2L01A

Solution nmr structure of protein bvu3908 from bacteroides vulgatus, northeast structural genomics consortium target bvr153
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'MKMLKEKAGALAGQIWEALNGTEGLTQKQIKKATKLKADKDFFLGLGWLLREDKVVTSEVEGEIFVKLVLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Solution NMR Structure of protein BVU3908 from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 19
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10771 DUF2582 Winged helix-turn-helix domain (DUF2582)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2l01A00
4CXFA 2XIGA 4M72A 2G7UA 3LAJA 3JW4A 2KRFA 1UB9A 2OZUA 2XRNA 4WXCA 3F3XA 2VOOA 1R36A 3V4GA 1LEBA 2ZMEA 2DU9A 4RB1A 4R1HA 2ZFWA 1T38A 5HS7A 3QP5A 4QWQA 2QVOA 1IN8A 2A3SA 3EYYA 4ESBA 1FC3A 5AIQA 1FOKA 3BJ6A 5A2QK 3FHZA 2P7CB 3TO6A 4N9HA 1J0RA 2EFWA 3WG9A 2P6SA 1KGSA 1TNSA 1U78A 1B4AA 4LJZF 3GFMA 4EMSA 3QU6A 3I53A 4WK8F 1F1ZA 3H3UA 4ZYDA 3L00A 5L3EA 3GFJA 3LAPA 3FZVA 1O3RA 5F6FA 1WWXA 1KYZA 4HBLA 4I7HA 1JHFA 5LHGA 2M8EA 4LG0A 1QPMA 3SXYA 3T5XA 1FX7A 4RGXA 1C0WA 3KP5A 1AWCA 2CGPA 1TBXA 4ENKA 1DPUA 1Z6RA 1RZ4A 5FLXZ 3FF5A 2EB7A 1A04A 3Q9SA 1O57A 1T39A 3MEXA 1SMTA 5D5VB 1T0FA 3WGIA 1SAXA 5A2QZ 4A5NA 2XAQA 4HDUA 1QZZA 4ZZLA 2EFNA 1TQIA 4CYDA 1WQ2A 2VC0A 3ZMUA 3GXOA 3J80K 5DCMB 2BBYA 1AOYA 4U0VA 1RIOH 3I58A 3V8KA 2PJPA 1FP1D 3HSRA 2ISYA 3TGNA 1RUOA 5ICGA 4N9IA 3LA7A 2HTSA 3M8FA 2FOKA 4DQ2A 1W5SA 5LGNA 2CW0F 3G3ZA 2EK5A 4RB0A 3LQRA 4A0ZA 4PGGA 1KA8A 3BDDA 5D5UB 1ZHFA 4HAMA 3OOPA 4HV6A 3EDPA 4LK0F 2FSWA 2NS0A 2UWMA 1SD5A 5BS6A 2DK8A 2PG4A 1HW5A 5D6EA 2O8XA 3D0SA 2L4MA 3LWFA 4P9UA 4HDVA 2DQRA 5ILVA 4O5VA 4I0BA 3L7WA 1K7AA 3BJAA 5CVRA 2A6HF 3B02A 5F1RA 1PP7U 2VBZA 2QLZA 5L3GA 2VONA 2R3SA 2IW5A 2UZKA 1YTYA 4H0EA 3IKTA 4YIIA 1P2FA 3R6SA 3DPTA 2ZNZA 2NNNA 1XCBA 3IWZA 2V1UA 2XGXA 5BPDA 2O0YA 4A12A 1B6AA 1H9TA 3EQLF 2V1XA 1R23A 4KNYA 1UFMA 4I02A 3ZMZA 3E5UA 2NAZA 3MCZA 4G8XA 2HQRA 1XB4A 3BOQA 2Q2EA 1BJAA 5L3CA 1BI3A 3VB2A 5TJJA 1LJ9A 5LLQA 5J8FA 5BMZA 3J7AO 2YX7A 4TV7A 4K2EA 3TOAA 2MLGA 3RPUA 2K7LA 4WXDA 4XRFA 2IRFG 1IW7F 2QM3A 2XAHA 4Z2YA 5DD8A 3HRTA 3DP7A 1R1TA 4R8HA 4HF1A 3F6VA 1S7OA 1ZG1A 5DD4A 1S3JA 3RYPA 2P5VA 4EJOA 3I59A 2P8TA 2LNBA 5BOXA 1I5ZA 4AIHA 2PQ8A 1KQ8A 1EH7A 1F9NA 3BZ6A 3WTXC 3W6KB 2MBFA 2FBKA 5K1YA 3T1BA 1XGMA 1QNTA 4KYWA 4Q5SF 1MKMA 1CF7A 4WF2A 3GEZA 4CGZA 2A68F 5D8KB 2ZO4A 2ZMEB 4UV9A 1DUXC 1STZA 4KUMA 1OR7A 4U0YA 3QU3A 4M74A 4OOIA 1K78A 1ZN2A 3SZPA 3SZTA 3NEUA 3ELKA 3K1PA 4EJVA 3RI4A 4RS8A 1YS6A 1MJAA 2HOEA 2JT1A 3IC7A 1V4RA 2LDUA 1J9IA 4M71A 1O3QA 5EEHA 5E1WA 2RC4A 2NRAC 2UXNA 2E7XA 3JAMZ 5ICEA 2O03A 2FF4A 3K1NA 4AVPA 5ERIA 4G6QA 3CUQA 2PFBA 4YFKF 1MD0A 5IT3A 1H9GA 2CQKA 5EEGA 4EGZA 2MA3A 2CG4A 4LG0B 4U7DA 2ETHA 3HUGA 1T2KA 3V7SA 4RB2C 4HZFA 3IHUA 1E17A 1BI2A 2DPUA 2GXGA 3JSOA 2EA2A 1HKQA 5CJ9A 2F5CA 3ZQ7A 3HYIA 1XMAA 2K4BA 2MC3A 1W5TA 1XGOA 1OYYA 1SD4A 4UVAA 1XGNA 4GYIA 4ASNA 1R00A 1Z1DA 3F8NA 4PGHA 4XBFA 1TLHB 3ISPA 4ZYGA 3WTUC 4ENNA 4G7OF 1G6NA 2XVCA 4AWXB 2ACJA 1OYWA 4IJAA 4UUVA 3BPXA 1IN4A 3KP6A 1TQMA 3ERED 3IKVA 2EV5A 1BIBA 2V6CA 1VTNC 1BIAA 1KYWA 1FNNA 1TNTA 3H92A 4IRIA 3T8RA 1V3FA 4IPAA 2QQAA 6PAXA 4MEXF 2GAUA 5D5WB 3KP2A 2IVMA 2A61A 4A6DA 1G4DA 1B9MA 3QAHA 2HTJA 2K86A 2EV6A 2KIFA 1R58A 2O6GE 4EVIA 3KP3A 3KCCA 4BYYA 5E8IA 1XD7A 3MWMA 5E18F 5LBQA 1G3TA 1HKTA 2H6BA 3R60A 5E17F 2CFXA 3F22A 4IHTA 3I0TA 4YG2F 1I1SA 2OQGA 3F72A 2EWNA 4QLCU 2VODA 5FD6A 2HFHA 2DQLA 5D6FA 2V9VA 2VT2A 4KDPA 2ZJ2A 2F2EA 3HSEA 1HSTA 2TDXA 4L9JA 5HLHA 3LA3A 3C1DA 1HXDA 2WTEA 5HDKA 4KICA 4IRHA 1ZREA 1H0MA 3M9AA 1MJBA 5CYVA 3O2PE 1IN7A 4AIJA 2FU4A 4LFUA 4Y15A 3SFZA 2K4JA 2XV4S 1IXCA 4KFCA 4IRGA 2YPRA 3E3VA 2ZBKA 4PDKA 3COAC 4A5MA 3P9KA 2RV8A 3SQNA 4ZYHA 4OIPF 2VBWA 3WTZA 3REOA 3GFIA 5E1XA 2BE5F 1XSVA 3GFLA 2BV6A 2DT5A 4OIRF 3KZYA 3RKXA 3N4MA 2GIVA 2PMHA 2ELHA 3VFZA 5ICCA 1SD6A 4KIBA 2KKOA 4OMZA 2XROA 2DO7A 2DI3A 2XHKA 4P5OA 3I59B 5CVUA 4L9VA 4HW0A 1YW9A 4KMUX 2MH2A 4RB3C 1S8NA 3KEOA 4EM1A 4LK1F 3AAFA 1BC8C 3ZMTA 2STTA 3RDIA 4F7ZA 5K5RA 2YR2A 4M6XA 1IUYA 3ZMSA 3GO5A 4L5IA 2HKXA 2MD5A 2RNJA 3HHHA 2P6TA 5CVJA 1OYIA 1CF7B 1P92A 1KQ0A 2EV0A 2PEXA 2ZXJA 1XGSA 4MTDA 4BNCA 3KEQA 1LDDA 2W25A 2QUFA 1TTYA 2ZKZA 3KP7A 5JI6A 3D5LA 4CZZA 3RTRA 2F5FA 4GCVA 4GYGA 1ZH5A 2P4WA 4FT8A 4G7HF 2QZ8A 2E7WA 1K78B 1R1VA 1I6XA 2HKOA 4RGRA 2VT3A 2DBBA 2FXAA 4M6YA 5BPIA 3RKWA 3CUQC 1KU3A 2IT0A 3J81K 1WI9A 4OIQF 1KU9A 3BJOA 1E2XA 5E1ZB 3L9FA 1YQAA 1KU2A 1J59A 1T98A 1RI7A 2OZ6A 1YFHA 4IHSA 2EFPA 4ON0A 3V7CA 1K6OA 4WWCA 3BWGA 2RN7A 4KIFA 4O6JA 1IRFA 2MLKA 5H6RA 3CUQB 5DDGA 4GGGA 4L0ZB 3C18A 2RDPA 4BH9A 3FMQA 1O7LA 1FSHA 1NHAA 1GXQA 4M73A 1BI1A 2A5YB 2FQ3A 2OU2A 3W6JB 3J80Z 1QZYA 2GA1A 2EJRA 3G73A 1BM9A 3GYHX 1MGTA 2CO5A 5IT9K 3TDZC 2GXBA 2QYOA 1QO0D 4RGSA 1U5TA 1JGSA 4D0PA 1F5TA 3O3KA 4LGWA 4HX7A 1RUNA 1GXPA 3KLNA 4HQEA 2ZNYA 3BROA 5D5XB 2OAZA 4RAYA 4P96A 1PDNC 1FLIA 1TQPA 3L2CA 4KA4A 2Z5UA 4WX9A 5HLIA 2VBYA 4L18B 2HEOA 2E1NA 3HSFA 1KU7A 2YSRA 2H6CA 5AONA 4ENJA 1ZRDA 3PQKA 1HW2A 1IN5A 4E70A 2Z33A 2VN2A 3CO7C 5LRRA 1EH8A 3WU1B 5D4SA 5DUIA 2DAOA 4I0AA 1J75A 3QRFF 1ZG3A 3F6OA 4RGUA 2FNPA 4EM0B 2YU3A 1ZGJA 4JK1X 3DPLC 3VODA 3T8TA 4MTEA 3HIFA 1SMYF 4HX4A 1R7JA 3WODF 1FY7A 2IA0A 2VXZA 1ZG5A 1XDUA 3WTSC 5LHIA 1YO5C 1P6RA 3KE2A 2FRHA 1ZLKA 4CICA 1EV7A 2W57A 1Z9CA 1QQIA 1IXRC 2XUBA 4Q47A 3ULQB 3C7JA 1YW8A 2KIMA 2OQRA 1W7PA 3VOEA 4DNCA 3HTSB 2NNYA 2JSCA 3E5XA 3GX4X 3KZZA 2D45A 2OD5A 4BHBA 3MFKA 2EFQA 4FHTA 3FMSA 3HOSA 3R4KA 2AXLA 3JTGA 4MNUA 2QQBA 3K0LA 4P9FA 4I2OA 2HWVA 5LEJA 3CTAA 4NHJA 5F64A 5ED4A 2XAFA 2L3DA 3VEPA 1R22A 3DF8A 3WTYC 5HS9A 1FBQA 3GVAA 1GVJA 2L02A 5HLGA 2PI0A 3R0AA 2VE8A 3F8MA 3FM5A 4G94A 4KN7X 3KETA 1X3UA 2X4HA 3DQVC 1OKRA 1FYMA 2DTRA 4O3MA 3K69A 5FB2A 3WTVC 4KMFA 2R7FA 2ESHA 3U1DA 3R61A 3QPTA 1YG2A 3MQ0A 1SFXA 3RYRA 1P4AA 1CGPA 1JXSA 2Z3YA 4CDGA 3HRMA 1JE8A 4U0WA 4EJUA 1YS7A 2LSOA 3KFWX 4Q48A 2FEZA 1WSUA 1BC7C 3E6CC 2FBIA 4AD9A 3ZN0A 3B73A 1S6LA 2MH9A 3DXJF 4XLPF 5LRSA 2JRTA 2QENA 2Y0MA 1B59A 1FWZA 1USSA 1FPQA 3CLOA 2P7VB 4JQFA 2OA4A 2DPDA 3GUDA 1IAWA 1L3LA 4HX8A 3BP8A 1OPCA 1SD7A 5HS8A 4EV0A 3FMRA 3K1MA 1U5TC 4MEYF 3LQQA 4EJWA 2IP2A 5LGTA 2XKOA 2EFOA 1FP2A 4EGYA 1BOAA 2FE3A 2P5LC 3U2RA 3WGGA 2GZWA 4BHPA 3GZ5A 4LD5A 5FFXA 5KVRA 1Z7UA 1PP8F 1R5HA 2PMUA 1ONVA 3OV8A 3T0YA 4ESJA 1LVAA 3L09A 5LHHA 2Y75A 3O6BB 1MDMA 1U5TB 4XSZF 4NQWA 2FMLA 1WRJA 2GWRA 4ETSA 1S29A 2QWWA 2GQQA 3QOPA 3WE3A 1TW3A 4S04A 1ZRCA 4FX0A 2QBYA 5TRDA 2H94A 1BN5A 5CVVA 3TKYA 2P5KA 4HOBA 4L9NA 4ZZDA 1DPRA 1ZRFA 1B9NA 5ICFA 3P9CA 1DP7P 3IRQA 3CO6C 2ESNA 3I64A 1W4MA 4RAZA 4U88A 3DKWA 3Q5FA 3E6BA 2ADUA 4EQQA 5FLXK 3BY6A 5L3DA 2LKPA 2YX4A 1ON2A 3Q9VA 5K5OA 3FWEA 2LF7A 1U3EM 4I98B 4ZYEA 3LA2A 1EH6A 5FO5A 2V79A 1G3YA 4ZH4F 5L3FA 5D4RA 1UHWA 1O3TA 5FFZA 2IA1A 3HRSA 4YFNF 1SFEA 3GZ6A 3SHFA 3ZMVA 1XDSA 3C3WA 4UXNA 4MGRA 1MZBA 4HYEA 2COMA 5E8GA 2Q8KA 3F8FA 4BAYA 1REPC 2DW4A 1IN6A 3EETA 2CSOA 3ZPLA 2RKHA 5J8CA 3FXRA 1D5VA 5JR3A 1P4WA 4HQMA 1D8KA 4L5JA 1Q1HA 1I1GA 1WKMA 2M30A 2OBPA 1DDNA 4A2UA 1HBXG 5ILSA 3WE2A 1I27A 3F23A 1Z05A 2HDCA 1FYLA 1W7PB 3I71A 2PN6A 4MQVA 3R0JA 2DLLA 3HRUA 2UXXA 3WGHA 4G7ZF 5HDNA 3RJPA 4GO1A 2VC1A 2VOPA 3HOTA 2J5PA 3ABTA 5LGUA 4M9SA 2O3FA 2AS5F 1HQCA 2L4AA 4M9ZA 4YFXF 5JFRA 3ROUA 3V8JA 1JHHA 4HA8A 1Z91A 1QGPA 3P7NA 2JZYA 2L01A 1ZAOA 5BQTA 1R1UA 1LB2A 4LLLA 5DV5A 1U6GA 4L0YB 1XCVA 2WV0A 2JPCA 3CDHA 4UV8A 4LMYA 3P9IA 5D8LB 1KQ9A 1ZLJA 2ZCWA 2M1BA 1YYVA 2O61A 3EUHA 2A69F 5H6QA 2ISZA 1HW1A 5K5QA 2A6EF 3S2WA 4OINF 2HS5A 2W24A 1D3YA 2FMYA 2Z9OA 3LSTA 4HLXA 2QQ9A 2BEOA 2RGVA 2J5OA 3J81Z 2HYGD 4S05A 5JVTA 4N0BA 2FBHA 2A07F 2L54A 1OMIA 2B0LA 4KN4X 3I4PA 5ILUA 1K79A 4G6DA 4M9XA 2KJBA 3PFIA 3U9GA 2K02A 2IJLA 3F8CA 3GWZA 2JPBA 4OMYA 1XSXA 2BYVE 5CLSA 2M5WA 5KK1A 2M87A 2W84A 3WU0A 4HV5A 1LQ1A 3NQOA 1FZPB 3FM3A 2E1CA 3RIRA 1FT9A 3E97A 1U2WA 1RNLA 4OIOF 4KIGA 2KJCA 5DUKA 3ZN1A 1T6SA 2D1VA 4I09A 2D2WA 3ZMDA 1ON1A 3FXUA 3GLXA 2PBIA 3I54A 5DYMA 4R79A 4UNOA 5LEKA 5E20A 5IT9Z 4Y13A 2CWEA 5HDGA 2RQPA 3F8BA 4BXUA 2G7HA 2PLYA 2V1DA 2K27A 2FNAA 4XSXF 3TO9A 1YW7A 3ML6A 3E6DA 2M45A 2F5EA 3GW2A 2XAJA 1IF1A 3F21A 2F5DA 1FYKA 1USTA 4CHUA 1MDMB 1LEAA 4A0YA 3PQJA 1G3WA 1TW2A 1J2XA 2HQNA 4PCQA 3WTTC 1J7KA 3KLOA 3QP6A 2WC2A 3JAMK 2QBYB 3JSPA 5H20A 1ODDA 2EA4A 1J5YA 2DK5A 3QPHA 3RKYA 4I01A 2HZTA 1Z6TA 3MZYA 3DFGA 5FD5A 3V8LA 3M1EA 3N97A 3LFKA 3IRRA 1IZ1A 4U7BA 2STWA 3ECOA 2VE9A 2Z99A 2Y48A 4IXAA 2XKPA 1R5GA 5HVQC 1F4KA 1P4XA 3K2ZA 4LB6B 3KP4A 4BHCA 5DCMA 4LLNA 1LDJA 1HKSA 4GXOA 1ZGAA 2HYFA 3CUOA 5FGMA 4HF2A 1LDKB 5DEQA 3ABUA 1BI0A 5L3BA 5AIPA 4Q4ZF 3V7RA 1ZARA 4P55A 3K9TA 3I5UA 1IRGA 2FA5A 1D8JA 3FXQA 2X0LA 3IL2A 3TOBA 1W7PD 1S7AA 4L9TA 1SFUA 4OU0A 4B09A 5CVIA 4ESFA 2WWYA 4NB5A 3TO7A 3RPQA 3TQNA 1XMKA 4G9YA 1XSDA 3JTHA 1Y0UA 3FX3A 2H09A 3HTUA 2LF8A 2RVCA 2NYXA 4IVNA 4XLNF 4A0XA 2IA2A 3MAJA 4UVBA 4A6EA 2JTVA 1B1BA 1MJ9A 3DEUA 2HGCA 1FBUA 3GF2A 2XAGA 2R7DA 4CO8A 3IWFA 1ZYRF 2W85A 1YLFA 3TDUC 1FSEA 2BGCA 4IF4A 4FX4A 4AIKA 2C6YA 5HOOA 3ZP5A 3EYIA 1LNWA 2G9WA 5J6XA 4YIFA 5DCFA 3M8EA 1GHCA 1ULYA 3WTWC 3NRVA 4HLYA 4PZJA 2KIUA 1UHMA 1G3SA 2CYYA 4UVCA 2DFIA 1QBJA 2GA2A 4MQ9F 2D1HA 1PUEE 4ENMA 4EJTA 1YIOA 1UCRA 4Y17A 1L0OC 4LLGF 3BPVA 1IXSB 2VBXA 1U8RA 1FBSA 3ECHA 4JBAA 1BBYA 5JHUA 4MHGA 2H27A 4WCGA 3DV8A 4B8XA 3MZHA 4WXHA 3HHGA 1O3SA 2HR3A 1O7FA 4HF0A 3CJNA 2IPQX 4EM2A 1HSJA 4LB5A 4BQAA 3M7GA 1XN7A 3E5QA 4UHTA 2Q0OA 3E6MA 4KT5C 3H3ZA 2XASA
chains in the Genus database with same CATH superfamily
1W1WE 2BY2A 4CXFA 2XIGA 4M72A 1OCRH 1VF9A 2ECCA 2G7UA 3LAJA 4BACA 1QA6A 4Z6YA 1S72I 3JW4A 2KRFA 1UB9A 2OZUA 2XRNA 4AYBN 4F55A 3IAS2 1MH4A 4WXCA 3F3XA 2VOOA 2XB0X 4XLCA 5C3EJ 1R36A 3V4GA 2HI3A 2LY1A 1LEBA 2E5NA 2ZMEA 2DU9A 2VXDA 4RB1A 4BJ6C 2HNHA 3W2WA 4R1HA 2H8WA 2ZFWA 2L7ZA 2OPTA 1T38A 2GOXB 2X9DA 1TP4A 4M6VA 5HS7A 2R7ZJ 1Y8QB 1Z77A 3NWSA 4JX4A 5CQGA 3PSIA 3GTKJ 2W00A 3K6GA 3QP5A 4QWQA 2QVOA 4KISA 4HSRA 4IQ4A 2M4GA 3BT9A 2PX9A 3CF2A 1IN8A 2A3SA 3EYYA 4ESBA 1FC3A 1YIJI 4E7IA 2FX0A 3LSHA 3GTGJ 5AIQA 1FOKA 3BJ6A 5A2QK 2R7SA 3RSNA 3FHZA 2P7CB 4B44A 5FRMA 3TO6A 3S14J 4N9HA 1J0RA 2EFWA 5LD2C 1GLNA 4A3KJ 4UUTA 3A2KA 1QVTA 3WG9A 1NH3A 2IS2A 2P6SA 1YJNI 1KGSA 2R7RA 3RQIA 1Q1VA 4NDLA 1TNSA 1U78A 1B4AA 2R7UA 4LJZF 3GFMA 2DDAA 4EMSA 3QU6A 4FASD 3I53A 3DU6A 4WK8F 1F1ZA 2FD5A 3H3UA 5K7HA 4ZYDA 1NK2P 3H3VK 3CP2A 2EIKH 3L00A 3OS0A 1VNDA 1WVRA 5L3EA 1R71A 2DA5A 5J1RA 1VQ9I 3GFJA 3LAPA 3FZVA 2JA5J 1FJLA 1O3RA 5F6FA 1WWXA 2BY0A 3A01A 1KYZA 4HBLA 3PL8A 5E3MA 1MNMC 2XC7A 4I7HA 5J47A 1JHFA 4XK4A 5LHGA 1HF0A 3I9V2 2XB5A 4JX5A 2M8EA 4LG0A 2VPLA 1QPMA 1YE9A 3JREA 1RR8C 1DP3A 3UNGC 2R7WA 4NNJA 3SXYA 4D7MA 1JI8A 3T5XA 1FX7A 4RGXA 1IUFA 1C0WA 4BEHB 3KP5A 4IQJA 1AWCA 2CGPA 3VPRA 1TBXA 5GAEJ 4ENKA 4Y7NJ 5IPAA 1DPUA 1RZ4A 1Z6RA 2GIZA 5GPCA 5FLXZ 3FF5A 2EB7A 1A04A 1JTXA 3BG6A 3Q9SA 1N25A 1O57A 1T39A 3MEXA 1VZ0A 1SMTA 4CCKA 3G1LA 1WPKA 5D5VB 1HDPA 2L2OA 1T0FA 3WGIA 1SAXA 5A2QZ 4A5NA 3BZKA 2XAQA 4J01A 1IRXA 1VI0A 2VL8A 4HDUA 1QZZA 4DBRA 4H4KC 4ZZLA 2EFNA 1TQIA 3M07A 1B8IB 2V9KA 4CYDA 3S32A 1WQ2A 3KYLA 1VQ7I 2QSGX 3ZRGA 2VC0A 2YU9J 3ZMUA 3GXOA 3DEWA 1QZEA 3J80K 5DCMB 2E60A 2KLOA 1ETXA 1ETYA 2BBYA 1AOYA 1ETQA 2ID3A 4U0VA 1RIOH 3I58A 3CJTB 4BXXJ 3S15J 3V8KA 2PJPA 3PM1A 1FP1D 2R7QA 3HSRA 2ISYA 1H8AC 2V6EA 3TGNA 1RUOA 1A5JA 5ICGA 5IP7J 2YS9A 4M3DA 2B9SA 4N9IA 3LA7A 2HTSA 3OL3A 3OS1A 3M8FA 2FOKA 4DQ2A 4BJ5C 1W5SA 5LGNA 1MMSA 3U21A 1BR1A 3ERMA 1XG1A 2CW0F 3G3ZA 2EK5A 4RB0A 3LQRA 4A0ZA 2M2EA 2ELKA 4PGGA 1KA8A 3EUKL 3BDDA 5D5UB 5IOYA 3AG3H 2AXTC 4JP0A 4HEA2 1ZHFA 4HAMA 3OOPA 2E1MC 4V2GA 4HV6A 3EDPA 4LK0F 4NBQA 2FSWA 2NS0A 1JKPC 3ABMH 1SD5A 2UWMA 5BS6A 2DK8A 2PG4A 1HW5A 5D6EA 2O8XA 1XS9A 4F91B 3CCLI 3TL4X 2XDVA 2L4MA 3D0SA 3LWFA 1SVLA 4P9UA 3LSJA 2DQRA 5B1BH 4HDVA 3HDDA 2RAEA 2EZKA 2L7FP 5ILVA 4O5VA 2KPMA 1FMVA 2KL4A 2OTJI 4I0BA 2EIMH 4RAGA 2BW3B 3L7WA 1EF4A 4BE1A 3IH4A 3BJAA 5CVRA 3W2VA 1K7AA 3S1NJ 2A6HF 3B02A 3Q0WA 5F1RA 2BHZA 4YEJA 1PP7U 2VBZA 2XF7A 3M3YJ 2QLZA 5L3GA 3S17J 2VONA 2R3SA 2R7VA 2E1MB 4G6TB 2IW5A 4LIVA 2UZKA 1YTYA 1FTTA 1BW6A 2MABA 1JUPA 3IKTA 4H0EA 3EUAA 5H2FC 1A6IA 4YIIA 3BTJA 1P2FA 2V1NA 3R6SA 1V54H 2JK3A 1FOWA 3DPTA 3DLLF 2ZNZA 5KCMA 3AKZA 2NNNA 2R93J 1XCBA 3IWZA 2ME6A 3JRDA 1N77A 2V1UA 2XGXA 5BPDA 2O0YA 4A12A 1B6AA 1H9TA 3EQLF 3JCUC 1YOVB 4NC6A 2V1XA 4IHXA 1R23A 4KNYA 4BQOA 3H35A 3CJQB 4A3MJ 1BA5A 2ECBA 4XR6A 3OY9A 3OYFA 1UFMA 4I02A 3H9GA 3ZMZA 3E5UA 3L2VA 3C2BA 2HYJA 3HOXJ 3BR0A 2NAZA 2WBMA 3MCZA 1AHDP 4G8XA 2HQRA 3AFHA 1XB4A 2VJIA 4FTHA 1SVMA 2Y30A 3BOQA 1VQ5I 2OUMA 4BQQA 5C44J 2Q2EA 1BJAA 5L3CA 1BI3A 3VB2A 5TJJA 1YX3A 1IGNA 1LJ9A 5LLQA 4E7SA 2KDZA 2X48A 3K4MA 2XPVA 1F43A 5J8FA 5BMZA 3J7AO 3JRIA 4B43A 1OCCH 3CC2I 2YX7A 4TV7A 4K2EA 3TOAA 2MLGA 3RPUA 4C2UA 2K7LA 1MNDA 2QSFX 2ZFUA 1ACIA 1HCRA 2F48A 4WXDA 4IOAF 1MIJA 3HPHA 2E36A 2HZDA 3K4CA 1IW7F 2XAHA 2GBYA 2EIJH 2QM3A 3FXLA 3HRTA 4XRFA 3D5RC 3DP7A 5DD8A 4Z2YA 1R1TA 3OYGA 2F5VA 3BG5A 4NUBA 4C2MJ 2H1LA 4R8HA 4CSWA 4HF1A 2DYSH 3F6VA 1S7OA 1ZG1A 2DA7A 5DD4A 4UB8C 4A3LJ 1S3JA 3RYPA 2P5VA 2CUEA 3VYRB 1QPIA 2O8KA 4X1EA 4EJOA 2DMNA 3I59A 4XL9A 1UHSA 2EZLA 1VQOI 2GLOA 2P8TA 3TBIA 1DU6A 2LNBA 5M5WJ 2NVUB 5BOXA 4CH7A 9ANTA 2FUG2 1I5ZA 2ZMEC 3I55I 1VQ4I 4AIHA 2PQ8A 4V2FA 1KQ8A 1EH7A 2A05A 1F9NA 4IX7A 1T8IA 3BZ6A 3Q0VA 2VPRA 4E4HA 3DCFA 3WTXC 3W6KB 2L9RA 2CUZA 2MSYA 2E71A 2MBFA 4ZDPA 3W2AA 2FBKA 5B1AH 5K1YA 3FIWA 3T1BA 3LL7A 1XGMA 4A3GJ 1QNTA 4KYWA 4Q5SF 1MKMA 1LUJB 1FTZA 1RR7A 1CF7A 3FK7A 4WF2A 4BE2A 2VKVA 2QQ8A 3GEZA 3JRCA 5F0HA 1N75A 1X3WB 4F92B 4CGZA 4D9JA 2A68F 1GV5A 3OYIA 2NOJB 2IGKA 5F04A 4D5CA 5D8KB 1WJEA 2ZO4A 2ZMEB 3OYMA 2IS4A 2CRGA 4UV9A 5EF6A 1DUXC 2K3PA 3CCUI 3CC4I 2HQAA 1STZA 1A6QA 4KUMA 2XPUA 1W5CC 1OR7A 1E0EA 1J09A 4U0YA 3G6EI 2ZXIA 3QU3A 4M74A 4OOIA 1K78A 1ZN2A 3SZPA 3SZTA 3NEUA 4PSWA 4C30A 3ELKA 3K1PA 4EJVA 2H8RA 2FQ4A 4N4OB 4RS8A 1YS6A 2Z2SB 3RI4A 1MJAA 4IHWA 2HOEA 1XX5A 2X6XA 3HB9A 2JT1A 3FXKA 3IC7A 1V4RA 3E1SA 2LDUA 2K9QA 3MKLA 2JA8J 4QIWN 2VI6A 1J9IA 4M71A 1O3QA 3CESA 5EEHA 1FOXA 3U1KA 5E1WA 1B72A 2RC4A 2NRAC 2VJJA 4M3EA 2UXNA 3BC8A 2E7XA 3JAMZ 1SFKA 4C9YA 2BY3A 5FLMJ 3OYNA 5ICEA 2IGMA 5CQEA 4XN3A 3PUBA 2O03A 3A01B 2FF4A 3K1NA 5GP9A 4AVPA 5ERIA 5IY5H 2LMDA 3RCOA 3RZDJ 1JJ6C 3VYSB 2DOEA 4G6QA 3CUQA 2PFBA 4YFKF 1MD0A 5IT3A 1H9GA 1T0FC 2CQKA 2WY8Q 5EEGA 1PVEA 2F4OB 4EGZA 2MA3A 4D1QA 3CMMA 2CG4A 4LG0B 4U7DA 2ETHA 3HUGA 3QQAA 4LG3A 1T2KA 3GLLA 3H0DA 3V7SA 4RB2C 2JA2A 2W82A 4HZFA 5HODA 3IHUA 1E17A 2CJJA 3A1YA 3X2QH 1BI2A 3S16J 2DPUA 2JVHA 3HZJA 3WG7H 2X1DA 3GCMA 2GXGA 3JSOA 2EA2A 1Y1WJ 1HKQA 5CJ9A 2F5CA 4KITB 1BJZA 3ZQ7A 1ORKA 3HYIA 3K10A 1XMAA 2K4BA 1R9TJ 2MC3A 1W5TA 2ICWG 1XGOA 3HC7A 4G12A 1OYYA 2V7FA 1SD4A 4UVAA 1XGNA 4GYIA 4ASNA 1R00A 3A0HC 1Z1DA 3F8NA 4FCYA 1HLVA 4PGHA 1YI2I 3VSLA 2HVRA 2WAQA 3I3LA 4XBFA 1TLHB 1ETVA 3ISPA 4ZYGA 3BZCA 3WTUC 4ENNA 4G7OF 1G6NA 2XVCA 4AWXB 1U8BA 2ACJA 4PJLA 4ZDOA 1OYWA 4IL6C 4IJAA 5KHDA 4UUVA 3BPXA 1IN4A 2LRDA 2XAUA 3KP6A 3VWBA 2HXOA 1TQMA 4BQNA 3ERED 3IKVA 4JYKA 4II2A 2EV5A 1BIBA 2I5UA 2V6CA 1VTNC 1BIAA 2ELJA 1KYWA 2AO9A 2KQRA 2HPMA 1FNNA 1TNTA 3H92A 4IRIA 2KDOA 2Q1ZB 3T8RA 1V3FA 3SYTA 4IPAA 2QQAA 2E19A 1ZELA 6PAXA 2VASA 1E3OC 1R5ID 4MFEA 3OL4A 1RC9A 1ETKA 4Y3OA 4MEXF 1JTYA 2GAUA 5D5WB 3W6VA 3KP2A 1ENHA 2IVMA 3MVPA 2A61A 5CKTA 3LMMA 4A6DA 5EEAA 1X2MA 1B9MA 3QAHA 1X1PA 1G4DA 2EPFA 2HTJA 2K86A 2M9HA 2KZGA 2EV6A 2DA3A 1R58A 1JT6A 2KIFA 5F0FA 4EVIA 2O6GE 1CQTA 3KP3A 4FE4A 3VYUB 3KCCA 4BYYA 5E8IA 1XD7A 3HKZA 3MWMA 5E18F 3GTOJ 1V5EA 2NS7A 5LBQA 1G3TA 1JUMA 1HKTA 1NK3P 1K83J 3MZ8A 2H6BA 3PO3J 3R60A 1ZQ3P 5E17F 2CFXA 3F22A 4IHTA 3IP4B 3I0TA 3BR5A 4YG2F 1XMXA 5GAGJ 2JQ7A 2OQGA 1I1SA 2WAQN 3TW7A 2VKEA 4IZZA 3F72A 3S3MA 2EWNA 4QLCU 2VODA 5FD6A 2LVSA 2HFHA 3HM5A 2DQLA 3W3CA 4EEFG 5D6FA 2V9VA 2VT2A 4KDPA 2ZJ2A 1X2NA 2F2EA 3HSEA 3WHCA 1HSTA 1TWGJ 2LKSA 3MKZA 1SAUA 2ZJPF 2TDXA 1N78A 1Z0XA 3BLYA 4L9JA 3LA3A 5HLHA 3HL2A 4IHVA 2HDWA 1S7EA 3C1DA 1HXDA 4E7ZA 5GAHJ 1W0UA 2WTEA 5HDKA 4KICA 4E7LA 1OCZH 4IRHA 3J7YJ 1P7JA 2A5WA 1H0MA 3M9AA 1ZREA 1MJBA 1V5GA 3KPHA 1E3HA 3O2PE 5CYVA 5M5YJ 4E7KA 1IN7A 2IGNA 4AIJA 2FU4A 4LFUA 4Y15A 3SFZA 2K4JA 2XV4S 3PIPF 1IXCA 4KFCA 3IUOA 4IRGA 4OAYA 4XKCA 3BG7A 3MKWB 2YPRA 1TT0A 3E3VA 4RM2A 2ZBKA 4QTRA 1JT0A 3OOUA 2QA4I 4PDKA 3COAC 3QPLA 4A5MA 3P9KA 2HOTA 1KONA 2RV8A 2JWTA 2X6OA 3K70D 2IAIA 2WB1N 3SQNA 4ZYHA 2V26A 4HPQA 2LR8A 4OIPF 2Q2EB 2VBWA 2ZSIB 2Y9ZA 3G2BA 3WTZA 3REOA 3GFIA 2BE5F 5E1XA 1XSVA 3S3NA 3HG9A 3GFLA 2VQHA 3S2DJ 2BV6A 4ITVA 4PK4A 2DT5A 4OIRF 3HGYA 3KZYA 4IO9F 2XF5A 2KIQA 2OCEA 1TL8A 4UUSA 2Y0SA 3RKXA 4E7JA 4A3DJ 3N4MA 2GIVA 2XSJC 2PMHA 2ELHA 1F36A 1I39A 5JVGF 3WHBA 3VFZA 3HBLA 5ICCA 2M0CA 1SD6A 4KIBA 4XMYA 4A3IJ 2WV1A 2ZC2A 2KKOA 4LITA 3MN2A 4QPQA 4OMZA 5EG0A 1HOMA 1JUSA 3RKQA 2XROA 2DO7A 2DI3A 2XHKA 4P5OA 2WAFA 1A35A 3I59B 5CVUA 2Y9YA 4L9VA 3DWLE 1MH3A 4HW0A 1MSEC 1YW9A 5KAIC 3CCMI 4KMUX 2MH2A 4DYRA 1Z7LA 4RB3C 3P5JA 1S8NA 1DGWY 4XIDA 3KEOA 2CH0A 1BOBA 2DDBA 4EM1A 4LK1F 4C3HJ 2CS3A 1K4TA 1U9OA 4B1RA 3NWTA 3AAFA 4A69C 1BC8C 1PYVA 2CU7A 4C3IJ 1M1EB 3ZMTA 2STTA 2YUSA 3RDIA 4F7ZA 1X19A 1OR7C 1WJBA 1G2HA 3MMYB 5K5RA 2YR2A 4M6XA 1IUYA 3ZMSA 3GO5A 4U87A 2VIXA 4L5IA 2HKXA 4IHYA 2MD5A 2RNJA 5FKKA 4ZTJA 3HHHA 2P6TA 3A02A 4FISA 2KFDA 5CVJA 1X1CA 1OYIA 5E79C 1CF7B 1GVDA 1P92A 4XLEA 1KQ0A 2EV0A 2PEXA 3CP8A 2ZXJA 1XGSA 1ITYA 4MTDA 5M5XJ 4BNCA 3KEQA 2LTPA 4BXFA 2VQCA 1LDDA 3PUFA 2W25A 2QUFA 3HPGA 1TTYA 2ZKZA 3KP7A 5JI6A 3D5LA 4CZZA 3RTRA 2Y31A 2F5FA 2Y0SN 4GCVA 1GDTA 4GYGA 1ZH5A 2P4WA 4FT8A 4G7HF 2QZ8A 1MMNA 1R6RA 2E7WA 2JSPA 1R1VA 5DS9A 1K78B 1I6XA 1QU3A 2HKOA 4RGRA 5F1JA 2X6YA 1ERDA 5J4YA 2VT3A 2DBBA 4I6ZA 2FXAA 4M6YA 3ESWB 5BPIA 3RKWA 3CUQC 1IDZA 1KU3A 1P7IA 3B6AA 2X1CA 2IT0A 3J81K 2LC2A 1WI9A 5JLWA 4OIQF 3GBGA 3Q0UA 1ETWA 1KU9A 3BJOA 1E2XA 5E1ZB 3L9FA 1WFXA 3KYDB 3QYFA 3ZQFA 1QVUA 1B72B 1YQAA 1WJ5A 3FKJA 1KU2A 1E3PA 3KZIC 4HNTA 1J59A 1T98A 1RI7A 3WU2C 3AL0C 3OYLA 2OZ6A 1YFHA 4IHSA 2EFPA 4ON0A 3V7CA 5EZHA 1K6OA 1ETOA 3CCYA 4WWCA 3BWGA 1OFCX 2RN7A 4IKFA 4KIFA 4XORA 4O6JA 2R5YA 3ZOBA 1IRFA 2MLKA 4PJNA 5H6RA 3LSPA 2O7OA 3H5RA 3CUQB 4DYCA 5DDGA 4GGGA 4L0ZB 5TGTA 3C18A 1X1AA 2RDPA 3CDIA 4BH9A 3FMQA 1UG2A 4XONA 4BUPA 3CCRI 3HUGB 1O7LA 1FSHA 1NHAA 1GXQA 3FBNB 4M73A 1BI1A 2PMZA 3FXOA 4CZCA 3IAM2 2CQNA 1VQLI 5J40A 2A5YB 1LE8A 2FQ3A 2OU2A 3W6JB 3AL0B 3J80Z 1QZYA 4XN0A 1D0XA 1XPXA 3OSFA 2GA1A 2EJRA 3G73A 1BM9A 3GYHX 1MGTA 2CO5A 3BQZA 3L2QA 3PJRA 1Z67A 5IT9K 1W36D 3TDZC 2LFBA 2GXBA 2QYOA 1I50J 1QO0D 4RGSA 4LOCA 1U5TA 1JGSA 4C3JJ 1QRYA 2VKHA 5J1YA 1Z3XA 3TP3A 2PJRA 4DZJA 3H5AA 4BY1J 4D0PA 3G1OA 1F5TA 3O3KA 3G1MA 4LGWA 2D5VA 2M34A 3S8PA 4DIQA 4HX7A 2LREA 2BVMA 3KIOA 4II3A 1RUNA 1GXPA 3HOWJ 2IRFG 3KLNA 1GUUA 4HQEA 3CCEI 2CQ7A 2ZNYA 3BROA 1YHQI 2DMTA 5D5XB 1AKHA 4NC7A 2OAZA 4RAYA 4P96A 1PDNC 1FLIA 1WI3A 4RM3A 1D1CA 2DCEA 3LSMA 1TQPA 3L2CA 2O9LA 3PNTA 4KA4A 2Z5UA 4WX9A 1NG7A 3H9QA 5HLIA 2VBYA 2NOGA 4L18B 2IXSA 2HEOA 2E1NA 3HSFA 4OAZA 1KU7A 2R5ZA 5GTIC 1MSFC 2LK2A 2YSRA 2H6CA 5AONA 2BOLA 3I4MJ 2LLKA 4ENJA 2W7NA 1ZRDA 3HOYJ 5B66C 3ONQA 5DM6F 3PQKA 1HW2A 3BCAA 1IN5A 5C4JJ 4E70A 1RRJA 3G71I 2Z33A 2VN2A 3CO7C 5LRRA 4F93B 1IDYA 1NTCA 3LOCA 2DN0A 2GM4A 2JN6A 1EH8A 2KRCA 3FHNA 3WU1B 1MNEA 5D4SA 5DUIA 2DAOA 3OYBA 4I0AA 1J75A 3QRFF 4W97A 1ZG3A 2R0QC 1H89C 3F6OA 1TC3C 1MBFA 5IYCJ 4CCMA 5IYBJ 4RGUA 2LKXA 2FNPA 4BJTA 4EM0B 2YU3A 2X85A 1YX5A 1ZGJA 4JK1X 4DYQA 3DPLC 3H0GJ 3VODA 3L2WA 1SC7A 3T8TA 2DA6A 1EKEA 4M3GA 4MTEA 3V42A 4A93J 4DZPA 1DQUA 3HIFA 4GFBA 1SMYF 4HX4A 1R7JA 3WODF 1OCPA 1FY7A 2VQLA 4BS9A 2IA0A 2VXZA 1ZG5A 1XDUA 2HU9A 3HOUJ 2BVLA 4XRMA 5J1UA 3WTSC 5LHIA 1YO5C 2I8DA 1P6RA 2XSDC 2VQGA 3KE2A 3OR1C 2FRHA 1FOYA 2ID6A 2QCOA 4DOZA 1ZLKA 5FLVA 3IV5A 3QPSA 2WA0A 4M3FA 4CICA 3ZQLA 5B3SH 1EV7A 3VDXA 2B7EA 2DT7B 2W57A 1Z9CA 1QQIA 1IXRC 2XUBA 4Q47A 3ULQB 3CMEI 3C7JA 1YW8A 1AA7A 2KIMA 2OQRA 1TZLA 2DA2A 2DMUA 2L9SA 5EZGA 4GDFA 1W7PA 2VB6A 2DXIA 2GXAA 3VOEA 4BKXA 3RZOJ 4DNCA 1I3QJ 3HTSB 2NNYA 2JSCA 3E5XA 3GX4X 4A3FJ 2K9SA 3M8JA 3KZZA 2D45A 2DFFA 2OD5A 4BHBA 3MFKA 2EFQA 4FHTA 4XRSG 4UUSB 3FMSA 3HOSA 3R4KA 2AXLA 2ME0A 3QOEA 1OQYA 4MNUA 2QQBA 3JTGA 3OYAA 3K0LA 4XRSA 3VYTB 2K9LA 4P9FA 2QKMB 4I2OA 2HWVA 2CUJA 5LEJA 5EG0B 3CTAA 4NHJA 1SANA 5F64A 5ED4A 2XAFA 2JMWA 3M4OJ 2L3DA 4AM3A 4PJ0C 5F0CA 1AU7A 3VEPA 1R22A 3DF8A 4CUGA 1LFUP 1LPQA 3KX2A 1WJFA 1XTAA 3OMYA 1VQ6I 2HOAA 3WTYC 2N8GA 3BR3A 5HS9A 1BW5A 1VQKI 1FBQA 3GVAA 1GVJA 1UJ8A 2L02A 3DBLB 1SFOJ 5HLGA 2PI0A 3R0AA 3ZQIA 1D1BA 2AQEA 2DTZA 2VE8A 3F8MA 3FM5A 4ANJA 3ASOH 2KHMA 4G94A 4KN7X 3KETA 1MMGA 5K7FA 1X3UA 3QYBA 4F3QA 2IS1A 2X4HA 3DQVC 1OKRA 1K4SA 3KEYA 3OYHA 1FYMA 5J4VA 2E35A 3GTQJ 2DTRA 3E7LA 3HEFA 4C2TA 1MW7A 4O3MA 3K69A 2E2IJ 5FB2A 4Y52J 2JA6J 3WTVC 4KMFA 3BTIA 3SDBA 2R7FA 2ESHA 3U1DA 3CF5F 3R61A 3QPTA 4PFPA 4P1WA 1YG2A 1BR2A 5EGOA 2E2HJ 3MQ0A 2BXZA 5BNGA 2EZIA 1V55H 2KMUA 2HQ5A 1SFXA 3RYRA 5FKMA 3SEQA 1P4AA 2NVTJ 3ABKH 1CGPA 1OCTC 3GTLJ 1JXSA 2Z3YA 4CDGA 3RQ4A 3HRMA 1JE8A 4U0WA 4EJUA 1YS7A 2BXYA 2LSOA 3BCBA 1WH5A 3GTPJ 3NAUA 3KFWX 4XLHA 4Q48A 2FEZA 1WSUA 1BC7C 2JRMA 3OYDA 2OF7A 1Z3YA 2EQRA 3E6CC 2FBIA 3MKYB 1VQPI 3BG3A 4AD9A 3ZN0A 3J7AY 2IS6A 1MMDA 2CQXA 3B73A 1S6LA 2MH9A 3DXJF 4XLPF 3G4SI 2VJ4A 5LRSA 2JRTA 2QENA 2JUCA 2KISA 2M0MA 2Y0MA 3ABLH 5E3NA 2HDDA 1B59A 2Z1DA 1FWZA 1USSA 3EUHC 1T08B 3LFUA 1WHUA 1FPQA 4AC0A 2DA1A 1PJRA 2MYSA 3FDYA 4HG2A 1I3AA 3CLOA 2MFZA 1LKXA 2UV1A 2P7VB 4JQFA 4QPOA 2OA4A 2DPDA 3KYCB 3ZGKA 5IP9J 3A0BC 1Y8RB 3GUDA 4J00A 1SEUA 1U0JA 2R5YB 4XM3A 1IAWA 1L3LA 3F9KA 4HX8A 3BP8A 1OPCA 2LY2A 1SD7A 1V5FA 5HS8A 5IP6A 4EV0A 1IV8A 3FMRA 3K1MA 1U5TC 4MEYF 3LQQA 4EJWA 2A6TA 2IP2A 5LGTA 1MBJA 2EFOA 2XKOA 3VSKA 1FP2A 4D7NA 2CV1A 4EGYA 1BOAA 2FE3A 3I4NJ 2JA7J 2P5LC 2R7XA 1UMQA 2GOMA 3U2RA 3WGGA 1VQMI 3FISA 4X0GA 2GZWA 1RKWA 1LE8B 2KP6A 2LBFA 4BHPA 4E6KG 3GZ5A 3CCJI 4RDUA 3ZQHA 4LD5A 3S1RJ 5FFXA 5KVRA 4LIUA 1Z7UA 1PP8F 1R5HA 2PMUA 2W1OA 1JKRC 1G8XA 1ONVA 3OV8A 3T0YA 4ESJA 1LVAA 1X58A 3L09A 1U9NA 2DOAA 5LHHA 2Y75A 3C2HA 3O6BB 1MDMA 1U5TB 4XSZF 4NQWA 3K4NA 2FMLA 2L9VA 1WRJA 2DYRH 2GWRA 2PJRB 4CA0A 4ETSA 1S29A 2K40A 2QWWA 3OYEA 4B3XA 2OC6A 1FEXA 4CCNA 5DM7F 4RBOA 2QSHX 2GQQA 3QOPA 3WE3A 1TW3A 4S04A 1ZRCA 5F27A 2M7BA 3S1QJ 4FX0A 5LFAA 1FIPA 2QBYA 5TRDA 2H94A 1Z21A 2HVSA 1T95A 2W4SA 5KNLA 2E1OA 2Y69H 1BN5A 3DPUA 5CVVA 4MIMA 2V4JC 2P5KA 3TKYA 1AKHB 2W48A 4UB6C 5FKLA 4D5FA 4YIRX 4HOBA 4L9NA 3DBHB 4ZZDA 4MFDA 1DPRA 1ZRFA 2ZSHB 3HOVJ 2XPWA 1B9NA 5ICFA 1X1BA 3P9CA 1DP7P 3IRQA 2WY7Q 3CO6C 2ESNA 3I64A 3HKZN 1W4MA 5C4XJ 2EH3A 4AU7A 4X6AJ 1POGA 1LVKA 4RAZA 4U88A 4I99C 2M3AA 3IH3A 2DMPA 3DKWA 3Q5FA 2NVQJ 2M7AA 2ADUA 3E6BA 4EQQA 2R5ZB 5FLXK 2CUFA 3FXJA 3BY6A 5L3DA 2LKPA 1A36A 2XRLA 2YX4A 4PJMA 1O4XA 2OCCH 2K3FA 1ON2A 3Q9VA 5K5OA 3QWLA 2DOFA 3J7ZI 3FWEA 2LF7A 1U3EM 2NVXJ 2I10A 4I98B 4M3BA 2X51A 2IEKA 4ZYEA 3LA2A 4AUXA 1ZR2A 1EH6A 1D1AA 5FO5A 2V79A 1G3YA 2DA4A 4ZH4F 3CQZJ 5L3FA 1UHWA 4HSTA 5D4RA 2FOWA 1O3TA 4CYCA 2KRHA 5FFZA 1YRNA 2IA1A 3O8GA 3HRSA 3PFYA 4YFNF 1SFEA 4BDZA 4ZC3A 3GZ6A 1IRZA 3SHFA 5M3MJ 2MG4A 3ZMVA 1XDSA 2DODA 3AG1H 2OJED 3D5SC 3C3WA 2OV7A 3DKXA 1S5LC 3OWTA 4UXNA 3TEDA 4MGRA 3H5NA 2TCTA 4HNVA 1JJ8C 1MZBA 4DJAA 2NVYJ 4HYEA 1R4MB 2COMA 5E8GA 2Q8KA 3F8FA 4BAYA 1REPC 2DW4A 1IN6A 3EETA 4IEJA 1VQ8I 2CSOA 3ZPLA 2RKHA 5F08A 3L1PA 5J8CA 3FXRA 1D5VA 1K6YA 5JR3A 1P4WA 4HQMA 3OIOA 2RQQA 2QF7A 2ZB9A 4DW6A 3L2RA 2B63J 1WH7A 3SEZA 1D8KA 4L5JA 1MBHA 2VLAA 1Q1HA 3ZCOA 1I1GA 1RKTA 1WKMA 2CW8A 2M30A 2MC4A 2OBPA 4RA2A 1DDNA 5EYRA 4A2UA 3D1NI 2RNGA 3DTIA 1HBXG 3S3OA 1QHGA 3S2HJ 2HOSA 4PUSA 1PUFA 5DTDA 4JOMA 5ILSA 2DMQA 3WE2A 1I27A 3F23A 1Z05A 2HDCA 4QSHA 4GRIA 3S93A 1FYLA 1W7PB 2HXIA 2L5QA 3I71A 2PN6A 1APLC 4MQVA 2XF6A 3R0JA 2DLLA 3HRUA 2L9NA 4BGDA 2UXXA 3WGHA 2WADA 4G7ZF 5HDNA 3RJPA 2CMPA 4GO1A 2VC1A 1QHHD 2VOPA 3HOTA 1YITI 3OYCA 2J5PA 3ABTA 5LGUA 1H88C 2K9NA 4M9SA 2O3FA 2AS5F 3DU5A 1TWFJ 1HQCA 2L4AA 2V9PA 3DLAA 3GTJJ 2IGOA 4M9ZA 5FRNA 1R4NB 4HNUA 4YFXF 5JFRA 3ROUA 3V8JA 1JHHA 1A31A 3M1CA 4HA8A 1Z91A 3GMEA 1EJ9A 1DU0A 1QGPA 3P7NA 1HA8A 2JZYA 2L01A 4PSXA 2H1KA 1ZAOA 5BQTA 1R1UA 1LB2A 3PNVA 4LLLA 4Y33A 5DV5A 1FIAA 2KT0A 1U6GA 2M8GX 4L0YB 1XCVA 2JVGA 3JRHA 3K4LA 3OS2A 5M3FJ 1IG7A 2WV0A 2JPCA 2P81A 3CDHA 2L7MP 4UV8A 4LMYA 3P9IA 5D8LB 2EBIA 1KQ9A 1ZLJA 2ZCWA 1Y0NA 1LFBA 2M1BA 4BBSJ 1YYVA 2X1EA 4W1UA 2O61A 3EUHA 2RREA 3BQYA 1W0TA 3H1CA 2A69F 5H6QA 2ISZA 3I56I 1T33A 3SZGA 1HW1A 5K5QA 3HOZJ 3DEEA 2A6EF 4J19A 3S2WA 2L0KA 5FKNA 4NC8A 4OINF 1VFCA 2HS5A 2W24A 1YJ9I 1D3YA 2FMYA 4BU2A 4ZJZA 3MD2A 3LSTA 2Z9OA 4HLXA 1GT0C 1R49A 2QQ9A 2BEOA 4XNFA 1OCOH 4XLAA 5IYDJ 2M4KA 2RGVA 2J5OA 3J81Z 2CQQA 2HYGD 4S05A 5EGOB 5JVTA 4N0BA 2FBHA 2A07F 4CCOA 3CCQI 2L54A 1OMIA 2B0LA 3BG9A 4KN4X 2EINH 3I4PA 5ILUA 1K79A 3UKGA 4G6DA 4M9XA 2KJBA 3PFIA 4KJZA 3U9GA 2Y2ZA 2K02A 3A03A 2IJLA 3F8CA 1JKOC 3GWZA 3A4CA 2JPBA 2K9MA 2DT6A 4OMYA 4S0HB 3CDLA 1XSXA 2BYVE 3GZNB 5CLSA 4FE7A 5TISC 2LD5A 2F6CA 2M5WA 5KK1A 3UR3C 3QYEA 2M87A 2W84A 3WU0A 4HV5A 1LQ1A 3NQOA 4B3AA 1FZPB 3FM3A 3PIOF 3JRBA 3H9JA 2E1CA 4ZDLA 1Y1VJ 3RIRA 1FT9A 4XICA 3E97A 5GADJ 3BR6A 1U2WA 1RNLA 4OIOF 4KIGA 2KJCA 2QKLB 2PMZN 5DUKA 3ZN1A 4ZYAA 3SFIA 1T6SA 2D1VA 3BTCA 3OIPA 4AVZA 4RMNA 2NS8A 4I09A 2D2WA 3ZMDA 4BBRJ 2E5ZA 4RLQA 4CCLA 1ON1A 2TRTA 3FXUA 2Z16A 3GLXA 2PBIA 3I54A 1X4OA 3TW6A 5GTHC 2R7OA 3CLQA 3ZR8X 1NG6A 1WJAA 3CCSI 5DYMA 4R79A 4UNOA 5LEKA 5E20A 5IT9Z 5E3OA 4RAFA 3CMAI 2LP0A 2G0EA 2ZXHA 4Y13A 4XLFA 3TMOA 1VQNI 2CWEA 5HDGA 3K70C 2RQPA 3F8BA 4BXUA 4HRIA 3SDGA 3DTKA 1X1DA 2QGUA 2G7HA 2PLYA 1LFPA 2EILH 2V1DA 2K27A 2LBFB 2FNAA 4XSXF 2F4IA 4E7HA 3TO9A 1YW7A 5B5EC 3ML6A 3E6DA 4A3JJ 5JLXA 2M45A 2F5EA 3HXLA 2JUGA 3HJEA 3GW2A 2XAJA 4DGWB 4XQFA 1IF1A 3OR2C 3F21A 3OSGA 2F5DA 1FYKA 3ZQCA 3OYJA 3L2UA 1USTA 1RESA 2CFOA 1MBKA 5KAFC 3RPUD 4CHUA 1MDMB 1LEAA 4NQWB 4A0YA 5HLTA 3PQJA 1G3WA 3DKYA 1TW2A 1J2XA 3K4JA 2HQNA 3BTLA 4PCQA 1XC5A 3SJMA 1IC8A 4BY7J 3WTTC 3CCVI 1GV2A 5FJ8J 3CC7I 1J7KA 3KLOA 3QP6A 2WC2A 4BEHA 3JAMK 2QBYB 5EDNA 4XOPA 3JSPA 5H20A 2VKDA 1ODDA 2AHQA 1D0ZA 2EA4A 1J5YA 2DK5A 3JRAA 3QPHA 1TWHJ 3RKYA 4I01A 2HZTA 1Z6TA 2XGDA 4B4CA 3MZYA 3DFGA 4B47A 5FD5A 3V8LA 1T56A 3JRFA 3M1EA 1X3ZB 3OIQA 3N97A 3LFKA 3IRRA 1IZ1A 4U7BA 5CPRB 3LNQA 2STWA 2QEXI 3ECOA 4MO7A 4DBQA 2VE9A 1TWCJ 3ASNH 2Z99A 4A3EJ 1DGRM 2Y48A 3DBRB 3K4BA 1ZR4A 4IXAA 1B8IA 1WCMJ 2XKPA 1R5GA 5HVQC 1F4KA 1P4XA 3K2ZA 4LB6B 4YRVA 1Y39A 2R92J 4A3CJ 3KP4A 4BHCA 2CW7A 2XGCA 4RLFA 4XOTA 1UG0A 5DCMA 5FROA 4LLNA 2HPIA 3LSKA 1LDJA 3FKIJ 1HKSA 3FK6A 4GXOA 4YELA 2E2JJ 2KZVA 2P0WA 1ZGAA 2HYFA 3O8HA 4IOCF 1ZKGA 3CUOA 2LOOA 4FETA 1HDDC 1IV6A 3PSFA 5FGMA 1ZK8A 4HF2A 1LDKB 5DEQA 1EA3A 3ABUA 3LSRA 1MBGA 3B6CA 1BI0A 1WZ2A 5L3BA 5AIPA 4MLOA 4AIDA 2ZJRF 4Q4ZF 3FBIB 3V7RA 3OYKA 1UELB 1ZARA 4P55A 1IJWC 3K9TA 2EZHA 3I5UA 1IRGA 2R4GA 2FA5A 1D8JA 3FXQA 2VJ5A 2L7KA 3C2GA 3TP0A 2X0LA 2LY9A 4CYCB 3IL2A 3TOBA 1W7PD 1S7AA 4L9TA 1YRNB 4UY8I 3CD6I 1SFUA 4FQGA 1ZTRA 2ZJQF 4OU0A 1BL0A 4B09A 5CVIA 4ESFA 3BR2A 4B48A 2WWYA 2CV2A 2NXNB 3K2AA 3CJRB 4XKVA 4NB5A 3TO7A 3RPQA 3TQNA 1TWAJ 2O5RA 1XMKA 4G9YA 1XSDA 2LYCA 3JTHA 2AQFA 2LG4A 1RPWA 1I6HJ 1Y0UA 3FX3A 2H09A 3HTUA 2LF8A 1G59A 2RVCA 3PO2J 1FMWA 4Y4RA 1OLTA 2BW3A 2MW8A 2NYXA 1UZCA 1BR4A 4IVNA 4XKWA 4XLNF 4N4NB 4A0XA 2JJ7A 2IA2A 2CV0A 4A3BJ 1WGXA 1JKQC 2BZTA 3MAJA 3BR1A 4UVBA 5FKOA 4A6EA 3Q3SA 2JTVA 1B1BA 4PFOA 1UAAA 2R7TA 1MJ9A 5HNHA 1PUFB 3AG4H 3DEUA 2HGCA 1FBUA 2VUMJ 2FJ1A 2K85A 3K7AJ 3GF2A 2XAGA 2R7DA 4BL0B 4CO8A 3ZQQA 3IWFA 4ABZA 1SVOA 1ZYRF 2W85A 1YLFA 3TDUC 1FSEA 2BGCA 4IF4A 4CCJA 4FX4A 1W36C 4AIKA 1OISA 1JGGA 3CZ6A 2C6YA 5HOOA 1D0YA 3ZP5A 2OTLI 3EYIA 1S9HA 1YJWI 1HC8A 2F4MB 3EPZA 1LNWA 2G9WA 5J6XA 4YIFA 3FXMA 5DCFA 3LSGA 3M8EA 4KT6A 1ZGWA 1GHCA 1ULYA 3NARA 3WTWC 4EATA 2DJIA 3NRVA 1KZHA 4HLYA 4PZJA 2XGEA 3IH2A 2KIUA 1UHMA 1K61A 3LSIA 1G3SA 2CYYA 4UVCA 2DFIA 1QBJA 2BY1A 1IO2A 2GA2A 2X6WA 4MQ9F 2HVQA 1WJCA 2D1HA 4F52A 1PUEE 2LH9A 3HGGA 4ENMA 4EJTA 4PJJA 4AYBA 1YIOA 3ZXSA 3S1MJ 1UCRA 2UUZA 2WAEA 3CMYA 3N05A 4Y17A 1Y56A 1L0OC 2K5CA 2MGQA 4LLGF 5E3LA 4V19K 3K4KA 3BPVA 1X4PA 2BHYA 5EJCA 1IXSB 2WB1A 5IOZA 2VBXA 4BDYA 5GPAA 1RETA 3JRGA 1U8RA 1FBSA 3ECHA 3PNYA 5JHFA 1D5YA 4JBAA 2DJNA 3QODA 3DTEA 4JX6A 1BBYA 5JHUA 4MHGA 2H27A 3E0JB 4WCGA 3DV8A 2COBA 3AG2H 4B8XA 4I76A 3MZHA 3H36A 4WXHA 2IBDA 3HHGA 1Y6IA 4BE0A 1O3SA 3ZQGA 2HR3A 2ZXWH 1O7FA 4HF0A 1WJDA 3CJNA 2IPQX 4OWRB 5HNFA 4EM2A 3F0CA 5K7ZA 2MD0A 1HSJA 3JR9A 4LB5A 2DFHA 1P9QC 2DFEA 4ZTFA 4BQAA 2E34A 3M7GA 1MMAA 1TT5B 1XN7A 4L5EA 3E5QA 4UHTA 2Q0OA 1OJLA 3E6MA 4XKBA 3GTMJ 1MBEA 5J3LA 4KT5C 3H3ZA 2XASA
chains in the Genus database with same CATH topology
4CXFA 2XIGA 4M72A 2G7UA 3LAJA 3JW4A 2KRFA 1UB9A 2OZUA 2XRNA 4WXCA 3F3XA 2VOOA 1R36A 3V4GA 1LEBA 2ZMEA 2DU9A 4RB1A 4R1HA 2ZFWA 1T38A 5HS7A 3QP5A 4QWQA 2QVOA 1IN8A 2A3SA 3EYYA 4ESBA 1FC3A 5AIQA 1FOKA 3BJ6A 5A2QK 3FHZA 2P7CB 3TO6A 4N9HA 1J0RA 2EFWA 3WG9A 2P6SA 1KGSA 1TNSA 1U78A 1B4AA 4LJZF 3GFMA 4EMSA 3QU6A 3I53A 4WK8F 1F1ZA 3H3UA 4ZYDA 3L00A 5L3EA 3GFJA 3LAPA 3FZVA 1O3RA 5F6FA 1WWXA 1KYZA 4HBLA 4I7HA 1JHFA 5LHGA 2M8EA 4LG0A 1QPMA 3SXYA 3T5XA 1FX7A 4RGXA 1C0WA 3KP5A 1AWCA 2CGPA 1TBXA 4ENKA 1DPUA 1Z6RA 1RZ4A 5FLXZ 3FF5A 2EB7A 1A04A 3Q9SA 1O57A 1T39A 3MEXA 1SMTA 5D5VB 1T0FA 3WGIA 1SAXA 5A2QZ 4A5NA 2XAQA 4HDUA 1QZZA 4ZZLA 2EFNA 1TQIA 4CYDA 1WQ2A 2VC0A 3ZMUA 3GXOA 3J80K 5DCMB 2BBYA 1AOYA 4U0VA 1RIOH 3I58A 3V8KA 2PJPA 1FP1D 3HSRA 2ISYA 3TGNA 1RUOA 5ICGA 4N9IA 3LA7A 2HTSA 3M8FA 2FOKA 4DQ2A 1W5SA 5LGNA 2CW0F 3G3ZA 2EK5A 4RB0A 3LQRA 4A0ZA 4PGGA 1KA8A 3BDDA 5D5UB 1ZHFA 4HAMA 3OOPA 4HV6A 3EDPA 4LK0F 2FSWA 2NS0A 2UWMA 1SD5A 5BS6A 2DK8A 2PG4A 1HW5A 5D6EA 2O8XA 3D0SA 2L4MA 3LWFA 4P9UA 4HDVA 2DQRA 5ILVA 4O5VA 4I0BA 3L7WA 1K7AA 3BJAA 5CVRA 2A6HF 3B02A 5F1RA 1PP7U 2VBZA 2QLZA 5L3GA 2VONA 2R3SA 2IW5A 2UZKA 1YTYA 4H0EA 3IKTA 4YIIA 1P2FA 3R6SA 3DPTA 2ZNZA 2NNNA 1XCBA 3IWZA 2V1UA 2XGXA 5BPDA 2O0YA 4A12A 1B6AA 1H9TA 3EQLF 2V1XA 1R23A 4KNYA 1UFMA 4I02A 3ZMZA 3E5UA 2NAZA 3MCZA 4G8XA 2HQRA 1XB4A 3BOQA 2Q2EA 1BJAA 5L3CA 1BI3A 3VB2A 5TJJA 1LJ9A 5LLQA 5J8FA 5BMZA 3J7AO 2YX7A 4TV7A 4K2EA 3TOAA 2MLGA 3RPUA 2K7LA 4WXDA 4XRFA 2IRFG 1IW7F 2QM3A 2XAHA 4Z2YA 5DD8A 3HRTA 3DP7A 1R1TA 4R8HA 4HF1A 3F6VA 1S7OA 1ZG1A 5DD4A 1S3JA 3RYPA 2P5VA 4EJOA 3I59A 2P8TA 2LNBA 5BOXA 1I5ZA 4AIHA 2PQ8A 1KQ8A 1EH7A 1F9NA 3BZ6A 3WTXC 3W6KB 2MBFA 2FBKA 5K1YA 3T1BA 1XGMA 1QNTA 4KYWA 4Q5SF 1MKMA 1CF7A 4WF2A 3GEZA 4CGZA 2A68F 5D8KB 2ZO4A 2ZMEB 4UV9A 1DUXC 1STZA 4KUMA 1OR7A 4U0YA 3QU3A 4M74A 4OOIA 1K78A 1ZN2A 3SZPA 3SZTA 3NEUA 3ELKA 3K1PA 4EJVA 3RI4A 4RS8A 1YS6A 1MJAA 2HOEA 2JT1A 3IC7A 1V4RA 2LDUA 1J9IA 4M71A 1O3QA 5EEHA 5E1WA 2RC4A 2NRAC 2UXNA 2E7XA 3JAMZ 5ICEA 2O03A 2FF4A 3K1NA 4AVPA 5ERIA 4G6QA 3CUQA 2PFBA 4YFKF 1MD0A 5IT3A 1H9GA 2CQKA 5EEGA 4EGZA 2MA3A 2CG4A 4LG0B 4U7DA 2ETHA 3HUGA 1T2KA 3V7SA 4RB2C 4HZFA 3IHUA 1E17A 1BI2A 2DPUA 2GXGA 3JSOA 2EA2A 1HKQA 5CJ9A 2F5CA 3ZQ7A 3HYIA 1XMAA 2K4BA 2MC3A 1W5TA 1XGOA 1OYYA 1SD4A 4UVAA 1XGNA 4GYIA 4ASNA 1R00A 1Z1DA 3F8NA 4PGHA 4XBFA 1TLHB 3ISPA 4ZYGA 3WTUC 4ENNA 4G7OF 1G6NA 2XVCA 4AWXB 2ACJA 1OYWA 4IJAA 4UUVA 3BPXA 1IN4A 3KP6A 1TQMA 3ERED 3IKVA 2EV5A 1BIBA 2V6CA 1VTNC 1BIAA 1KYWA 1FNNA 1TNTA 3H92A 4IRIA 3T8RA 1V3FA 4IPAA 2QQAA 6PAXA 4MEXF 2GAUA 5D5WB 3KP2A 2IVMA 2A61A 4A6DA 1G4DA 1B9MA 3QAHA 2HTJA 2K86A 2EV6A 2KIFA 1R58A 2O6GE 4EVIA 3KP3A 3KCCA 4BYYA 5E8IA 1XD7A 3MWMA 5E18F 5LBQA 1G3TA 1HKTA 2H6BA 3R60A 5E17F 2CFXA 3F22A 4IHTA 3I0TA 4YG2F 1I1SA 2OQGA 3F72A 2EWNA 4QLCU 2VODA 5FD6A 2HFHA 2DQLA 5D6FA 2V9VA 2VT2A 4KDPA 2ZJ2A 2F2EA 3HSEA 1HSTA 2TDXA 4L9JA 5HLHA 3LA3A 3C1DA 1HXDA 2WTEA 5HDKA 4KICA 4IRHA 1ZREA 1H0MA 3M9AA 1MJBA 5CYVA 3O2PE 1IN7A 4AIJA 2FU4A 4LFUA 4Y15A 3SFZA 2K4JA 2XV4S 1IXCA 4KFCA 4IRGA 2YPRA 3E3VA 2ZBKA 4PDKA 3COAC 4A5MA 3P9KA 2RV8A 3SQNA 4ZYHA 4OIPF 2VBWA 3WTZA 3REOA 3GFIA 5E1XA 2BE5F 1XSVA 3GFLA 2BV6A 2DT5A 4OIRF 3KZYA 3RKXA 3N4MA 2GIVA 2PMHA 2ELHA 3VFZA 5ICCA 1SD6A 4KIBA 2KKOA 4OMZA 2XROA 2DO7A 2DI3A 2XHKA 4P5OA 3I59B 5CVUA 4L9VA 4HW0A 1YW9A 4KMUX 2MH2A 4RB3C 1S8NA 3KEOA 4EM1A 4LK1F 3AAFA 1BC8C 3ZMTA 2STTA 3RDIA 4F7ZA 5K5RA 2YR2A 4M6XA 1IUYA 3ZMSA 3GO5A 4L5IA 2HKXA 2MD5A 2RNJA 3HHHA 2P6TA 5CVJA 1OYIA 1CF7B 1P92A 1KQ0A 2EV0A 2PEXA 2ZXJA 1XGSA 4MTDA 4BNCA 3KEQA 1LDDA 2W25A 2QUFA 1TTYA 2ZKZA 3KP7A 5JI6A 3D5LA 4CZZA 3RTRA 2F5FA 4GCVA 4GYGA 1ZH5A 2P4WA 4FT8A 4G7HF 2QZ8A 2E7WA 1K78B 1R1VA 1I6XA 2HKOA 4RGRA 2VT3A 2DBBA 2FXAA 4M6YA 5BPIA 3RKWA 3CUQC 1KU3A 2IT0A 3J81K 1WI9A 4OIQF 1KU9A 3BJOA 1E2XA 5E1ZB 3L9FA 1YQAA 1KU2A 1J59A 1T98A 1RI7A 2OZ6A 1YFHA 4IHSA 2EFPA 4ON0A 3V7CA 1K6OA 4WWCA 3BWGA 2RN7A 4KIFA 4O6JA 1IRFA 2MLKA 5H6RA 3CUQB 5DDGA 4GGGA 4L0ZB 3C18A 2RDPA 4BH9A 3FMQA 1O7LA 1FSHA 1NHAA 1GXQA 4M73A 1BI1A 2A5YB 2FQ3A 2OU2A 3W6JB 3J80Z 1QZYA 2GA1A 2EJRA 3G73A 1BM9A 3GYHX 1MGTA 2CO5A 5IT9K 3TDZC 2GXBA 2QYOA 1QO0D 4RGSA 1U5TA 1JGSA 4D0PA 1F5TA 3O3KA 4LGWA 4HX7A 1RUNA 1GXPA 3KLNA 4HQEA 2ZNYA 3BROA 5D5XB 2OAZA 4RAYA 4P96A 1PDNC 1FLIA 1TQPA 3L2CA 4KA4A 2Z5UA 4WX9A 5HLIA 2VBYA 4L18B 2HEOA 2E1NA 3HSFA 1KU7A 2YSRA 2H6CA 5AONA 4ENJA 1ZRDA 3PQKA 1HW2A 1IN5A 4E70A 2Z33A 2VN2A 3CO7C 5LRRA 1EH8A 3WU1B 5D4SA 5DUIA 2DAOA 4I0AA 1J75A 3QRFF 1ZG3A 3F6OA 4RGUA 2FNPA 4EM0B 2YU3A 1ZGJA 4JK1X 3DPLC 3VODA 3T8TA 4MTEA 3HIFA 1SMYF 4HX4A 1R7JA 3WODF 1FY7A 2IA0A 2VXZA 1ZG5A 1XDUA 3WTSC 5LHIA 1YO5C 1P6RA 3KE2A 2FRHA 1ZLKA 4CICA 1EV7A 2W57A 1Z9CA 1QQIA 1IXRC 2XUBA 4Q47A 3ULQB 3C7JA 1YW8A 2KIMA 2OQRA 1W7PA 3VOEA 4DNCA 3HTSB 2NNYA 2JSCA 3E5XA 3GX4X 3KZZA 2D45A 2OD5A 4BHBA 3MFKA 2EFQA 4FHTA 3FMSA 3HOSA 3R4KA 2AXLA 3JTGA 4MNUA 2QQBA 3K0LA 4P9FA 4I2OA 2HWVA 5LEJA 3CTAA 4NHJA 5F64A 5ED4A 2XAFA 2L3DA 3VEPA 1R22A 3DF8A 3WTYC 5HS9A 1FBQA 3GVAA 1GVJA 2L02A 5HLGA 2PI0A 3R0AA 2VE8A 3F8MA 3FM5A 4G94A 4KN7X 3KETA 1X3UA 2X4HA 3DQVC 1OKRA 1FYMA 2DTRA 4O3MA 3K69A 5FB2A 3WTVC 4KMFA 2R7FA 2ESHA 3U1DA 3R61A 3QPTA 1YG2A 3MQ0A 1SFXA 3RYRA 1P4AA 1CGPA 1JXSA 2Z3YA 4CDGA 3HRMA 1JE8A 4U0WA 4EJUA 1YS7A 2LSOA 3KFWX 4Q48A 2FEZA 1WSUA 1BC7C 3E6CC 2FBIA 4AD9A 3ZN0A 3B73A 1S6LA 2MH9A 3DXJF 4XLPF 5LRSA 2JRTA 2QENA 2Y0MA 1B59A 1FWZA 1USSA 1FPQA 3CLOA 2P7VB 4JQFA 2OA4A 2DPDA 3GUDA 1IAWA 1L3LA 4HX8A 3BP8A 1OPCA 1SD7A 5HS8A 4EV0A 3FMRA 3K1MA 1U5TC 4MEYF 3LQQA 4EJWA 2IP2A 5LGTA 2XKOA 2EFOA 1FP2A 4EGYA 1BOAA 2FE3A 2P5LC 3U2RA 3WGGA 2GZWA 4BHPA 3GZ5A 4LD5A 5FFXA 5KVRA 1Z7UA 1PP8F 1R5HA 2PMUA 1ONVA 3OV8A 3T0YA 4ESJA 1LVAA 3L09A 5LHHA 2Y75A 3O6BB 1MDMA 1U5TB 4XSZF 4NQWA 2FMLA 1WRJA 2GWRA 4ETSA 1S29A 2QWWA 2GQQA 3QOPA 3WE3A 1TW3A 4S04A 1ZRCA 4FX0A 2QBYA 5TRDA 2H94A 1BN5A 5CVVA 3TKYA 2P5KA 4HOBA 4L9NA 4ZZDA 1DPRA 1ZRFA 1B9NA 5ICFA 3P9CA 1DP7P 3IRQA 3CO6C 2ESNA 3I64A 1W4MA 4RAZA 4U88A 3DKWA 3Q5FA 3E6BA 2ADUA 4EQQA 5FLXK 3BY6A 5L3DA 2LKPA 2YX4A 1ON2A 3Q9VA 5K5OA 3FWEA 2LF7A 1U3EM 4I98B 4ZYEA 3LA2A 1EH6A 5FO5A 2V79A 1G3YA 4ZH4F 5L3FA 5D4RA 1UHWA 1O3TA 5FFZA 2IA1A 3HRSA 4YFNF 1SFEA 3GZ6A 3SHFA 3ZMVA 1XDSA 3C3WA 4UXNA 4MGRA 1MZBA 4HYEA 2COMA 5E8GA 2Q8KA 3F8FA 4BAYA 1REPC 2DW4A 1IN6A 3EETA 2CSOA 3ZPLA 2RKHA 5J8CA 3FXRA 1D5VA 5JR3A 1P4WA 4HQMA 1D8KA 4L5JA 1Q1HA 1I1GA 1WKMA 2M30A 2OBPA 1DDNA 4A2UA 1HBXG 5ILSA 3WE2A 1I27A 3F23A 1Z05A 2HDCA 1FYLA 1W7PB 3I71A 2PN6A 4MQVA 3R0JA 2DLLA 3HRUA 2UXXA 3WGHA 4G7ZF 5HDNA 3RJPA 4GO1A 2VC1A 2VOPA 3HOTA 2J5PA 3ABTA 5LGUA 4M9SA 2O3FA 2AS5F 1HQCA 2L4AA 4M9ZA 4YFXF 5JFRA 3ROUA 3V8JA 1JHHA 4HA8A 1Z91A 1QGPA 3P7NA 2JZYA 2L01A 1ZAOA 5BQTA 1R1UA 1LB2A 4LLLA 5DV5A 1U6GA 4L0YB 1XCVA 2WV0A 2JPCA 3CDHA 4UV8A 4LMYA 3P9IA 5D8LB 1KQ9A 1ZLJA 2ZCWA 2M1BA 1YYVA 2O61A 3EUHA 2A69F 5H6QA 2ISZA 1HW1A 5K5QA 2A6EF 3S2WA 4OINF 2HS5A 2W24A 1D3YA 2FMYA 2Z9OA 3LSTA 4HLXA 2QQ9A 2BEOA 2RGVA 2J5OA 3J81Z 2HYGD 4S05A 5JVTA 4N0BA 2FBHA 2A07F 2L54A 1OMIA 2B0LA 4KN4X 3I4PA 5ILUA 1K79A 4G6DA 4M9XA 2KJBA 3PFIA 3U9GA 2K02A 2IJLA 3F8CA 3GWZA 2JPBA 4OMYA 1XSXA 2BYVE 5CLSA 2M5WA 5KK1A 2M87A 2W84A 3WU0A 4HV5A 1LQ1A 3NQOA 1FZPB 3FM3A 2E1CA 3RIRA 1FT9A 3E97A 1U2WA 1RNLA 4OIOF 4KIGA 2KJCA 5DUKA 3ZN1A 1T6SA 2D1VA 4I09A 2D2WA 3ZMDA 1ON1A 3FXUA 3GLXA 2PBIA 3I54A 5DYMA 4R79A 4UNOA 5LEKA 5E20A 5IT9Z 4Y13A 2CWEA 5HDGA 2RQPA 3F8BA 4BXUA 2G7HA 2PLYA 2V1DA 2K27A 2FNAA 4XSXF 3TO9A 1YW7A 3ML6A 3E6DA 2M45A 2F5EA 3GW2A 2XAJA 1IF1A 3F21A 2F5DA 1FYKA 1USTA 4CHUA 1MDMB 1LEAA 4A0YA 3PQJA 1G3WA 1TW2A 1J2XA 2HQNA 4PCQA 3WTTC 1J7KA 3KLOA 3QP6A 2WC2A 3JAMK 2QBYB 3JSPA 5H20A 1ODDA 2EA4A 1J5YA 2DK5A 3QPHA 3RKYA 4I01A 2HZTA 1Z6TA 3MZYA 3DFGA 5FD5A 3V8LA 3M1EA 3N97A 3LFKA 3IRRA 1IZ1A 4U7BA 2STWA 3ECOA 2VE9A 2Z99A 2Y48A 4IXAA 2XKPA 1R5GA 5HVQC 1F4KA 1P4XA 3K2ZA 4LB6B 3KP4A 4BHCA 5DCMA 4LLNA 1LDJA 1HKSA 4GXOA 1ZGAA 2HYFA 3CUOA 5FGMA 4HF2A 1LDKB 5DEQA 3ABUA 1BI0A 5L3BA 5AIPA 4Q4ZF 3V7RA 1ZARA 4P55A 3K9TA 3I5UA 1IRGA 2FA5A 1D8JA 3FXQA 2X0LA 3IL2A 3TOBA 1W7PD 1S7AA 4L9TA 1SFUA 4OU0A 4B09A 5CVIA 4ESFA 2WWYA 4NB5A 3TO7A 3RPQA 3TQNA 1XMKA 4G9YA 1XSDA 3JTHA 1Y0UA 3FX3A 2H09A 3HTUA 2LF8A 2RVCA 2NYXA 4IVNA 4XLNF 4A0XA 2IA2A 3MAJA 4UVBA 4A6EA 2JTVA 1B1BA 1MJ9A 3DEUA 2HGCA 1FBUA 3GF2A 2XAGA 2R7DA 4CO8A 3IWFA 1ZYRF 2W85A 1YLFA 3TDUC 1FSEA 2BGCA 4IF4A 4FX4A 4AIKA 2C6YA 5HOOA 3ZP5A 3EYIA 1LNWA 2G9WA 5J6XA 4YIFA 5DCFA 3M8EA 1GHCA 1ULYA 3WTWC 3NRVA 4HLYA 4PZJA 2KIUA 1UHMA 1G3SA 2CYYA 4UVCA 2DFIA 1QBJA 2GA2A 4MQ9F 2D1HA 1PUEE 4ENMA 4EJTA 1YIOA 1UCRA 4Y17A 1L0OC 4LLGF 3BPVA 1IXSB 2VBXA 1U8RA 1FBSA 3ECHA 4JBAA 1BBYA 5JHUA 4MHGA 2H27A 4WCGA 3DV8A 4B8XA 3MZHA 4WXHA 3HHGA 1O3SA 2HR3A 1O7FA 4HF0A 3CJNA 2IPQX 4EM2A 1HSJA 4LB5A 4BQAA 3M7GA 1XN7A 3E5QA 4UHTA 2Q0OA 3E6MA 4KT5C 3H3ZA 2XASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXF A;  2XIG A;  4M72 A;  2G7U A;  3LAJ A;  3JW4 A;  2KRF A;  1UB9 A;  2OZU A;  2XRN A;  4WXC A;  3F3X A;  2VOO A;  1R36 A;  3V4G A;  1LEB A;  2ZME A;  2DU9 A;  4RB1 A;  4R1H A;  2ZFW A;  1T38 A;  5HS7 A;  3QP5 A;  4QWQ A;  2QVO A;  1IN8 A;  2A3S A;  3EYY A;  4ESB A;  1FC3 A;  5AIQ A;  1FOK A;  3BJ6 A;  5A2Q K;  3FHZ A;  2P7C B;  3TO6 A;  4N9H A;  1J0R A;  2EFW A;  3WG9 A;  2P6S A;  1KGS A;  1TNS A;  1U78 A;  1B4A A;  4LJZ F;  3GFM A;  4EMS A;  3QU6 A;  3I53 A;  4WK8 F;  1F1Z A;  3H3U A;  4ZYD A;  3L00 A;  5L3E A;  3GFJ A;  3LAP A;  3FZV A;  1O3R A;  5F6F A;  1WWX A;  1KYZ A;  4HBL A;  4I7H A;  1JHF A;  5LHG A;  2M8E A;  4LG0 A;  1QPM A;  3SXY A;  3T5X A;  1FX7 A;  4RGX A;  1C0W A;  3KP5 A;  1AWC A;  2CGP A;  1TBX A;  4ENK A;  1DPU A;  1Z6R A;  1RZ4 A;  5FLX Z;  3FF5 A;  2EB7 A;  1A04 A;  3Q9S A;  1O57 A;  1T39 A;  3MEX A;  1SMT A;  5D5V B;  1T0F A;  3WGI A;  1SAX A;  5A2Q Z;  4A5N A;  2XAQ A;  4HDU A;  1QZZ A;  4ZZL A;  2EFN A;  1TQI A;  4CYD A;  1WQ2 A;  2VC0 A;  3ZMU A;  3GXO A;  3J80 K;  5DCM B;  2BBY A;  1AOY A;  4U0V A;  1RIO H;  3I58 A;  3V8K A;  2PJP A;  1FP1 D;  3HSR A;  2ISY A;  3TGN A;  1RUO A;  5ICG A;  4N9I A;  3LA7 A;  2HTS A;  3M8F A;  2FOK A;  4DQ2 A;  1W5S A;  5LGN A;  2CW0 F;  3G3Z A;  2EK5 A;  4RB0 A;  3LQR A;  4A0Z A;  4PGG A;  1KA8 A;  3BDD A;  5D5U B;  1ZHF A;  4HAM A;  3OOP A;  4HV6 A;  3EDP A;  4LK0 F;  2FSW A;  2NS0 A;  2UWM A;  1SD5 A;  5BS6 A;  2DK8 A;  2PG4 A;  1HW5 A;  5D6E A;  2O8X A;  3D0S A;  2L4M A;  3LWF A;  4P9U A;  4HDV A;  2DQR A;  5ILV A;  4O5V A;  4I0B A;  3L7W A;  1K7A A;  3BJA A;  5CVR A;  2A6H F;  3B02 A;  5F1R A;  1PP7 U;  2VBZ A;  2QLZ A;  5L3G A;  2VON A;  2R3S A;  2IW5 A;  2UZK A;  1YTY A;  4H0E A;  3IKT A;  4YII A;  1P2F A;  3R6S A;  3DPT A;  2ZNZ A;  2NNN A;  1XCB A;  3IWZ A;  2V1U A;  2XGX A;  5BPD A;  2O0Y A;  4A12 A;  1B6A A;  1H9T A;  3EQL F;  2V1X A;  1R23 A;  4KNY A;  1UFM A;  4I02 A;  3ZMZ A;  3E5U A;  2NAZ A;  3MCZ A;  4G8X A;  2HQR A;  1XB4 A;  3BOQ A;  2Q2E A;  1BJA A;  5L3C A;  1BI3 A;  3VB2 A;  5TJJ A;  1LJ9 A;  5LLQ A;  5J8F A;  5BMZ A;  3J7A O;  2YX7 A;  4TV7 A;  4K2E A;  3TOA A;  2MLG A;  3RPU A;  2K7L A;  4WXD A;  4XRF A;  2IRF G;  1IW7 F;  2QM3 A;  2XAH A;  4Z2Y A;  5DD8 A;  3HRT A;  3DP7 A;  1R1T A;  4R8H A;  4HF1 A;  3F6V A;  1S7O A;  1ZG1 A;  5DD4 A;  1S3J A;  3RYP A;  2P5V A;  4EJO A;  3I59 A;  2P8T A;  2LNB A;  5BOX A;  1I5Z A;  4AIH A;  2PQ8 A;  1KQ8 A;  1EH7 A;  1F9N A;  3BZ6 A;  3WTX C;  3W6K B;  2MBF A;  2FBK A;  5K1Y A;  3T1B A;  1XGM A;  1QNT A;  4KYW A;  4Q5S F;  1MKM A;  1CF7 A;  4WF2 A;  3GEZ A;  4CGZ A;  2A68 F;  5D8K B;  2ZO4 A;  2ZME B;  4UV9 A;  1DUX C;  1STZ A;  4KUM A;  1OR7 A;  4U0Y A;  3QU3 A;  4M74 A;  4OOI A;  1K78 A;  1ZN2 A;  3SZP A;  3SZT A;  3NEU A;  3ELK A;  3K1P A;  4EJV A;  3RI4 A;  4RS8 A;  1YS6 A;  1MJA A;  2HOE A;  2JT1 A;  3IC7 A;  1V4R A;  2LDU A;  1J9I A;  4M71 A;  1O3Q A;  5EEH A;  5E1W A;  2RC4 A;  2NRA C;  2UXN A;  2E7X A;  3JAM Z;  5ICE A;  2O03 A;  2FF4 A;  3K1N A;  4AVP A;  5ERI A;  4G6Q A;  3CUQ A;  2PFB A;  4YFK F;  1MD0 A;  5IT3 A;  1H9G A;  2CQK A;  5EEG A;  4EGZ A;  2MA3 A;  2CG4 A;  4LG0 B;  4U7D A;  2ETH A;  3HUG A;  1T2K A;  3V7S A;  4RB2 C;  4HZF A;  3IHU A;  1E17 A;  1BI2 A;  2DPU A;  2GXG A;  3JSO A;  2EA2 A;  1HKQ A;  5CJ9 A;  2F5C A;  3ZQ7 A;  3HYI A;  1XMA A;  2K4B A;  2MC3 A;  1W5T A;  1XGO A;  1OYY A;  1SD4 A;  4UVA A;  1XGN A;  4GYI A;  4ASN A;  1R00 A;  1Z1D A;  3F8N A;  4PGH A;  4XBF A;  1TLH B;  3ISP A;  4ZYG A;  3WTU C;  4ENN A;  4G7O F;  1G6N A;  2XVC A;  4AWX B;  2ACJ A;  1OYW A;  4IJA A;  4UUV A;  3BPX A;  1IN4 A;  3KP6 A;  1TQM A;  3ERE D;  3IKV A;  2EV5 A;  1BIB A;  2V6C A;  1VTN C;  1BIA A;  1KYW A;  1FNN A;  1TNT A;  3H92 A;  4IRI A;  3T8R A;  1V3F A;  4IPA A;  2QQA A;  6PAX A;  4MEX F;  2GAU A;  5D5W B;  3KP2 A;  2IVM A;  2A61 A;  4A6D A;  1G4D A;  1B9M A;  3QAH A;  2HTJ A;  2K86 A;  2EV6 A;  2KIF A;  1R58 A;  2O6G E;  4EVI A;  3KP3 A;  3KCC A;  4BYY A;  5E8I A;  1XD7 A;  3MWM A;  5E18 F;  5LBQ A;  1G3T A;  1HKT A;  2H6B A;  3R60 A;  5E17 F;  2CFX A;  3F22 A;  4IHT A;  3I0T A;  4YG2 F;  1I1S A;  2OQG A;  3F72 A;  2EWN A;  4QLC U;  2VOD A;  5FD6 A;  2HFH A;  2DQL A;  5D6F A;  2V9V A;  2VT2 A;  4KDP A;  2ZJ2 A;  2F2E A;  3HSE A;  1HST A;  2TDX A;  4L9J A;  5HLH A;  3LA3 A;  3C1D A;  1HXD A;  2WTE A;  5HDK A;  4KIC A;  4IRH A;  1ZRE A;  1H0M A;  3M9A A;  1MJB A;  5CYV A;  3O2P E;  1IN7 A;  4AIJ A;  2FU4 A;  4LFU A;  4Y15 A;  3SFZ A;  2K4J A;  2XV4 S;  1IXC A;  4KFC A;  4IRG A;  2YPR A;  3E3V A;  2ZBK A;  4PDK A;  3COA C;  4A5M A;  3P9K A;  2RV8 A;  3SQN A;  4ZYH A;  4OIP F;  2VBW A;  3WTZ A;  3REO A;  3GFI A;  5E1X A;  2BE5 F;  1XSV A;  3GFL A;  2BV6 A;  2DT5 A;  4OIR F;  3KZY A;  3RKX A;  3N4M A;  2GIV A;  2PMH A;  2ELH A;  3VFZ A;  5ICC A;  1SD6 A;  4KIB A;  2KKO A;  4OMZ A;  2XRO A;  2DO7 A;  2DI3 A;  2XHK A;  4P5O A;  3I59 B;  5CVU A;  4L9V A;  4HW0 A;  1YW9 A;  4KMU X;  2MH2 A;  4RB3 C;  1S8N A;  3KEO A;  4EM1 A;  4LK1 F;  3AAF A;  1BC8 C;  3ZMT A;  2STT A;  3RDI A;  4F7Z A;  5K5R A;  2YR2 A;  4M6X A;  1IUY A;  3ZMS A;  3GO5 A;  4L5I A;  2HKX A;  2MD5 A;  2RNJ A;  3HHH A;  2P6T A;  5CVJ A;  1OYI A;  1CF7 B;  1P92 A;  1KQ0 A;  2EV0 A;  2PEX A;  2ZXJ A;  1XGS A;  4MTD A;  4BNC A;  3KEQ A;  1LDD A;  2W25 A;  2QUF A;  1TTY A;  2ZKZ A;  3KP7 A;  5JI6 A;  3D5L A;  4CZZ A;  3RTR A;  2F5F A;  4GCV A;  4GYG A;  1ZH5 A;  2P4W A;  4FT8 A;  4G7H F;  2QZ8 A;  2E7W A;  1K78 B;  1R1V A;  1I6X A;  2HKO A;  4RGR A;  2VT3 A;  2DBB A;  2FXA A;  4M6Y A;  5BPI A;  3RKW A;  3CUQ C;  1KU3 A;  2IT0 A;  3J81 K;  1WI9 A;  4OIQ F;  1KU9 A;  3BJO A;  1E2X A;  5E1Z B;  3L9F A;  1YQA A;  1KU2 A;  1J59 A;  1T98 A;  1RI7 A;  2OZ6 A;  1YFH A;  4IHS A;  2EFP A;  4ON0 A;  3V7C A;  1K6O A;  4WWC A;  3BWG A;  2RN7 A;  4KIF A;  4O6J A;  1IRF A;  2MLK A;  5H6R A;  3CUQ B;  5DDG A;  4GGG A;  4L0Z B;  3C18 A;  2RDP A;  4BH9 A;  3FMQ A;  1O7L A;  1FSH A;  1NHA A;  1GXQ A;  4M73 A;  1BI1 A;  2A5Y B;  2FQ3 A;  2OU2 A;  3W6J B;  3J80 Z;  1QZY A;  2GA1 A;  2EJR A;  3G73 A;  1BM9 A;  3GYH X;  1MGT A;  2CO5 A;  5IT9 K;  3TDZ C;  2GXB A;  2QYO A;  1QO0 D;  4RGS A;  1U5T A;  1JGS A;  4D0P A;  1F5T A;  3O3K A;  4LGW A;  4HX7 A;  1RUN A;  1GXP A;  3KLN A;  4HQE A;  2ZNY A;  3BRO A;  5D5X B;  2OAZ A;  4RAY A;  4P96 A;  1PDN C;  1FLI A;  1TQP A;  3L2C A;  4KA4 A;  2Z5U A;  4WX9 A;  5HLI A;  2VBY A;  4L18 B;  2HEO A;  2E1N A;  3HSF A;  1KU7 A;  2YSR A;  2H6C A;  5AON A;  4ENJ A;  1ZRD A;  3PQK A;  1HW2 A;  1IN5 A;  4E70 A;  2Z33 A;  2VN2 A;  3CO7 C;  5LRR A;  1EH8 A;  3WU1 B;  5D4S A;  5DUI A;  2DAO A;  4I0A A;  1J75 A;  3QRF F;  1ZG3 A;  3F6O A;  4RGU A;  2FNP A;  4EM0 B;  2YU3 A;  1ZGJ A;  4JK1 X;  3DPL C;  3VOD A;  3T8T A;  4MTE A;  3HIF A;  1SMY F;  4HX4 A;  1R7J A;  3WOD F;  1FY7 A;  2IA0 A;  2VXZ A;  1ZG5 A;  1XDU A;  3WTS C;  5LHI A;  1YO5 C;  1P6R A;  3KE2 A;  2FRH A;  1ZLK A;  4CIC A;  1EV7 A;  2W57 A;  1Z9C A;  1QQI A;  1IXR C;  2XUB A;  4Q47 A;  3ULQ B;  3C7J A;  1YW8 A;  2KIM A;  2OQR A;  1W7P A;  3VOE A;  4DNC A;  3HTS B;  2NNY A;  2JSC A;  3E5X A;  3GX4 X;  3KZZ A;  2D45 A;  2OD5 A;  4BHB A;  3MFK A;  2EFQ A;  4FHT A;  3FMS A;  3HOS A;  3R4K A;  2AXL A;  3JTG A;  4MNU A;  2QQB A;  3K0L A;  4P9F A;  4I2O A;  2HWV A;  5LEJ A;  3CTA A;  4NHJ A;  5F64 A;  5ED4 A;  2XAF A;  2L3D A;  3VEP A;  1R22 A;  3DF8 A;  3WTY C;  5HS9 A;  1FBQ A;  3GVA A;  1GVJ A;  2L02 A;  5HLG A;  2PI0 A;  3R0A A;  2VE8 A;  3F8M A;  3FM5 A;  4G94 A;  4KN7 X;  3KET A;  1X3U A;  2X4H A;  3DQV C;  1OKR A;  1FYM A;  2DTR A;  4O3M A;  3K69 A;  5FB2 A;  3WTV C;  4KMF A;  2R7F A;  2ESH A;  3U1D A;  3R61 A;  3QPT A;  1YG2 A;  3MQ0 A;  1SFX A;  3RYR A;  1P4A A;  1CGP A;  1JXS A;  2Z3Y A;  4CDG A;  3HRM A;  1JE8 A;  4U0W A;  4EJU A;  1YS7 A;  2LSO A;  3KFW X;  4Q48 A;  2FEZ A;  1WSU A;  1BC7 C;  3E6C C;  2FBI A;  4AD9 A;  3ZN0 A;  3B73 A;  1S6L A;  2MH9 A;  3DXJ F;  4XLP F;  5LRS A;  2JRT A;  2QEN A;  2Y0M A;  1B59 A;  1FWZ A;  1USS A;  1FPQ A;  3CLO A;  2P7V B;  4JQF A;  2OA4 A;  2DPD A;  3GUD A;  1IAW A;  1L3L A;  4HX8 A;  3BP8 A;  1OPC A;  1SD7 A;  5HS8 A;  4EV0 A;  3FMR A;  3K1M A;  1U5T C;  4MEY F;  3LQQ A;  4EJW A;  2IP2 A;  5LGT A;  2XKO A;  2EFO A;  1FP2 A;  4EGY A;  1BOA A;  2FE3 A;  2P5L C;  3U2R A;  3WGG A;  2GZW A;  4BHP A;  3GZ5 A;  4LD5 A;  5FFX A;  5KVR A;  1Z7U A;  1PP8 F;  1R5H A;  2PMU A;  1ONV A;  3OV8 A;  3T0Y A;  4ESJ A;  1LVA A;  3L09 A;  5LHH A;  2Y75 A;  3O6B B;  1MDM A;  1U5T B;  4XSZ F;  4NQW A;  2FML A;  1WRJ A;  2GWR A;  4ETS A;  1S29 A;  2QWW A;  2GQQ A;  3QOP A;  3WE3 A;  1TW3 A;  4S04 A;  1ZRC A;  4FX0 A;  2QBY A;  5TRD A;  2H94 A;  1BN5 A;  5CVV A;  3TKY A;  2P5K A;  4HOB A;  4L9N A;  4ZZD A;  1DPR A;  1ZRF A;  1B9N A;  5ICF A;  3P9C A;  1DP7 P;  3IRQ A;  3CO6 C;  2ESN A;  3I64 A;  1W4M A;  4RAZ A;  4U88 A;  3DKW A;  3Q5F A;  3E6B A;  2ADU A;  4EQQ A;  5FLX K;  3BY6 A;  5L3D A;  2LKP A;  2YX4 A;  1ON2 A;  3Q9V A;  5K5O A;  3FWE A;  2LF7 A;  1U3E M;  4I98 B;  4ZYE A;  3LA2 A;  1EH6 A;  5FO5 A;  2V79 A;  1G3Y A;  4ZH4 F;  5L3F A;  5D4R A;  1UHW A;  1O3T A;  5FFZ A;  2IA1 A;  3HRS A;  4YFN F;  1SFE A;  3GZ6 A;  3SHF A;  3ZMV A;  1XDS A;  3C3W A;  4UXN A;  4MGR A;  1MZB A;  4HYE A;  2COM A;  5E8G A;  2Q8K A;  3F8F A;  4BAY A;  1REP C;  2DW4 A;  1IN6 A;  3EET A;  2CSO A;  3ZPL A;  2RKH A;  5J8C A;  3FXR A;  1D5V A;  5JR3 A;  1P4W A;  4HQM A;  1D8K A;  4L5J A;  1Q1H A;  1I1G A;  1WKM A;  2M30 A;  2OBP A;  1DDN A;  4A2U A;  1HBX G;  5ILS A;  3WE2 A;  1I27 A;  3F23 A;  1Z05 A;  2HDC A;  1FYL A;  1W7P B;  3I71 A;  2PN6 A;  4MQV A;  3R0J A;  2DLL A;  3HRU A;  2UXX A;  3WGH A;  4G7Z F;  5HDN A;  3RJP A;  4GO1 A;  2VC1 A;  2VOP A;  3HOT A;  2J5P A;  3ABT A;  5LGU A;  4M9S A;  2O3F A;  2AS5 F;  1HQC A;  2L4A A;  4M9Z A;  4YFX F;  5JFR A;  3ROU A;  3V8J A;  1JHH A;  4HA8 A;  1Z91 A;  1QGP A;  3P7N A;  2JZY A;  2L01 A;  1ZAO A;  5BQT A;  1R1U A;  1LB2 A;  4LLL A;  5DV5 A;  1U6G A;  4L0Y B;  1XCV A;  2WV0 A;  2JPC A;  3CDH A;  4UV8 A;  4LMY A;  3P9I A;  5D8L B;  1KQ9 A;  1ZLJ A;  2ZCW A;  2M1B A;  1YYV A;  2O61 A;  3EUH A;  2A69 F;  5H6Q A;  2ISZ A;  1HW1 A;  5K5Q A;  2A6E F;  3S2W A;  4OIN F;  2HS5 A;  2W24 A;  1D3Y A;  2FMY A;  2Z9O A;  3LST A;  4HLX A;  2QQ9 A;  2BEO A;  2RGV A;  2J5O A;  3J81 Z;  2HYG D;  4S05 A;  5JVT A;  4N0B A;  2FBH A;  2A07 F;  2L54 A;  1OMI A;  2B0L A;  4KN4 X;  3I4P A;  5ILU A;  1K79 A;  4G6D A;  4M9X A;  2KJB A;  3PFI A;  3U9G A;  2K02 A;  2IJL A;  3F8C A;  3GWZ A;  2JPB A;  4OMY A;  1XSX A;  2BYV E;  5CLS A;  2M5W A;  5KK1 A;  2M87 A;  2W84 A;  3WU0 A;  4HV5 A;  1LQ1 A;  3NQO A;  1FZP B;  3FM3 A;  2E1C A;  3RIR A;  1FT9 A;  3E97 A;  1U2W A;  1RNL A;  4OIO F;  4KIG A;  2KJC A;  5DUK A;  3ZN1 A;  1T6S A;  2D1V A;  4I09 A;  2D2W A;  3ZMD A;  1ON1 A;  3FXU A;  3GLX A;  2PBI A;  3I54 A;  5DYM A;  4R79 A;  4UNO A;  5LEK A;  5E20 A;  5IT9 Z;  4Y13 A;  2CWE A;  5HDG A;  2RQP A;  3F8B A;  4BXU A;  2G7H A;  2PLY A;  2V1D A;  2K27 A;  2FNA A;  4XSX F;  3TO9 A;  1YW7 A;  3ML6 A;  3E6D A;  2M45 A;  2F5E A;  3GW2 A;  2XAJ A;  1IF1 A;  3F21 A;  2F5D A;  1FYK A;  1UST A;  4CHU A;  1MDM B;  1LEA A;  4A0Y A;  3PQJ A;  1G3W A;  1TW2 A;  1J2X A;  2HQN A;  4PCQ A;  3WTT C;  1J7K A;  3KLO A;  3QP6 A;  2WC2 A;  3JAM K;  2QBY B;  3JSP A;  5H20 A;  1ODD A;  2EA4 A;  1J5Y A;  2DK5 A;  3QPH A;  3RKY A;  4I01 A;  2HZT A;  1Z6T A;  3MZY A;  3DFG A;  5FD5 A;  3V8L A;  3M1E A;  3N97 A;  3LFK A;  3IRR A;  1IZ1 A;  4U7B A;  2STW A;  3ECO A;  2VE9 A;  2Z99 A;  2Y48 A;  4IXA A;  2XKP A;  1R5G A;  5HVQ C;  1F4K A;  1P4X A;  3K2Z A;  4LB6 B;  3KP4 A;  4BHC A;  5DCM A;  4LLN A;  1LDJ A;  1HKS A;  4GXO A;  1ZGA A;  2HYF A;  3CUO A;  5FGM A;  4HF2 A;  1LDK B;  5DEQ A;  3ABU A;  1BI0 A;  5L3B A;  5AIP A;  4Q4Z F;  3V7R A;  1ZAR A;  4P55 A;  3K9T A;  3I5U A;  1IRG A;  2FA5 A;  1D8J A;  3FXQ A;  2X0L A;  3IL2 A;  3TOB A;  1W7P D;  1S7A A;  4L9T A;  1SFU A;  4OU0 A;  4B09 A;  5CVI A;  4ESF A;  2WWY A;  4NB5 A;  3TO7 A;  3RPQ A;  3TQN A;  1XMK A;  4G9Y A;  1XSD A;  3JTH A;  1Y0U A;  3FX3 A;  2H09 A;  3HTU A;  2LF8 A;  2RVC A;  2NYX A;  4IVN A;  4XLN F;  4A0X A;  2IA2 A;  3MAJ A;  4UVB A;  4A6E A;  2JTV A;  1B1B A;  1MJ9 A;  3DEU A;  2HGC A;  1FBU A;  3GF2 A;  2XAG A;  2R7D A;  4CO8 A;  3IWF A;  1ZYR F;  2W85 A;  1YLF A;  3TDU C;  1FSE A;  2BGC A;  4IF4 A;  4FX4 A;  4AIK A;  2C6Y A;  5HOO A;  3ZP5 A;  3EYI A;  1LNW A;  2G9W A;  5J6X A;  4YIF A;  5DCF A;  3M8E A;  1GHC A;  1ULY A;  3WTW C;  3NRV A;  4HLY A;  4PZJ A;  2KIU A;  1UHM A;  1G3S A;  2CYY A;  4UVC A;  2DFI A;  1QBJ A;  2GA2 A;  4MQ9 F;  2D1H A;  1PUE E;  4ENM A;  4EJT A;  1YIO A;  1UCR A;  4Y17 A;  1L0O C;  4LLG F;  3BPV A;  1IXS B;  2VBX A;  1U8R A;  1FBS A;  3ECH A;  4JBA A;  1BBY A;  5JHU A;  4MHG A;  2H27 A;  4WCG A;  3DV8 A;  4B8X A;  3MZH A;  4WXH A;  3HHG A;  1O3S A;  2HR3 A;  1O7F A;  4HF0 A;  3CJN A;  2IPQ X;  4EM2 A;  1HSJ A;  4LB5 A;  4BQA A;  3M7G A;  1XN7 A;  3E5Q A;  4UHT A;  2Q0O A;  3E6M A;  4KT5 C;  3H3Z A;  2XAS A; 
#chains in the Genus database with same CATH topology
 1W1W E;  2BY2 A;  4CXF A;  2XIG A;  4M72 A;  1OCR H;  1VF9 A;  2ECC A;  2G7U A;  3LAJ A;  4BAC A;  1QA6 A;  4Z6Y A;  1S72 I;  3JW4 A;  2KRF A;  1UB9 A;  2OZU A;  2XRN A;  4AYB N;  4F55 A;  3IAS 2;  1MH4 A;  4WXC A;  3F3X A;  2VOO A;  2XB0 X;  4XLC A;  5C3E J;  1R36 A;  3V4G A;  2HI3 A;  2LY1 A;  1LEB A;  2E5N A;  2ZME A;  2DU9 A;  2VXD A;  4RB1 A;  4BJ6 C;  2HNH A;  3W2W A;  4R1H A;  2H8W A;  2ZFW A;  2L7Z A;  2OPT A;  1T38 A;  2GOX B;  2X9D A;  1TP4 A;  4M6V A;  5HS7 A;  2R7Z J;  1Y8Q B;  1Z77 A;  3NWS A;  4JX4 A;  5CQG A;  3PSI A;  3GTK J;  2W00 A;  3K6G A;  3QP5 A;  4QWQ A;  2QVO A;  4KIS A;  4HSR A;  4IQ4 A;  2M4G A;  3BT9 A;  2PX9 A;  3CF2 A;  1IN8 A;  2A3S A;  3EYY A;  4ESB A;  1FC3 A;  1YIJ I;  4E7I A;  2FX0 A;  3LSH A;  3GTG J;  5AIQ A;  1FOK A;  3BJ6 A;  5A2Q K;  2R7S A;  3RSN A;  3FHZ A;  2P7C B;  4B44 A;  5FRM A;  3TO6 A;  3S14 J;  4N9H A;  1J0R A;  2EFW A;  5LD2 C;  1GLN A;  4A3K J;  4UUT A;  3A2K A;  1QVT A;  3WG9 A;  1NH3 A;  2IS2 A;  2P6S A;  1YJN I;  1KGS A;  2R7R A;  3RQI A;  1Q1V A;  4NDL A;  1TNS A;  1U78 A;  1B4A A;  2R7U A;  4LJZ F;  3GFM A;  2DDA A;  4EMS A;  3QU6 A;  4FAS D;  3I53 A;  3DU6 A;  4WK8 F;  1F1Z A;  2FD5 A;  3H3U A;  5K7H A;  4ZYD A;  1NK2 P;  3H3V K;  3CP2 A;  2EIK H;  3L00 A;  3OS0 A;  1VND A;  1WVR A;  5L3E A;  1R71 A;  2DA5 A;  5J1R A;  1VQ9 I;  3GFJ A;  3LAP A;  3FZV A;  2JA5 J;  1FJL A;  1O3R A;  5F6F A;  1WWX A;  2BY0 A;  3A01 A;  1KYZ A;  4HBL A;  3PL8 A;  5E3M A;  1MNM C;  2XC7 A;  4I7H A;  5J47 A;  1JHF A;  4XK4 A;  5LHG A;  1HF0 A;  3I9V 2;  2XB5 A;  4JX5 A;  2M8E A;  4LG0 A;  2VPL A;  1QPM A;  1YE9 A;  3JRE A;  1RR8 C;  1DP3 A;  3UNG C;  2R7W A;  4NNJ A;  3SXY A;  4D7M A;  1JI8 A;  3T5X A;  1FX7 A;  4RGX A;  1IUF A;  1C0W A;  4BEH B;  3KP5 A;  4IQJ A;  1AWC A;  2CGP A;  3VPR A;  1TBX A;  5GAE J;  4ENK A;  4Y7N J;  5IPA A;  1DPU A;  1RZ4 A;  1Z6R A;  2GIZ A;  5GPC A;  5FLX Z;  3FF5 A;  2EB7 A;  1A04 A;  1JTX A;  3BG6 A;  3Q9S A;  1N25 A;  1O57 A;  1T39 A;  3MEX A;  1VZ0 A;  1SMT A;  4CCK A;  3G1L A;  1WPK A;  5D5V B;  1HDP A;  2L2O A;  1T0F A;  3WGI A;  1SAX A;  5A2Q Z;  4A5N A;  3BZK A;  2XAQ A;  4J01 A;  1IRX A;  1VI0 A;  2VL8 A;  4HDU A;  1QZZ A;  4DBR A;  4H4K C;  4ZZL A;  2EFN A;  1TQI A;  3M07 A;  1B8I B;  2V9K A;  4CYD A;  3S32 A;  1WQ2 A;  3KYL A;  1VQ7 I;  2QSG X;  3ZRG A;  2VC0 A;  2YU9 J;  3ZMU A;  3GXO A;  3DEW A;  1QZE A;  3J80 K;  5DCM B;  2E60 A;  2KLO A;  1ETX A;  1ETY A;  2BBY A;  1AOY A;  1ETQ A;  2ID3 A;  4U0V A;  1RIO H;  3I58 A;  3CJT B;  4BXX J;  3S15 J;  3V8K A;  2PJP A;  3PM1 A;  1FP1 D;  2R7Q A;  3HSR A;  2ISY A;  1H8A C;  2V6E A;  3TGN A;  1RUO A;  1A5J A;  5ICG A;  5IP7 J;  2YS9 A;  4M3D A;  2B9S A;  4N9I A;  3LA7 A;  2HTS A;  3OL3 A;  3OS1 A;  3M8F A;  2FOK A;  4DQ2 A;  4BJ5 C;  1W5S A;  5LGN A;  1MMS A;  3U21 A;  1BR1 A;  3ERM A;  1XG1 A;  2CW0 F;  3G3Z A;  2EK5 A;  4RB0 A;  3LQR A;  4A0Z A;  2M2E A;  2ELK A;  4PGG A;  1KA8 A;  3EUK L;  3BDD A;  5D5U B;  5IOY A;  3AG3 H;  2AXT C;  4JP0 A;  4HEA 2;  1ZHF A;  4HAM A;  3OOP A;  2E1M C;  4V2G A;  4HV6 A;  3EDP A;  4LK0 F;  4NBQ A;  2FSW A;  2NS0 A;  1JKP C;  3ABM H;  1SD5 A;  2UWM A;  5BS6 A;  2DK8 A;  2PG4 A;  1HW5 A;  5D6E A;  2O8X A;  1XS9 A;  4F91 B;  3CCL I;  3TL4 X;  2XDV A;  2L4M A;  3D0S A;  3LWF A;  1SVL A;  4P9U A;  3LSJ A;  2DQR A;  5B1B H;  4HDV A;  3HDD A;  2RAE A;  2EZK A;  2L7F P;  5ILV A;  4O5V A;  2KPM A;  1FMV A;  2KL4 A;  2OTJ I;  4I0B A;  2EIM H;  4RAG A;  2BW3 B;  3L7W A;  1EF4 A;  4BE1 A;  3IH4 A;  3BJA A;  5CVR A;  3W2V A;  1K7A A;  3S1N J;  2A6H F;  3B02 A;  3Q0W A;  5F1R A;  2BHZ A;  4YEJ A;  1PP7 U;  2VBZ A;  2XF7 A;  3M3Y J;  2QLZ A;  5L3G A;  3S17 J;  2VON A;  2R3S A;  2R7V A;  2E1M B;  4G6T B;  2IW5 A;  4LIV A;  2UZK A;  1YTY A;  1FTT A;  1BW6 A;  2MAB A;  1JUP A;  3IKT A;  4H0E A;  3EUA A;  5H2F C;  1A6I A;  4YII A;  3BTJ A;  1P2F A;  2V1N A;  3R6S A;  1V54 H;  2JK3 A;  1FOW A;  3DPT A;  3DLL F;  2ZNZ A;  5KCM A;  3AKZ A;  2NNN A;  2R93 J;  1XCB A;  3IWZ A;  2ME6 A;  3JRD A;  1N77 A;  2V1U A;  2XGX A;  5BPD A;  2O0Y A;  4A12 A;  1B6A A;  1H9T A;  3EQL F;  3JCU C;  1YOV B;  4NC6 A;  2V1X A;  4IHX A;  1R23 A;  4KNY A;  4BQO A;  3H35 A;  3CJQ B;  4A3M J;  1BA5 A;  2ECB A;  4XR6 A;  3OY9 A;  3OYF A;  1UFM A;  4I02 A;  3H9G A;  3ZMZ A;  3E5U A;  3L2V A;  3C2B A;  2HYJ A;  3HOX J;  3BR0 A;  2NAZ A;  2WBM A;  3MCZ A;  1AHD P;  4G8X A;  2HQR A;  3AFH A;  1XB4 A;  2VJI A;  4FTH A;  1SVM A;  2Y30 A;  3BOQ A;  1VQ5 I;  2OUM A;  4BQQ A;  5C44 J;  2Q2E A;  1BJA A;  5L3C A;  1BI3 A;  3VB2 A;  5TJJ A;  1YX3 A;  1IGN A;  1LJ9 A;  5LLQ A;  4E7S A;  2KDZ A;  2X48 A;  3K4M A;  2XPV A;  1F43 A;  5J8F A;  5BMZ A;  3J7A O;  3JRI A;  4B43 A;  1OCC H;  3CC2 I;  2YX7 A;  4TV7 A;  4K2E A;  3TOA A;  2MLG A;  3RPU A;  4C2U A;  2K7L A;  1MND A;  2QSF X;  2ZFU A;  1ACI A;  1HCR A;  2F48 A;  4WXD A;  4IOA F;  1MIJ A;  3HPH A;  2E36 A;  2HZD A;  3K4C A;  1IW7 F;  2XAH A;  2GBY A;  2EIJ H;  2QM3 A;  3FXL A;  3HRT A;  4XRF A;  3D5R C;  3DP7 A;  5DD8 A;  4Z2Y A;  1R1T A;  3OYG A;  2F5V A;  3BG5 A;  4NUB A;  4C2M J;  2H1L A;  4R8H A;  4CSW A;  4HF1 A;  2DYS H;  3F6V A;  1S7O A;  1ZG1 A;  2DA7 A;  5DD4 A;  4UB8 C;  4A3L J;  1S3J A;  3RYP A;  2P5V A;  2CUE A;  3VYR B;  1QPI A;  2O8K A;  4X1E A;  4EJO A;  2DMN A;  3I59 A;  4XL9 A;  1UHS A;  2EZL A;  1VQO I;  2GLO A;  2P8T A;  3TBI A;  1DU6 A;  2LNB A;  5M5W J;  2NVU B;  5BOX A;  4CH7 A;  9ANT A;  2FUG 2;  1I5Z A;  2ZME C;  3I55 I;  1VQ4 I;  4AIH A;  2PQ8 A;  4V2F A;  1KQ8 A;  1EH7 A;  2A05 A;  1F9N A;  4IX7 A;  1T8I A;  3BZ6 A;  3Q0V A;  2VPR A;  4E4H A;  3DCF A;  3WTX C;  3W6K B;  2L9R A;  2CUZ A;  2MSY A;  2E71 A;  2MBF A;  4ZDP A;  3W2A A;  2FBK A;  5B1A H;  5K1Y A;  3FIW A;  3T1B A;  3LL7 A;  1XGM A;  4A3G J;  1QNT A;  4KYW A;  4Q5S F;  1MKM A;  1LUJ B;  1FTZ A;  1RR7 A;  1CF7 A;  3FK7 A;  4WF2 A;  4BE2 A;  2VKV A;  2QQ8 A;  3GEZ A;  3JRC A;  5F0H A;  1N75 A;  1X3W B;  4F92 B;  4CGZ A;  4D9J A;  2A68 F;  1GV5 A;  3OYI A;  2NOJ B;  2IGK A;  5F04 A;  4D5C A;  5D8K B;  1WJE A;  2ZO4 A;  2ZME B;  3OYM A;  2IS4 A;  2CRG A;  4UV9 A;  5EF6 A;  1DUX C;  2K3P A;  3CCU I;  3CC4 I;  2HQA A;  1STZ A;  1A6Q A;  4KUM A;  2XPU A;  1W5C C;  1OR7 A;  1E0E A;  1J09 A;  4U0Y A;  3G6E I;  2ZXI A;  3QU3 A;  4M74 A;  4OOI A;  1K78 A;  1ZN2 A;  3SZP A;  3SZT A;  3NEU A;  4PSW A;  4C30 A;  3ELK A;  3K1P A;  4EJV A;  2H8R A;  2FQ4 A;  4N4O B;  4RS8 A;  1YS6 A;  2Z2S B;  3RI4 A;  1MJA A;  4IHW A;  2HOE A;  1XX5 A;  2X6X A;  3HB9 A;  2JT1 A;  3FXK A;  3IC7 A;  1V4R A;  3E1S A;  2LDU A;  2K9Q A;  3MKL A;  2JA8 J;  4QIW N;  2VI6 A;  1J9I A;  4M71 A;  1O3Q A;  3CES A;  5EEH A;  1FOX A;  3U1K A;  5E1W A;  1B72 A;  2RC4 A;  2NRA C;  2VJJ A;  4M3E A;  2UXN A;  3BC8 A;  2E7X A;  3JAM Z;  1SFK A;  4C9Y A;  2BY3 A;  5FLM J;  3OYN A;  5ICE A;  2IGM A;  5CQE A;  4XN3 A;  3PUB A;  2O03 A;  3A01 B;  2FF4 A;  3K1N A;  5GP9 A;  4AVP A;  5ERI A;  5IY5 H;  2LMD A;  3RCO A;  3RZD J;  1JJ6 C;  3VYS B;  2DOE A;  4G6Q A;  3CUQ A;  2PFB A;  4YFK F;  1MD0 A;  5IT3 A;  1H9G A;  1T0F C;  2CQK A;  2WY8 Q;  5EEG A;  1PVE A;  2F4O B;  4EGZ A;  2MA3 A;  4D1Q A;  3CMM A;  2CG4 A;  4LG0 B;  4U7D A;  2ETH A;  3HUG A;  3QQA A;  4LG3 A;  1T2K A;  3GLL A;  3H0D A;  3V7S A;  4RB2 C;  2JA2 A;  2W82 A;  4HZF A;  5HOD A;  3IHU A;  1E17 A;  2CJJ A;  3A1Y A;  3X2Q H;  1BI2 A;  3S16 J;  2DPU A;  2JVH A;  3HZJ A;  3WG7 H;  2X1D A;  3GCM A;  2GXG A;  3JSO A;  2EA2 A;  1Y1W J;  1HKQ A;  5CJ9 A;  2F5C A;  4KIT B;  1BJZ A;  3ZQ7 A;  1ORK A;  3HYI A;  3K10 A;  1XMA A;  2K4B A;  1R9T J;  2MC3 A;  1W5T A;  2ICW G;  1XGO A;  3HC7 A;  4G12 A;  1OYY A;  2V7F A;  1SD4 A;  4UVA A;  1XGN A;  4GYI A;  4ASN A;  1R00 A;  3A0H C;  1Z1D A;  3F8N A;  4FCY A;  1HLV A;  4PGH A;  1YI2 I;  3VSL A;  2HVR A;  2WAQ A;  3I3L A;  4XBF A;  1TLH B;  1ETV A;  3ISP A;  4ZYG A;  3BZC A;  3WTU C;  4ENN A;  4G7O F;  1G6N A;  2XVC A;  4AWX B;  1U8B A;  2ACJ A;  4PJL A;  4ZDO A;  1OYW A;  4IL6 C;  4IJA A;  5KHD A;  4UUV A;  3BPX A;  1IN4 A;  2LRD A;  2XAU A;  3KP6 A;  3VWB A;  2HXO A;  1TQM A;  4BQN A;  3ERE D;  3IKV A;  4JYK A;  4II2 A;  2EV5 A;  1BIB A;  2I5U A;  2V6C A;  1VTN C;  1BIA A;  2ELJ A;  1KYW A;  2AO9 A;  2KQR A;  2HPM A;  1FNN A;  1TNT A;  3H92 A;  4IRI A;  2KDO A;  2Q1Z B;  3T8R A;  1V3F A;  3SYT A;  4IPA A;  2QQA A;  2E19 A;  1ZEL A;  6PAX A;  2VAS A;  1E3O C;  1R5I D;  4MFE A;  3OL4 A;  1RC9 A;  1ETK A;  4Y3O A;  4MEX F;  1JTY A;  2GAU A;  5D5W B;  3W6V A;  3KP2 A;  1ENH A;  2IVM A;  3MVP A;  2A61 A;  5CKT A;  3LMM A;  4A6D A;  5EEA A;  1X2M A;  1B9M A;  3QAH A;  1X1P A;  1G4D A;  2EPF A;  2HTJ A;  2K86 A;  2M9H A;  2KZG A;  2EV6 A;  2DA3 A;  1R58 A;  1JT6 A;  2KIF A;  5F0F A;  4EVI A;  2O6G E;  1CQT A;  3KP3 A;  4FE4 A;  3VYU B;  3KCC A;  4BYY A;  5E8I A;  1XD7 A;  3HKZ A;  3MWM A;  5E18 F;  3GTO J;  1V5E A;  2NS7 A;  5LBQ A;  1G3T A;  1JUM A;  1HKT A;  1NK3 P;  1K83 J;  3MZ8 A;  2H6B A;  3PO3 J;  3R60 A;  1ZQ3 P;  5E17 F;  2CFX A;  3F22 A;  4IHT A;  3IP4 B;  3I0T A;  3BR5 A;  4YG2 F;  1XMX A;  5GAG J;  2JQ7 A;  2OQG A;  1I1S A;  2WAQ N;  3TW7 A;  2VKE A;  4IZZ A;  3F72 A;  3S3M A;  2EWN A;  4QLC U;  2VOD A;  5FD6 A;  2LVS A;  2HFH A;  3HM5 A;  2DQL A;  3W3C A;  4EEF G;  5D6F A;  2V9V A;  2VT2 A;  4KDP A;  2ZJ2 A;  1X2N A;  2F2E A;  3HSE A;  3WHC A;  1HST A;  1TWG J;  2LKS A;  3MKZ A;  1SAU A;  2ZJP F;  2TDX A;  1N78 A;  1Z0X A;  3BLY A;  4L9J A;  3LA3 A;  5HLH A;  3HL2 A;  4IHV A;  2HDW A;  1S7E A;  3C1D A;  1HXD A;  4E7Z A;  5GAH J;  1W0U A;  2WTE A;  5HDK A;  4KIC A;  4E7L A;  1OCZ H;  4IRH A;  3J7Y J;  1P7J A;  2A5W A;  1H0M A;  3M9A A;  1ZRE A;  1MJB A;  1V5G A;  3KPH A;  1E3H A;  3O2P E;  5CYV A;  5M5Y J;  4E7K A;  1IN7 A;  2IGN A;  4AIJ A;  2FU4 A;  4LFU A;  4Y15 A;  3SFZ A;  2K4J A;  2XV4 S;  3PIP F;  1IXC A;  4KFC A;  3IUO A;  4IRG A;  4OAY A;  4XKC A;  3BG7 A;  3MKW B;  2YPR A;  1TT0 A;  3E3V A;  4RM2 A;  2ZBK A;  4QTR A;  1JT0 A;  3OOU A;  2QA4 I;  4PDK A;  3COA C;  3QPL A;  4A5M A;  3P9K A;  2HOT A;  1KON A;  2RV8 A;  2JWT A;  2X6O A;  3K70 D;  2IAI A;  2WB1 N;  3SQN A;  4ZYH A;  2V26 A;  4HPQ A;  2LR8 A;  4OIP F;  2Q2E B;  2VBW A;  2ZSI B;  2Y9Z A;  3G2B A;  3WTZ A;  3REO A;  3GFI A;  2BE5 F;  5E1X A;  1XSV A;  3S3N A;  3HG9 A;  3GFL A;  2VQH A;  3S2D J;  2BV6 A;  4ITV A;  4PK4 A;  2DT5 A;  4OIR F;  3HGY A;  3KZY A;  4IO9 F;  2XF5 A;  2KIQ A;  2OCE A;  1TL8 A;  4UUS A;  2Y0S A;  3RKX A;  4E7J A;  4A3D J;  3N4M A;  2GIV A;  2XSJ C;  2PMH A;  2ELH A;  1F36 A;  1I39 A;  5JVG F;  3WHB A;  3VFZ A;  3HBL A;  5ICC A;  2M0C A;  1SD6 A;  4KIB A;  4XMY A;  4A3I J;  2WV1 A;  2ZC2 A;  2KKO A;  4LIT A;  3MN2 A;  4QPQ A;  4OMZ A;  5EG0 A;  1HOM A;  1JUS A;  3RKQ A;  2XRO A;  2DO7 A;  2DI3 A;  2XHK A;  4P5O A;  2WAF A;  1A35 A;  3I59 B;  5CVU A;  2Y9Y A;  4L9V A;  3DWL E;  1MH3 A;  4HW0 A;  1MSE C;  1YW9 A;  5KAI C;  3CCM I;  4KMU X;  2MH2 A;  4DYR A;  1Z7L A;  4RB3 C;  3P5J A;  1S8N A;  1DGW Y;  4XID A;  3KEO A;  2CH0 A;  1BOB A;  2DDB A;  4EM1 A;  4LK1 F;  4C3H J;  2CS3 A;  1K4T A;  1U9O A;  4B1R A;  3NWT A;  3AAF A;  4A69 C;  1BC8 C;  1PYV A;  2CU7 A;  4C3I J;  1M1E B;  3ZMT A;  2STT A;  2YUS A;  3RDI A;  4F7Z A;  1X19 A;  1OR7 C;  1WJB A;  1G2H A;  3MMY B;  5K5R A;  2YR2 A;  4M6X A;  1IUY A;  3ZMS A;  3GO5 A;  4U87 A;  2VIX A;  4L5I A;  2HKX A;  4IHY A;  2MD5 A;  2RNJ A;  5FKK A;  4ZTJ A;  3HHH A;  2P6T A;  3A02 A;  4FIS A;  2KFD A;  5CVJ A;  1X1C A;  1OYI A;  5E79 C;  1CF7 B;  1GVD A;  1P92 A;  4XLE A;  1KQ0 A;  2EV0 A;  2PEX A;  3CP8 A;  2ZXJ A;  1XGS A;  1ITY A;  4MTD A;  5M5X J;  4BNC A;  3KEQ A;  2LTP A;  4BXF A;  2VQC A;  1LDD A;  3PUF A;  2W25 A;  2QUF A;  3HPG A;  1TTY A;  2ZKZ A;  3KP7 A;  5JI6 A;  3D5L A;  4CZZ A;  3RTR A;  2Y31 A;  2F5F A;  2Y0S N;  4GCV A;  1GDT A;  4GYG A;  1ZH5 A;  2P4W A;  4FT8 A;  4G7H F;  2QZ8 A;  1MMN A;  1R6R A;  2E7W A;  2JSP A;  1R1V A;  5DS9 A;  1K78 B;  1I6X A;  1QU3 A;  2HKO A;  4RGR A;  5F1J A;  2X6Y A;  1ERD A;  5J4Y A;  2VT3 A;  2DBB A;  4I6Z A;  2FXA A;  4M6Y A;  3ESW B;  5BPI A;  3RKW A;  3CUQ C;  1IDZ A;  1KU3 A;  1P7I A;  3B6A A;  2X1C A;  2IT0 A;  3J81 K;  2LC2 A;  1WI9 A;  5JLW A;  4OIQ F;  3GBG A;  3Q0U A;  1ETW A;  1KU9 A;  3BJO A;  1E2X A;  5E1Z B;  3L9F A;  1WFX A;  3KYD B;  3QYF A;  3ZQF A;  1QVU A;  1B72 B;  1YQA A;  1WJ5 A;  3FKJ A;  1KU2 A;  1E3P A;  3KZI C;  4HNT A;  1J59 A;  1T98 A;  1RI7 A;  3WU2 C;  3AL0 C;  3OYL A;  2OZ6 A;  1YFH A;  4IHS A;  2EFP A;  4ON0 A;  3V7C A;  5EZH A;  1K6O A;  1ETO A;  3CCY A;  4WWC A;  3BWG A;  1OFC X;  2RN7 A;  4IKF A;  4KIF A;  4XOR A;  4O6J A;  2R5Y A;  3ZOB A;  1IRF A;  2MLK A;  4PJN A;  5H6R A;  3LSP A;  2O7O A;  3H5R A;  3CUQ B;  4DYC A;  5DDG A;  4GGG A;  4L0Z B;  5TGT A;  3C18 A;  1X1A A;  2RDP A;  3CDI A;  4BH9 A;  3FMQ A;  1UG2 A;  4XON A;  4BUP A;  3CCR I;  3HUG B;  1O7L A;  1FSH A;  1NHA A;  1GXQ A;  3FBN B;  4M73 A;  1BI1 A;  2PMZ A;  3FXO A;  4CZC A;  3IAM 2;  2CQN A;  1VQL I;  5J40 A;  2A5Y B;  1LE8 A;  2FQ3 A;  2OU2 A;  3W6J B;  3AL0 B;  3J80 Z;  1QZY A;  4XN0 A;  1D0X A;  1XPX A;  3OSF A;  2GA1 A;  2EJR A;  3G73 A;  1BM9 A;  3GYH X;  1MGT A;  2CO5 A;  3BQZ A;  3L2Q A;  3PJR A;  1Z67 A;  5IT9 K;  1W36 D;  3TDZ C;  2LFB A;  2GXB A;  2QYO A;  1I50 J;  1QO0 D;  4RGS A;  4LOC A;  1U5T A;  1JGS A;  4C3J J;  1QRY A;  2VKH A;  5J1Y A;  1Z3X A;  3TP3 A;  2PJR A;  4DZJ A;  3H5A A;  4BY1 J;  4D0P A;  3G1O A;  1F5T A;  3O3K A;  3G1M A;  4LGW A;  2D5V A;  2M34 A;  3S8P A;  4DIQ A;  4HX7 A;  2LRE A;  2BVM A;  3KIO A;  4II3 A;  1RUN A;  1GXP A;  3HOW J;  2IRF G;  3KLN A;  1GUU A;  4HQE A;  3CCE I;  2CQ7 A;  2ZNY A;  3BRO A;  1YHQ I;  2DMT A;  5D5X B;  1AKH A;  4NC7 A;  2OAZ A;  4RAY A;  4P96 A;  1PDN C;  1FLI A;  1WI3 A;  4RM3 A;  1D1C A;  2DCE A;  3LSM A;  1TQP A;  3L2C A;  2O9L A;  3PNT A;  4KA4 A;  2Z5U A;  4WX9 A;  1NG7 A;  3H9Q A;  5HLI A;  2VBY A;  2NOG A;  4L18 B;  2IXS A;  2HEO A;  2E1N A;  3HSF A;  4OAZ A;  1KU7 A;  2R5Z A;  5GTI C;  1MSF C;  2LK2 A;  2YSR A;  2H6C A;  5AON A;  2BOL A;  3I4M J;  2LLK A;  4ENJ A;  2W7N A;  1ZRD A;  3HOY J;  5B66 C;  3ONQ A;  5DM6 F;  3PQK A;  1HW2 A;  3BCA A;  1IN5 A;  5C4J J;  4E70 A;  1RRJ A;  3G71 I;  2Z33 A;  2VN2 A;  3CO7 C;  5LRR A;  4F93 B;  1IDY A;  1NTC A;  3LOC A;  2DN0 A;  2GM4 A;  2JN6 A;  1EH8 A;  2KRC A;  3FHN A;  3WU1 B;  1MNE A;  5D4S A;  5DUI A;  2DAO A;  3OYB A;  4I0A A;  1J75 A;  3QRF F;  4W97 A;  1ZG3 A;  2R0Q C;  1H89 C;  3F6O A;  1TC3 C;  1MBF A;  5IYC J;  4CCM A;  5IYB J;  4RGU A;  2LKX A;  2FNP A;  4BJT A;  4EM0 B;  2YU3 A;  2X85 A;  1YX5 A;  1ZGJ A;  4JK1 X;  4DYQ A;  3DPL C;  3H0G J;  3VOD A;  3L2W A;  1SC7 A;  3T8T A;  2DA6 A;  1EKE A;  4M3G A;  4MTE A;  3V42 A;  4A93 J;  4DZP A;  1DQU A;  3HIF A;  4GFB A;  1SMY F;  4HX4 A;  1R7J A;  3WOD F;  1OCP A;  1FY7 A;  2VQL A;  4BS9 A;  2IA0 A;  2VXZ A;  1ZG5 A;  1XDU A;  2HU9 A;  3HOU J;  2BVL A;  4XRM A;  5J1U A;  3WTS C;  5LHI A;  1YO5 C;  2I8D A;  1P6R A;  2XSD C;  2VQG A;  3KE2 A;  3OR1 C;  2FRH A;  1FOY A;  2ID6 A;  2QCO A;  4DOZ A;  1ZLK A;  5FLV A;  3IV5 A;  3QPS A;  2WA0 A;  4M3F A;  4CIC A;  3ZQL A;  5B3S H;  1EV7 A;  3VDX A;  2B7E A;  2DT7 B;  2W57 A;  1Z9C A;  1QQI A;  1IXR C;  2XUB A;  4Q47 A;  3ULQ B;  3CME I;  3C7J A;  1YW8 A;  1AA7 A;  2KIM A;  2OQR A;  1TZL A;  2DA2 A;  2DMU A;  2L9S A;  5EZG A;  4GDF A;  1W7P A;  2VB6 A;  2DXI A;  2GXA A;  3VOE A;  4BKX A;  3RZO J;  4DNC A;  1I3Q J;  3HTS B;  2NNY A;  2JSC A;  3E5X A;  3GX4 X;  4A3F J;  2K9S A;  3M8J A;  3KZZ A;  2D45 A;  2DFF A;  2OD5 A;  4BHB A;  3MFK A;  2EFQ A;  4FHT A;  4XRS G;  4UUS B;  3FMS A;  3HOS A;  3R4K A;  2AXL A;  2ME0 A;  3QOE A;  1OQY A;  4MNU A;  2QQB A;  3JTG A;  3OYA A;  3K0L A;  4XRS A;  3VYT B;  2K9L A;  4P9F A;  2QKM B;  4I2O A;  2HWV A;  2CUJ A;  5LEJ A;  5EG0 B;  3CTA A;  4NHJ A;  1SAN A;  5F64 A;  5ED4 A;  2XAF A;  2JMW A;  3M4O J;  2L3D A;  4AM3 A;  4PJ0 C;  5F0C A;  1AU7 A;  3VEP A;  1R22 A;  3DF8 A;  4CUG A;  1LFU P;  1LPQ A;  3KX2 A;  1WJF A;  1XTA A;  3OMY A;  1VQ6 I;  2HOA A;  3WTY C;  2N8G A;  3BR3 A;  5HS9 A;  1BW5 A;  1VQK I;  1FBQ A;  3GVA A;  1GVJ A;  1UJ8 A;  2L02 A;  3DBL B;  1SFO J;  5HLG A;  2PI0 A;  3R0A A;  3ZQI A;  1D1B A;  2AQE A;  2DTZ A;  2VE8 A;  3F8M A;  3FM5 A;  4ANJ A;  3ASO H;  2KHM A;  4G94 A;  4KN7 X;  3KET A;  1MMG A;  5K7F A;  1X3U A;  3QYB A;  4F3Q A;  2IS1 A;  2X4H A;  3DQV C;  1OKR A;  1K4S A;  3KEY A;  3OYH A;  1FYM A;  5J4V A;  2E35 A;  3GTQ J;  2DTR A;  3E7L A;  3HEF A;  4C2T A;  1MW7 A;  4O3M A;  3K69 A;  2E2I J;  5FB2 A;  4Y52 J;  2JA6 J;  3WTV C;  4KMF A;  3BTI A;  3SDB A;  2R7F A;  2ESH A;  3U1D A;  3CF5 F;  3R61 A;  3QPT A;  4PFP A;  4P1W A;  1YG2 A;  1BR2 A;  5EGO A;  2E2H J;  3MQ0 A;  2BXZ A;  5BNG A;  2EZI A;  1V55 H;  2KMU A;  2HQ5 A;  1SFX A;  3RYR A;  5FKM A;  3SEQ A;  1P4A A;  2NVT J;  3ABK H;  1CGP A;  1OCT C;  3GTL J;  1JXS A;  2Z3Y A;  4CDG A;  3RQ4 A;  3HRM A;  1JE8 A;  4U0W A;  4EJU A;  1YS7 A;  2BXY A;  2LSO A;  3BCB A;  1WH5 A;  3GTP J;  3NAU A;  3KFW X;  4XLH A;  4Q48 A;  2FEZ A;  1WSU A;  1BC7 C;  2JRM A;  3OYD A;  2OF7 A;  1Z3Y A;  2EQR A;  3E6C C;  2FBI A;  3MKY B;  1VQP I;  3BG3 A;  4AD9 A;  3ZN0 A;  3J7A Y;  2IS6 A;  1MMD A;  2CQX A;  3B73 A;  1S6L A;  2MH9 A;  3DXJ F;  4XLP F;  3G4S I;  2VJ4 A;  5LRS A;  2JRT A;  2QEN A;  2JUC A;  2KIS A;  2M0M A;  2Y0M A;  3ABL H;  5E3N A;  2HDD A;  1B59 A;  2Z1D A;  1FWZ A;  1USS A;  3EUH C;  1T08 B;  3LFU A;  1WHU A;  1FPQ A;  4AC0 A;  2DA1 A;  1PJR A;  2MYS A;  3FDY A;  4HG2 A;  1I3A A;  3CLO A;  2MFZ A;  1LKX A;  2UV1 A;  2P7V B;  4JQF A;  4QPO A;  2OA4 A;  2DPD A;  3KYC B;  3ZGK A;  5IP9 J;  3A0B C;  1Y8R B;  3GUD A;  4J00 A;  1SEU A;  1U0J A;  2R5Y B;  4XM3 A;  1IAW A;  1L3L A;  3F9K A;  4HX8 A;  3BP8 A;  1OPC A;  2LY2 A;  1SD7 A;  1V5F A;  5HS8 A;  5IP6 A;  4EV0 A;  1IV8 A;  3FMR A;  3K1M A;  1U5T C;  4MEY F;  3LQQ A;  4EJW A;  2A6T A;  2IP2 A;  5LGT A;  1MBJ A;  2EFO A;  2XKO A;  3VSK A;  1FP2 A;  4D7N A;  2CV1 A;  4EGY A;  1BOA A;  2FE3 A;  3I4N J;  2JA7 J;  2P5L C;  2R7X A;  1UMQ A;  2GOM A;  3U2R A;  3WGG A;  1VQM I;  3FIS A;  4X0G A;  2GZW A;  1RKW A;  1LE8 B;  2KP6 A;  2LBF A;  4BHP A;  4E6K G;  3GZ5 A;  3CCJ I;  4RDU A;  3ZQH A;  4LD5 A;  3S1R J;  5FFX A;  5KVR A;  4LIU A;  1Z7U A;  1PP8 F;  1R5H A;  2PMU A;  2W1O A;  1JKR C;  1G8X A;  1ONV A;  3OV8 A;  3T0Y A;  4ESJ A;  1LVA A;  1X58 A;  3L09 A;  1U9N A;  2DOA A;  5LHH A;  2Y75 A;  3C2H A;  3O6B B;  1MDM A;  1U5T B;  4XSZ F;  4NQW A;  3K4N A;  2FML A;  2L9V A;  1WRJ A;  2DYR H;  2GWR A;  2PJR B;  4CA0 A;  4ETS A;  1S29 A;  2K40 A;  2QWW A;  3OYE A;  4B3X A;  2OC6 A;  1FEX A;  4CCN A;  5DM7 F;  4RBO A;  2QSH X;  2GQQ A;  3QOP A;  3WE3 A;  1TW3 A;  4S04 A;  1ZRC A;  5F27 A;  2M7B A;  3S1Q J;  4FX0 A;  5LFA A;  1FIP A;  2QBY A;  5TRD A;  2H94 A;  1Z21 A;  2HVS A;  1T95 A;  2W4S A;  5KNL A;  2E1O A;  2Y69 H;  1BN5 A;  3DPU A;  5CVV A;  4MIM A;  2V4J C;  2P5K A;  3TKY A;  1AKH B;  2W48 A;  4UB6 C;  5FKL A;  4D5F A;  4YIR X;  4HOB A;  4L9N A;  3DBH B;  4ZZD A;  4MFD A;  1DPR A;  1ZRF A;  2ZSH B;  3HOV J;  2XPW A;  1B9N A;  5ICF A;  1X1B A;  3P9C A;  1DP7 P;  3IRQ A;  2WY7 Q;  3CO6 C;  2ESN A;  3I64 A;  3HKZ N;  1W4M A;  5C4X J;  2EH3 A;  4AU7 A;  4X6A J;  1POG A;  1LVK A;  4RAZ A;  4U88 A;  4I99 C;  2M3A A;  3IH3 A;  2DMP A;  3DKW A;  3Q5F A;  2NVQ J;  2M7A A;  2ADU A;  3E6B A;  4EQQ A;  2R5Z B;  5FLX K;  2CUF A;  3FXJ A;  3BY6 A;  5L3D A;  2LKP A;  1A36 A;  2XRL A;  2YX4 A;  4PJM A;  1O4X A;  2OCC H;  2K3F A;  1ON2 A;  3Q9V A;  5K5O A;  3QWL A;  2DOF A;  3J7Z I;  3FWE A;  2LF7 A;  1U3E M;  2NVX J;  2I10 A;  4I98 B;  4M3B A;  2X51 A;  2IEK A;  4ZYE A;  3LA2 A;  4AUX A;  1ZR2 A;  1EH6 A;  1D1A A;  5FO5 A;  2V79 A;  1G3Y A;  2DA4 A;  4ZH4 F;  3CQZ J;  5L3F A;  1UHW A;  4HST A;  5D4R A;  2FOW A;  1O3T A;  4CYC A;  2KRH A;  5FFZ A;  1YRN A;  2IA1 A;  3O8G A;  3HRS A;  3PFY A;  4YFN F;  1SFE A;  4BDZ A;  4ZC3 A;  3GZ6 A;  1IRZ A;  3SHF A;  5M3M J;  2MG4 A;  3ZMV A;  1XDS A;  2DOD A;  3AG1 H;  2OJE D;  3D5S C;  3C3W A;  2OV7 A;  3DKX A;  1S5L C;  3OWT A;  4UXN A;  3TED A;  4MGR A;  3H5N A;  2TCT A;  4HNV A;  1JJ8 C;  1MZB A;  4DJA A;  2NVY J;  4HYE A;  1R4M B;  2COM A;  5E8G A;  2Q8K A;  3F8F A;  4BAY A;  1REP C;  2DW4 A;  1IN6 A;  3EET A;  4IEJ A;  1VQ8 I;  2CSO A;  3ZPL A;  2RKH A;  5F08 A;  3L1P A;  5J8C A;  3FXR A;  1D5V A;  1K6Y A;  5JR3 A;  1P4W A;  4HQM A;  3OIO A;  2RQQ A;  2QF7 A;  2ZB9 A;  4DW6 A;  3L2R A;  2B63 J;  1WH7 A;  3SEZ A;  1D8K A;  4L5J A;  1MBH A;  2VLA A;  1Q1H A;  3ZCO A;  1I1G A;  1RKT A;  1WKM A;  2CW8 A;  2M30 A;  2MC4 A;  2OBP A;  4RA2 A;  1DDN A;  5EYR A;  4A2U A;  3D1N I;  2RNG A;  3DTI A;  1HBX G;  3S3O A;  1QHG A;  3S2H J;  2HOS A;  4PUS A;  1PUF A;  5DTD A;  4JOM A;  5ILS A;  2DMQ A;  3WE2 A;  1I27 A;  3F23 A;  1Z05 A;  2HDC A;  4QSH A;  4GRI A;  3S93 A;  1FYL A;  1W7P B;  2HXI A;  2L5Q A;  3I71 A;  2PN6 A;  1APL C;  4MQV A;  2XF6 A;  3R0J A;  2DLL A;  3HRU A;  2L9N A;  4BGD A;  2UXX A;  3WGH A;  2WAD A;  4G7Z F;  5HDN A;  3RJP A;  2CMP A;  4GO1 A;  2VC1 A;  1QHH D;  2VOP A;  3HOT A;  1YIT I;  3OYC A;  2J5P A;  3ABT A;  5LGU A;  1H88 C;  2K9N A;  4M9S A;  2O3F A;  2AS5 F;  3DU5 A;  1TWF J;  1HQC A;  2L4A A;  2V9P A;  3DLA A;  3GTJ J;  2IGO A;  4M9Z A;  5FRN A;  1R4N B;  4HNU A;  4YFX F;  5JFR A;  3ROU A;  3V8J A;  1JHH A;  1A31 A;  3M1C A;  4HA8 A;  1Z91 A;  3GME A;  1EJ9 A;  1DU0 A;  1QGP A;  3P7N A;  1HA8 A;  2JZY A;  2L01 A;  4PSX A;  2H1K A;  1ZAO A;  5BQT A;  1R1U A;  1LB2 A;  3PNV A;  4LLL A;  4Y33 A;  5DV5 A;  1FIA A;  2KT0 A;  1U6G A;  2M8G X;  4L0Y B;  1XCV A;  2JVG A;  3JRH A;  3K4L A;  3OS2 A;  5M3F J;  1IG7 A;  2WV0 A;  2JPC A;  2P81 A;  3CDH A;  2L7M P;  4UV8 A;  4LMY A;  3P9I A;  5D8L B;  2EBI A;  1KQ9 A;  1ZLJ A;  2ZCW A;  1Y0N A;  1LFB A;  2M1B A;  4BBS J;  1YYV A;  2X1E A;  4W1U A;  2O61 A;  3EUH A;  2RRE A;  3BQY A;  1W0T A;  3H1C A;  2A69 F;  5H6Q A;  2ISZ A;  3I56 I;  1T33 A;  3SZG A;  1HW1 A;  5K5Q A;  3HOZ J;  3DEE A;  2A6E F;  4J19 A;  3S2W A;  2L0K A;  5FKN A;  4NC8 A;  4OIN F;  1VFC A;  2HS5 A;  2W24 A;  1YJ9 I;  1D3Y A;  2FMY A;  4BU2 A;  4ZJZ A;  3MD2 A;  3LST A;  2Z9O A;  4HLX A;  1GT0 C;  1R49 A;  2QQ9 A;  2BEO A;  4XNF A;  1OCO H;  4XLA A;  5IYD J;  2M4K A;  2RGV A;  2J5O A;  3J81 Z;  2CQQ A;  2HYG D;  4S05 A;  5EGO B;  5JVT A;  4N0B A;  2FBH A;  2A07 F;  4CCO A;  3CCQ I;  2L54 A;  1OMI A;  2B0L A;  3BG9 A;  4KN4 X;  2EIN H;  3I4P A;  5ILU A;  1K79 A;  3UKG A;  4G6D A;  4M9X A;  2KJB A;  3PFI A;  4KJZ A;  3U9G A;  2Y2Z A;  2K02 A;  3A03 A;  2IJL A;  3F8C A;  1JKO C;  3GWZ A;  3A4C A;  2JPB A;  2K9M A;  2DT6 A;  4OMY A;  4S0H B;  3CDL A;  1XSX A;  2BYV E;  3GZN B;  5CLS A;  4FE7 A;  5TIS C;  2LD5 A;  2F6C A;  2M5W A;  5KK1 A;  3UR3 C;  3QYE A;  2M87 A;  2W84 A;  3WU0 A;  4HV5 A;  1LQ1 A;  3NQO A;  4B3A A;  1FZP B;  3FM3 A;  3PIO F;  3JRB A;  3H9J A;  2E1C A;  4ZDL A;  1Y1V J;  3RIR A;  1FT9 A;  4XIC A;  3E97 A;  5GAD J;  3BR6 A;  1U2W A;  1RNL A;  4OIO F;  4KIG A;  2KJC A;  2QKL B;  2PMZ N;  5DUK A;  3ZN1 A;  4ZYA A;  3SFI A;  1T6S A;  2D1V A;  3BTC A;  3OIP A;  4AVZ A;  4RMN A;  2NS8 A;  4I09 A;  2D2W A;  3ZMD A;  4BBR J;  2E5Z A;  4RLQ A;  4CCL A;  1ON1 A;  2TRT A;  3FXU A;  2Z16 A;  3GLX A;  2PBI A;  3I54 A;  1X4O A;  3TW6 A;  5GTH C;  2R7O A;  3CLQ A;  3ZR8 X;  1NG6 A;  1WJA A;  3CCS I;  5DYM A;  4R79 A;  4UNO A;  5LEK A;  5E20 A;  5IT9 Z;  5E3O A;  4RAF A;  3CMA I;  2LP0 A;  2G0E A;  2ZXH A;  4Y13 A;  4XLF A;  3TMO A;  1VQN I;  2CWE A;  5HDG A;  3K70 C;  2RQP A;  3F8B A;  4BXU A;  4HRI A;  3SDG A;  3DTK A;  1X1D A;  2QGU A;  2G7H A;  2PLY A;  1LFP A;  2EIL H;  2V1D A;  2K27 A;  2LBF B;  2FNA A;  4XSX F;  2F4I A;  4E7H A;  3TO9 A;  1YW7 A;  5B5E C;  3ML6 A;  3E6D A;  4A3J J;  5JLX A;  2M45 A;  2F5E A;  3HXL A;  2JUG A;  3HJE A;  3GW2 A;  2XAJ A;  4DGW B;  4XQF A;  1IF1 A;  3OR2 C;  3F21 A;  3OSG A;  2F5D A;  1FYK A;  3ZQC A;  3OYJ A;  3L2U A;  1UST A;  1RES A;  2CFO A;  1MBK A;  5KAF C;  3RPU D;  4CHU A;  1MDM B;  1LEA A;  4NQW B;  4A0Y A;  5HLT A;  3PQJ A;  1G3W A;  3DKY A;  1TW2 A;  1J2X A;  3K4J A;  2HQN A;  3BTL A;  4PCQ A;  1XC5 A;  3SJM A;  1IC8 A;  4BY7 J;  3WTT C;  3CCV I;  1GV2 A;  5FJ8 J;  3CC7 I;  1J7K A;  3KLO A;  3QP6 A;  2WC2 A;  4BEH A;  3JAM K;  2QBY B;  5EDN A;  4XOP A;  3JSP A;  5H20 A;  2VKD A;  1ODD A;  2AHQ A;  1D0Z A;  2EA4 A;  1J5Y A;  2DK5 A;  3JRA A;  3QPH A;  1TWH J;  3RKY A;  4I01 A;  2HZT A;  1Z6T A;  2XGD A;  4B4C A;  3MZY A;  3DFG A;  4B47 A;  5FD5 A;  3V8L A;  1T56 A;  3JRF A;  3M1E A;  1X3Z B;  3OIQ A;  3N97 A;  3LFK A;  3IRR A;  1IZ1 A;  4U7B A;  5CPR B;  3LNQ A;  2STW A;  2QEX I;  3ECO A;  4MO7 A;  4DBQ A;  2VE9 A;  1TWC J;  3ASN H;  2Z99 A;  4A3E J;  1DGR M;  2Y48 A;  3DBR B;  3K4B A;  1ZR4 A;  4IXA A;  1B8I A;  1WCM J;  2XKP A;  1R5G A;  5HVQ C;  1F4K A;  1P4X A;  3K2Z A;  4LB6 B;  4YRV A;  1Y39 A;  2R92 J;  4A3C J;  3KP4 A;  4BHC A;  2CW7 A;  2XGC A;  4RLF A;  4XOT A;  1UG0 A;  5DCM A;  5FRO A;  4LLN A;  2HPI A;  3LSK A;  1LDJ A;  3FKI J;  1HKS A;  3FK6 A;  4GXO A;  4YEL A;  2E2J J;  2KZV A;  2P0W A;  1ZGA A;  2HYF A;  3O8H A;  4IOC F;  1ZKG A;  3CUO A;  2LOO A;  4FET A;  1HDD C;  1IV6 A;  3PSF A;  5FGM A;  1ZK8 A;  4HF2 A;  1LDK B;  5DEQ A;  1EA3 A;  3ABU A;  3LSR A;  1MBG A;  3B6C A;  1BI0 A;  1WZ2 A;  5L3B A;  5AIP A;  4MLO A;  4AID A;  2ZJR F;  4Q4Z F;  3FBI B;  3V7R A;  3OYK A;  1UEL B;  1ZAR A;  4P55 A;  1IJW C;  3K9T A;  2EZH A;  3I5U A;  1IRG A;  2R4G A;  2FA5 A;  1D8J A;  3FXQ A;  2VJ5 A;  2L7K A;  3C2G A;  3TP0 A;  2X0L A;  2LY9 A;  4CYC B;  3IL2 A;  3TOB A;  1W7P D;  1S7A A;  4L9T A;  1YRN B;  4UY8 I;  3CD6 I;  1SFU A;  4FQG A;  1ZTR A;  2ZJQ F;  4OU0 A;  1BL0 A;  4B09 A;  5CVI A;  4ESF A;  3BR2 A;  4B48 A;  2WWY A;  2CV2 A;  2NXN B;  3K2A A;  3CJR B;  4XKV A;  4NB5 A;  3TO7 A;  3RPQ A;  3TQN A;  1TWA J;  2O5R A;  1XMK A;  4G9Y A;  1XSD A;  2LYC A;  3JTH A;  2AQF A;  2LG4 A;  1RPW A;  1I6H J;  1Y0U A;  3FX3 A;  2H09 A;  3HTU A;  2LF8 A;  1G59 A;  2RVC A;  3PO2 J;  1FMW A;  4Y4R A;  1OLT A;  2BW3 A;  2MW8 A;  2NYX A;  1UZC A;  1BR4 A;  4IVN A;  4XKW A;  4XLN F;  4N4N B;  4A0X A;  2JJ7 A;  2IA2 A;  2CV0 A;  4A3B J;  1WGX A;  1JKQ C;  2BZT A;  3MAJ A;  3BR1 A;  4UVB A;  5FKO A;  4A6E A;  3Q3S A;  2JTV A;  1B1B A;  4PFO A;  1UAA A;  2R7T A;  1MJ9 A;  5HNH A;  1PUF B;  3AG4 H;  3DEU A;  2HGC A;  1FBU A;  2VUM J;  2FJ1 A;  2K85 A;  3K7A J;  3GF2 A;  2XAG A;  2R7D A;  4BL0 B;  4CO8 A;  3ZQQ A;  3IWF A;  4ABZ A;  1SVO A;  1ZYR F;  2W85 A;  1YLF A;  3TDU C;  1FSE A;  2BGC A;  4IF4 A;  4CCJ A;  4FX4 A;  1W36 C;  4AIK A;  1OIS A;  1JGG A;  3CZ6 A;  2C6Y A;  5HOO A;  1D0Y A;  3ZP5 A;  2OTL I;  3EYI A;  1S9H A;  1YJW I;  1HC8 A;  2F4M B;  3EPZ A;  1LNW A;  2G9W A;  5J6X A;  4YIF A;  3FXM A;  5DCF A;  3LSG A;  3M8E A;  4KT6 A;  1ZGW A;  1GHC A;  1ULY A;  3NAR A;  3WTW C;  4EAT A;  2DJI A;  3NRV A;  1KZH A;  4HLY A;  4PZJ A;  2XGE A;  3IH2 A;  2KIU A;  1UHM A;  1K61 A;  3LSI A;  1G3S A;  2CYY A;  4UVC A;  2DFI A;  1QBJ A;  2BY1 A;  1IO2 A;  2GA2 A;  2X6W A;  4MQ9 F;  2HVQ A;  1WJC A;  2D1H A;  4F52 A;  1PUE E;  2LH9 A;  3HGG A;  4ENM A;  4EJT A;  4PJJ A;  4AYB A;  1YIO A;  3ZXS A;  3S1M J;  1UCR A;  2UUZ A;  2WAE A;  3CMY A;  3N05 A;  4Y17 A;  1Y56 A;  1L0O C;  2K5C A;  2MGQ A;  4LLG F;  5E3L A;  4V19 K;  3K4K A;  3BPV A;  1X4P A;  2BHY A;  5EJC A;  1IXS B;  2WB1 A;  5IOZ A;  2VBX A;  4BDY A;  5GPA A;  1RET A;  3JRG A;  1U8R A;  1FBS A;  3ECH A;  3PNY A;  5JHF A;  1D5Y A;  4JBA A;  2DJN A;  3QOD A;  3DTE A;  4JX6 A;  1BBY A;  5JHU A;  4MHG A;  2H27 A;  3E0J B;  4WCG A;  3DV8 A;  2COB A;  3AG2 H;  4B8X A;  4I76 A;  3MZH A;  3H36 A;  4WXH A;  2IBD A;  3HHG A;  1Y6I A;  4BE0 A;  1O3S A;  3ZQG A;  2HR3 A;  2ZXW H;  1O7F A;  4HF0 A;  1WJD A;  3CJN A;  2IPQ X;  4OWR B;  5HNF A;  4EM2 A;  3F0C A;  5K7Z A;  2MD0 A;  1HSJ A;  3JR9 A;  4LB5 A;  2DFH A;  1P9Q C;  2DFE A;  4ZTF A;  4BQA A;  2E34 A;  3M7G A;  1MMA A;  1TT5 B;  1XN7 A;  4L5E A;  3E5Q A;  4UHT A;  2Q0O A;  1OJL A;  3E6M A;  4XKB A;  3GTM J;  1MBE A;  5J3L A;  4KT5 C;  3H3Z A;  2XAS A; 
#chains in the Genus database with same CATH homology
 4CXF A;  2XIG A;  4M72 A;  2G7U A;  3LAJ A;  3JW4 A;  2KRF A;  1UB9 A;  2OZU A;  2XRN A;  4WXC A;  3F3X A;  2VOO A;  1R36 A;  3V4G A;  1LEB A;  2ZME A;  2DU9 A;  4RB1 A;  4R1H A;  2ZFW A;  1T38 A;  5HS7 A;  3QP5 A;  4QWQ A;  2QVO A;  1IN8 A;  2A3S A;  3EYY A;  4ESB A;  1FC3 A;  5AIQ A;  1FOK A;  3BJ6 A;  5A2Q K;  3FHZ A;  2P7C B;  3TO6 A;  4N9H A;  1J0R A;  2EFW A;  3WG9 A;  2P6S A;  1KGS A;  1TNS A;  1U78 A;  1B4A A;  4LJZ F;  3GFM A;  4EMS A;  3QU6 A;  3I53 A;  4WK8 F;  1F1Z A;  3H3U A;  4ZYD A;  3L00 A;  5L3E A;  3GFJ A;  3LAP A;  3FZV A;  1O3R A;  5F6F A;  1WWX A;  1KYZ A;  4HBL A;  4I7H A;  1JHF A;  5LHG A;  2M8E A;  4LG0 A;  1QPM A;  3SXY A;  3T5X A;  1FX7 A;  4RGX A;  1C0W A;  3KP5 A;  1AWC A;  2CGP A;  1TBX A;  4ENK A;  1DPU A;  1Z6R A;  1RZ4 A;  5FLX Z;  3FF5 A;  2EB7 A;  1A04 A;  3Q9S A;  1O57 A;  1T39 A;  3MEX A;  1SMT A;  5D5V B;  1T0F A;  3WGI A;  1SAX A;  5A2Q Z;  4A5N A;  2XAQ A;  4HDU A;  1QZZ A;  4ZZL A;  2EFN A;  1TQI A;  4CYD A;  1WQ2 A;  2VC0 A;  3ZMU A;  3GXO A;  3J80 K;  5DCM B;  2BBY A;  1AOY A;  4U0V A;  1RIO H;  3I58 A;  3V8K A;  2PJP A;  1FP1 D;  3HSR A;  2ISY A;  3TGN A;  1RUO A;  5ICG A;  4N9I A;  3LA7 A;  2HTS A;  3M8F A;  2FOK A;  4DQ2 A;  1W5S A;  5LGN A;  2CW0 F;  3G3Z A;  2EK5 A;  4RB0 A;  3LQR A;  4A0Z A;  4PGG A;  1KA8 A;  3BDD A;  5D5U B;  1ZHF A;  4HAM A;  3OOP A;  4HV6 A;  3EDP A;  4LK0 F;  2FSW A;  2NS0 A;  2UWM A;  1SD5 A;  5BS6 A;  2DK8 A;  2PG4 A;  1HW5 A;  5D6E A;  2O8X A;  3D0S A;  2L4M A;  3LWF A;  4P9U A;  4HDV A;  2DQR A;  5ILV A;  4O5V A;  4I0B A;  3L7W A;  1K7A A;  3BJA A;  5CVR A;  2A6H F;  3B02 A;  5F1R A;  1PP7 U;  2VBZ A;  2QLZ A;  5L3G A;  2VON A;  2R3S A;  2IW5 A;  2UZK A;  1YTY A;  4H0E A;  3IKT A;  4YII A;  1P2F A;  3R6S A;  3DPT A;  2ZNZ A;  2NNN A;  1XCB A;  3IWZ A;  2V1U A;  2XGX A;  5BPD A;  2O0Y A;  4A12 A;  1B6A A;  1H9T A;  3EQL F;  2V1X A;  1R23 A;  4KNY A;  1UFM A;  4I02 A;  3ZMZ A;  3E5U A;  2NAZ A;  3MCZ A;  4G8X A;  2HQR A;  1XB4 A;  3BOQ A;  2Q2E A;  1BJA A;  5L3C A;  1BI3 A;  3VB2 A;  5TJJ A;  1LJ9 A;  5LLQ A;  5J8F A;  5BMZ A;  3J7A O;  2YX7 A;  4TV7 A;  4K2E A;  3TOA A;  2MLG A;  3RPU A;  2K7L A;  4WXD A;  4XRF A;  2IRF G;  1IW7 F;  2QM3 A;  2XAH A;  4Z2Y A;  5DD8 A;  3HRT A;  3DP7 A;  1R1T A;  4R8H A;  4HF1 A;  3F6V A;  1S7O A;  1ZG1 A;  5DD4 A;  1S3J A;  3RYP A;  2P5V A;  4EJO A;  3I59 A;  2P8T A;  2LNB A;  5BOX A;  1I5Z A;  4AIH A;  2PQ8 A;  1KQ8 A;  1EH7 A;  1F9N A;  3BZ6 A;  3WTX C;  3W6K B;  2MBF A;  2FBK A;  5K1Y A;  3T1B A;  1XGM A;  1QNT A;  4KYW A;  4Q5S F;  1MKM A;  1CF7 A;  4WF2 A;  3GEZ A;  4CGZ A;  2A68 F;  5D8K B;  2ZO4 A;  2ZME B;  4UV9 A;  1DUX C;  1STZ A;  4KUM A;  1OR7 A;  4U0Y A;  3QU3 A;  4M74 A;  4OOI A;  1K78 A;  1ZN2 A;  3SZP A;  3SZT A;  3NEU A;  3ELK A;  3K1P A;  4EJV A;  3RI4 A;  4RS8 A;  1YS6 A;  1MJA A;  2HOE A;  2JT1 A;  3IC7 A;  1V4R A;  2LDU A;  1J9I A;  4M71 A;  1O3Q A;  5EEH A;  5E1W A;  2RC4 A;  2NRA C;  2UXN A;  2E7X A;  3JAM Z;  5ICE A;  2O03 A;  2FF4 A;  3K1N A;  4AVP A;  5ERI A;  4G6Q A;  3CUQ A;  2PFB A;  4YFK F;  1MD0 A;  5IT3 A;  1H9G A;  2CQK A;  5EEG A;  4EGZ A;  2MA3 A;  2CG4 A;  4LG0 B;  4U7D A;  2ETH A;  3HUG A;  1T2K A;  3V7S A;  4RB2 C;  4HZF A;  3IHU A;  1E17 A;  1BI2 A;  2DPU A;  2GXG A;  3JSO A;  2EA2 A;  1HKQ A;  5CJ9 A;  2F5C A;  3ZQ7 A;  3HYI A;  1XMA A;  2K4B A;  2MC3 A;  1W5T A;  1XGO A;  1OYY A;  1SD4 A;  4UVA A;  1XGN A;  4GYI A;  4ASN A;  1R00 A;  1Z1D A;  3F8N A;  4PGH A;  4XBF A;  1TLH B;  3ISP A;  4ZYG A;  3WTU C;  4ENN A;  4G7O F;  1G6N A;  2XVC A;  4AWX B;  2ACJ A;  1OYW A;  4IJA A;  4UUV A;  3BPX A;  1IN4 A;  3KP6 A;  1TQM A;  3ERE D;  3IKV A;  2EV5 A;  1BIB A;  2V6C A;  1VTN C;  1BIA A;  1KYW A;  1FNN A;  1TNT A;  3H92 A;  4IRI A;  3T8R A;  1V3F A;  4IPA A;  2QQA A;  6PAX A;  4MEX F;  2GAU A;  5D5W B;  3KP2 A;  2IVM A;  2A61 A;  4A6D A;  1G4D A;  1B9M A;  3QAH A;  2HTJ A;  2K86 A;  2EV6 A;  2KIF A;  1R58 A;  2O6G E;  4EVI A;  3KP3 A;  3KCC A;  4BYY A;  5E8I A;  1XD7 A;  3MWM A;  5E18 F;  5LBQ A;  1G3T A;  1HKT A;  2H6B A;  3R60 A;  5E17 F;  2CFX A;  3F22 A;  4IHT A;  3I0T A;  4YG2 F;  1I1S A;  2OQG A;  3F72 A;  2EWN A;  4QLC U;  2VOD A;  5FD6 A;  2HFH A;  2DQL A;  5D6F A;  2V9V A;  2VT2 A;  4KDP A;  2ZJ2 A;  2F2E A;  3HSE A;  1HST A;  2TDX A;  4L9J A;  5HLH A;  3LA3 A;  3C1D A;  1HXD A;  2WTE A;  5HDK A;  4KIC A;  4IRH A;  1ZRE A;  1H0M A;  3M9A A;  1MJB A;  5CYV A;  3O2P E;  1IN7 A;  4AIJ A;  2FU4 A;  4LFU A;  4Y15 A;  3SFZ A;  2K4J A;  2XV4 S;  1IXC A;  4KFC A;  4IRG A;  2YPR A;  3E3V A;  2ZBK A;  4PDK A;  3COA C;  4A5M A;  3P9K A;  2RV8 A;  3SQN A;  4ZYH A;  4OIP F;  2VBW A;  3WTZ A;  3REO A;  3GFI A;  5E1X A;  2BE5 F;  1XSV A;  3GFL A;  2BV6 A;  2DT5 A;  4OIR F;  3KZY A;  3RKX A;  3N4M A;  2GIV A;  2PMH A;  2ELH A;  3VFZ A;  5ICC A;  1SD6 A;  4KIB A;  2KKO A;  4OMZ A;  2XRO A;  2DO7 A;  2DI3 A;  2XHK A;  4P5O A;  3I59 B;  5CVU A;  4L9V A;  4HW0 A;  1YW9 A;  4KMU X;  2MH2 A;  4RB3 C;  1S8N A;  3KEO A;  4EM1 A;  4LK1 F;  3AAF A;  1BC8 C;  3ZMT A;  2STT A;  3RDI A;  4F7Z A;  5K5R A;  2YR2 A;  4M6X A;  1IUY A;  3ZMS A;  3GO5 A;  4L5I A;  2HKX A;  2MD5 A;  2RNJ A;  3HHH A;  2P6T A;  5CVJ A;  1OYI A;  1CF7 B;  1P92 A;  1KQ0 A;  2EV0 A;  2PEX A;  2ZXJ A;  1XGS A;  4MTD A;  4BNC A;  3KEQ A;  1LDD A;  2W25 A;  2QUF A;  1TTY A;  2ZKZ A;  3KP7 A;  5JI6 A;  3D5L A;  4CZZ A;  3RTR A;  2F5F A;  4GCV A;  4GYG A;  1ZH5 A;  2P4W A;  4FT8 A;  4G7H F;  2QZ8 A;  2E7W A;  1K78 B;  1R1V A;  1I6X A;  2HKO A;  4RGR A;  2VT3 A;  2DBB A;  2FXA A;  4M6Y A;  5BPI A;  3RKW A;  3CUQ C;  1KU3 A;  2IT0 A;  3J81 K;  1WI9 A;  4OIQ F;  1KU9 A;  3BJO A;  1E2X A;  5E1Z B;  3L9F A;  1YQA A;  1KU2 A;  1J59 A;  1T98 A;  1RI7 A;  2OZ6 A;  1YFH A;  4IHS A;  2EFP A;  4ON0 A;  3V7C A;  1K6O A;  4WWC A;  3BWG A;  2RN7 A;  4KIF A;  4O6J A;  1IRF A;  2MLK A;  5H6R A;  3CUQ B;  5DDG A;  4GGG A;  4L0Z B;  3C18 A;  2RDP A;  4BH9 A;  3FMQ A;  1O7L A;  1FSH A;  1NHA A;  1GXQ A;  4M73 A;  1BI1 A;  2A5Y B;  2FQ3 A;  2OU2 A;  3W6J B;  3J80 Z;  1QZY A;  2GA1 A;  2EJR A;  3G73 A;  1BM9 A;  3GYH X;  1MGT A;  2CO5 A;  5IT9 K;  3TDZ C;  2GXB A;  2QYO A;  1QO0 D;  4RGS A;  1U5T A;  1JGS A;  4D0P A;  1F5T A;  3O3K A;  4LGW A;  4HX7 A;  1RUN A;  1GXP A;  3KLN A;  4HQE A;  2ZNY A;  3BRO A;  5D5X B;  2OAZ A;  4RAY A;  4P96 A;  1PDN C;  1FLI A;  1TQP A;  3L2C A;  4KA4 A;  2Z5U A;  4WX9 A;  5HLI A;  2VBY A;  4L18 B;  2HEO A;  2E1N A;  3HSF A;  1KU7 A;  2YSR A;  2H6C A;  5AON A;  4ENJ A;  1ZRD A;  3PQK A;  1HW2 A;  1IN5 A;  4E70 A;  2Z33 A;  2VN2 A;  3CO7 C;  5LRR A;  1EH8 A;  3WU1 B;  5D4S A;  5DUI A;  2DAO A;  4I0A A;  1J75 A;  3QRF F;  1ZG3 A;  3F6O A;  4RGU A;  2FNP A;  4EM0 B;  2YU3 A;  1ZGJ A;  4JK1 X;  3DPL C;  3VOD A;  3T8T A;  4MTE A;  3HIF A;  1SMY F;  4HX4 A;  1R7J A;  3WOD F;  1FY7 A;  2IA0 A;  2VXZ A;  1ZG5 A;  1XDU A;  3WTS C;  5LHI A;  1YO5 C;  1P6R A;  3KE2 A;  2FRH A;  1ZLK A;  4CIC A;  1EV7 A;  2W57 A;  1Z9C A;  1QQI A;  1IXR C;  2XUB A;  4Q47 A;  3ULQ B;  3C7J A;  1YW8 A;  2KIM A;  2OQR A;  1W7P A;  3VOE A;  4DNC A;  3HTS B;  2NNY A;  2JSC A;  3E5X A;  3GX4 X;  3KZZ A;  2D45 A;  2OD5 A;  4BHB A;  3MFK A;  2EFQ A;  4FHT A;  3FMS A;  3HOS A;  3R4K A;  2AXL A;  3JTG A;  4MNU A;  2QQB A;  3K0L A;  4P9F A;  4I2O A;  2HWV A;  5LEJ A;  3CTA A;  4NHJ A;  5F64 A;  5ED4 A;  2XAF A;  2L3D A;  3VEP A;  1R22 A;  3DF8 A;  3WTY C;  5HS9 A;  1FBQ A;  3GVA A;  1GVJ A;  2L02 A;  5HLG A;  2PI0 A;  3R0A A;  2VE8 A;  3F8M A;  3FM5 A;  4G94 A;  4KN7 X;  3KET A;  1X3U A;  2X4H A;  3DQV C;  1OKR A;  1FYM A;  2DTR A;  4O3M A;  3K69 A;  5FB2 A;  3WTV C;  4KMF A;  2R7F A;  2ESH A;  3U1D A;  3R61 A;  3QPT A;  1YG2 A;  3MQ0 A;  1SFX A;  3RYR A;  1P4A A;  1CGP A;  1JXS A;  2Z3Y A;  4CDG A;  3HRM A;  1JE8 A;  4U0W A;  4EJU A;  1YS7 A;  2LSO A;  3KFW X;  4Q48 A;  2FEZ A;  1WSU A;  1BC7 C;  3E6C C;  2FBI A;  4AD9 A;  3ZN0 A;  3B73 A;  1S6L A;  2MH9 A;  3DXJ F;  4XLP F;  5LRS A;  2JRT A;  2QEN A;  2Y0M A;  1B59 A;  1FWZ A;  1USS A;  1FPQ A;  3CLO A;  2P7V B;  4JQF A;  2OA4 A;  2DPD A;  3GUD A;  1IAW A;  1L3L A;  4HX8 A;  3BP8 A;  1OPC A;  1SD7 A;  5HS8 A;  4EV0 A;  3FMR A;  3K1M A;  1U5T C;  4MEY F;  3LQQ A;  4EJW A;  2IP2 A;  5LGT A;  2XKO A;  2EFO A;  1FP2 A;  4EGY A;  1BOA A;  2FE3 A;  2P5L C;  3U2R A;  3WGG A;  2GZW A;  4BHP A;  3GZ5 A;  4LD5 A;  5FFX A;  5KVR A;  1Z7U A;  1PP8 F;  1R5H A;  2PMU A;  1ONV A;  3OV8 A;  3T0Y A;  4ESJ A;  1LVA A;  3L09 A;  5LHH A;  2Y75 A;  3O6B B;  1MDM A;  1U5T B;  4XSZ F;  4NQW A;  2FML A;  1WRJ A;  2GWR A;  4ETS A;  1S29 A;  2QWW A;  2GQQ A;  3QOP A;  3WE3 A;  1TW3 A;  4S04 A;  1ZRC A;  4FX0 A;  2QBY A;  5TRD A;  2H94 A;  1BN5 A;  5CVV A;  3TKY A;  2P5K A;  4HOB A;  4L9N A;  4ZZD A;  1DPR A;  1ZRF A;  1B9N A;  5ICF A;  3P9C A;  1DP7 P;  3IRQ A;  3CO6 C;  2ESN A;  3I64 A;  1W4M A;  4RAZ A;  4U88 A;  3DKW A;  3Q5F A;  3E6B A;  2ADU A;  4EQQ A;  5FLX K;  3BY6 A;  5L3D A;  2LKP A;  2YX4 A;  1ON2 A;  3Q9V A;  5K5O A;  3FWE A;  2LF7 A;  1U3E M;  4I98 B;  4ZYE A;  3LA2 A;  1EH6 A;  5FO5 A;  2V79 A;  1G3Y A;  4ZH4 F;  5L3F A;  5D4R A;  1UHW A;  1O3T A;  5FFZ A;  2IA1 A;  3HRS A;  4YFN F;  1SFE A;  3GZ6 A;  3SHF A;  3ZMV A;  1XDS A;  3C3W A;  4UXN A;  4MGR A;  1MZB A;  4HYE A;  2COM A;  5E8G A;  2Q8K A;  3F8F A;  4BAY A;  1REP C;  2DW4 A;  1IN6 A;  3EET A;  2CSO A;  3ZPL A;  2RKH A;  5J8C A;  3FXR A;  1D5V A;  5JR3 A;  1P4W A;  4HQM A;  1D8K A;  4L5J A;  1Q1H A;  1I1G A;  1WKM A;  2M30 A;  2OBP A;  1DDN A;  4A2U A;  1HBX G;  5ILS A;  3WE2 A;  1I27 A;  3F23 A;  1Z05 A;  2HDC A;  1FYL A;  1W7P B;  3I71 A;  2PN6 A;  4MQV A;  3R0J A;  2DLL A;  3HRU A;  2UXX A;  3WGH A;  4G7Z F;  5HDN A;  3RJP A;  4GO1 A;  2VC1 A;  2VOP A;  3HOT A;  2J5P A;  3ABT A;  5LGU A;  4M9S A;  2O3F A;  2AS5 F;  1HQC A;  2L4A A;  4M9Z A;  4YFX F;  5JFR A;  3ROU A;  3V8J A;  1JHH A;  4HA8 A;  1Z91 A;  1QGP A;  3P7N A;  2JZY A;  2L01 A;  1ZAO A;  5BQT A;  1R1U A;  1LB2 A;  4LLL A;  5DV5 A;  1U6G A;  4L0Y B;  1XCV A;  2WV0 A;  2JPC A;  3CDH A;  4UV8 A;  4LMY A;  3P9I A;  5D8L B;  1KQ9 A;  1ZLJ A;  2ZCW A;  2M1B A;  1YYV A;  2O61 A;  3EUH A;  2A69 F;  5H6Q A;  2ISZ A;  1HW1 A;  5K5Q A;  2A6E F;  3S2W A;  4OIN F;  2HS5 A;  2W24 A;  1D3Y A;  2FMY A;  2Z9O A;  3LST A;  4HLX A;  2QQ9 A;  2BEO A;  2RGV A;  2J5O A;  3J81 Z;  2HYG D;  4S05 A;  5JVT A;  4N0B A;  2FBH A;  2A07 F;  2L54 A;  1OMI A;  2B0L A;  4KN4 X;  3I4P A;  5ILU A;  1K79 A;  4G6D A;  4M9X A;  2KJB A;  3PFI A;  3U9G A;  2K02 A;  2IJL A;  3F8C A;  3GWZ A;  2JPB A;  4OMY A;  1XSX A;  2BYV E;  5CLS A;  2M5W A;  5KK1 A;  2M87 A;  2W84 A;  3WU0 A;  4HV5 A;  1LQ1 A;  3NQO A;  1FZP B;  3FM3 A;  2E1C A;  3RIR A;  1FT9 A;  3E97 A;  1U2W A;  1RNL A;  4OIO F;  4KIG A;  2KJC A;  5DUK A;  3ZN1 A;  1T6S A;  2D1V A;  4I09 A;  2D2W A;  3ZMD A;  1ON1 A;  3FXU A;  3GLX A;  2PBI A;  3I54 A;  5DYM A;  4R79 A;  4UNO A;  5LEK A;  5E20 A;  5IT9 Z;  4Y13 A;  2CWE A;  5HDG A;  2RQP A;  3F8B A;  4BXU A;  2G7H A;  2PLY A;  2V1D A;  2K27 A;  2FNA A;  4XSX F;  3TO9 A;  1YW7 A;  3ML6 A;  3E6D A;  2M45 A;  2F5E A;  3GW2 A;  2XAJ A;  1IF1 A;  3F21 A;  2F5D A;  1FYK A;  1UST A;  4CHU A;  1MDM B;  1LEA A;  4A0Y A;  3PQJ A;  1G3W A;  1TW2 A;  1J2X A;  2HQN A;  4PCQ A;  3WTT C;  1J7K A;  3KLO A;  3QP6 A;  2WC2 A;  3JAM K;  2QBY B;  3JSP A;  5H20 A;  1ODD A;  2EA4 A;  1J5Y A;  2DK5 A;  3QPH A;  3RKY A;  4I01 A;  2HZT A;  1Z6T A;  3MZY A;  3DFG A;  5FD5 A;  3V8L A;  3M1E A;  3N97 A;  3LFK A;  3IRR A;  1IZ1 A;  4U7B A;  2STW A;  3ECO A;  2VE9 A;  2Z99 A;  2Y48 A;  4IXA A;  2XKP A;  1R5G A;  5HVQ C;  1F4K A;  1P4X A;  3K2Z A;  4LB6 B;  3KP4 A;  4BHC A;  5DCM A;  4LLN A;  1LDJ A;  1HKS A;  4GXO A;  1ZGA A;  2HYF A;  3CUO A;  5FGM A;  4HF2 A;  1LDK B;  5DEQ A;  3ABU A;  1BI0 A;  5L3B A;  5AIP A;  4Q4Z F;  3V7R A;  1ZAR A;  4P55 A;  3K9T A;  3I5U A;  1IRG A;  2FA5 A;  1D8J A;  3FXQ A;  2X0L A;  3IL2 A;  3TOB A;  1W7P D;  1S7A A;  4L9T A;  1SFU A;  4OU0 A;  4B09 A;  5CVI A;  4ESF A;  2WWY A;  4NB5 A;  3TO7 A;  3RPQ A;  3TQN A;  1XMK A;  4G9Y A;  1XSD A;  3JTH A;  1Y0U A;  3FX3 A;  2H09 A;  3HTU A;  2LF8 A;  2RVC A;  2NYX A;  4IVN A;  4XLN F;  4A0X A;  2IA2 A;  3MAJ A;  4UVB A;  4A6E A;  2JTV A;  1B1B A;  1MJ9 A;  3DEU A;  2HGC A;  1FBU A;  3GF2 A;  2XAG A;  2R7D A;  4CO8 A;  3IWF A;  1ZYR F;  2W85 A;  1YLF A;  3TDU C;  1FSE A;  2BGC A;  4IF4 A;  4FX4 A;  4AIK A;  2C6Y A;  5HOO A;  3ZP5 A;  3EYI A;  1LNW A;  2G9W A;  5J6X A;  4YIF A;  5DCF A;  3M8E A;  1GHC A;  1ULY A;  3WTW C;  3NRV A;  4HLY A;  4PZJ A;  2KIU A;  1UHM A;  1G3S A;  2CYY A;  4UVC A;  2DFI A;  1QBJ A;  2GA2 A;  4MQ9 F;  2D1H A;  1PUE E;  4ENM A;  4EJT A;  1YIO A;  1UCR A;  4Y17 A;  1L0O C;  4LLG F;  3BPV A;  1IXS B;  2VBX A;  1U8R A;  1FBS A;  3ECH A;  4JBA A;  1BBY A;  5JHU A;  4MHG A;  2H27 A;  4WCG A;  3DV8 A;  4B8X A;  3MZH A;  4WXH A;  3HHG A;  1O3S A;  2HR3 A;  1O7F A;  4HF0 A;  3CJN A;  2IPQ X;  4EM2 A;  1HSJ A;  4LB5 A;  4BQA A;  3M7G A;  1XN7 A;  3E5Q A;  4UHT A;  2Q0O A;  3E6M A;  4KT5 C;  3H3Z A;  2XAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...