2L06A

Solution nmr structure of the pbs linker polypeptide domain (fragment 254-400) of phycobilisome linker protein apce from synechocystis sp. pcc 6803. northeast structural genomics consortium target sgr209c
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
155
structure length
155
Chain Sequence
PQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGRGPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phycobilisome LCM core-membrane linker polypeptide
publication title Solution NMR structure of the PBS linker polypeptide domain of phycobilisome linker protein apcE from Synechocystis sp. Northeast Structural Genomics Consortium Target SgR209C
rcsb
source organism Synechocystis sp.
molecule tags Protein binding
total genus 44
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00427 PBS_linker_poly Phycobilisome Linker polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3130.20 Mainly Alpha Orthogonal Bundle serine acetyltransferase, domain 1 serine acetyltransferase, domain 1 2l06A00
2KY4A 3NPHB 2L3WA 2L06A 2L8VA 3OHWA 3OSJA 3PRUA
chains in the Genus database with same CATH superfamily
2KY4A 4HZDA 3NPHB 4N6BA 4H7OA 3OSJA 4N69A 3GVDA 3Q1XA 2L3WA 2L06A 3P47A 3PRUA 3F1XA 1SSMA 3MC4A 1SSQA 2L8VA 1T3DA 1S80A 1SSTA 4N6AA 3OHWA 3P1BA 4HZCA
chains in the Genus database with same CATH topology
2KY4A 4HZDA 3NPHB 4N6BA 4H7OA 3OSJA 4N69A 3GVDA 3Q1XA 2L3WA 2L06A 3P47A 3PRUA 3F1XA 1SSMA 3MC4A 1SSQA 2L8VA 1T3DA 1S80A 1SSTA 4N6AA 3OHWA 3P1BA 4HZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KY4 A;  3NPH B;  2L3W A;  2L06 A;  2L8V A;  3OHW A;  3OSJ A;  3PRU A; 
#chains in the Genus database with same CATH topology
 2KY4 A;  4HZD A;  3NPH B;  4N6B A;  4H7O A;  3OSJ A;  4N69 A;  3GVD A;  3Q1X A;  2L3W A;  2L06 A;  3P47 A;  3PRU A;  3F1X A;  1SSM A;  3MC4 A;  1SSQ A;  2L8V A;  1T3D A;  1S80 A;  1SST A;  4N6A A;  3OHW A;  3P1B A;  4HZC A; 
#chains in the Genus database with same CATH homology
 2KY4 A;  4HZD A;  3NPH B;  4N6B A;  4H7O A;  3OSJ A;  4N69 A;  3GVD A;  3Q1X A;  2L3W A;  2L06 A;  3P47 A;  3PRU A;  3F1X A;  1SSM A;  3MC4 A;  1SSQ A;  2L8V A;  1T3D A;  1S80 A;  1SST A;  4N6A A;  3OHW A;  3P1B A;  4HZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...