FX4A 4HNTA 4GGGA 2H27A 3OIOA 3V7RA 4XRFA 1I50J 2CH0A 4O3MA 1WJ5A 3FBNB 3FM3A 1TWGJ 3JTGA 2IEKA 1GT0C 3PIOF 2ELHA 2F2EA 3S93A 3JRDA 1GUUA 1W5CC 2DT6A 2G0EA 1W7PD 2WAQA 1YIJI 3CCRI 1LKXA 3T0YA 4YRVA 3IUOA 1R71A 4Y3OA 1XG1A 3DPUA 3TP3A 1K7AA 2M8EA 1WHUA 3O3KA 3DEEA 3LSHA 2XHKA 1HSTA 1YJNI 4KNYA 4LK1F 5DCMB 1MNMC 3GCMA 3QOEA 1LFPA 1L0OC 2BV6A 5K5OA 5CVRA 5F6FA 3LSPA 1MW7A 3I58A 2ZJPF 2K4BA 2VBZA 4M3GA 3M8JA 3H36A 1VQ5I 2HVQA 3CZ6A 1UG0A 3D0SA 4D5CA 1EH6A 4KN7X 3O8HA 4E7HA 3WHBA 3I56I 5TJJA 2K86A 4EJWA 4XLAA 2X51A 1KQ8A 2ZXHA 1IUFA 1I1GA 5IP7J 1MZBA 1QGPA 2UWMA 5GP9A 4C3IJ 1P4WA 2LF7A 1RETA 3BJAA 3HHGA 4ZDOA 2EV6A 4Y4RA 1D3YA 4BNCA 3S14J 1D8KA 4I0AA 3HJEA 5JLXA 2GA1A 3MKWB 3F72A 2VB6A 3HRUA 2DYRH 1SEUA 1IZ1A 1MBGA 5J8CA 1W7PB 3ONQA 2NXNB 3LSMA 2LDUA 2IXSA 4LK0F 4UB6C 3LMMA 1FYMA 1R23A 2YSRA 1YLFA 5ICEA 2VL8A 1GDTA 3GTMJ 1TL8A 2F5EA 2EJRA 3FXMA 1BA5A 2QKLB 3HTSB 3DKXA 3CO7C 3HOSA 3GFLA 1R6RA 3HGYA 3L2WA 5DCMA 1FEXA 1U8RA 3A1YA 5L3DA 3TW6A 3EYYA 4A3FJ 1D0YA 2NS7A 4IZZA 4BACA 1FBUA 1HXDA 3S2WA 4AC0A 5DS9A 1TLHB 5CQGA 2I5UA 4A12A 3LSIA 2BHZA 2K9NA 5DEQA 3WTYC 2CQXA 4HSRA 2KLOA 4U0VA 3Q0WA 4PGHA 1MDMB 1RRJA 3RPUA 3EQLF 3B6AA 2DOEA 2L02A 1ENHA 3SDGA 2ZXWH 3EETA 5F1RA 1G8XA 4XRMA 2LKSA 1P4XA 4NC7A 1S8NA 1T33A 3G3ZA 4IVNA 2FNPA 1YOVB 3FM5A 5M5WJ 3FK6A 4KUMA 3GLXA 4A0ZA 2MH9A 1IG7A 3CP2A 4MTDA 3VYUB 2QF7A 3BPVA 4JK1X 4LIUA 1BI1A 2QSGX 3G2BA 5D8KB 2HOSA 4WWCA 5HS9A 1W7PA 1ZGAA 3OYMA 1YJWI 2KZVA 2CG4A 2R5ZB 3D5RC 5FKMA 4HAMA 1AA7A 1JTYA 2HR3A 1JHHA 4FETA 4L9VA 3J7AO 3C2BA 3CMEI 1TZLA 4E7KA 1VQOI 4V2FA 4BQNA 2VXDA 1KYZA 4CDGA 4I98B 4G94A 1WI9A 2Z99A 2KDZA 2ZSHB 4RLQA 4QLCU 4HF0A 5IP9J 2ZXJA 2LKXA 5M5YJ 1USTA 2G9WA 2DJNA 2GM4A 2MLKA 4XKCA 4YEJA 2W1OA 1J09A 3PJRA 1MDMA 1P7JA 5C4XJ 2A5WA 4PSXA 4JBAA 1YFHA 3I53A 2IJLA 2EIKH 4G12A 4L9NA 4CCNA 2WAFA 1SD6A 2IP2A 3H92A 3QYFA 2ADUA 3V8KA 3ZN0A 4OAZA 1MNEA 2DDAA 2L0KA 4UVBA 1OCZH 5LEJA 4BXUA 2COBA 4I6ZA 2VOOA 3HPGA 3WGHA 3IL2A 4HRIA 5HVQC 2CO5A 3CDIA 4IRIA 3F8CA 4HZFA 3IH3A 2V1XA 2XGEA 1U0JA 4G7OF 5HNHA 5ILUA 3K2ZA 4I09A 1HF0A 4Y13A 4RGRA 1OKRA 5B1BH 1F9NA 3IC7A 2VPLA 2XGCA 5E8IA 2R5ZA 1KU7A 2RKHA 1YYVA 2PG4A 2L54A 3CP8A 4EGYA 3CUQB 1WH7A 2CW7A 2J5PA 5HDNA 3J7YJ 2HEOA 2P0WA 1RZ4A 2O7OA 2VJ4A 1HC8A 2E2IJ 1WJCA 4XMYA 3TO6A 2DMQA 3HXLA 3MZHA 1ZLKA 3MKYB 1V5FA 2BY3A 2V1DA 4L5JA 2HDCA 3DTIA 1K6OA 2LH9A 1HA8A 1PUFA 2QGUA 1HOMA 1I6XA 1CQTA 2JUCA 3RJPA 3M3YJ 2HQAA 3GBGA 3H9QA 1KQ0A 2H1LA 3E7LA 1XGOA 4FISA 4HX4A 2V9KA 1T95A 2NS8A 1TT0A 3ZMZA 2HZTA 3ABTA 1BI0A 3IP4B 1RKTA 4BQAA 3J7AY 1FJLA 1OYYA 1S72I 1DGRM 2QQ9A 4HNUA 1WJEA 2R5YB 2ACJA 3KZYA 3KP2A 1E3HA 3CESA 2XKOA 2OQRA 1N77A 1MSFC 3PNVA 3OS1A 4HNVA 3LAPA 4XL9A 4M73A 4UXNA 5D6FA 4QTRA 4BY7J 2JA8J 3VB2A 3ZMSA 3LA7A 3A2KA 4F52A 3MAJA 3CUQA 2EINH 3GXOA 2F5DA 1TWFJ 2EIJH 2DA6A 4HSTA 2L01A 2Z2SB 4EM1A 3H5AA 3ML6A 1RUOA 3I4NJ 2HOTA 1U8BA 1DU0A 1FIAA 1QHGA 2MW8A 4KMUX 3BDDA 2VKDA 3OIPA 2A3SA 4KT6A 5CVUA 5L3EA 2E7XA 1BOAA 4PSWA 2IA1A 3OYAA 3D1NI 2BY2A 2K4JA 2H6CA 1U5TC 2FF4A 3ISPA 4AYBA 1PYVA 4G6QA 1U5TB 1P92A 1Z05A 4BBSJ 3E6MA 1R5HA 4LG3A 2XAFA 1APLC 2XDVA 3BROA 2JVGA 2E36A 5GPCA 3IKTA 1MMNA 4ON0A 3DP7A 2XGDA 4MO7A 3JREA 3KE2A 1S6LA 2FQ4A 1Q1VA 5K7HA 2NNYA 1B9MA 2R5YA 2IA0A 1LDKB 3QPLA 5AONA 3DLAA 3REOA 4U7DA 4A3LJ 2A6EF 3BLYA 1HW1A 2OF7A 1W36D 1ZG3A 4NUBA 1ON1A 2FU4A 2DA1A 3GWZA 1T2KA 1O7LA 2RNGA 2JRMA 1MBHA 3G1MA 2XPWA 3OR1C 2VQCA 2ESHA 2WAQN 2IS1A 3HRSA 2LY1A 4B3AA 4UUSB 5EZGA 1XSDA 1IN8A 1WJAA 5IT9Z 1Y8QB 3B73A 3BG6A 2CQQA 3W2VA 2MSYA 1Y1VJ 4BE0A 3ZMUA 2XPVA 4B44A 1KZHA 4S0HB 3F22A 1H89C 5JI6A 2UXNA 5F0CA 2R7XA 1KGSA 3G73A 1V4RA 3S1RJ 1IRXA 5CVVA 2VKVA 4PFPA 3SYTA 1U5TA 2CUJA 2ELJA 3K70D 1Z6TA 2AS5F 4WF2A 4CCMA 3U21A 2KRFA 4HG2A 3K2AA 1W36C 5E3NA 4OMYA 1FTZA 3QYEA 2OU2A 2E7WA 4OIOF 5LHGA 4M3FA 3OYBA 5J1YA 1YE9A 2VBYA 5AIQA 1ODDA 2DFEA 3HRTA 3MZ8A 1EJ9A 1H0MA 1R5GA 1JT6A 2BY1A 5D5XB 4EJUA 3PM1A 1YS6A 3K9TA 4NDLA 4CSWA 1I3AA 2EIMH 1PP8F 1QRYA 2KRHA 2D1HA 3TQNA 3Q5FA 4C30A 4DZPA 5IT3A 1J59A 1X1CA 3S8PA 2W84A 3I55I 2IS2A 2VBXA 3L2RA 1TW2A 4KITB 3CCMI 1F5TA 4GDFA 2DT5A 3GTOJ 1CGPA 3HHHA 3K70C 5IPAA 5ICCA 1A6QA 2DCEA 3PFIA 9ANTA 2GIVA 1DPRA 3JW4A 3A0BC 2KIMA 2Z9OA 1ZLJA 3DF8A 2YR2A 4G7HF 1YW9A 3EUAA 2DPUA 4RAZA 2JVHA 3GFMA 5D8LB 4UUTA 4A2UA 3IRQA 2DT7B 3W6KB 1JE8A 1ZYRF 2FA5A 1LE8B 3OYGA 1QBJA 1X3ZB 2DMTA 4DW6A 3DBHB 1QNTA 2LC2A 4B47A 4YIFA 3VYSB 1G3TA 1R7JA 3K69A 3BR2A 3BJOA 4A3KJ 5J47A 1BN5A 1XDUA 3BQYA 4YFKF 2OUMA 2XGXA 4A93J 4M74A 3OYLA 3RZDJ 2BXYA 1H88C 3RKYA 1VQ9I 4C2TA 4YIRX 3FKJA 4KICA 2EFWA 1X1DA 1OR7A 1FT9A 2CWEA 2E71A 3K10A 4C2MJ 4JQFA 1ON2A 1OJLA 1TQMA 2TRTA 4QPOA 2JJ7A 3LNQA 3CDHA 3VOEA 3LSJA 2VODA 2HKXA 4HQEA 1MSEC 4FASD 4O6JA 3LL7A 2ZO4A 2XF6A 4IQ4A 4NQWA 1WJDA 2ZMEB 4M9XA 5FGMA 4ZYGA 1VI0A 4RM2A 2D45A 3PIPF 1W4MA 4UHTA 5D6EA 1XMXA 3OOUA 3RKXA 5FB2A 3CMYA 1WJFA 2VLAA 4R79A 1SAXA 2Y2ZA 1G6NA 4D5FA 1VFCA 5GTIC 3DU6A 5FLXZ 1KU3A 1ACIA 2ID3A 1FBQA 3G1LA 3KLOA 4BU2A 2EBIA 4NNJA 2CQ7A 1QZYA 4AM3A 4Q47A 1LEBA 2G7UA 3ZQGA 3BTCA 4EQQA 1MMDA 1OFCX 3CCEI 4FT8A 4XICA 3N05A 1FOXA 4MIMA 4U87A 5F0FA 4KFCA 2BW3B 2IAIA 4N9IA 5GAEJ 3O8GA 1EA3A 5E20A 3FMQA 2LBFB 3GFJA 1TWCJ 3F6OA 3VEPA 5LGUA 3ASNH 3LSRA 4DBRA 1J7KA 3TGNA 2B7EA 1IRGA 3KZZA 1J5YA 1ETOA 2K9QA 4BXXJ 5HLHA 4A3EJ 4ZYAA 1AHDP 3BZCA 1GV2A 3C3WA 3GTGJ 1E3PA 2RREA 4HV5A 2LG4A 3HOTA 2ZMEA 5CYVA 2DO7A 2DMNA 1BI2A 2PBIA 1JKQC 1AU7A 1YJ9I 3QP5A 4A69C 2RC4A 4RBOA 1S7AA 2P4WA 2NVUB 1XPXA 2L7ZA 2W85A 3BC8A 1FNNA 4RAYA 1O3QA 2F4OB 3TP0A 2HVRA 2COMA 4RAFA 4U7BA 1POGA 2NS0A 5IOZA 4ESJA 4A5MA 4RM3A 5LRRA 2E1CA 4XM3A 2E34A 3MMYB 2W48A 3H3VK 4RA2A 3MZYA 3HOZJ 2PX9A 1G4DA 3WODF 2VE9A 3L00A 3HGGA 3LSTA 3QRFF 3QP6A 3WGGA 4LJZF 2O61A 1BR1A 1X1BA 2L2OA 3BPXA 3KCCA 1ETYA 2FX0A 4IJAA 1I1SA 2AO9A 1NHAA 2O6GE 3VDXA 1A5JA 1IN5A 2O3FA 3KP4A 4XLHA 1JGGA 3JRIA 3T1BA 1R1TA 2LBFA 2Y75A 2HWVA 3CTAA 3QODA 4B4CA 5DM7F 4LITA 1G2HA 2XAJA 1TC3C 2FEZA 1XS9A 3ZPLA 1KU2A 1MMAA 2BVLA 1MJ9A 3KYDB 2IW5A 2JRTA 3SJMA 4L5IA 5EEHA 2LD5A 3IAS2 5HNFA 3WTWC 2XSDC 2EFPA 3EUHC 1IN6A 4A0YA 5FFXA 2WC2A 4LB5A 2DK8A 3A4CA 2Y9ZA 2VJJA 4XOTA 2LMDA 1VTNC 3WTTC 1LB2A 2KRCA 3V7CA 3WU0A 1JGSA 2XV4S 4AYBN 2DDBA 3ULQB 3PO2J 3BR5A 3CF2A 3NQOA 2OAZA 2R0QC 2K5CA 2LF8A 3B02A 1DPUA 3D5LA 2FMYA 3ABKH 5C3EJ 4EEFG 2YU3A 2L7MP 3CDLA 1WCMJ 3K1MA 1BIAA 4AU7A 5C44J 2KKOA 4MGRA 2CU7A 2LREA 1X3UA 1JUMA 5L3BA 2O9LA 1C0WA 3FHZA 4CCLA 4DOZA 2IGKA 1IV6A 5DM6F 4UVAA 3HYIA 2LYCA 2E1MC 2A68F 4IO9F 3DTEA 2VASA 3JCUC 4E7LA 5IY5H 4BJ6C 2E1MB 3HG9A 4F91B 3FDYA 4N9HA 2NRAC 3BG3A 4EJTA 3KX2A 3E6CC 2ZXIA 5FLMJ 1T38A 1S5LC 2R7TA 2EV0A 3AG3H 2BEOA 2XF5A 3U1DA 3TEDA 2P81A 2KFDA 1XB4A 2A6TA 2DBBA 5JVTA 2PI0A 2XRNA 2A6HF 2K7LA 1G3WA 2LRDA 3R6SA 2HOAA 1XSVA 2MYSA 5KAIC 3EUHA 4M3EA 5J6XA 1EV7A 4OIQF 3IWFA 2QCOA 4XQFA 2CFXA 4EV0A 2VIXA 2DODA 1UZCA 1IXSB 1KA8A 4B43A 1U2WA 1P6RA 2K9SA 4BQQA 5JLWA 5GPAA 4HQMA 4RB0A 3ZQFA 1BC8C 5J4YA 4RGUA 1DU6A 1HKTA 4XSZF 3SXYA 3F9KA 2XSJC 2E19A 5HLTA 4E7IA 1FPQA 4OAYA 2G7HA 1YITI 1QZEA 3ABUA 1K78B 1EH7A 2STWA 1UMQA 5JR3A 1Z9CA 3M8EA 1G59A 2HDWA 3ECOA 3LFUA 1ZH5A 4G6TB 2IS6A 1OCPA 5EZHA 5GADJ 1O3RA 4A3DJ 2X0LA 1Z7LA 3PNTA 2B63J 1R9TJ 1QHHD 2M34A 2HTJA 4HW0A 1MJAA 2CS3A 4N0BA 5CVIA 3L2VA 1ZRFA 3EUKL 3RZOJ 2RV8A 2D5VA 1S7EA 4WXDA 2WAEA 3OYDA 3RYRA 1HKSA 1NG7A 1B1BA 4IHWA 3R0AA 4BHBA 2JT1A 2PMZA 4L0YB 4NB5A 2QA4I 2CW0F 1ETQA 1ETWA 2MC3A 2LFBA 4QSHA 4DYRA 4BE1A 2VC0A 1ZKGA 2HDDA 3IKVA 3I5UA 1SC7A 4YFNF 2R7FA 3LWFA 3DBRB 3O2PE 1MH4A 3QWLA 2LP0A 3F21A 1JXSA 1YW7A 4Y33A 3GUDA 4FE4A 3AG1H 3J81K 4BYYA 2HOEA 3OL4A 1S7OA 5FLXK 4XKWA 2DA4A 3ELKA 1VQPI 3DPTA 3P9CA 4OINF 3A02A 5HS7A 5F04A 3WTVC 2ICWG 1K78A 2V79A 1P2FA 3BR6A 3H0DA 1K6YA 2WBMA 3L2QA 3DLLF 1R5ID 4NC6A 4M9SA 1P4AA 3WTUC 4D1QA 1QVTA 2KHMA 4IRHA 1E3OC 1BJZA 4E6KG 3CC4I 1JKPC 2RN7A 1VNDA 1IAWA 1R00A 2DQRA 3KPHA 3D5SC 4CCJA 2K3FA 5J8FA 2H8WA 4IHSA 4CXFA 3CLOA 3TBIA 2X6WA 4W1UA 1GXPA 1DUXC 1SFEA 1ZN2A 4ZH4F 2IRFG 2JA5J 1HQCA 3BT9A 4LB6B 3FK7A 3OYHA 2V4JC 4A5NA 2MGQA 1OLTA 2FUG2 5EF6A 3PO3J 2BGCA 2ZSIB 5FKLA 5HS8A 5B3SH 2E35A 3OS2A 2PJRB 4C9YA 5IYCJ 2HFHA 4GRIA 2ISYA 5DCFA 3P7NA 2MLGA 5B1AH 3LSGA 1U9NA 5DD4A 4KISA 3GZNB 4ZYHA 1ZAOA 1DQUA 2A07F 3QQAA 2CMPA 3M1CA 3PSFA 2P7CB 3OIQA 2QSHX 1NH3A 2Y48A 1OYWA 1REPC 3FXUA 2MD0A 1ZHFA 5E1WA 3M8FA 4L0ZB 3CUQC 3JRFA 2VN2A 2MA3A 1KQ9A 1O4XA 3KP6A 4ENJA 5LHHA 2FD5A 1J2XA 5K1YA 3KFWX 4RB2C 4AIDA 1WRJA 1ORKA 4DGWB 1G3SA 3HC7A 4YFXF 4EVIA 1PJRA 2O5RA 2EV5A 1HLVA 2Y0MA 2EFOA 2HNHA 3K1NA 5LEKA 1OCRH 2MFZA 2P5VA 4KMFA 5B66C 3P9IA 3ZQQA 4HF2A 3A01B 4XOPA 1VF9A 2V1UA 3OSGA 2XAGA 4M72A 1D8JA 3FZVA 3RPQA 2XC7A 2M9HA 5L3CA 1H8AC 2FOKA 4A3CJ 1Y39A 2HPIA 1NG6A 4PJJA 1MMSA 2CQKA 2M5WA 3WU2C 4CO8A 1KYWA 2OZ6A 2V26A 4I0BA 2PJRA 2VKHA 2NOJB 2PMUA 4Z2YA 4BKXA 2XF7A 2RGVA 1R22A 1X1PA 3CCJI 1SD5A 3GW2A 2HTSA 2X9DA 4ESBA 3BZ6A 3MCZA 2DTRA 5CQEA 2VT2A 3IRRA 1XCVA 3MKLA 2XAUA 2QEXI 2XAHA 2MD5A 2OTLI 2E1OA 2DOAA 1ITYA 1E0EA 1ZR4A 1XMAA 4F7ZA 1D0XA 2QUFA 2XVCA 2R7SA 3LQRA 1J9IA 5CVJA 2IS4A 4J19A 1XTAA 4B8XA 5TGTA 4ETSA 5J1RA 4ANJA 3GZ5A 3RTRA 3E97A 2CSOA 3FX3A 1B4AA 4A0XA 3E1SA 3GVAA 4JX5A 1T8IA 2L9NA 2P6SA 2AHQA 3DEUA 1SD7A 2Q1ZB 1W0UA 2JTVA 1NTCA 1ONVA 3WHCA 3VYTB 1FX7A 1DDNA 4XRSG 5FLVA 3H35A 2STTA 2F5VA 3HTUA 4QIWN 1K61A 1F4KA 2JSPA 3S1QJ 3GLLA 3BCBA 4FE7A 2DW4A 4XIDA 2YX7A 1RI7A 2Q8KA 4WK8F 3S1MJ 2I8DA 1Z91A 3KEYA 3CLQA 2EWNA 3FMRA 4XKVA 3AKZA 3C7JA 2DLLA 2EZKA 1TW3A 1O7FA 2VT3A 2W82A 2ESNA 1LNWA 4AD9A 3RKQA 1BW5A 4BUPA 3QPSA 5M5XJ 2JPBA 2OA4A 1TNTA 1F43A 2RQQA 3TW7A 4EJOA 1YI2I 1BIBA 1VQKI 3AG2H 4GXOA 5KNLA 2AXTC 4WXCA 3W2WA 1O3SA 1UELB 4LG0B 3CQZJ 1SFKA 1B59A 1XSXA 2P5KA 4XLPF 2M7BA 2K9LA 3OYJA 3B6CA 2A61A 2UUZA 2CGPA 1RKWA 2DMUA 1AKHB 1FTTA 2KJCA 2GZWA 1EKEA 4IPAA 1W5TA 3ESWB 4DYCA 2X4HA 4HLXA 4QWQA 2DFIA 4KYWA 2D2WA 2L4MA 2KQRA 4LOCA 3TOAA 1MIJA 5KVRA 4EM0B 4Y7NJ 1Y1WJ 1Z7UA 2XB5A 1FSHA 3GEZA 2ZFUA 3OWTA 4RLFA 4JYKA 2P5LC 1FP1D 3CJRB 2W00A 2NYXA 5DYMA 4B3XA 2HPMA 2H1KA 1LDDA 1IRZA 1QVUA 1NK2P 3T8RA 2JA7J 1FBSA 1MH3A 4JP0A 2AXLA 2BHYA 2OV7A 2YS9A 4B09A 1RR7A 4ZZDA 5E18F 2ZJ2A 1ETKA 5F1JA 3M4OJ 3PUFA 3HDDA 2IGNA 4JX4A 2M45A 3F3XA 1ETVA 2DFFA 3WG7H 3H9GA 1OR7C 5BS6A 2W4SA 4NC8A 3ASOH 2LNBA 1USSA 4UUSA 1VQMI 3S2DJ 1T0FA 1SVMA 3L1PA 3L09A 4WX9A 2ZCWA 4HA8A 3Q9VA 3I4MJ 5EYRA 5ED4A 2GXBA 1Z3XA 1ZTRA 2DI3A 4RB1A 1TWAJ 1TP4A 3ZXSA 3PNYA 4A6EA 2XASA 2R3SA 3ZQHA 2DA3A 1RNLA 3KEQA 2PMZN 3DTKA 4L5EA 4E7SA 3K6GA 1AKHA 1ZARA 3PL8A 5HODA 5F08A 5GAGJ 1OCCH 5EG0B 1ETXA 1K79A 5ICFA 3GTKJ 1RUNA 4IF4A 3OY9A 2O0YA 4BQOA 1CF7B 1T6SA 2DMPA 3ABMH 3LSKA 2H09A 1Z21A 1U3EM 1K4TA 3VPRA 5JHFA 2FBKA 3K7AJ 5JHUA 1OISA 3I9V2 4GYGA 2BBYA 2ZKZA 2BY0A 4YELA 1I27A 1FOWA 1H9TA 3OYKA 2FQ3A 2A5YB 1ULYA 2V6CA 4GCVA 2CV2A 4HLYA 2JN6A 3BY6A 2M4KA 4OIPF 2M30A 3MKZA 1Q1HA 5JFRA 3TDZC 4G7ZF 2QM3A 4J00A 2KISA 5EJCA 2OD5A 2WY7Q 3MEXA 5H6QA 1KONA 4CYDA 1O3TA 2HU9A 3LQQA 3R0JA 4I76A 5FD5A 5D4RA 3QOPA 2ZMEC 3SZPA 3HM5A 1EF4A 3L2UA 2DQLA 2DA5A 2JA6J 4LGWA 3S2HJ 3K4BA 3L9FA 3TO9A 2DK5A 1WGXA 5E79C 1J75A 1BI3A 2KDOA 3K4LA 5EG0A 2Z1DA 4EM2A 4H0EA 1AOYA 2N8GA 4BGDA 2RVCA 4JOMA 4BJ5C 2AQEA 1CF7A 4LLNA 3KYLA 2HI3A 3J81Z 1N78A 2DAOA 4P9UA 3BG7A 2EH3A 3DFGA 1LE8A 1S3JA 5D5VB 4XKBA 3HOXJ 1X19A 2LTPA 4KIGA 2VC1A 5BPDA 2M0CA 2ECCA 2WV0A 2LKPA 2GXAA 2ZJRF 1IC8A 2NVTJ 4EMSA 1BR4A 3IHUA 1FZPB 4D7NA 2H94A 4UV9A 2Z33A 1TQIA 3CCVI 1A31A 1ZK8A 2EZIA 3GTPJ 3F6VA 5HLGA 2PN6A 1ZGJA 3C1DA 3WG9A 2DOFA 2Y30A 4V2GA 2HYJA 4W97A 1TWHJ 2WY8Q 4BH9A 5BMZA 2KIUA 3BOQA 5ILVA 1MD0A 4LIVA 4A3BJ 5CPRB 3FBIB 1UG2A 5J1UA 4DYQA 1STZA 3H1CA 3BJ6A 3QAHA 3JAMZ 3S15J 4PDKA 2WA0A 2WV1A 4WCGA 2ME6A 2X6XA 3K4KA 4CZZA 5DD8A 4UUVA 3WTZA 3ECHA 4CA0A 3KP7A 2OZUA 3BTLA 3CJTB 5HLIA 2OTJI 3I0TA 3JRGA 4BL0B 2KL4A 1YRNB 1YQAA 2XKPA 4AWXB 3CF5F 2FJ1A 2KIQA 4PZJA 1LFUP 1BM9A 2IGOA 3RDIA 5E3MA 1E17A 2HKOA 4M6YA 4LLGF 3BTJA 4Q4ZF 2CV1A 2VPRA 1JKRC 4IXAA 3HSFA 4CUGA 4XSXF 4Y17A 2DPDA 3RIRA 4PFOA 1SFUA 2VONA 1FMVA 2Q0OA 5H2FC 2BW3A 3C18A 3BTIA 3UNGC 3HOWJ 4DNCA 3M07A 3BG9A 1LQ1A 5F0HA 1SVOA 2V9VA 2ZNYA 4BXFA 5DUKA 3N4MA 1Z67A 4HEA2 3G71I 1YX3A 2ELKA 1X4PA 3HL2A 3K4MA 1WI3A 4UNOA 2YUSA 3WTXC 1YO5C 3KEOA 3IAM2 1RC9A 4CHUA 2DJIA 4PK4A 4CICA 3CCUI 3ZP5A 1VQ8I 2JUGA 2CV0A 4WXHA 4XORA 3WE3A 2X1EA 2X85A 1YS7A 3VWBA 3GTQJ 4A3GJ 3HB9A 3ZN1A 1W0TA 4U0WA 2NVYJ 1YRNA 3UKGA 3OYNA 3PSIA 1P9QC 3OR2C 1VQ4I 2QKMB 4NHJA 3BCAA 2GXGA 2F4IA 1IN4A 4PJ0C 3FISA 2VJIA 3ZGKA 2BVMA 2W7NA 3PFYA 3NEUA 2V7FA 4E7ZA 4G8XA 1FOKA 2KP6A 3V7SA 5E1ZB 2DXIA 4C3HJ 2W25A 1FWZA 3ZMVA 2WWYA 3CD6I 1J0RA 4M6XA 3NARA 4IHXA 3HRMA 4Q5SF 2CJJA 1Y6IA 3G4SI 1JT0A 1VQ6I 5J4VA 4E7JA 4OWRB 3DV8A 4YIIA 4S05A 2Y69H 2F5FA 3FXKA 5CJ9A 5EDNA 3KLNA 3ZQ7A 4IX7A 5J40A 3VODA 2LLKA 3JSOA 4TV7A 3FWEA 4XN3A 4IL6C 2R7DA 5H20A 4KA4A 4MFDA 2HXOA 2KMUA 2RQPA 2R7WA 2C6YA 1JI8A 1GXQA 1UAAA 5E3OA 4ZYEA 3FXJA 4IOAF 3K4CA 1P7IA 2KJBA 3RQ4A 4D0PA 5BOXA 1TQPA 2GOXB 2OC6A 4AUXA 4BHCA 4KIBA 3K4NA 3W6VA 2BXZA 3H3UA 3S3OA 4R8HA 3WE2A 2Z3YA 3GTJJ 3I64A 4YG2F 5BPIA 2RDPA 2M87A 5CKTA 4IHVA 4BDYA 3TO7A 4UV8A 1JJ6C 4RGSA 3OYFA 1DP3A 1LFBA 3HIFA 3KYCB 2MH2A 2XAQA 3NWTA 1GLNA 3CC7I 2JZYA 3GO5A 5K7ZA 5HDKA 5D5WB 3AG4H 2IGMA 2LK2A 4BHPA 4PJNA 1X3WB 3NWSA 2FOWA 4N4OB 4J01A 2JPCA 4E70A 4AIJA 3DWLE 4HX8A 1YIOA 2EFQA 4GFBA 1R58A 2FNAA 3QU3A 2FE3A 3J80K 1UHSA 3RI4A 3FHNA 1ZRDA 2HYGD 1JUPA 2GIZA 4CZCA 1RIOH 1LUJB 3BQZA 2L5QA 5TISC 5FJ8J 2TCTA 4H4KC 1LDJA 3HSEA 1D5VA 1T56A 3LA2A 4UVCA 4K2EA 1JHFA 2WB1A 3BR3A 3QPTA 4L18B 2QENA 3PUBA 3DCFA 1X2NA 2M0MA 1XDSA 3FXQA 2L9SA 4CYCB 3ERMA 2VBWA 2L9RA 3C2GA 4I2OA 5CLSA 1IGNA 4IKFA 1XX5A 2L7KA 5E17F 1V55H 3KP3A 4X6AJ 5LRSA 1QO0D 2CUFA 3V8JA 3X2QH 1N25A 2IBDA 2QLZA 3CJQB 5ERIA 1ZG5A 5IP6A 5HDGA 2OCCH 4HDVA 1ZQ3P 4FTHA 4UB8C 2EZLA 4ESFA 2O8XA 4GYIA 1FLIA 4MQVA 3EYIA 1W1WE
chains in the Genus database with same CATH topology
2GQQA 1ZREA 3I4PA 1YTYA 2P6TA 4ENKA 4EJVA 3PQJA 4HDUA 3QPHA 2BE5F 2DU9A 1UFMA 2O03A 1SFXA 4ENNA 5L3FA 3JAMK 4GO1A 3T5XA 1E2XA 3LFKA 2P8TA 4G6DA 1PDNC 5BQTA 3JTHA 3DXJF 4IRGA 4IHTA 3CJNA 4U0YA 4OU0A 3QU6A 1R1UA 2A69F 1ZG1A 1U78A 2EB7A 1XGMA 4RB3C 2BYVE 3Q9SA 1QPMA 3TDUC 4ENMA 1XGNA 5EEGA 3T8TA 4M71A 2LSOA 1IF1A 5FD6A 3SQNA 2QZ8A 2PJPA 1IXCA 1AWCA 3WU1B 2W24A 1FYLA 5A2QZ 1IW7F 2YPRA 1FY7A 1OPCA 4I01A 3EDPA 4ZYDA 3BP8A 2FSWA 1SMTA 1TBXA 5F64A 1GHCA 5FFZA 1YW8A 3ZMTA 2FRHA 1B9NA 2IPQX 2CYYA 2P7VB 4FHTA 3OOPA 3F8FA 4M9ZA 5ILSA 3DQVC 2NAZA 3SHFA 4ASNA 2W57A 5LGTA 1YG2A 5FO5A 2QBYB 2M1BA 2ZNZA 4Q48A 1ZRCA 2PFBA 3COAC 4BAYA 2IT0A 4AIKA 3E5UA 5KK1A 5LGNA 3I59B 2HQNA 2K27A 3TOBA 3E5XA 3OV8A 4XBFA 3SZTA 1A04A 3MWMA 4EGZA 2QVOA 3ERED 2QQBA 1FSEA 4P5OA 5LLQA 3CUOA 4HX7A 5ICGA 2L3DA 5AIPA 4LMYA 4I7HA 4KDPA 2FBIA 1BC7C 1FYKA 3JSPA 2QBYA 1WQ2A 4HOBA 4L9TA 5E1XA 1WKMA 2JSCA 3BWGA 1HW2A 4HF1A 4KN4X 3GYHX 3GFIA 5TRDA 1XCBA 2UXXA 3KP5A 3E3VA 4S04A 2IVMA 3I59A 4AIHA 1SMYF 2Z5UA 3E6DA 4P55A 1HW5A 3F23A 1MJBA 3MFKA 2L4AA 3F8MA 2Q2EA 3M7GA 1B6AA 1O57A 1Z6RA 1GVJA 1LJ9A 1XGSA 1Y0UA 2MBFA 3RKWA 2HS5A 4DQ2A 3LA3A 1PP7U 3DKWA 3K1PA 2VE8A 4MEYF 5LBQA 1SD4A 5L3GA 4LG0A 2FMLA 2PEXA 1FP2A 3IWZA 3K0LA 1I5ZA 1G3YA 3P9KA 4CGZA 1F1ZA 3M1EA 4Y15A 2VXZA 1LVAA 2XUBA 1HSJA 2WTEA 1OMIA 4G9YA 3L7WA 1UCRA 2EK5A 2QQAA 3HUGA 3J80Z 1IUYA 4A6DA 1W5SA 4L9JA 2K02A 1IRFA 2HYFA 2F5CA 4AVPA 4U88A 4R1HA 2ISZA 5DV5A 5A2QK 1PUEE 1UB9A 3E5QA 4HV6A 1FC3A 4MEXF 1IXRC 1HKQA 2J5OA 2EA4A 4OIRF 2XROA 3I54A 2XIGA 4MNUA 5K5QA 1U6GA 1IN7A 3F8BA 3NRVA 4O5VA 5E8GA 2QWWA 5DDGA 6PAXA 2ETHA 4LD5A 3TKYA 5H6RA 3SFZA 3KETA 4P9FA 1QZZA 4LFUA 3O6BB 4RS8A 1BJAA 3VFZA 2GA2A 2EFNA 4MHGA 2PMHA 3I71A 3GZ6A 3ZMDA 4OOIA 4LLLA 1WWXA 1EH8A 2HGCA 2IA2A 3AAFA 1R36A 1XD7A 2KIFA 3FF5A 1H9GA 1TNSA 1T39A 3N97A 1BBYA 2B0LA 2RNJA 4I02A 3DPLC 3L2CA 3CO6C 4PCQA 1R1VA 1OYIA 3R61A 3U9GA 5HOOA 3WTSC 3GX4X 1DP7P 2HQRA 3R60A 2TDXA 1Z1DA 3WGIA 2H6BA 1UHMA 1TTYA 4PGGA 4KIFA 3FXRA 1MKMA 1WSUA 4P96A 2D1VA 3FMSA 4RGXA 1S29A 1T98A 5K5RA 3PQKA 1UHWA 4XLNF 2GAUA 3V8LA 1XMKA 2PQ8A 2YX4A 3H3ZA 3LAJA 3M9AA 5D5UB 4KT5C 3MQ0A 3ROUA 3W6JB 2PLYA 2VOPA 2NNNA 1XN7A 5D4SA 3R4KA 1V3FA 2ZFWA 2QYOA 4OMZA 2ZBKA 5IT9K 3U2RA 2OQGA 2OBPA 1LEAA 5LHIA 2GWRA 1L3LA 4HYEA 2FXAA 5DUIA 3F8NA 1MGTA 3HSRA 2E1NA 4HBLA 3GF2A 2FBHA 1HBXG 4FX0A 4ZZLA 1KU9A 3E6BA 1QQIA 3V4GA 4MQ9F 2EA2A 4MTEA 2UZKA 3RYPA 4FX4A 4GGGA 2H27A 3V7RA 4XRFA 4O3MA 3FM3A 3JTGA 2ELHA 2F2EA 1W7PD 3T0YA 1K7AA 2M8EA 3O3KA 2XHKA 1HSTA 4KNYA 4LK1F 5DCMB 2BV6A 1L0OC 5K5OA 5CVRA 5F6FA 3I58A 2K4BA 2VBZA 3D0SA 1EH6A 4KN7X 5TJJA 2K86A 4EJWA 1KQ8A 1I1GA 1MZBA 1QGPA 2UWMA 1P4WA 2LF7A 3BJAA 3HHGA 2EV6A 1D3YA 4BNCA 1D8KA 4I0AA 2GA1A 3F72A 3HRUA 1IZ1A 5J8CA 1W7PB 2LDUA 4LK0F 1FYMA 1R23A 2YSRA 1YLFA 5ICEA 2F5EA 2EJRA 3HTSB 3CO7C 3HOSA 3GFLA 5DCMA 1U8RA 5L3DA 3EYYA 1FBUA 1HXDA 3S2WA 1TLHB 4A12A 5DEQA 3WTYC 4U0VA 4PGHA 1MDMB 3RPUA 3EQLF 2L02A 3EETA 5F1RA 1P4XA 1S8NA 3G3ZA 4IVNA 2FNPA 3FM5A 4A0ZA 4KUMA 3GLXA 2MH9A 4MTDA 4JK1X 3BPVA 1BI1A 5D8KB 4WWCA 5HS9A 1W7PA 1ZGAA 2CG4A 4HAMA 2HR3A 1JHHA 4L9VA 3J7AO 4CDGA 1KYZA 4I98B 4G94A 1WI9A 2Z99A 4QLCU 4HF0A 2ZXJA 1USTA 2G9WA 2MLKA 1MDMA 4JBAA 1YFHA 3I53A 2IJLA 4L9NA 1SD6A 2IP2A 3H92A 2ADUA 3V8KA 3ZN0A 4UVBA 5LEJA 4BXUA 2VOOA 3WGHA 3IL2A 5HVQC 2CO5A 4IRIA 3F8CA 4HZFA 4G7OF 2V1XA 5ILUA 3K2ZA 4I09A 4Y13A 4RGRA 1OKRA 1F9NA 3IC7A 5E8IA 1KU7A 2RKHA 1YYVA 2PG4A 2L54A 4EGYA 3CUQB 5HDNA 2J5PA 2HEOA 1RZ4A 3TO6A 3MZHA 1ZLKA 2V1DA 4L5JA 2HDCA 1K6OA 1I6XA 3RJPA 1KQ0A 1XGOA 4HX4A 3ZMZA 2HZTA 3ABTA 1BI0A 4BQAA 1OYYA 2QQ9A 2ACJA 3KZYA 3KP2A 2XKOA 2OQRA 3LAPA 4M73A 4UXNA 5D6FA 3VB2A 3ZMSA 3LA7A 3MAJA 3CUQA 3GXOA 2F5DA 2L01A 4EM1A 3ML6A 1RUOA 4KMUX 3BDDA 2A3SA 5L3EA 5CVUA 2E7XA 1BOAA 2IA1A 2K4JA 2H6CA 1U5TC 2FF4A 3ISPA 4G6QA 1U5TB 1P92A 1Z05A 3E6MA 1R5HA 2XAFA 3BROA 3IKTA 4ON0A 3DP7A 3KE2A 1S6LA 2NNYA 1B9MA 2IA0A 1LDKB 5AONA 3REOA 4U7DA 2A6EF 1HW1A 1ZG3A 1ON1A 2FU4A 3GWZA 1T2KA 1O7LA 2ESHA 3HRSA 1XSDA 1IN8A 5IT9Z 3B73A 3ZMUA 3F22A 5JI6A 2UXNA 1KGSA 3G73A 1V4RA 5CVVA 1U5TA 1Z6TA 2AS5F 4WF2A 2KRFA 4OMYA 2OU2A 2E7WA 4OIOF 5LHGA 5AIQA 2VBYA 1ODDA 3HRTA 1H0MA 1R5GA 5D5XB 4EJUA 1YS6A 3K9TA 1PP8F 2D1HA 3TQNA 3Q5FA 5IT3A 1J59A 2W84A 2VBXA 1TW2A 1F5TA 2DT5A 1CGPA 3HHHA 5ICCA 3PFIA 2GIVA 1DPRA 3JW4A 2KIMA 2Z9OA 1ZLJA 3DF8A 2YR2A 4G7HF 1YW9A 2DPUA 4RAZA 3GFMA 5D8LB 4A2UA 3IRQA 3W6KB 1JE8A 1ZYRF 2FA5A 1QBJA 1QNTA 4YIFA 1G3TA 1R7JA 3K69A 3BJOA 1BN5A 1XDUA 4YFKF 2XGXA 4M74A 3RKYA 4KICA 2EFWA 1OR7A 1FT9A 2CWEA 4JQFA 1ON2A 1TQMA 3CDHA 3VOEA 2VODA 2HKXA 4HQEA 4O6JA 2ZO4A 4NQWA 2ZMEB 4M9XA 5FGMA 4ZYGA 2D45A 1W4MA 4UHTA 5D6EA 3RKXA 5FB2A 4R79A 1SAXA 1G6NA 5FLXZ 1KU3A 1FBQA 3KLOA 1QZYA 4Q47A 1LEBA 2G7UA 4EQQA 4FT8A 4KFCA 4N9IA 5E20A 3FMQA 3GFJA 3F6OA 3VEPA 5LGUA 1J7KA 3TGNA 1IRGA 3KZZA 1J5YA 5HLHA 3C3WA 4HV5A 3HOTA 2ZMEA 5CYVA 2DO7A 1BI2A 2PBIA 3QP5A 2RC4A 1S7AA 2P4WA 2W85A 4RAYA 1FNNA 1O3QA 2COMA 4U7BA 2NS0A 4ESJA 4A5MA 5LRRA 2E1CA 3MZYA 1G4DA 3WODF 2VE9A 3L00A 3LSTA 3QRFF 3QP6A 3WGGA 4LJZF 2O61A 3BPXA 3KCCA 1I1SA 4IJAA 1NHAA 2O6GE 1IN5A 2O3FA 3KP4A 3T1BA 1R1TA 2Y75A 2HWVA 3CTAA 2XAJA 2FEZA 3ZPLA 1KU2A 1MJ9A 2IW5A 2JRTA 4L5IA 5EEHA 3WTWC 2EFPA 1IN6A 4A0YA 5FFXA 2WC2A 4LB5A 2DK8A 1VTNC 3WTTC 1LB2A 3V7CA 3WU0A 1JGSA 2XV4S 3ULQB 3NQOA 2OAZA 2LF8A 3B02A 1DPUA 3D5LA 2FMYA 2YU3A 3K1MA 1BIAA 2KKOA 4MGRA 1X3UA 5L3BA 1C0WA 3FHZA 4UVAA 3HYIA 2A68F 4N9HA 2NRAC 4EJTA 3E6CC 1T38A 2EV0A 2BEOA 3U1DA 5JVTA 1XB4A 2DBBA 2PI0A 2XRNA 2A6HF 2K7LA 1G3WA 3R6SA 1XSVA 5J6XA 3EUHA 4OIQF 1EV7A 3IWFA 2CFXA 4EV0A 1IXSB 1KA8A 1U2WA 1P6RA 4HQMA 4RB0A 1BC8C 4RGUA 1HKTA 4XSZF 3SXYA 1FPQA 2G7HA 3ABUA 1K78B 1EH7A 2STWA 5JR3A 1Z9CA 3M8EA 3ECOA 1ZH5A 1O3RA 2X0LA 2HTJA 4HW0A 1MJAA 4N0BA 5CVIA 1ZRFA 2RV8A 4WXDA 3RYRA 1HKSA 1B1BA 3R0AA 4BHBA 2JT1A 4L0YB 4NB5A 2CW0F 2MC3A 2VC0A 3IKVA 3I5UA 4YFNF 2R7FA 3LWFA 3O2PE 3F21A 1JXSA 1YW7A 3GUDA 3J81K 4BYYA 2HOEA 1S7OA 5FLXK 3ELKA 3DPTA 3P9CA 4OINF 5HS7A 3WTVC 1K78A 2V79A 1P2FA 4M9SA 1P4AA 3WTUC 4IRHA 2RN7A 1IAWA 1R00A 2DQRA 5J8FA 4IHSA 4CXFA 3CLOA 1GXPA 1DUXC 1SFEA 1ZN2A 4ZH4F 2IRFG 1HQCA 4LB6B 4A5NA 2BGCA 5HS8A 2HFHA 2ISYA 5DCFA 3P7NA 2MLGA 5DD4A 4ZYHA 1ZAOA 2A07F 2P7CB 2Y48A 1OYWA 1REPC 3FXUA 1ZHFA 5E1WA 3M8FA 4L0ZB 3CUQC 2MA3A 2VN2A 1KQ9A 3KP6A 4ENJA 5LHHA 5K1YA 1J2XA 3KFWX 4RB2C 1WRJA 1G3SA 4YFXF 4EVIA 2EV5A 2Y0MA 2EFOA 3K1NA 5LEKA 2P5VA 4KMFA 3P9IA 4HF2A 2V1UA 2XAGA 4M72A 1D8JA 3FZVA 3RPQA 5L3CA 2FOKA 2CQKA 2M5WA 4CO8A 1KYWA 2OZ6A 4I0BA 2PMUA 4Z2YA 2RGVA 1R22A 1SD5A 3GW2A 2HTSA 4ESBA 3BZ6A 3MCZA 2DTRA 2VT2A 3IRRA 1XCVA 2XAHA 2MD5A 1XMAA 4F7ZA 2QUFA 2XVCA 3LQRA 1J9IA 5CVJA 4B8XA 4ETSA 3GZ5A 3RTRA 3E97A 2CSOA 3FX3A 1B4AA 4A0XA 3GVAA 2P6SA 3DEUA 1SD7A 2JTVA 1ONVA 1FX7A 1DDNA 2STTA 3HTUA 1F4KA 2DW4A 2YX7A 1RI7A 2Q8KA 4WK8F 1Z91A 2EWNA 3FMRA 3C7JA 2DLLA 1TW3A 1O7FA 2VT3A 2ESNA 1LNWA 4AD9A 2JPBA 2OA4A 1TNTA 4EJOA 1BIBA 4GXOA 4WXCA 1O3SA 4LG0B 1B59A 1XSXA 2P5KA 4XLPF 2A61A 2CGPA 2KJCA 2GZWA 4IPAA 1W5TA 2X4HA 4HLXA 4QWQA 2DFIA 4KYWA 2D2WA 2L4MA 3TOAA 5KVRA 4EM0B 1Z7UA 1FSHA 3GEZA 2P5LC 1FP1D 2NYXA 5DYMA 1LDDA 3T8RA 1FBSA 5E18F 2AXLA 4B09A 4ZZDA 2ZJ2A 2M45A 3F3XA 5BS6A 2LNBA 1USSA 1T0FA 3L09A 4WX9A 2ZCWA 4HA8A 3Q9VA 5ED4A 2GXBA 2DI3A 4RB1A 4A6EA 2XASA 2R3SA 1RNLA 3KEQA 1ZARA 1K79A 5ICFA 1RUNA 4IF4A 2O0YA 1CF7B 1T6SA 2H09A 1U3EM 2FBKA 5JHUA 4GYGA 2BBYA 2ZKZA 1I27A 1H9TA 2FQ3A 2A5YB 1ULYA 2V6CA 4GCVA 4HLYA 3BY6A 4OIPF 2M30A 1Q1HA 5JFRA 4G7ZF 3TDZC 2QM3A 2OD5A 3MEXA 5H6QA 4CYDA 1O3TA 3LQQA 3R0JA 5FD5A 5D4RA 3QOPA 3SZPA 2DQLA 4LGWA 3L9FA 3TO9A 2DK5A 1J75A 1BI3A 1AOYA 4H0EA 4EM2A 2RVCA 1CF7A 4LLNA 3J81Z 2DAOA 4P9UA 3DFGA 1S3JA 5D5VB 4KIGA 2VC1A 5BPDA 2WV0A 2LKPA 4EMSA 3IHUA 1FZPB 2H94A 4UV9A 2Z33A 1TQIA 3F6VA 5HLGA 2PN6A 1ZGJA 3C1DA 3WG9A 4BH9A 5BMZA 2KIUA 3BOQA 5ILVA 1MD0A 1STZA 3BJ6A 3QAHA 3JAMZ 4PDKA 4WCGA 4CZZA 5DD8A 4UUVA 3WTZA 3ECHA 3KP7A 2OZUA 5HLIA 3I0TA 1YQAA 2XKPA 4AWXB 4PZJA 1BM9A 3RDIA 1E17A 2HKOA 4M6YA 4LLGF 4Q4ZF 4IXAA 3HSFA 4XSXF 4Y17A 2DPDA 3RIRA 1SFUA 2VONA 2Q0OA 3C18A 4DNCA 1LQ1A 2V9VA 2ZNYA 5DUKA 3N4MA 4UNOA 3WTXC 1YO5C 3KEOA 4CHUA 4CICA 3ZP5A 4WXHA 3WE3A 1YS7A 3ZN1A 4U0WA 4NHJA 2GXGA 1IN4A 3NEUA 4G8XA 1FOKA 3V7SA 5E1ZB 2W25A 1FWZA 3ZMVA 2WWYA 1J0RA 4M6XA 3HRMA 4Q5SF 3DV8A 4YIIA 4S05A 2F5FA 5CJ9A 3KLNA 3ZQ7A 3VODA 3JSOA 4TV7A 3FWEA 2R7DA 5H20A 4KA4A 2RQPA 2C6YA 1GXQA 4ZYEA 2KJBA 4D0PA 5BOXA 1TQPA 4BHCA 4KIBA 3H3UA 4R8HA 3WE2A 2Z3YA 3I64A 4YG2F 5BPIA 2RDPA 2M87A 3TO7A 4UV8A 4RGSA 3HIFA 2MH2A 2XAQA 2JZYA 3GO5A 5HDKA 5D5WB 4BHPA 2JPCA 4E70A 4AIJA 4HX8A 1YIOA 2EFQA 1R58A 2FNAA 3QU3A 2FE3A 3J80K 3RI4A 1ZRDA 2HYGD 1RIOH 1LDJA 3HSEA 1D5VA 3LA2A 4UVCA 4K2EA 1JHFA 3QPTA 4L18B 2QENA 1XDSA 3FXQA 2VBWA 4I2OA 5CLSA 5E17F 3KP3A 5LRSA 1QO0D 3V8JA 2QLZA 5ERIA 1ZG5A 5HDGA 4HDVA 4ESFA 2O8XA 4GYIA 1FLIA 4MQVA 3EYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQQ A;  1ZRE A;  3I4P A;  1YTY A;  2P6T A;  4ENK A;  4EJV A;  3PQJ A;  4HDU A;  3QPH A;  2BE5 F;  2DU9 A;  1UFM A;  2O03 A;  1SFX A;  4ENN A;  5L3F A;  3JAM K;  4GO1 A;  3T5X A;  1E2X A;  3LFK A;  2P8T A;  4G6D A;  1PDN C;  5BQT A;  3JTH A;  3DXJ F;  4IRG A;  4IHT A;  3CJN A;  4U0Y A;  4OU0 A;  3QU6 A;  1R1U A;  2A69 F;  1ZG1 A;  1U78 A;  2EB7 A;  1XGM A;  4RB3 C;  2BYV E;  3Q9S A;  1QPM A;  3TDU C;  4ENM A;  1XGN A;  5EEG A;  3T8T A;  4M71 A;  2LSO A;  1IF1 A;  5FD6 A;  3SQN A;  2QZ8 A;  2PJP A;  1IXC A;  1AWC A;  3WU1 B;  2W24 A;  1FYL A;  5A2Q Z;  1IW7 F;  2YPR A;  1FY7 A;  1OPC A;  4I01 A;  3EDP A;  4ZYD A;  3BP8 A;  2FSW A;  1SMT A;  1TBX A;  5F64 A;  1GHC A;  5FFZ A;  1YW8 A;  3ZMT A;  2FRH A;  1B9N A;  2IPQ X;  2CYY A;  2P7V B;  4FHT A;  3OOP A;  3F8F A;  4M9Z A;  5ILS A;  3DQV C;  2NAZ A;  3SHF A;  4ASN A;  2W57 A;  5LGT A;  1YG2 A;  5FO5 A;  2QBY B;  2M1B A;  2ZNZ A;  4Q48 A;  1ZRC A;  2PFB A;  3COA C;  4BAY A;  2IT0 A;  4AIK A;  3E5U A;  5KK1 A;  5LGN A;  3I59 B;  2HQN A;  2K27 A;  3TOB A;  3E5X A;  3OV8 A;  4XBF A;  3SZT A;  1A04 A;  3MWM A;  4EGZ A;  2QVO A;  3ERE D;  2QQB A;  1FSE A;  4P5O A;  5LLQ A;  3CUO A;  4HX7 A;  5ICG A;  2L3D A;  5AIP A;  4LMY A;  4I7H A;  4KDP A;  2FBI A;  1BC7 C;  1FYK A;  3JSP A;  2QBY A;  1WQ2 A;  4HOB A;  4L9T A;  5E1X A;  1WKM A;  2JSC A;  3BWG A;  1HW2 A;  4HF1 A;  4KN4 X;  3GYH X;  3GFI A;  5TRD A;  1XCB A;  2UXX A;  3KP5 A;  3E3V A;  4S04 A;  2IVM A;  3I59 A;  4AIH A;  1SMY F;  2Z5U A;  3E6D A;  4P55 A;  1HW5 A;  3F23 A;  1MJB A;  3MFK A;  2L4A A;  3F8M A;  2Q2E A;  3M7G A;  1B6A A;  1O57 A;  1Z6R A;  1GVJ A;  1LJ9 A;  1XGS A;  1Y0U A;  2MBF A;  3RKW A;  2HS5 A;  4DQ2 A;  3LA3 A;  1PP7 U;  3DKW A;  3K1P A;  2VE8 A;  4MEY F;  5LBQ A;  1SD4 A;  5L3G A;  4LG0 A;  2FML A;  2PEX A;  1FP2 A;  3IWZ A;  3K0L A;  1I5Z A;  1G3Y A;  3P9K A;  4CGZ A;  1F1Z A;  3M1E A;  4Y15 A;  2VXZ A;  1LVA A;  2XUB A;  1HSJ A;  2WTE A;  1OMI A;  4G9Y A;  3L7W A;  1UCR A;  2EK5 A;  2QQA A;  3HUG A;  3J80 Z;  1IUY A;  4A6D A;  1W5S A;  4L9J A;  2K02 A;  1IRF A;  2HYF A;  2F5C A;  4AVP A;  4U88 A;  4R1H A;  2ISZ A;  5DV5 A;  5A2Q K;  1PUE E;  1UB9 A;  3E5Q A;  4HV6 A;  1FC3 A;  4MEX F;  1IXR C;  1HKQ A;  2J5O A;  2EA4 A;  4OIR F;  2XRO A;  3I54 A;  2XIG A;  4MNU A;  5K5Q A;  1U6G A;  1IN7 A;  3F8B A;  3NRV A;  4O5V A;  5E8G A;  2QWW A;  5DDG A;  6PAX A;  2ETH A;  4LD5 A;  3TKY A;  5H6R A;  3SFZ A;  3KET A;  4P9F A;  1QZZ A;  4LFU A;  3O6B B;  4RS8 A;  1BJA A;  3VFZ A;  2GA2 A;  2EFN A;  4MHG A;  2PMH A;  3I71 A;  3GZ6 A;  3ZMD A;  4OOI A;  4LLL A;  1WWX A;  1EH8 A;  2HGC A;  2IA2 A;  3AAF A;  1R36 A;  1XD7 A;  2KIF A;  3FF5 A;  1H9G A;  1TNS A;  1T39 A;  3N97 A;  1BBY A;  2B0L A;  2RNJ A;  4I02 A;  3DPL C;  3L2C A;  3CO6 C;  4PCQ A;  1R1V A;  1OYI A;  3R61 A;  3U9G A;  5HOO A;  3WTS C;  3GX4 X;  1DP7 P;  2HQR A;  3R60 A;  2TDX A;  1Z1D A;  3WGI A;  2H6B A;  1UHM A;  1TTY A;  4PGG A;  4KIF A;  3FXR A;  1MKM A;  1WSU A;  4P96 A;  2D1V A;  3FMS A;  4RGX A;  1S29 A;  1T98 A;  5K5R A;  3PQK A;  1UHW A;  4XLN F;  2GAU A;  3V8L A;  1XMK A;  2PQ8 A;  2YX4 A;  3H3Z A;  3LAJ A;  3M9A A;  5D5U B;  4KT5 C;  3MQ0 A;  3ROU A;  3W6J B;  2PLY A;  2VOP A;  2NNN A;  1XN7 A;  5D4S A;  3R4K A;  1V3F A;  2ZFW A;  2QYO A;  4OMZ A;  2ZBK A;  5IT9 K;  3U2R A;  2OQG A;  2OBP A;  1LEA A;  5LHI A;  2GWR A;  1L3L A;  4HYE A;  2FXA A;  5DUI A;  3F8N A;  1MGT A;  3HSR A;  2E1N A;  4HBL A;  3GF2 A;  2FBH A;  1HBX G;  4FX0 A;  4ZZL A;  1KU9 A;  3E6B A;  1QQI A;  3V4G A;  4MQ9 F;  2EA2 A;  4MTE A;  2UZK A;  3RYP A;  4FX4 A;  4GGG A;  2H27 A;  3V7R A;  4XRF A;  4O3M A;  3FM3 A;  3JTG A;  2ELH A;  2F2E A;  1W7P D;  3T0Y A;  1K7A A;  2M8E A;  3O3K A;  2XHK A;  1HST A;  4KNY A;  4LK1 F;  5DCM B;  2BV6 A;  1L0O C;  5K5O A;  5CVR A;  5F6F A;  3I58 A;  2K4B A;  2VBZ A;  3D0S A;  1EH6 A;  4KN7 X;  5TJJ A;  2K86 A;  4EJW A;  1KQ8 A;  1I1G A;  1MZB A;  1QGP A;  2UWM A;  1P4W A;  2LF7 A;  3BJA A;  3HHG A;  2EV6 A;  1D3Y A;  4BNC A;  1D8K A;  4I0A A;  2GA1 A;  3F72 A;  3HRU A;  1IZ1 A;  5J8C A;  1W7P B;  2LDU A;  4LK0 F;  1FYM A;  1R23 A;  2YSR A;  1YLF A;  5ICE A;  2F5E A;  2EJR A;  3HTS B;  3CO7 C;  3HOS A;  3GFL A;  5DCM A;  1U8R A;  5L3D A;  3EYY A;  1FBU A;  1HXD A;  3S2W A;  1TLH B;  4A12 A;  5DEQ A;  3WTY C;  4U0V A;  4PGH A;  1MDM B;  3RPU A;  3EQL F;  2L02 A;  3EET A;  5F1R A;  1P4X A;  1S8N A;  3G3Z A;  4IVN A;  2FNP A;  3FM5 A;  4A0Z A;  4KUM A;  3GLX A;  2MH9 A;  4MTD A;  4JK1 X;  3BPV A;  1BI1 A;  5D8K B;  4WWC A;  5HS9 A;  1W7P A;  1ZGA A;  2CG4 A;  4HAM A;  2HR3 A;  1JHH A;  4L9V A;  3J7A O;  4CDG A;  1KYZ A;  4I98 B;  4G94 A;  1WI9 A;  2Z99 A;  4QLC U;  4HF0 A;  2ZXJ A;  1UST A;  2G9W A;  2MLK A;  1MDM A;  4JBA A;  1YFH A;  3I53 A;  2IJL A;  4L9N A;  1SD6 A;  2IP2 A;  3H92 A;  2ADU A;  3V8K A;  3ZN0 A;  4UVB A;  5LEJ A;  4BXU A;  2VOO A;  3WGH A;  3IL2 A;  5HVQ C;  2CO5 A;  4IRI A;  3F8C A;  4HZF A;  4G7O F;  2V1X A;  5ILU A;  3K2Z A;  4I09 A;  4Y13 A;  4RGR A;  1OKR A;  1F9N A;  3IC7 A;  5E8I A;  1KU7 A;  2RKH A;  1YYV A;  2PG4 A;  2L54 A;  4EGY A;  3CUQ B;  5HDN A;  2J5P A;  2HEO A;  1RZ4 A;  3TO6 A;  3MZH A;  1ZLK A;  2V1D A;  4L5J A;  2HDC A;  1K6O A;  1I6X A;  3RJP A;  1KQ0 A;  1XGO A;  4HX4 A;  3ZMZ A;  2HZT A;  3ABT A;  1BI0 A;  4BQA A;  1OYY A;  2QQ9 A;  2ACJ A;  3KZY A;  3KP2 A;  2XKO A;  2OQR A;  3LAP A;  4M73 A;  4UXN A;  5D6F A;  3VB2 A;  3ZMS A;  3LA7 A;  3MAJ A;  3CUQ A;  3GXO A;  2F5D A;  2L01 A;  4EM1 A;  3ML6 A;  1RUO A;  4KMU X;  3BDD A;  2A3S A;  5L3E A;  5CVU A;  2E7X A;  1BOA A;  2IA1 A;  2K4J A;  2H6C A;  1U5T C;  2FF4 A;  3ISP A;  4G6Q A;  1U5T B;  1P92 A;  1Z05 A;  3E6M A;  1R5H A;  2XAF A;  3BRO A;  3IKT A;  4ON0 A;  3DP7 A;  3KE2 A;  1S6L A;  2NNY A;  1B9M A;  2IA0 A;  1LDK B;  5AON A;  3REO A;  4U7D A;  2A6E F;  1HW1 A;  1ZG3 A;  1ON1 A;  2FU4 A;  3GWZ A;  1T2K A;  1O7L A;  2ESH A;  3HRS A;  1XSD A;  1IN8 A;  5IT9 Z;  3B73 A;  3ZMU A;  3F22 A;  5JI6 A;  2UXN A;  1KGS A;  3G73 A;  1V4R A;  5CVV A;  1U5T A;  1Z6T A;  2AS5 F;  4WF2 A;  2KRF A;  4OMY A;  2OU2 A;  2E7W A;  4OIO F;  5LHG A;  5AIQ A;  2VBY A;  1ODD A;  3HRT A;  1H0M A;  1R5G A;  5D5X B;  4EJU A;  1YS6 A;  3K9T A;  1PP8 F;  2D1H A;  3TQN A;  3Q5F A;  5IT3 A;  1J59 A;  2W84 A;  2VBX A;  1TW2 A;  1F5T A;  2DT5 A;  1CGP A;  3HHH A;  5ICC A;  3PFI A;  2GIV A;  1DPR A;  3JW4 A;  2KIM A;  2Z9O A;  1ZLJ A;  3DF8 A;  2YR2 A;  4G7H F;  1YW9 A;  2DPU A;  4RAZ A;  3GFM A;  5D8L B;  4A2U A;  3IRQ A;  3W6K B;  1JE8 A;  1ZYR F;  2FA5 A;  1QBJ A;  1QNT A;  4YIF A;  1G3T A;  1R7J A;  3K69 A;  3BJO A;  1BN5 A;  1XDU A;  4YFK F;  2XGX A;  4M74 A;  3RKY A;  4KIC A;  2EFW A;  1OR7 A;  1FT9 A;  2CWE A;  4JQF A;  1ON2 A;  1TQM A;  3CDH A;  3VOE A;  2VOD A;  2HKX A;  4HQE A;  4O6J A;  2ZO4 A;  4NQW A;  2ZME B;  4M9X A;  5FGM A;  4ZYG A;  2D45 A;  1W4M A;  4UHT A;  5D6E A;  3RKX A;  5FB2 A;  4R79 A;  1SAX A;  1G6N A;  5FLX Z;  1KU3 A;  1FBQ A;  3KLO A;  1QZY A;  4Q47 A;  1LEB A;  2G7U A;  4EQQ A;  4FT8 A;  4KFC A;  4N9I A;  5E20 A;  3FMQ A;  3GFJ A;  3F6O A;  3VEP A;  5LGU A;  1J7K A;  3TGN A;  1IRG A;  3KZZ A;  1J5Y A;  5HLH A;  3C3W A;  4HV5 A;  3HOT A;  2ZME A;  5CYV A;  2DO7 A;  1BI2 A;  2PBI A;  3QP5 A;  2RC4 A;  1S7A A;  2P4W A;  2W85 A;  4RAY A;  1FNN A;  1O3Q A;  2COM A;  4U7B A;  2NS0 A;  4ESJ A;  4A5M A;  5LRR A;  2E1C A;  3MZY A;  1G4D A;  3WOD F;  2VE9 A;  3L00 A;  3LST A;  3QRF F;  3QP6 A;  3WGG A;  4LJZ F;  2O61 A;  3BPX A;  3KCC A;  1I1S A;  4IJA A;  1NHA A;  2O6G E;  1IN5 A;  2O3F A;  3KP4 A;  3T1B A;  1R1T A;  2Y75 A;  2HWV A;  3CTA A;  2XAJ A;  2FEZ A;  3ZPL A;  1KU2 A;  1MJ9 A;  2IW5 A;  2JRT A;  4L5I A;  5EEH A;  3WTW C;  2EFP A;  1IN6 A;  4A0Y A;  5FFX A;  2WC2 A;  4LB5 A;  2DK8 A;  1VTN C;  3WTT C;  1LB2 A;  3V7C A;  3WU0 A;  1JGS A;  2XV4 S;  3ULQ B;  3NQO A;  2OAZ A;  2LF8 A;  3B02 A;  1DPU A;  3D5L A;  2FMY A;  2YU3 A;  3K1M A;  1BIA A;  2KKO A;  4MGR A;  1X3U A;  5L3B A;  1C0W A;  3FHZ A;  4UVA A;  3HYI A;  2A68 F;  4N9H A;  2NRA C;  4EJT A;  3E6C C;  1T38 A;  2EV0 A;  2BEO A;  3U1D A;  5JVT A;  1XB4 A;  2DBB A;  2PI0 A;  2XRN A;  2A6H F;  2K7L A;  1G3W A;  3R6S A;  1XSV A;  5J6X A;  3EUH A;  4OIQ F;  1EV7 A;  3IWF A;  2CFX A;  4EV0 A;  1IXS B;  1KA8 A;  1U2W A;  1P6R A;  4HQM A;  4RB0 A;  1BC8 C;  4RGU A;  1HKT A;  4XSZ F;  3SXY A;  1FPQ A;  2G7H A;  3ABU A;  1K78 B;  1EH7 A;  2STW A;  5JR3 A;  1Z9C A;  3M8E A;  3ECO A;  1ZH5 A;  1O3R A;  2X0L A;  2HTJ A;  4HW0 A;  1MJA A;  4N0B A;  5CVI A;  1ZRF A;  2RV8 A;  4WXD A;  3RYR A;  1HKS A;  1B1B A;  3R0A A;  4BHB A;  2JT1 A;  4L0Y B;  4NB5 A;  2CW0 F;  2MC3 A;  2VC0 A;  3IKV A;  3I5U A;  4YFN F;  2R7F A;  3LWF A;  3O2P E;  3F21 A;  1JXS A;  1YW7 A;  3GUD A;  3J81 K;  4BYY A;  2HOE A;  1S7O A;  5FLX K;  3ELK A;  3DPT A;  3P9C A;  4OIN F;  5HS7 A;  3WTV C;  1K78 A;  2V79 A;  1P2F A;  4M9S A;  1P4A A;  3WTU C;  4IRH A;  2RN7 A;  1IAW A;  1R00 A;  2DQR A;  5J8F A;  4IHS A;  4CXF A;  3CLO A;  1GXP A;  1DUX C;  1SFE A;  1ZN2 A;  4ZH4 F;  2IRF G;  1HQC A;  4LB6 B;  4A5N A;  2BGC A;  5HS8 A;  2HFH A;  2ISY A;  5DCF A;  3P7N A;  2MLG A;  5DD4 A;  4ZYH A;  1ZAO A;  2A07 F;  2P7C B;  2Y48 A;  1OYW A;  1REP C;  3FXU A;  1ZHF A;  5E1W A;  3M8F A;  4L0Z B;  3CUQ C;  2MA3 A;  2VN2 A;  1KQ9 A;  3KP6 A;  4ENJ A;  5LHH A;  5K1Y A;  1J2X A;  3KFW X;  4RB2 C;  1WRJ A;  1G3S A;  4YFX F;  4EVI A;  2EV5 A;  2Y0M A;  2EFO A;  3K1N A;  5LEK A;  2P5V A;  4KMF A;  3P9I A;  4HF2 A;  2V1U A;  2XAG A;  4M72 A;  1D8J A;  3FZV A;  3RPQ A;  5L3C A;  2FOK A;  2CQK A;  2M5W A;  4CO8 A;  1KYW A;  2OZ6 A;  4I0B A;  2PMU A;  4Z2Y A;  2RGV A;  1R22 A;  1SD5 A;  3GW2 A;  2HTS A;  4ESB A;  3BZ6 A;  3MCZ A;  2DTR A;  2VT2 A;  3IRR A;  1XCV A;  2XAH A;  2MD5 A;  1XMA A;  4F7Z A;  2QUF A;  2XVC A;  3LQR A;  1J9I A;  5CVJ A;  4B8X A;  4ETS A;  3GZ5 A;  3RTR A;  3E97 A;  2CSO A;  3FX3 A;  1B4A A;  4A0X A;  3GVA A;  2P6S A;  3DEU A;  1SD7 A;  2JTV A;  1ONV A;  1FX7 A;  1DDN A;  2STT A;  3HTU A;  1F4K A;  2DW4 A;  2YX7 A;  1RI7 A;  2Q8K A;  4WK8 F;  1Z91 A;  2EWN A;  3FMR A;  3C7J A;  2DLL A;  1TW3 A;  1O7F A;  2VT3 A;  2ESN A;  1LNW A;  4AD9 A;  2JPB A;  2OA4 A;  1TNT A;  4EJO A;  1BIB A;  4GXO A;  4WXC A;  1O3S A;  4LG0 B;  1B59 A;  1XSX A;  2P5K A;  4XLP F;  2A61 A;  2CGP A;  2KJC A;  2GZW A;  4IPA A;  1W5T A;  2X4H A;  4HLX A;  4QWQ A;  2DFI A;  4KYW A;  2D2W A;  2L4M A;  3TOA A;  5KVR A;  4EM0 B;  1Z7U A;  1FSH A;  3GEZ A;  2P5L C;  1FP1 D;  2NYX A;  5DYM A;  1LDD A;  3T8R A;  1FBS A;  5E18 F;  2AXL A;  4B09 A;  4ZZD A;  2ZJ2 A;  2M45 A;  3F3X A;  5BS6 A;  2LNB A;  1USS A;  1T0F A;  3L09 A;  4WX9 A;  2ZCW A;  4HA8 A;  3Q9V A;  5ED4 A;  2GXB A;  2DI3 A;  4RB1 A;  4A6E A;  2XAS A;  2R3S A;  1RNL A;  3KEQ A;  1ZAR A;  1K79 A;  5ICF A;  1RUN A;  4IF4 A;  2O0Y A;  1CF7 B;  1T6S A;  2H09 A;  1U3E M;  2FBK A;  5JHU A;  4GYG A;  2BBY A;  2ZKZ A;  1I27 A;  1H9T A;  2FQ3 A;  2A5Y B;  1ULY A;  2V6C A;  4GCV A;  4HLY A;  3BY6 A;  4OIP F;  2M30 A;  1Q1H A;  5JFR A;  4G7Z F;  3TDZ C;  2QM3 A;  2OD5 A;  3MEX A;  5H6Q A;  4CYD A;  1O3T A;  3LQQ A;  3R0J A;  5FD5 A;  5D4R A;  3QOP A;  3SZP A;  2DQL A;  4LGW A;  3L9F A;  3TO9 A;  2DK5 A;  1J75 A;  1BI3 A;  1AOY A;  4H0E A;  4EM2 A;  2RVC A;  1CF7 A;  4LLN A;  3J81 Z;  2DAO A;  4P9U A;  3DFG A;  1S3J A;  5D5V B;  4KIG A;  2VC1 A;  5BPD A;  2WV0 A;  2LKP A;  4EMS A;  3IHU A;  1FZP B;  2H94 A;  4UV9 A;  2Z33 A;  1TQI A;  3F6V A;  5HLG A;  2PN6 A;  1ZGJ A;  3C1D A;  3WG9 A;  4BH9 A;  5BMZ A;  2KIU A;  3BOQ A;  5ILV A;  1MD0 A;  1STZ A;  3BJ6 A;  3QAH A;  3JAM Z;  4PDK A;  4WCG A;  4CZZ A;  5DD8 A;  4UUV A;  3WTZ A;  3ECH A;  3KP7 A;  2OZU A;  5HLI A;  3I0T A;  1YQA A;  2XKP A;  4AWX B;  4PZJ A;  1BM9 A;  3RDI A;  1E17 A;  2HKO A;  4M6Y A;  4LLG F;  4Q4Z F;  4IXA A;  3HSF A;  4XSX F;  4Y17 A;  2DPD A;  3RIR A;  1SFU A;  2VON A;  2Q0O A;  3C18 A;  4DNC A;  1LQ1 A;  2V9V A;  2ZNY A;  5DUK A;  3N4M A;  4UNO A;  3WTX C;  1YO5 C;  3KEO A;  4CHU A;  4CIC A;  3ZP5 A;  4WXH A;  3WE3 A;  1YS7 A;  3ZN1 A;  4U0W A;  4NHJ A;  2GXG A;  1IN4 A;  3NEU A;  4G8X A;  1FOK A;  3V7S A;  5E1Z B;  2W25 A;  1FWZ A;  3ZMV A;  2WWY A;  1J0R A;  4M6X A;  3HRM A;  4Q5S F;  3DV8 A;  4YII A;  4S05 A;  2F5F A;  5CJ9 A;  3KLN A;  3ZQ7 A;  3VOD A;  3JSO A;  4TV7 A;  3FWE A;  2R7D A;  5H20 A;  4KA4 A;  2RQP A;  2C6Y A;  1GXQ A;  4ZYE A;  2KJB A;  4D0P A;  5BOX A;  1TQP A;  4BHC A;  4KIB A;  3H3U A;  4R8H A;  3WE2 A;  2Z3Y A;  3I64 A;  4YG2 F;  5BPI A;  2RDP A;  2M87 A;  3TO7 A;  4UV8 A;  4RGS A;  3HIF A;  2MH2 A;  2XAQ A;  2JZY A;  3GO5 A;  5HDK A;  5D5W B;  4BHP A;  2JPC A;  4E70 A;  4AIJ A;  4HX8 A;  1YIO A;  2EFQ A;  1R58 A;  2FNA A;  3QU3 A;  2FE3 A;  3J80 K;  3RI4 A;  1ZRD A;  2HYG D;  1RIO H;  1LDJ A;  3HSE A;  1D5V A;  3LA2 A;  4UVC A;  4K2E A;  1JHF A;  3QPT A;  4L18 B;  2QEN A;  1XDS A;  3FXQ A;  2VBW A;  4I2O A;  5CLS A;  5E17 F;  3KP3 A;  5LRS A;  1QO0 D;  3V8J A;  2QLZ A;  5ERI A;  1ZG5 A;  5HDG A;  4HDV A;  4ESF A;  2O8X A;  4GYI A;  1FLI A;  4MQV A;  3EYI A; 
#chains in the Genus database with same CATH topology
 2GQQ A;  2Y31 A;  1ZRE A;  2X48 A;  3I4P A;  1YTY A;  4F92 B;  3OYE A;  3HZJ A;  4MFE A;  2P6T A;  4RDU A;  4ENK A;  1HCR A;  4EJV A;  2X1D A;  2DYS H;  3PQJ A;  2DN0 A;  2WAD A;  2Y0S A;  1HDD C;  4HDU A;  1WH5 A;  3QPH A;  4RAG A;  2BE5 F;  2DU9 A;  3OMY A;  1UFM A;  2O03 A;  2LR8 A;  2I10 A;  1SFX A;  1ZGW A;  2EZH A;  4ENN A;  5L3F A;  2VQL A;  2KT0 A;  2HVS A;  3JAM K;  4GO1 A;  4XN0 A;  1A36 A;  3T5X A;  1E2X A;  2HQ5 A;  2MC4 A;  3LFK A;  2P8T A;  4G6D A;  4BBR J;  1PDN C;  4V19 K;  3JR9 A;  4CYC A;  4CCO A;  4QPQ A;  5FRO A;  5BQT A;  3JTH A;  3DXJ F;  4IRG A;  4IHT A;  2VJ5 A;  1Y8R B;  1BOB A;  2OPT A;  3CJN A;  4OU0 A;  4U0Y A;  3QU6 A;  3OSF A;  1R1U A;  4BY1 J;  1MND A;  2A69 F;  1ZG1 A;  1D0Z A;  2K3P A;  1U78 A;  2EB7 A;  2E5Z A;  1XGM A;  1BR2 A;  5M3M J;  1LPQ A;  1K83 J;  1T08 B;  1PUF B;  3C2H A;  3VSL A;  2F4M B;  4RB3 C;  2BYV E;  3Q9S A;  1QPM A;  2NVX J;  2HZD A;  1MBF A;  3TDU C;  4ENM A;  2R93 J;  3G6E I;  2F48 A;  1XGN A;  3HKZ A;  5EEG A;  3T8T A;  4M71 A;  2RAE A;  2LSO A;  1IF1 A;  5FD6 A;  3SQN A;  2R7R A;  1GVD A;  2QZ8 A;  2UV1 A;  2M2E A;  1F36 A;  5LD2 C;  2PJP A;  1IXC A;  1JUS A;  3P5J A;  1D1A A;  1AWC A;  3WU1 B;  2W24 A;  4DJA A;  1FYL A;  5A2Q Z;  1IW7 F;  2YPR A;  1FY7 A;  1WJB A;  4XNF A;  2R7U A;  1OPC A;  4I01 A;  5LFA A;  1X2M A;  2XB0 X;  3E0J B;  3EDP A;  4IHY A;  4ZYD A;  3BP8 A;  2FSW A;  1SMT A;  2ECB A;  3A03 A;  1TBX A;  3K4J A;  3FKI J;  4AVZ A;  5F64 A;  1GHC A;  4XLF A;  2M8G X;  5FFZ A;  1YW8 A;  4ZTF A;  3H5R A;  3ZMT A;  2FRH A;  4E4H A;  1B9N A;  3JRB A;  1RR8 C;  2IPQ X;  2CYY A;  1MBK A;  3G1O A;  2P7V B;  4FHT A;  3OOP A;  3HBL A;  4C3J J;  2B9S A;  1IJW C;  3F8F A;  4M9Z A;  4XR6 A;  3H5N A;  5ILS A;  2ZC2 A;  1YX5 A;  1BW6 A;  1X1A A;  3DQV C;  1MMG A;  2NAZ A;  3SHF A;  2E60 A;  3U1K A;  4ASN A;  1V5G A;  1SVL A;  1MBJ A;  3J7Z I;  3ZQC A;  5C4J J;  3ZQI A;  2W57 A;  3HOV J;  5LGT A;  4C2U A;  1Z0X A;  1YG2 A;  5FO5 A;  1X58 A;  4F3Q A;  2QBY B;  2M1B A;  3Q0U A;  2ZNZ A;  4Q48 A;  1VQL I;  1ZRC A;  1QA6 A;  2PFB A;  3COA C;  3F0C A;  5F27 A;  4BAY A;  5E3L A;  4I99 C;  4A3I J;  4ABZ A;  2IT0 A;  2L9V A;  4AIK A;  4PJM A;  1A35 A;  3E5U A;  3UR3 C;  4II2 A;  3DBL B;  3S16 J;  2GLO A;  5GAH J;  1GV5 A;  4KJZ A;  3I3L A;  1PVE A;  5KK1 A;  3I59 B;  2HQN A;  2K27 A;  5LGN A;  3A01 A;  3ABL H;  1K4S A;  4BS9 A;  3TOB A;  3E5X A;  5DTD A;  3OV8 A;  2OJE D;  4BDZ A;  2E2J J;  4XBF A;  3SZT A;  1A04 A;  3MWM A;  4EGZ A;  2QVO A;  3H0G J;  1WZ2 A;  1I6H J;  2VQH A;  3CCQ I;  3GTL J;  3ERE D;  2QQB A;  1FSE A;  4P5O A;  2Q2E B;  1B8I B;  5LLQ A;  3CUO A;  4HX7 A;  3KZI C;  5ICG A;  2L3D A;  3DEW A;  3W3C A;  2MG4 A;  5AIP A;  4LMY A;  4I7H A;  3RQI A;  2LY2 A;  2H8R A;  4KDP A;  2X1C A;  2FBI A;  4M3B A;  1T0F C;  1BC7 C;  3RCO A;  1HDP A;  1FYK A;  3JSP A;  2QBY A;  1WQ2 A;  2M7A A;  3S3M A;  2BOL A;  4HOB A;  1R4M B;  4L9T A;  2DFH A;  5E1X A;  1WKM A;  2BZT A;  2JSC A;  3BWG A;  3OYI A;  1HW2 A;  2NVQ J;  2Z16 A;  4HF1 A;  2F6C A;  2V6E A;  4KN4 X;  3GYH X;  2DA2 A;  2R92 J;  1R49 A;  3JRA A;  3GFI A;  2XPU A;  5TRD A;  1XCB A;  1YHQ I;  2UXX A;  5KHD A;  3KP5 A;  3E3V A;  1DGW Y;  4S04 A;  1JKO C;  2IVM A;  3I59 A;  2E2H J;  4AIH A;  1SMY F;  2Z5U A;  3E6D A;  3S17 J;  4P55 A;  3BR1 A;  1SAU A;  1Y0N A;  3MD2 A;  4IEJ A;  1HW5 A;  1MBE A;  2K85 A;  2Y9Y A;  1IV8 A;  1MJB A;  3F23 A;  3MFK A;  2EPF A;  1D1B A;  5JVG F;  2L4A A;  2CUZ A;  3F8M A;  1Z3Y A;  4PUS A;  2Q2E A;  1B8I A;  3M7G A;  1B6A A;  1O57 A;  1Z6R A;  1GVJ A;  1R4N B;  5KAF C;  1LJ9 A;  1XGS A;  1Y0U A;  2MBF A;  3RKW A;  2HS5 A;  4DQ2 A;  1IO2 A;  5EEA A;  4IOC F;  4BE2 A;  2O8K A;  3H9J A;  2DA7 A;  5IYB J;  2XRL A;  3LA3 A;  3HUG B;  3DKW A;  1RPW A;  3K1P A;  4NBQ A;  1PP7 U;  4BEH B;  1Z77 A;  2VE8 A;  4MEY F;  1A6I A;  5LBQ A;  1SD4 A;  4XRS A;  5L3G A;  1FIP A;  1ZR2 A;  3Q0V A;  4LG0 A;  2FML A;  2PEX A;  2R7Q A;  1FP2 A;  4B1R A;  3IWZ A;  2WB1 N;  4DBQ A;  3OS0 A;  3K0L A;  3RSN A;  1I5Z A;  1G3Y A;  3P9K A;  3CC2 I;  2R4G A;  1OCO H;  3ZRG A;  4CGZ A;  3AFH A;  3A0H C;  2ME0 A;  1F1Z A;  3M1E A;  4ZTJ A;  2VUM J;  4Y15 A;  2LVS A;  2VXZ A;  1WFX A;  3CMM A;  1LVA A;  2JA2 A;  2XUB A;  5K7F A;  1XC5 A;  1HSJ A;  2KPM A;  1B72 B;  4NQW B;  1QPI A;  2WTE A;  5KCM A;  1OMI A;  3FXL A;  4G9Y A;  3SEQ A;  2DTZ A;  3L7W A;  3SFI A;  1UCR A;  4EAT A;  1VQ7 I;  2EK5 A;  3ZR8 X;  4D9J A;  1D1C A;  2QQA A;  5GTH C;  4M6V A;  5IYD J;  3HUG A;  3J80 Z;  5IOY A;  1IUY A;  2Y0S N;  4BEH A;  4A6D A;  1W5S A;  2V1N A;  4L9J A;  2VKE A;  2QQ8 A;  5J3L A;  5B5E C;  2K02 A;  2JQ7 A;  3TL4 X;  1IRF A;  1LVK A;  2CUE A;  2HYF A;  3MVP A;  2F5C A;  2L7F P;  4U88 A;  4AVP A;  4R1H A;  2ISZ A;  5DV5 A;  5A2Q K;  1PUE E;  3JRC A;  2CQN A;  1UB9 A;  2R7V A;  1UJ8 A;  1M1E B;  4ZDP A;  3E5Q A;  4HV6 A;  1FC3 A;  2R7O A;  3KIO A;  2OCE A;  1U9O A;  4MEX F;  1IDY A;  4A3J J;  2NOG A;  1IXR C;  1HKQ A;  2ID6 A;  2EA4 A;  2J5O A;  3AL0 C;  2CW8 A;  3QYB A;  2HXI A;  2M4G A;  1BL0 A;  1ERD A;  2GBY A;  3IV5 A;  1S9H A;  4CCK A;  2A05 A;  4OIR F;  4IQJ A;  3ZCO A;  3CMA I;  3AL0 B;  4II3 A;  1ZEL A;  2XRO A;  2E5N A;  4D7M A;  3I54 A;  4B48 A;  5FKO A;  3S1N J;  1FOY A;  2XIG A;  2ZJQ F;  4MNU A;  5K5Q A;  1U6G A;  1IN7 A;  3F8B A;  3NRV A;  3CCL I;  4O5V A;  4ZC3 A;  5E8G A;  3FXO A;  2QWW A;  3IH4 A;  3BG5 A;  4XK4 A;  5DDG A;  1B72 A;  6PAX A;  1SAN A;  2ETH A;  4LD5 A;  3DKY A;  3GME A;  3TKY A;  3SZG A;  3HKZ N;  1I3Q J;  5FRN A;  2EIL H;  5FRM A;  5H6R A;  3IH2 A;  3SFZ A;  3CCS I;  1JJ8 C;  2CFO A;  1WPK A;  5EGO B;  3KET A;  2GOM A;  5FKK A;  4P9F A;  3EPZ A;  1QZZ A;  4LFU A;  4ITV A;  3O6B B;  4RS8 A;  1BJA A;  3VFZ A;  2GA2 A;  4ZJZ A;  2EFN A;  1WVR A;  4MHG A;  2PMH A;  3S32 A;  1TT5 B;  3I71 A;  2AQF A;  3GZ6 A;  3ZMD A;  2K40 A;  4OOI A;  3DU5 A;  2LOO A;  4LLL A;  1WWX A;  1RES A;  1EH8 A;  4JX6 A;  2HGC A;  1X4O A;  2IA2 A;  3BR0 A;  3VSK A;  1D5Y A;  4A3M J;  3W2A A;  3AAF A;  2JK3 A;  4X1E A;  1R36 A;  1XD7 A;  2KIF A;  3FF5 A;  1H9G A;  1TNS A;  1T39 A;  3N97 A;  1BBY A;  2B0L A;  2RNJ A;  4I02 A;  3DPL C;  3L2C A;  3CO6 C;  4X0G A;  4PCQ A;  1R1V A;  1QU3 A;  1OYI A;  3SDB A;  3R61 A;  3U9G A;  1JTX A;  3HPH A;  5HOO A;  3WTS C;  3GX4 X;  4XON A;  1DP7 P;  2HQR A;  3R60 A;  2TDX A;  3JRH A;  1Z1D A;  3WGI A;  3VYR B;  2JMW A;  2H6B A;  2V9P A;  4DIQ A;  4M3D A;  1UHM A;  1TTY A;  3Q3S A;  3FXR A;  4KIF A;  4PGG A;  1MKM A;  1WSU A;  4P96 A;  2D1V A;  3FMS A;  1IDZ A;  4RGX A;  3BZK A;  1FMW A;  1S29 A;  1Y56 A;  1T98 A;  4HPQ A;  4FCY A;  5K5R A;  3OYC A;  4N4N B;  3PQK A;  4PJL A;  5EGO A;  1UHW A;  4MLO A;  4XLN F;  2EQR A;  1N75 A;  2CRG A;  2M3A A;  2GAU A;  4BJT A;  2LY9 A;  1V54 H;  3V8L A;  2R7Z J;  1XMK A;  2PQ8 A;  2YX4 A;  3FIW A;  3HEF A;  3H3Z A;  3LAJ A;  3M9A A;  1VQN I;  5D5U B;  4KT5 C;  3S3N A;  4ZDL A;  3MQ0 A;  4F93 B;  3ROU A;  3W6J B;  2PLY A;  2VOP A;  2NNN A;  2MAB A;  1XN7 A;  5D4S A;  1NK3 P;  3MN2 A;  2X6O A;  3R4K A;  2KZG A;  1V3F A;  3LOC A;  2ZFW A;  2QYO A;  4XLC A;  4OMZ A;  2ZBK A;  2K9M A;  4F55 A;  5IT9 K;  3HOY J;  3U2R A;  4Z6Y A;  2OQG A;  2OBP A;  3V42 A;  1LEA A;  2ZB9 A;  3ZOB A;  4DZJ A;  2QSF X;  5LHI A;  3ZQL A;  2GWR A;  1L3L A;  4HYE A;  2FXA A;  5DUI A;  1V5E A;  3SEZ A;  2VQG A;  4UY8 I;  1OQY A;  3F8N A;  1MGT A;  3HSR A;  3TMO A;  2E1N A;  1I39 A;  2X6Y A;  3CCY A;  4HBL A;  2YU9 J;  3GF2 A;  3HOU J;  2FBH A;  1HBX G;  4FX0 A;  1OCT C;  4P1W A;  4ZZL A;  5M3F J;  1KU9 A;  3NAU A;  1VZ0 A;  3RPU D;  1SFO J;  5FKN A;  3E6B A;  4FQG A;  4CH7 A;  1QQI A;  3V4G A;  4MQ9 F;  5BNG A;  2EA2 A;  4MTE A;  2VI6 A;  2JWT A;  3OL3 A;  4XLE A;  4Y52 J;  2UZK A;  4RMN A;  3RYP A;  4FX4 A;  4HNT A;  4GGG A;  2H27 A;  3OIO A;  3V7R A;  4XRF A;  1I50 J;  2CH0 A;  4O3M A;  1WJ5 A;  3FBN B;  3FM3 A;  1TWG J;  3JTG A;  2IEK A;  1GT0 C;  3PIO F;  2ELH A;  2F2E A;  3S93 A;  3JRD A;  1GUU A;  1W5C C;  2DT6 A;  2G0E A;  1W7P D;  2WAQ A;  1YIJ I;  3CCR I;  1LKX A;  3T0Y A;  4YRV A;  3IUO A;  1R71 A;  4Y3O A;  1XG1 A;  3DPU A;  3TP3 A;  1K7A A;  2M8E A;  1WHU A;  3O3K A;  3DEE A;  3LSH A;  2XHK A;  1HST A;  1YJN I;  4KNY A;  4LK1 F;  5DCM B;  1MNM C;  3GCM A;  3QOE A;  1LFP A;  1L0O C;  2BV6 A;  5K5O A;  5CVR A;  5F6F A;  3LSP A;  1MW7 A;  3I58 A;  2ZJP F;  2K4B A;  2VBZ A;  4M3G A;  3M8J A;  3H36 A;  1VQ5 I;  2HVQ A;  3CZ6 A;  1UG0 A;  3D0S A;  4D5C A;  1EH6 A;  4KN7 X;  3O8H A;  4E7H A;  3WHB A;  3I56 I;  5TJJ A;  2K86 A;  4EJW A;  4XLA A;  2X51 A;  1KQ8 A;  2ZXH A;  1IUF A;  1I1G A;  5IP7 J;  1MZB A;  1QGP A;  2UWM A;  5GP9 A;  4C3I J;  1P4W A;  2LF7 A;  1RET A;  3BJA A;  3HHG A;  4ZDO A;  2EV6 A;  4Y4R A;  1D3Y A;  4BNC A;  3S14 J;  1D8K A;  4I0A A;  3HJE A;  5JLX A;  2GA1 A;  3MKW B;  3F72 A;  2VB6 A;  3HRU A;  2DYR H;  1SEU A;  1IZ1 A;  1MBG A;  5J8C A;  1W7P B;  3ONQ A;  2NXN B;  3LSM A;  2LDU A;  2IXS A;  4LK0 F;  4UB6 C;  3LMM A;  1FYM A;  1R23 A;  2YSR A;  1YLF A;  5ICE A;  2VL8 A;  1GDT A;  3GTM J;  1TL8 A;  2F5E A;  2EJR A;  3FXM A;  1BA5 A;  2QKL B;  3HTS B;  3DKX A;  3CO7 C;  3HOS A;  3GFL A;  1R6R A;  3HGY A;  3L2W A;  5DCM A;  1FEX A;  1U8R A;  3A1Y A;  5L3D A;  3TW6 A;  3EYY A;  4A3F J;  1D0Y A;  2NS7 A;  4IZZ A;  4BAC A;  1FBU A;  1HXD A;  3S2W A;  4AC0 A;  5DS9 A;  1TLH B;  5CQG A;  2I5U A;  4A12 A;  3LSI A;  2BHZ A;  2K9N A;  5DEQ A;  3WTY C;  2CQX A;  4HSR A;  2KLO A;  4U0V A;  3Q0W A;  4PGH A;  1MDM B;  1RRJ A;  3RPU A;  3EQL F;  3B6A A;  2DOE A;  2L02 A;  1ENH A;  3SDG A;  2ZXW H;  3EET A;  5F1R A;  1G8X A;  4XRM A;  2LKS A;  1P4X A;  4NC7 A;  1S8N A;  1T33 A;  3G3Z A;  4IVN A;  2FNP A;  1YOV B;  3FM5 A;  5M5W J;  3FK6 A;  4KUM A;  3GLX A;  4A0Z A;  2MH9 A;  1IG7 A;  3CP2 A;  4MTD A;  3VYU B;  2QF7 A;  3BPV A;  4JK1 X;  4LIU A;  1BI1 A;  2QSG X;  3G2B A;  5D8K B;  2HOS A;  4WWC A;  5HS9 A;  1W7P A;  1ZGA A;  3OYM A;  1YJW I;  2KZV A;  2CG4 A;  2R5Z B;  3D5R C;  5FKM A;  4HAM A;  1AA7 A;  1JTY A;  2HR3 A;  1JHH A;  4FET A;  4L9V A;  3J7A O;  3C2B A;  3CME I;  1TZL A;  4E7K A;  1VQO I;  4V2F A;  4BQN A;  2VXD A;  1KYZ A;  4CDG A;  4I98 B;  4G94 A;  1WI9 A;  2Z99 A;  2KDZ A;  2ZSH B;  4RLQ A;  4QLC U;  4HF0 A;  5IP9 J;  2ZXJ A;  2LKX A;  5M5Y J;  1UST A;  2G9W A;  2DJN A;  2GM4 A;  2MLK A;  4XKC A;  4YEJ A;  2W1O A;  1J09 A;  3PJR A;  1MDM A;  1P7J A;  5C4X J;  2A5W A;  4PSX A;  4JBA A;  1YFH A;  3I53 A;  2IJL A;  2EIK H;  4G12 A;  4L9N A;  4CCN A;  2WAF A;  1SD6 A;  2IP2 A;  3H92 A;  3QYF A;  2ADU A;  3V8K A;  3ZN0 A;  4OAZ A;  1MNE A;  2DDA A;  2L0K A;  4UVB A;  1OCZ H;  5LEJ A;  4BXU A;  2COB A;  4I6Z A;  2VOO A;  3HPG A;  3WGH A;  3IL2 A;  4HRI A;  5HVQ C;  2CO5 A;  3CDI A;  4IRI A;  3F8C A;  4HZF A;  3IH3 A;  2V1X A;  2XGE A;  1U0J A;  4G7O F;  5HNH A;  5ILU A;  3K2Z A;  4I09 A;  1HF0 A;  4Y13 A;  4RGR A;  1OKR A;  5B1B H;  1F9N A;  3IC7 A;  2VPL A;  2XGC A;  5E8I A;  2R5Z A;  1KU7 A;  2RKH A;  1YYV A;  2PG4 A;  2L54 A;  3CP8 A;  4EGY A;  3CUQ B;  1WH7 A;  2CW7 A;  2J5P A;  5HDN A;  3J7Y J;  2HEO A;  2P0W A;  1RZ4 A;  2O7O A;  2VJ4 A;  1HC8 A;  2E2I J;  1WJC A;  4XMY A;  3TO6 A;  2DMQ A;  3HXL A;  3MZH A;  1ZLK A;  3MKY B;  1V5F A;  2BY3 A;  2V1D A;  4L5J A;  2HDC A;  3DTI A;  1K6O A;  2LH9 A;  1HA8 A;  1PUF A;  2QGU A;  1HOM A;  1I6X A;  1CQT A;  2JUC A;  3RJP A;  3M3Y J;  2HQA A;  3GBG A;  3H9Q A;  1KQ0 A;  2H1L A;  3E7L A;  1XGO A;  4FIS A;  4HX4 A;  2V9K A;  1T95 A;  2NS8 A;  1TT0 A;  3ZMZ A;  2HZT A;  3ABT A;  1BI0 A;  3IP4 B;  1RKT A;  4BQA A;  3J7A Y;  1FJL A;  1OYY A;  1S72 I;  1DGR M;  2QQ9 A;  4HNU A;  1WJE A;  2R5Y B;  2ACJ A;  3KZY A;  3KP2 A;  1E3H A;  3CES A;  2XKO A;  2OQR A;  1N77 A;  1MSF C;  3PNV A;  3OS1 A;  4HNV A;  3LAP A;  4XL9 A;  4M73 A;  4UXN A;  5D6F A;  4QTR A;  4BY7 J;  2JA8 J;  3VB2 A;  3ZMS A;  3LA7 A;  3A2K A;  4F52 A;  3MAJ A;  3CUQ A;  2EIN H;  3GXO A;  2F5D A;  1TWF J;  2EIJ H;  2DA6 A;  4HST A;  2L01 A;  2Z2S B;  4EM1 A;  3H5A A;  3ML6 A;  1RUO A;  3I4N J;  2HOT A;  1U8B A;  1DU0 A;  1FIA A;  1QHG A;  2MW8 A;  4KMU X;  3BDD A;  2VKD A;  3OIP A;  2A3S A;  4KT6 A;  5CVU A;  5L3E A;  2E7X A;  1BOA A;  4PSW A;  2IA1 A;  3OYA A;  3D1N I;  2BY2 A;  2K4J A;  2H6C A;  1U5T C;  2FF4 A;  3ISP A;  4AYB A;  1PYV A;  4G6Q A;  1U5T B;  1P92 A;  1Z05 A;  4BBS J;  3E6M A;  1R5H A;  4LG3 A;  2XAF A;  1APL C;  2XDV A;  3BRO A;  2JVG A;  2E36 A;  5GPC A;  3IKT A;  1MMN A;  4ON0 A;  3DP7 A;  2XGD A;  4MO7 A;  3JRE A;  3KE2 A;  1S6L A;  2FQ4 A;  1Q1V A;  5K7H A;  2NNY A;  1B9M A;  2R5Y A;  2IA0 A;  1LDK B;  3QPL A;  5AON A;  3DLA A;  3REO A;  4U7D A;  4A3L J;  2A6E F;  3BLY A;  1HW1 A;  2OF7 A;  1W36 D;  1ZG3 A;  4NUB A;  1ON1 A;  2FU4 A;  2DA1 A;  3GWZ A;  1T2K A;  1O7L A;  2RNG A;  2JRM A;  1MBH A;  3G1M A;  2XPW A;  3OR1 C;  2VQC A;  2ESH A;  2WAQ N;  2IS1 A;  3HRS A;  2LY1 A;  4B3A A;  4UUS B;  5EZG A;  1XSD A;  1IN8 A;  1WJA A;  5IT9 Z;  1Y8Q B;  3B73 A;  3BG6 A;  2CQQ A;  3W2V A;  2MSY A;  1Y1V J;  4BE0 A;  3ZMU A;  2XPV A;  4B44 A;  1KZH A;  4S0H B;  3F22 A;  1H89 C;  5JI6 A;  2UXN A;  5F0C A;  2R7X A;  1KGS A;  3G73 A;  1V4R A;  3S1R J;  1IRX A;  5CVV A;  2VKV A;  4PFP A;  3SYT A;  1U5T A;  2CUJ A;  2ELJ A;  3K70 D;  1Z6T A;  2AS5 F;  4WF2 A;  4CCM A;  3U21 A;  2KRF A;  4HG2 A;  3K2A A;  1W36 C;  5E3N A;  4OMY A;  1FTZ A;  3QYE A;  2OU2 A;  2E7W A;  4OIO F;  5LHG A;  4M3F A;  3OYB A;  5J1Y A;  1YE9 A;  2VBY A;  5AIQ A;  1ODD A;  2DFE A;  3HRT A;  3MZ8 A;  1EJ9 A;  1H0M A;  1R5G A;  1JT6 A;  2BY1 A;  5D5X B;  4EJU A;  3PM1 A;  1YS6 A;  3K9T A;  4NDL A;  4CSW A;  1I3A A;  2EIM H;  1PP8 F;  1QRY A;  2KRH A;  2D1H A;  3TQN A;  3Q5F A;  4C30 A;  4DZP A;  5IT3 A;  1J59 A;  1X1C A;  3S8P A;  2W84 A;  3I55 I;  2IS2 A;  2VBX A;  3L2R A;  1TW2 A;  4KIT B;  3CCM I;  1F5T A;  4GDF A;  2DT5 A;  3GTO J;  1CGP A;  3HHH A;  3K70 C;  5IPA A;  5ICC A;  1A6Q A;  2DCE A;  3PFI A;  9ANT A;  2GIV A;  1DPR A;  3JW4 A;  3A0B C;  2KIM A;  2Z9O A;  1ZLJ A;  3DF8 A;  2YR2 A;  4G7H F;  1YW9 A;  3EUA A;  2DPU A;  4RAZ A;  2JVH A;  3GFM A;  5D8L B;  4UUT A;  4A2U A;  3IRQ A;  2DT7 B;  3W6K B;  1JE8 A;  1ZYR F;  2FA5 A;  1LE8 B;  3OYG A;  1QBJ A;  1X3Z B;  2DMT A;  4DW6 A;  3DBH B;  1QNT A;  2LC2 A;  4B47 A;  4YIF A;  3VYS B;  1G3T A;  1R7J A;  3K69 A;  3BR2 A;  3BJO A;  4A3K J;  5J47 A;  1BN5 A;  1XDU A;  3BQY A;  4YFK F;  2OUM A;  2XGX A;  4A93 J;  4M74 A;  3OYL A;  3RZD J;  2BXY A;  1H88 C;  3RKY A;  1VQ9 I;  4C2T A;  4YIR X;  3FKJ A;  4KIC A;  2EFW A;  1X1D A;  1OR7 A;  1FT9 A;  2CWE A;  2E71 A;  3K10 A;  4C2M J;  4JQF A;  1ON2 A;  1OJL A;  1TQM A;  2TRT A;  4QPO A;  2JJ7 A;  3LNQ A;  3CDH A;  3VOE A;  3LSJ A;  2VOD A;  2HKX A;  4HQE A;  1MSE C;  4FAS D;  4O6J A;  3LL7 A;  2ZO4 A;  2XF6 A;  4IQ4 A;  4NQW A;  1WJD A;  2ZME B;  4M9X A;  5FGM A;  4ZYG A;  1VI0 A;  4RM2 A;  2D45 A;  3PIP F;  1W4M A;  4UHT A;  5D6E A;  1XMX A;  3OOU A;  3RKX A;  5FB2 A;  3CMY A;  1WJF A;  2VLA A;  4R79 A;  1SAX A;  2Y2Z A;  1G6N A;  4D5F A;  1VFC A;  5GTI C;  3DU6 A;  5FLX Z;  1KU3 A;  1ACI A;  2ID3 A;  1FBQ A;  3G1L A;  3KLO A;  4BU2 A;  2EBI A;  4NNJ A;  2CQ7 A;  1QZY A;  4AM3 A;  4Q47 A;  1LEB A;  2G7U A;  3ZQG A;  3BTC A;  4EQQ A;  1MMD A;  1OFC X;  3CCE I;  4FT8 A;  4XIC A;  3N05 A;  1FOX A;  4MIM A;  4U87 A;  5F0F A;  4KFC A;  2BW3 B;  2IAI A;  4N9I A;  5GAE J;  3O8G A;  1EA3 A;  5E20 A;  3FMQ A;  2LBF B;  3GFJ A;  1TWC J;  3F6O A;  3VEP A;  5LGU A;  3ASN H;  3LSR A;  4DBR A;  1J7K A;  3TGN A;  2B7E A;  1IRG A;  3KZZ A;  1J5Y A;  1ETO A;  2K9Q A;  4BXX J;  5HLH A;  4A3E J;  4ZYA A;  1AHD P;  3BZC A;  1GV2 A;  3C3W A;  3GTG J;  1E3P A;  2RRE A;  4HV5 A;  2LG4 A;  3HOT A;  2ZME A;  5CYV A;  2DO7 A;  2DMN A;  1BI2 A;  2PBI A;  1JKQ C;  1AU7 A;  1YJ9 I;  3QP5 A;  4A69 C;  2RC4 A;  4RBO A;  1S7A A;  2P4W A;  2NVU B;  1XPX A;  2L7Z A;  2W85 A;  3BC8 A;  1FNN A;  4RAY A;  1O3Q A;  2F4O B;  3TP0 A;  2HVR A;  2COM A;  4RAF A;  4U7B A;  1POG A;  2NS0 A;  5IOZ A;  4ESJ A;  4A5M A;  4RM3 A;  5LRR A;  2E1C A;  4XM3 A;  2E34 A;  3MMY B;  2W48 A;  3H3V K;  4RA2 A;  3MZY A;  3HOZ J;  2PX9 A;  1G4D A;  3WOD F;  2VE9 A;  3L00 A;  3HGG A;  3LST A;  3QRF F;  3QP6 A;  3WGG A;  4LJZ F;  2O61 A;  1BR1 A;  1X1B A;  2L2O A;  3BPX A;  3KCC A;  1ETY A;  2FX0 A;  4IJA A;  1I1S A;  2AO9 A;  1NHA A;  2O6G E;  3VDX A;  1A5J A;  1IN5 A;  2O3F A;  3KP4 A;  4XLH A;  1JGG A;  3JRI A;  3T1B A;  1R1T A;  2LBF A;  2Y75 A;  2HWV A;  3CTA A;  3QOD A;  4B4C A;  5DM7 F;  4LIT A;  1G2H A;  2XAJ A;  1TC3 C;  2FEZ A;  1XS9 A;  3ZPL A;  1KU2 A;  1MMA A;  2BVL A;  1MJ9 A;  3KYD B;  2IW5 A;  2JRT A;  3SJM A;  4L5I A;  5EEH A;  2LD5 A;  3IAS 2;  5HNF A;  3WTW C;  2XSD C;  2EFP A;  3EUH C;  1IN6 A;  4A0Y A;  5FFX A;  2WC2 A;  4LB5 A;  2DK8 A;  3A4C A;  2Y9Z A;  2VJJ A;  4XOT A;  2LMD A;  1VTN C;  3WTT C;  1LB2 A;  2KRC A;  3V7C A;  3WU0 A;  1JGS A;  2XV4 S;  4AYB N;  2DDB A;  3ULQ B;  3PO2 J;  3BR5 A;  3CF2 A;  3NQO A;  2OAZ A;  2R0Q C;  2K5C A;  2LF8 A;  3B02 A;  1DPU A;  3D5L A;  2FMY A;  3ABK H;  5C3E J;  4EEF G;  2YU3 A;  2L7M P;  3CDL A;  1WCM J;  3K1M A;  1BIA A;  4AU7 A;  5C44 J;  2KKO A;  4MGR A;  2CU7 A;  2LRE A;  1X3U A;  1JUM A;  5L3B A;  2O9L A;  1C0W A;  3FHZ A;  4CCL A;  4DOZ A;  2IGK A;  1IV6 A;  5DM6 F;  4UVA A;  3HYI A;  2LYC A;  2E1M C;  2A68 F;  4IO9 F;  3DTE A;  2VAS A;  3JCU C;  4E7L A;  5IY5 H;  4BJ6 C;  2E1M B;  3HG9 A;  4F91 B;  3FDY A;  4N9H A;  2NRA C;  3BG3 A;  4EJT A;  3KX2 A;  3E6C C;  2ZXI A;  5FLM J;  1T38 A;  1S5L C;  2R7T A;  2EV0 A;  3AG3 H;  2BEO A;  2XF5 A;  3U1D A;  3TED A;  2P81 A;  2KFD A;  1XB4 A;  2A6T A;  2DBB A;  5JVT A;  2PI0 A;  2XRN A;  2A6H F;  2K7L A;  1G3W A;  2LRD A;  3R6S A;  2HOA A;  1XSV A;  2MYS A;  5KAI C;  3EUH A;  4M3E A;  5J6X A;  1EV7 A;  4OIQ F;  3IWF A;  2QCO A;  4XQF A;  2CFX A;  4EV0 A;  2VIX A;  2DOD A;  1UZC A;  1IXS B;  1KA8 A;  4B43 A;  1U2W A;  1P6R A;  2K9S A;  4BQQ A;  5JLW A;  5GPA A;  4HQM A;  4RB0 A;  3ZQF A;  1BC8 C;  5J4Y A;  4RGU A;  1DU6 A;  1HKT A;  4XSZ F;  3SXY A;  3F9K A;  2XSJ C;  2E19 A;  5HLT A;  4E7I A;  1FPQ A;  4OAY A;  2G7H A;  1YIT I;  1QZE A;  3ABU A;  1K78 B;  1EH7 A;  2STW A;  1UMQ A;  5JR3 A;  1Z9C A;  3M8E A;  1G59 A;  2HDW A;  3ECO A;  3LFU A;  1ZH5 A;  4G6T B;  2IS6 A;  1OCP A;  5EZH A;  5GAD J;  1O3R A;  4A3D J;  2X0L A;  1Z7L A;  3PNT A;  2B63 J;  1R9T J;  1QHH D;  2M34 A;  2HTJ A;  4HW0 A;  1MJA A;  2CS3 A;  4N0B A;  5CVI A;  3L2V A;  1ZRF A;  3EUK L;  3RZO J;  2RV8 A;  2D5V A;  1S7E A;  4WXD A;  2WAE A;  3OYD A;  3RYR A;  1HKS A;  1NG7 A;  1B1B A;  4IHW A;  3R0A A;  4BHB A;  2JT1 A;  2PMZ A;  4L0Y B;  4NB5 A;  2QA4 I;  2CW0 F;  1ETQ A;  1ETW A;  2MC3 A;  2LFB A;  4QSH A;  4DYR A;  4BE1 A;  2VC0 A;  1ZKG A;  2HDD A;  3IKV A;  3I5U A;  1SC7 A;  4YFN F;  2R7F A;  3LWF A;  3DBR B;  3O2P E;  1MH4 A;  3QWL A;  2LP0 A;  3F21 A;  1JXS A;  1YW7 A;  4Y33 A;  3GUD A;  4FE4 A;  3AG1 H;  3J81 K;  4BYY A;  2HOE A;  3OL4 A;  1S7O A;  5FLX K;  4XKW A;  2DA4 A;  3ELK A;  1VQP I;  3DPT A;  3P9C A;  4OIN F;  3A02 A;  5HS7 A;  5F04 A;  3WTV C;  2ICW G;  1K78 A;  2V79 A;  1P2F A;  3BR6 A;  3H0D A;  1K6Y A;  2WBM A;  3L2Q A;  3DLL F;  1R5I D;  4NC6 A;  4M9S A;  1P4A A;  3WTU C;  4D1Q A;  1QVT A;  2KHM A;  4IRH A;  1E3O C;  1BJZ A;  4E6K G;  3CC4 I;  1JKP C;  2RN7 A;  1VND A;  1IAW A;  1R00 A;  2DQR A;  3KPH A;  3D5S C;  4CCJ A;  2K3F A;  5J8F A;  2H8W A;  4IHS A;  4CXF A;  3CLO A;  3TBI A;  2X6W A;  4W1U A;  1GXP A;  1DUX C;  1SFE A;  1ZN2 A;  4ZH4 F;  2IRF G;  2JA5 J;  1HQC A;  3BT9 A;  4LB6 B;  3FK7 A;  3OYH A;  2V4J C;  4A5N A;  2MGQ A;  1OLT A;  2FUG 2;  5EF6 A;  3PO3 J;  2BGC A;  2ZSI B;  5FKL A;  5HS8 A;  5B3S H;  2E35 A;  3OS2 A;  2PJR B;  4C9Y A;  5IYC J;  2HFH A;  4GRI A;  2ISY A;  5DCF A;  3P7N A;  2MLG A;  5B1A H;  3LSG A;  1U9N A;  5DD4 A;  4KIS A;  3GZN B;  4ZYH A;  1ZAO A;  1DQU A;  2A07 F;  3QQA A;  2CMP A;  3M1C A;  3PSF A;  2P7C B;  3OIQ A;  2QSH X;  1NH3 A;  2Y48 A;  1OYW A;  1REP C;  3FXU A;  2MD0 A;  1ZHF A;  5E1W A;  3M8F A;  4L0Z B;  3CUQ C;  3JRF A;  2VN2 A;  2MA3 A;  1KQ9 A;  1O4X A;  3KP6 A;  4ENJ A;  5LHH A;  2FD5 A;  1J2X A;  5K1Y A;  3KFW X;  4RB2 C;  4AID A;  1WRJ A;  1ORK A;  4DGW B;  1G3S A;  3HC7 A;  4YFX F;  4EVI A;  1PJR A;  2O5R A;  2EV5 A;  1HLV A;  2Y0M A;  2EFO A;  2HNH A;  3K1N A;  5LEK A;  1OCR H;  2MFZ A;  2P5V A;  4KMF A;  5B66 C;  3P9I A;  3ZQQ A;  4HF2 A;  3A01 B;  4XOP A;  1VF9 A;  2V1U A;  3OSG A;  2XAG A;  4M72 A;  1D8J A;  3FZV A;  3RPQ A;  2XC7 A;  2M9H A;  5L3C A;  1H8A C;  2FOK A;  4A3C J;  1Y39 A;  2HPI A;  1NG6 A;  4PJJ A;  1MMS A;  2CQK A;  2M5W A;  3WU2 C;  4CO8 A;  1KYW A;  2OZ6 A;  2V26 A;  4I0B A;  2PJR A;  2VKH A;  2NOJ B;  2PMU A;  4Z2Y A;  4BKX A;  2XF7 A;  2RGV A;  1R22 A;  1X1P A;  3CCJ I;  1SD5 A;  3GW2 A;  2HTS A;  2X9D A;  4ESB A;  3BZ6 A;  3MCZ A;  2DTR A;  5CQE A;  2VT2 A;  3IRR A;  1XCV A;  3MKL A;  2XAU A;  2QEX I;  2XAH A;  2MD5 A;  2OTL I;  2E1O A;  2DOA A;  1ITY A;  1E0E A;  1ZR4 A;  1XMA A;  4F7Z A;  1D0X A;  2QUF A;  2XVC A;  2R7S A;  3LQR A;  1J9I A;  5CVJ A;  2IS4 A;  4J19 A;  1XTA A;  4B8X A;  5TGT A;  4ETS A;  5J1R A;  4ANJ A;  3GZ5 A;  3RTR A;  3E97 A;  2CSO A;  3FX3 A;  1B4A A;  4A0X A;  3E1S A;  3GVA A;  4JX5 A;  1T8I A;  2L9N A;  2P6S A;  2AHQ A;  3DEU A;  1SD7 A;  2Q1Z B;  1W0U A;  2JTV A;  1NTC A;  1ONV A;  3WHC A;  3VYT B;  1FX7 A;  1DDN A;  4XRS G;  5FLV A;  3H35 A;  2STT A;  2F5V A;  3HTU A;  4QIW N;  1K61 A;  1F4K A;  2JSP A;  3S1Q J;  3GLL A;  3BCB A;  4FE7 A;  2DW4 A;  4XID A;  2YX7 A;  1RI7 A;  2Q8K A;  4WK8 F;  3S1M J;  2I8D A;  1Z91 A;  3KEY A;  3CLQ A;  2EWN A;  3FMR A;  4XKV A;  3AKZ A;  3C7J A;  2DLL A;  2EZK A;  1TW3 A;  1O7F A;  2VT3 A;  2W82 A;  2ESN A;  1LNW A;  4AD9 A;  3RKQ A;  1BW5 A;  4BUP A;  3QPS A;  5M5X J;  2JPB A;  2OA4 A;  1TNT A;  1F43 A;  2RQQ A;  3TW7 A;  4EJO A;  1YI2 I;  1BIB A;  1VQK I;  3AG2 H;  4GXO A;  5KNL A;  2AXT C;  4WXC A;  3W2W A;  1O3S A;  1UEL B;  4LG0 B;  3CQZ J;  1SFK A;  1B59 A;  1XSX A;  2P5K A;  4XLP F;  2M7B A;  2K9L A;  3OYJ A;  3B6C A;  2A61 A;  2UUZ A;  2CGP A;  1RKW A;  2DMU A;  1AKH B;  1FTT A;  2KJC A;  2GZW A;  1EKE A;  4IPA A;  1W5T A;  3ESW B;  4DYC A;  2X4H A;  4HLX A;  4QWQ A;  2DFI A;  4KYW A;  2D2W A;  2L4M A;  2KQR A;  4LOC A;  3TOA A;  1MIJ A;  5KVR A;  4EM0 B;  4Y7N J;  1Y1W J;  1Z7U A;  2XB5 A;  1FSH A;  3GEZ A;  2ZFU A;  3OWT A;  4RLF A;  4JYK A;  2P5L C;  1FP1 D;  3CJR B;  2W00 A;  2NYX A;  5DYM A;  4B3X A;  2HPM A;  2H1K A;  1LDD A;  1IRZ A;  1QVU A;  1NK2 P;  3T8R A;  2JA7 J;  1FBS A;  1MH3 A;  4JP0 A;  2AXL A;  2BHY A;  2OV7 A;  2YS9 A;  4B09 A;  1RR7 A;  4ZZD A;  5E18 F;  2ZJ2 A;  1ETK A;  5F1J A;  3M4O J;  3PUF A;  3HDD A;  2IGN A;  4JX4 A;  2M45 A;  3F3X A;  1ETV A;  2DFF A;  3WG7 H;  3H9G A;  1OR7 C;  5BS6 A;  2W4S A;  4NC8 A;  3ASO H;  2LNB A;  1USS A;  4UUS A;  1VQM I;  3S2D J;  1T0F A;  1SVM A;  3L1P A;  3L09 A;  4WX9 A;  2ZCW A;  4HA8 A;  3Q9V A;  3I4M J;  5EYR A;  5ED4 A;  2GXB A;  1Z3X A;  1ZTR A;  2DI3 A;  4RB1 A;  1TWA J;  1TP4 A;  3ZXS A;  3PNY A;  4A6E A;  2XAS A;  2R3S A;  3ZQH A;  2DA3 A;  1RNL A;  3KEQ A;  2PMZ N;  3DTK A;  4L5E A;  4E7S A;  3K6G A;  1AKH A;  1ZAR A;  3PL8 A;  5HOD A;  5F08 A;  5GAG J;  1OCC H;  5EG0 B;  1ETX A;  1K79 A;  5ICF A;  3GTK J;  1RUN A;  4IF4 A;  3OY9 A;  2O0Y A;  4BQO A;  1CF7 B;  1T6S A;  2DMP A;  3ABM H;  3LSK A;  2H09 A;  1Z21 A;  1U3E M;  1K4T A;  3VPR A;  5JHF A;  2FBK A;  3K7A J;  5JHU A;  1OIS A;  3I9V 2;  4GYG A;  2BBY A;  2ZKZ A;  2BY0 A;  4YEL A;  1I27 A;  1FOW A;  1H9T A;  3OYK A;  2FQ3 A;  2A5Y B;  1ULY A;  2V6C A;  4GCV A;  2CV2 A;  4HLY A;  2JN6 A;  3BY6 A;  2M4K A;  4OIP F;  2M30 A;  3MKZ A;  1Q1H A;  5JFR A;  3TDZ C;  4G7Z F;  2QM3 A;  4J00 A;  2KIS A;  5EJC A;  2OD5 A;  2WY7 Q;  3MEX A;  5H6Q A;  1KON A;  4CYD A;  1O3T A;  2HU9 A;  3LQQ A;  3R0J A;  4I76 A;  5FD5 A;  5D4R A;  3QOP A;  2ZME C;  3SZP A;  3HM5 A;  1EF4 A;  3L2U A;  2DQL A;  2DA5 A;  2JA6 J;  4LGW A;  3S2H J;  3K4B A;  3L9F A;  3TO9 A;  2DK5 A;  1WGX A;  5E79 C;  1J75 A;  1BI3 A;  2KDO A;  3K4L A;  5EG0 A;  2Z1D A;  4EM2 A;  4H0E A;  1AOY A;  2N8G A;  4BGD A;  2RVC A;  4JOM A;  4BJ5 C;  2AQE A;  1CF7 A;  4LLN A;  3KYL A;  2HI3 A;  3J81 Z;  1N78 A;  2DAO A;  4P9U A;  3BG7 A;  2EH3 A;  3DFG A;  1LE8 A;  1S3J A;  5D5V B;  4XKB A;  3HOX J;  1X19 A;  2LTP A;  4KIG A;  2VC1 A;  5BPD A;  2M0C A;  2ECC A;  2WV0 A;  2LKP A;  2GXA A;  2ZJR F;  1IC8 A;  2NVT J;  4EMS A;  1BR4 A;  3IHU A;  1FZP B;  4D7N A;  2H94 A;  4UV9 A;  2Z33 A;  1TQI A;  3CCV I;  1A31 A;  1ZK8 A;  2EZI A;  3GTP J;  3F6V A;  5HLG A;  2PN6 A;  1ZGJ A;  3C1D A;  3WG9 A;  2DOF A;  2Y30 A;  4V2G A;  2HYJ A;  4W97 A;  1TWH J;  2WY8 Q;  4BH9 A;  5BMZ A;  2KIU A;  3BOQ A;  5ILV A;  1MD0 A;  4LIV A;  4A3B J;  5CPR B;  3FBI B;  1UG2 A;  5J1U A;  4DYQ A;  1STZ A;  3H1C A;  3BJ6 A;  3QAH A;  3JAM Z;  3S15 J;  4PDK A;  2WA0 A;  2WV1 A;  4WCG A;  2ME6 A;  2X6X A;  3K4K A;  4CZZ A;  5DD8 A;  4UUV A;  3WTZ A;  3ECH A;  4CA0 A;  3KP7 A;  2OZU A;  3BTL A;  3CJT B;  5HLI A;  2OTJ I;  3I0T A;  3JRG A;  4BL0 B;  2KL4 A;  1YRN B;  1YQA A;  2XKP A;  4AWX B;  3CF5 F;  2FJ1 A;  2KIQ A;  4PZJ A;  1LFU P;  1BM9 A;  2IGO A;  3RDI A;  5E3M A;  1E17 A;  2HKO A;  4M6Y A;  4LLG F;  3BTJ A;  4Q4Z F;  2CV1 A;  2VPR A;  1JKR C;  4IXA A;  3HSF A;  4CUG A;  4XSX F;  4Y17 A;  2DPD A;  3RIR A;  4PFO A;  1SFU A;  2VON A;  1FMV A;  2Q0O A;  5H2F C;  2BW3 A;  3C18 A;  3BTI A;  3UNG C;  3HOW J;  4DNC A;  3M07 A;  3BG9 A;  1LQ1 A;  5F0H A;  1SVO A;  2V9V A;  2ZNY A;  4BXF A;  5DUK A;  3N4M A;  1Z67 A;  4HEA 2;  3G71 I;  1YX3 A;  2ELK A;  1X4P A;  3HL2 A;  3K4M A;  1WI3 A;  4UNO A;  2YUS A;  3WTX C;  1YO5 C;  3KEO A;  3IAM 2;  1RC9 A;  4CHU A;  2DJI A;  4PK4 A;  4CIC A;  3CCU I;  3ZP5 A;  1VQ8 I;  2JUG A;  2CV0 A;  4WXH A;  4XOR A;  3WE3 A;  2X1E A;  2X85 A;  1YS7 A;  3VWB A;  3GTQ J;  4A3G J;  3HB9 A;  3ZN1 A;  1W0T A;  4U0W A;  2NVY J;  1YRN A;  3UKG A;  3OYN A;  3PSI A;  1P9Q C;  3OR2 C;  1VQ4 I;  2QKM B;  4NHJ A;  3BCA A;  2GXG A;  2F4I A;  1IN4 A;  4PJ0 C;  3FIS A;  2VJI A;  3ZGK A;  2BVM A;  2W7N A;  3PFY A;  3NEU A;  2V7F A;  4E7Z A;  4G8X A;  1FOK A;  2KP6 A;  3V7S A;  5E1Z B;  2DXI A;  4C3H J;  2W25 A;  1FWZ A;  3ZMV A;  2WWY A;  3CD6 I;  1J0R A;  4M6X A;  3NAR A;  4IHX A;  3HRM A;  4Q5S F;  2CJJ A;  1Y6I A;  3G4S I;  1JT0 A;  1VQ6 I;  5J4V A;  4E7J A;  4OWR B;  3DV8 A;  4YII A;  4S05 A;  2Y69 H;  2F5F A;  3FXK A;  5CJ9 A;  5EDN A;  3KLN A;  3ZQ7 A;  4IX7 A;  5J40 A;  3VOD A;  2LLK A;  3JSO A;  4TV7 A;  3FWE A;  4XN3 A;  4IL6 C;  2R7D A;  5H20 A;  4KA4 A;  4MFD A;  2HXO A;  2KMU A;  2RQP A;  2R7W A;  2C6Y A;  1JI8 A;  1GXQ A;  1UAA A;  5E3O A;  4ZYE A;  3FXJ A;  4IOA F;  3K4C A;  1P7I A;  2KJB A;  3RQ4 A;  4D0P A;  5BOX A;  1TQP A;  2GOX B;  2OC6 A;  4AUX A;  4BHC A;  4KIB A;  3K4N A;  3W6V A;  2BXZ A;  3H3U A;  3S3O A;  4R8H A;  3WE2 A;  2Z3Y A;  3GTJ J;  3I64 A;  4YG2 F;  5BPI A;  2RDP A;  2M87 A;  5CKT A;  4IHV A;  4BDY A;  3TO7 A;  4UV8 A;  1JJ6 C;  4RGS A;  3OYF A;  1DP3 A;  1LFB A;  3HIF A;  3KYC B;  2MH2 A;  2XAQ A;  3NWT A;  1GLN A;  3CC7 I;  2JZY A;  3GO5 A;  5K7Z A;  5HDK A;  5D5W B;  3AG4 H;  2IGM A;  2LK2 A;  4BHP A;  4PJN A;  1X3W B;  3NWS A;  2FOW A;  4N4O B;  4J01 A;  2JPC A;  4E70 A;  4AIJ A;  3DWL E;  4HX8 A;  1YIO A;  2EFQ A;  4GFB A;  1R58 A;  2FNA A;  3QU3 A;  2FE3 A;  3J80 K;  1UHS A;  3RI4 A;  3FHN A;  1ZRD A;  2HYG D;  1JUP A;  2GIZ A;  4CZC A;  1RIO H;  1LUJ B;  3BQZ A;  2L5Q A;  5TIS C;  5FJ8 J;  2TCT A;  4H4K C;  1LDJ A;  3HSE A;  1D5V A;  1T56 A;  3LA2 A;  4UVC A;  4K2E A;  1JHF A;  2WB1 A;  3BR3 A;  3QPT A;  4L18 B;  2QEN A;  3PUB A;  3DCF A;  1X2N A;  2M0M A;  1XDS A;  3FXQ A;  2L9S A;  4CYC B;  3ERM A;  2VBW A;  2L9R A;  3C2G A;  4I2O A;  5CLS A;  1IGN A;  4IKF A;  1XX5 A;  2L7K A;  5E17 F;  1V55 H;  3KP3 A;  4X6A J;  5LRS A;  1QO0 D;  2CUF A;  3V8J A;  3X2Q H;  1N25 A;  2IBD A;  2QLZ A;  3CJQ B;  5ERI A;  1ZG5 A;  5IP6 A;  5HDG A;  2OCC H;  4HDV A;  1ZQ3 P;  4FTH A;  4UB8 C;  2EZL A;  4ESF A;  2O8X A;  4GYI A;  1FLI A;  4MQV A;  3EYI A;  1W1W E; 
#chains in the Genus database with same CATH homology
 2GQQ A;  1ZRE A;  3I4P A;  1YTY A;  2P6T A;  4ENK A;  4EJV A;  3PQJ A;  4HDU A;  3QPH A;  2BE5 F;  2DU9 A;  1UFM A;  2O03 A;  1SFX A;  4ENN A;  5L3F A;  3JAM K;  4GO1 A;  3T5X A;  1E2X A;  3LFK A;  2P8T A;  4G6D A;  1PDN C;  5BQT A;  3JTH A;  3DXJ F;  4IRG A;  4IHT A;  3CJN A;  4U0Y A;  4OU0 A;  3QU6 A;  1R1U A;  2A69 F;  1ZG1 A;  1U78 A;  2EB7 A;  1XGM A;  4RB3 C;  2BYV E;  3Q9S A;  1QPM A;  3TDU C;  4ENM A;  1XGN A;  5EEG A;  3T8T A;  4M71 A;  2LSO A;  1IF1 A;  5FD6 A;  3SQN A;  2QZ8 A;  2PJP A;  1IXC A;  1AWC A;  3WU1 B;  2W24 A;  1FYL A;  5A2Q Z;  1IW7 F;  2YPR A;  1FY7 A;  1OPC A;  4I01 A;  3EDP A;  4ZYD A;  3BP8 A;  2FSW A;  1SMT A;  1TBX A;  5F64 A;  1GHC A;  5FFZ A;  1YW8 A;  3ZMT A;  2FRH A;  1B9N A;  2IPQ X;  2CYY A;  2P7V B;  4FHT A;  3OOP A;  3F8F A;  4M9Z A;  5ILS A;  3DQV C;  2NAZ A;  3SHF A;  4ASN A;  2W57 A;  5LGT A;  1YG2 A;  5FO5 A;  2QBY B;  2M1B A;  2ZNZ A;  4Q48 A;  1ZRC A;  2PFB A;  3COA C;  4BAY A;  2IT0 A;  4AIK A;  3E5U A;  5KK1 A;  5LGN A;  3I59 B;  2HQN A;  2K27 A;  3TOB A;  3E5X A;  3OV8 A;  4XBF A;  3SZT A;  1A04 A;  3MWM A;  4EGZ A;  2QVO A;  3ERE D;  2QQB A;  1FSE A;  4P5O A;  5LLQ A;  3CUO A;  4HX7 A;  5ICG A;  2L3D A;  5AIP A;  4LMY A;  4I7H A;  4KDP A;  2FBI A;  1BC7 C;  1FYK A;  3JSP A;  2QBY A;  1WQ2 A;  4HOB A;  4L9T A;  5E1X A;  1WKM A;  2JSC A;  3BWG A;  1HW2 A;  4HF1 A;  4KN4 X;  3GYH X;  3GFI A;  5TRD A;  1XCB A;  2UXX A;  3KP5 A;  3E3V A;  4S04 A;  2IVM A;  3I59 A;  4AIH A;  1SMY F;  2Z5U A;  3E6D A;  4P55 A;  1HW5 A;  3F23 A;  1MJB A;  3MFK A;  2L4A A;  3F8M A;  2Q2E A;  3M7G A;  1B6A A;  1O57 A;  1Z6R A;  1GVJ A;  1LJ9 A;  1XGS A;  1Y0U A;  2MBF A;  3RKW A;  2HS5 A;  4DQ2 A;  3LA3 A;  1PP7 U;  3DKW A;  3K1P A;  2VE8 A;  4MEY F;  5LBQ A;  1SD4 A;  5L3G A;  4LG0 A;  2FML A;  2PEX A;  1FP2 A;  3IWZ A;  3K0L A;  1I5Z A;  1G3Y A;  3P9K A;  4CGZ A;  1F1Z A;  3M1E A;  4Y15 A;  2VXZ A;  1LVA A;  2XUB A;  1HSJ A;  2WTE A;  1OMI A;  4G9Y A;  3L7W A;  1UCR A;  2EK5 A;  2QQA A;  3HUG A;  3J80 Z;  1IUY A;  4A6D A;  1W5S A;  4L9J A;  2K02 A;  1IRF A;  2HYF A;  2F5C A;  4AVP A;  4U88 A;  4R1H A;  2ISZ A;  5DV5 A;  5A2Q K;  1PUE E;  1UB9 A;  3E5Q A;  4HV6 A;  1FC3 A;  4MEX F;  1IXR C;  1HKQ A;  2J5O A;  2EA4 A;  4OIR F;  2XRO A;  3I54 A;  2XIG A;  4MNU A;  5K5Q A;  1U6G A;  1IN7 A;  3F8B A;  3NRV A;  4O5V A;  5E8G A;  2QWW A;  5DDG A;  6PAX A;  2ETH A;  4LD5 A;  3TKY A;  5H6R A;  3SFZ A;  3KET A;  4P9F A;  1QZZ A;  4LFU A;  3O6B B;  4RS8 A;  1BJA A;  3VFZ A;  2GA2 A;  2EFN A;  4MHG A;  2PMH A;  3I71 A;  3GZ6 A;  3ZMD A;  4OOI A;  4LLL A;  1WWX A;  1EH8 A;  2HGC A;  2IA2 A;  3AAF A;  1R36 A;  1XD7 A;  2KIF A;  3FF5 A;  1H9G A;  1TNS A;  1T39 A;  3N97 A;  1BBY A;  2B0L A;  2RNJ A;  4I02 A;  3DPL C;  3L2C A;  3CO6 C;  4PCQ A;  1R1V A;  1OYI A;  3R61 A;  3U9G A;  5HOO A;  3WTS C;  3GX4 X;  1DP7 P;  2HQR A;  3R60 A;  2TDX A;  1Z1D A;  3WGI A;  2H6B A;  1UHM A;  1TTY A;  4PGG A;  4KIF A;  3FXR A;  1MKM A;  1WSU A;  4P96 A;  2D1V A;  3FMS A;  4RGX A;  1S29 A;  1T98 A;  5K5R A;  3PQK A;  1UHW A;  4XLN F;  2GAU A;  3V8L A;  1XMK A;  2PQ8 A;  2YX4 A;  3H3Z A;  3LAJ A;  3M9A A;  5D5U B;  4KT5 C;  3MQ0 A;  3ROU A;  3W6J B;  2PLY A;  2VOP A;  2NNN A;  1XN7 A;  5D4S A;  3R4K A;  1V3F A;  2ZFW A;  2QYO A;  4OMZ A;  2ZBK A;  5IT9 K;  3U2R A;  2OQG A;  2OBP A;  1LEA A;  5LHI A;  2GWR A;  1L3L A;  4HYE A;  2FXA A;  5DUI A;  3F8N A;  1MGT A;  3HSR A;  2E1N A;  4HBL A;  3GF2 A;  2FBH A;  1HBX G;  4FX0 A;  4ZZL A;  1KU9 A;  3E6B A;  1QQI A;  3V4G A;  4MQ9 F;  2EA2 A;  4MTE A;  2UZK A;  3RYP A;  4FX4 A;  4GGG A;  2H27 A;  3V7R A;  4XRF A;  4O3M A;  3FM3 A;  3JTG A;  2ELH A;  2F2E A;  1W7P D;  3T0Y A;  1K7A A;  2M8E A;  3O3K A;  2XHK A;  1HST A;  4KNY A;  4LK1 F;  5DCM B;  2BV6 A;  1L0O C;  5K5O A;  5CVR A;  5F6F A;  3I58 A;  2K4B A;  2VBZ A;  3D0S A;  1EH6 A;  4KN7 X;  5TJJ A;  2K86 A;  4EJW A;  1KQ8 A;  1I1G A;  1MZB A;  1QGP A;  2UWM A;  1P4W A;  2LF7 A;  3BJA A;  3HHG A;  2EV6 A;  1D3Y A;  4BNC A;  1D8K A;  4I0A A;  2GA1 A;  3F72 A;  3HRU A;  1IZ1 A;  5J8C A;  1W7P B;  2LDU A;  4LK0 F;  1FYM A;  1R23 A;  2YSR A;  1YLF A;  5ICE A;  2F5E A;  2EJR A;  3HTS B;  3CO7 C;  3HOS A;  3GFL A;  5DCM A;  1U8R A;  5L3D A;  3EYY A;  1FBU A;  1HXD A;  3S2W A;  1TLH B;  4A12 A;  5DEQ A;  3WTY C;  4U0V A;  4PGH A;  1MDM B;  3RPU A;  3EQL F;  2L02 A;  3EET A;  5F1R A;  1P4X A;  1S8N A;  3G3Z A;  4IVN A;  2FNP A;  3FM5 A;  4A0Z A;  4KUM A;  3GLX A;  2MH9 A;  4MTD A;  4JK1 X;  3BPV A;  1BI1 A;  5D8K B;  4WWC A;  5HS9 A;  1W7P A;  1ZGA A;  2CG4 A;  4HAM A;  2HR3 A;  1JHH A;  4L9V A;  3J7A O;  4CDG A;  1KYZ A;  4I98 B;  4G94 A;  1WI9 A;  2Z99 A;  4QLC U;  4HF0 A;  2ZXJ A;  1UST A;  2G9W A;  2MLK A;  1MDM A;  4JBA A;  1YFH A;  3I53 A;  2IJL A;  4L9N A;  1SD6 A;  2IP2 A;  3H92 A;  2ADU A;  3V8K A;  3ZN0 A;  4UVB A;  5LEJ A;  4BXU A;  2VOO A;  3WGH A;  3IL2 A;  5HVQ C;  2CO5 A;  4IRI A;  3F8C A;  4HZF A;  4G7O F;  2V1X A;  5ILU A;  3K2Z A;  4I09 A;  4Y13 A;  4RGR A;  1OKR A;  1F9N A;  3IC7 A;  5E8I A;  1KU7 A;  2RKH A;  1YYV A;  2PG4 A;  2L54 A;  4EGY A;  3CUQ B;  5HDN A;  2J5P A;  2HEO A;  1RZ4 A;  3TO6 A;  3MZH A;  1ZLK A;  2V1D A;  4L5J A;  2HDC A;  1K6O A;  1I6X A;  3RJP A;  1KQ0 A;  1XGO A;  4HX4 A;  3ZMZ A;  2HZT A;  3ABT A;  1BI0 A;  4BQA A;  1OYY A;  2QQ9 A;  2ACJ A;  3KZY A;  3KP2 A;  2XKO A;  2OQR A;  3LAP A;  4M73 A;  4UXN A;  5D6F A;  3VB2 A;  3ZMS A;  3LA7 A;  3MAJ A;  3CUQ A;  3GXO A;  2F5D A;  2L01 A;  4EM1 A;  3ML6 A;  1RUO A;  4KMU X;  3BDD A;  2A3S A;  5L3E A;  5CVU A;  2E7X A;  1BOA A;  2IA1 A;  2K4J A;  2H6C A;  1U5T C;  2FF4 A;  3ISP A;  4G6Q A;  1U5T B;  1P92 A;  1Z05 A;  3E6M A;  1R5H A;  2XAF A;  3BRO A;  3IKT A;  4ON0 A;  3DP7 A;  3KE2 A;  1S6L A;  2NNY A;  1B9M A;  2IA0 A;  1LDK B;  5AON A;  3REO A;  4U7D A;  2A6E F;  1HW1 A;  1ZG3 A;  1ON1 A;  2FU4 A;  3GWZ A;  1T2K A;  1O7L A;  2ESH A;  3HRS A;  1XSD A;  1IN8 A;  5IT9 Z;  3B73 A;  3ZMU A;  3F22 A;  5JI6 A;  2UXN A;  1KGS A;  3G73 A;  1V4R A;  5CVV A;  1U5T A;  1Z6T A;  2AS5 F;  4WF2 A;  2KRF A;  4OMY A;  2OU2 A;  2E7W A;  4OIO F;  5LHG A;  5AIQ A;  2VBY A;  1ODD A;  3HRT A;  1H0M A;  1R5G A;  5D5X B;  4EJU A;  1YS6 A;  3K9T A;  1PP8 F;  2D1H A;  3TQN A;  3Q5F A;  5IT3 A;  1J59 A;  2W84 A;  2VBX A;  1TW2 A;  1F5T A;  2DT5 A;  1CGP A;  3HHH A;  5ICC A;  3PFI A;  2GIV A;  1DPR A;  3JW4 A;  2KIM A;  2Z9O A;  1ZLJ A;  3DF8 A;  2YR2 A;  4G7H F;  1YW9 A;  2DPU A;  4RAZ A;  3GFM A;  5D8L B;  4A2U A;  3IRQ A;  3W6K B;  1JE8 A;  1ZYR F;  2FA5 A;  1QBJ A;  1QNT A;  4YIF A;  1G3T A;  1R7J A;  3K69 A;  3BJO A;  1BN5 A;  1XDU A;  4YFK F;  2XGX A;  4M74 A;  3RKY A;  4KIC A;  2EFW A;  1OR7 A;  1FT9 A;  2CWE A;  4JQF A;  1ON2 A;  1TQM A;  3CDH A;  3VOE A;  2VOD A;  2HKX A;  4HQE A;  4O6J A;  2ZO4 A;  4NQW A;  2ZME B;  4M9X A;  5FGM A;  4ZYG A;  2D45 A;  1W4M A;  4UHT A;  5D6E A;  3RKX A;  5FB2 A;  4R79 A;  1SAX A;  1G6N A;  5FLX Z;  1KU3 A;  1FBQ A;  3KLO A;  1QZY A;  4Q47 A;  1LEB A;  2G7U A;  4EQQ A;  4FT8 A;  4KFC A;  4N9I A;  5E20 A;  3FMQ A;  3GFJ A;  3F6O A;  3VEP A;  5LGU A;  1J7K A;  3TGN A;  1IRG A;  3KZZ A;  1J5Y A;  5HLH A;  3C3W A;  4HV5 A;  3HOT A;  2ZME A;  5CYV A;  2DO7 A;  1BI2 A;  2PBI A;  3QP5 A;  2RC4 A;  1S7A A;  2P4W A;  2W85 A;  4RAY A;  1FNN A;  1O3Q A;  2COM A;  4U7B A;  2NS0 A;  4ESJ A;  4A5M A;  5LRR A;  2E1C A;  3MZY A;  1G4D A;  3WOD F;  2VE9 A;  3L00 A;  3LST A;  3QRF F;  3QP6 A;  3WGG A;  4LJZ F;  2O61 A;  3BPX A;  3KCC A;  1I1S A;  4IJA A;  1NHA A;  2O6G E;  1IN5 A;  2O3F A;  3KP4 A;  3T1B A;  1R1T A;  2Y75 A;  2HWV A;  3CTA A;  2XAJ A;  2FEZ A;  3ZPL A;  1KU2 A;  1MJ9 A;  2IW5 A;  2JRT A;  4L5I A;  5EEH A;  3WTW C;  2EFP A;  1IN6 A;  4A0Y A;  5FFX A;  2WC2 A;  4LB5 A;  2DK8 A;  1VTN C;  3WTT C;  1LB2 A;  3V7C A;  3WU0 A;  1JGS A;  2XV4 S;  3ULQ B;  3NQO A;  2OAZ A;  2LF8 A;  3B02 A;  1DPU A;  3D5L A;  2FMY A;  2YU3 A;  3K1M A;  1BIA A;  2KKO A;  4MGR A;  1X3U A;  5L3B A;  1C0W A;  3FHZ A;  4UVA A;  3HYI A;  2A68 F;  4N9H A;  2NRA C;  4EJT A;  3E6C C;  1T38 A;  2EV0 A;  2BEO A;  3U1D A;  5JVT A;  1XB4 A;  2DBB A;  2PI0 A;  2XRN A;  2A6H F;  2K7L A;  1G3W A;  3R6S A;  1XSV A;  5J6X A;  3EUH A;  4OIQ F;  1EV7 A;  3IWF A;  2CFX A;  4EV0 A;  1IXS B;  1KA8 A;  1U2W A;  1P6R A;  4HQM A;  4RB0 A;  1BC8 C;  4RGU A;  1HKT A;  4XSZ F;  3SXY A;  1FPQ A;  2G7H A;  3ABU A;  1K78 B;  1EH7 A;  2STW A;  5JR3 A;  1Z9C A;  3M8E A;  3ECO A;  1ZH5 A;  1O3R A;  2X0L A;  2HTJ A;  4HW0 A;  1MJA A;  4N0B A;  5CVI A;  1ZRF A;  2RV8 A;  4WXD A;  3RYR A;  1HKS A;  1B1B A;  3R0A A;  4BHB A;  2JT1 A;  4L0Y B;  4NB5 A;  2CW0 F;  2MC3 A;  2VC0 A;  3IKV A;  3I5U A;  4YFN F;  2R7F A;  3LWF A;  3O2P E;  3F21 A;  1JXS A;  1YW7 A;  3GUD A;  3J81 K;  4BYY A;  2HOE A;  1S7O A;  5FLX K;  3ELK A;  3DPT A;  3P9C A;  4OIN F;  5HS7 A;  3WTV C;  1K78 A;  2V79 A;  1P2F A;  4M9S A;  1P4A A;  3WTU C;  4IRH A;  2RN7 A;  1IAW A;  1R00 A;  2DQR A;  5J8F A;  4IHS A;  4CXF A;  3CLO A;  1GXP A;  1DUX C;  1SFE A;  1ZN2 A;  4ZH4 F;  2IRF G;  1HQC A;  4LB6 B;  4A5N A;  2BGC A;  5HS8 A;  2HFH A;  2ISY A;  5DCF A;  3P7N A;  2MLG A;  5DD4 A;  4ZYH A;  1ZAO A;  2A07 F;  2P7C B;  2Y48 A;  1OYW A;  1REP C;  3FXU A;  1ZHF A;  5E1W A;  3M8F A;  4L0Z B;  3CUQ C;  2MA3 A;  2VN2 A;  1KQ9 A;  3KP6 A;  4ENJ A;  5LHH A;  5K1Y A;  1J2X A;  3KFW X;  4RB2 C;  1WRJ A;  1G3S A;  4YFX F;  4EVI A;  2EV5 A;  2Y0M A;  2EFO A;  3K1N A;  5LEK A;  2P5V A;  4KMF A;  3P9I A;  4HF2 A;  2V1U A;  2XAG A;  4M72 A;  1D8J A;  3FZV A;  3RPQ A;  5L3C A;  2FOK A;  2CQK A;  2M5W A;  4CO8 A;  1KYW A;  2OZ6 A;  4I0B A;  2PMU A;  4Z2Y A;  2RGV A;  1R22 A;  1SD5 A;  3GW2 A;  2HTS A;  4ESB A;  3BZ6 A;  3MCZ A;  2DTR A;  2VT2 A;  3IRR A;  1XCV A;  2XAH A;  2MD5 A;  1XMA A;  4F7Z A;  2QUF A;  2XVC A;  3LQR A;  1J9I A;  5CVJ A;  4B8X A;  4ETS A;  3GZ5 A;  3RTR A;  3E97 A;  2CSO A;  3FX3 A;  1B4A A;  4A0X A;  3GVA A;  2P6S A;  3DEU A;  1SD7 A;  2JTV A;  1ONV A;  1FX7 A;  1DDN A;  2STT A;  3HTU A;  1F4K A;  2DW4 A;  2YX7 A;  1RI7 A;  2Q8K A;  4WK8 F;  1Z91 A;  2EWN A;  3FMR A;  3C7J A;  2DLL A;  1TW3 A;  1O7F A;  2VT3 A;  2ESN A;  1LNW A;  4AD9 A;  2JPB A;  2OA4 A;  1TNT A;  4EJO A;  1BIB A;  4GXO A;  4WXC A;  1O3S A;  4LG0 B;  1B59 A;  1XSX A;  2P5K A;  4XLP F;  2A61 A;  2CGP A;  2KJC A;  2GZW A;  4IPA A;  1W5T A;  2X4H A;  4HLX A;  4QWQ A;  2DFI A;  4KYW A;  2D2W A;  2L4M A;  3TOA A;  5KVR A;  4EM0 B;  1Z7U A;  1FSH A;  3GEZ A;  2P5L C;  1FP1 D;  2NYX A;  5DYM A;  1LDD A;  3T8R A;  1FBS A;  5E18 F;  2AXL A;  4B09 A;  4ZZD A;  2ZJ2 A;  2M45 A;  3F3X A;  5BS6 A;  2LNB A;  1USS A;  1T0F A;  3L09 A;  4WX9 A;  2ZCW A;  4HA8 A;  3Q9V A;  5ED4 A;  2GXB A;  2DI3 A;  4RB1 A;  4A6E A;  2XAS A;  2R3S A;  1RNL A;  3KEQ A;  1ZAR A;  1K79 A;  5ICF A;  1RUN A;  4IF4 A;  2O0Y A;  1CF7 B;  1T6S A;  2H09 A;  1U3E M;  2FBK A;  5JHU A;  4GYG A;  2BBY A;  2ZKZ A;  1I27 A;  1H9T A;  2FQ3 A;  2A5Y B;  1ULY A;  2V6C A;  4GCV A;  4HLY A;  3BY6 A;  4OIP F;  2M30 A;  1Q1H A;  5JFR A;  4G7Z F;  3TDZ C;  2QM3 A;  2OD5 A;  3MEX A;  5H6Q A;  4CYD A;  1O3T A;  3LQQ A;  3R0J A;  5FD5 A;  5D4R A;  3QOP A;  3SZP A;  2DQL A;  4LGW A;  3L9F A;  3TO9 A;  2DK5 A;  1J75 A;  1BI3 A;  1AOY A;  4H0E A;  4EM2 A;  2RVC A;  1CF7 A;  4LLN A;  3J81 Z;  2DAO A;  4P9U A;  3DFG A;  1S3J A;  5D5V B;  4KIG A;  2VC1 A;  5BPD A;  2WV0 A;  2LKP A;  4EMS A;  3IHU A;  1FZP B;  2H94 A;  4UV9 A;  2Z33 A;  1TQI A;  3F6V A;  5HLG A;  2PN6 A;  1ZGJ A;  3C1D A;  3WG9 A;  4BH9 A;  5BMZ A;  2KIU A;  3BOQ A;  5ILV A;  1MD0 A;  1STZ A;  3BJ6 A;  3QAH A;  3JAM Z;  4PDK A;  4WCG A;  4CZZ A;  5DD8 A;  4UUV A;  3WTZ A;  3ECH A;  3KP7 A;  2OZU A;  5HLI A;  3I0T A;  1YQA A;  2XKP A;  4AWX B;  4PZJ A;  1BM9 A;  3RDI A;  1E17 A;  2HKO A;  4M6Y A;  4LLG F;  4Q4Z F;  4IXA A;  3HSF A;  4XSX F;  4Y17 A;  2DPD A;  3RIR A;  1SFU A;  2VON A;  2Q0O A;  3C18 A;  4DNC A;  1LQ1 A;  2V9V A;  2ZNY A;  5DUK A;  3N4M A;  4UNO A;  3WTX C;  1YO5 C;  3KEO A;  4CHU A;  4CIC A;  3ZP5 A;  4WXH A;  3WE3 A;  1YS7 A;  3ZN1 A;  4U0W A;  4NHJ A;  2GXG A;  1IN4 A;  3NEU A;  4G8X A;  1FOK A;  3V7S A;  5E1Z B;  2W25 A;  1FWZ A;  3ZMV A;  2WWY A;  1J0R A;  4M6X A;  3HRM A;  4Q5S F;  3DV8 A;  4YII A;  4S05 A;  2F5F A;  5CJ9 A;  3KLN A;  3ZQ7 A;  3VOD A;  3JSO A;  4TV7 A;  3FWE A;  2R7D A;  5H20 A;  4KA4 A;  2RQP A;  2C6Y A;  1GXQ A;  4ZYE A;  2KJB A;  4D0P A;  5BOX A;  1TQP A;  4BHC A;  4KIB A;  3H3U A;  4R8H A;  3WE2 A;  2Z3Y A;  3I64 A;  4YG2 F;  5BPI A;  2RDP A;  2M87 A;  3TO7 A;  4UV8 A;  4RGS A;  3HIF A;  2MH2 A;  2XAQ A;  2JZY A;  3GO5 A;  5HDK A;  5D5W B;  4BHP A;  2JPC A;  4E70 A;  4AIJ A;  4HX8 A;  1YIO A;  2EFQ A;  1R58 A;  2FNA A;  3QU3 A;  2FE3 A;  3J80 K;  3RI4 A;  1ZRD A;  2HYG D;  1RIO H;  1LDJ A;  3HSE A;  1D5V A;  3LA2 A;  4UVC A;  4K2E A;  1JHF A;  3QPT A;  4L18 B;  2QEN A;  1XDS A;  3FXQ A;  2VBW A;  4I2O A;  5CLS A;  5E17 F;  3KP3 A;  5LRS A;  1QO0 D;  3V8J A;  2QLZ A;  5ERI A;  1ZG5 A;  5HDG A;  4HDV A;  4ESF A;  2O8X A;  4GYI A;  1FLI A;  4MQV A;  3EYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...