2L0IA

Solution structure of rtt103 ctd-interacting domain bound to a ser2 phosphorylated ctd peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
136
structure length
136
Chain Sequence
AFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of Ty1 transposition protein 103
publication title Cooperative interaction of transcription termination factors with the RNA polymerase II C-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 53
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l0iA00
3G2TA 3D9MA 1EYHA 3G2SA 3ZYQA 1XGWA 4HFGA 1JWFA 1UJJA 1PY1A 4JXTA 1EDUA 2BF0X 4NACA 3RRUA 1H0AA 2V8SE 3ZYMA 3D9NA 3D9LA 1LF8A 4AVXA 5CMWA 1INZA 1ELKA 1HG5A 2KM4A 3ZYKA 1HF8A 4FLBA 3D9KA 4GZCA 1JWGA 3ZYLA 1MHQA 4Q94A 5LP0A 2MOWA 3G2UA 3D9IA 4GZDA 3ONKA 5J08A 3G2WA 2L0TB 2DCPA 3CLJA 2L0IA 1HFAA 1VDYA 3D9JA 5LOZA 1SZAA 1JPLA 1DVPA 3D9OA 1UJKA 3D9PA 3G2VA 1X5BA 1JUQA 1SZ9A 2LO6A 5CMYA 1HX8A 3LDZA 2DIWA 2QY7A 3ONLA 4Q96A 4FU3A 1HG2A
chains in the Genus database with same CATH superfamily
2XRZA 4DUIA 1JWFA 2BKGA 5A7DB 1QBQA 5JHBA 1SA5A 3L08A 5AENA 3BU8A 4GTMA 5G04C 2E2EA 2X6IA 4G11A 3SBTB 4O1OA 4PH4B 4AJWA 3FU0A 2XENA 4J0UA 4RG9A 4GTOA 1KT0A 4AIFA 2I6HA 2EQXA 5T8IA 3SO8A 4F53A 1TJFA 4A1GA 4KT6B 4HI9A 1HZ4A 4C0MA 1W3BA 1TN6A 4GAAA 4BSZB 4DK5A 4A3TA 1H2UA 1S0PA 1H6KA 3CHQA 4FULA 3U4TA 3BG1B 3QWVA 3APCA 2WMNA 3Q9NC 3MKQA 4N5CA 3QWPA 4L2YA 4G26A 1JWGA 3GYZA 3Q5MA 4UWKA 2WXJA 2RFAA 3DSSA 5B3SE 4RSYA 2AXVA 1X5BA 3DSXA 4MLPA 1K1BA 1K1AA 2XPZA 4JXTA 4CDMA 3KS2A 3OTNA 2H6GA 3ZVVA 3TXMA 2KCLA 4Q69A 4DI3A 5AQAA 1N0QA 2XPYA 2J07A 2XEVA 3V31A 2PM7A 3MEKA 2VGXA 4KZCA 3NOGD 4ANUA 4GA1A 2OV8A 2R03A 5G2NA 4GTRA 3CSTA 2V4LA 2NSZA 2IO3C 1OWMA 4TUMA 2DVWA 5AJLA 1TNOA 2I9CA 4PS7A 2H6FA 4X8QA 2OVFA 4Z68A 3AAAC 3UIOC 4YDEA 1KLXA 2UWJG 2OCCE 4BESA 4BT8A 3KSLA 4KXKB 4Q96A 5BV1A 2WB2A 1MJ0A 1BPOA 3CVLA 3TWWA 4UWGA 5HS0A 2WQHA 3RKVA 4AM9A 4GCOA 3FH5A 2RKKA 2CG2A 3ZNGA 2XEHA 2WXIA 2XRYA 2EIJE 5CRVA 5FZRA 2GRNB 4HOTA 2LXMA 2KZTB 3ML9A 4PUCA 3T8MA 4I9CA 2X3MA 3ZIMA 2V5QC 1HU3A 4B8AA 3RU0A 4I2ZA 5EIDA 4DX5D 3QARA 3ONLA 2KCVA 2KCKA 4U63A 4DLOA 2P2CP 3D9NA 3ZFWA 5M72A 3Q79A 4JVSA 2F37A 1KZPA 4CZ2D 2CG3A 5BPPA 2LUHA 3L22A 5J90A 2EIKE 3K9IA 3LY7A 2C0LA 4F3VA 2OEWA 3OXFA 3UIPC 4U0ZA 5LCWJ 1Z3XA 3JCKC 2KATA 3FUJA 3UPVA 1MZCA 1EDUA 3FUNA 1A5EA 3EJNA 4PDXA 3GZ1A 3CVUA 4TXRA 3D3MA 3DPDA 4XE0A 3PREA 1PC2A 5KNGA 1DCEA 1FT1A 2BTDA 1LD7A 4U07A 3CVVA 5A6CA 3W9FA 3L54A 2YHCA 3R9MA 4EBAG 2J49A 2VSOE 1S70B 2A5UA 2MOWA 2J09A 5AQ7A 2WXRA 4LG6A 2DBAA 3CEQA 2DIWA 2IEJA 1EYHA 4KBQA 3UMVA 5FZSA 1YYHA 3ABKE 2R5SA 1SQMA 3KD7A 3PH0C 3SY2A 3SD5A 1YCSB 5HKPA 5JJTA 1RW2A 3ASDA 1JPLA 4DRXE 3V79K 2J4BA 4FHJA 1Z5SC 4LNGA 3DEOA 2CHWA 5ENSD 2WXOA 4IULA 1OY3D 1O1SA 2PM6A 3KEZA 2XPIA 1LTXA 3HVEB 3Q47B 2IJGX 1FVHA 2Y0BG 2DWZA 1FVFA 4FJZA 5D66A 1IQRA 3LVQE 4GPMA 5A23A 3R7QA 2IU1A 5IY5E 5EKQD 4CYMD 4YVQC 3TWQA 4J7WA 5ANRA 3PDNA 1NA3A 4RQIA 3DXMG 5JJ6A 2P9LG 3FTSA 4HXIA 1HG2A 3LYAA 4UUCA 1IKND 3FH7A 3E4BA 4LNBA 3UKRG 5BUZA 1MX4A 5BXUA 1AWCB 1TR4A 1U3CA 2R2LA 3PEUB 2IO2C 2ETBA 1G3NB 1ELRA 3FUFA 4NIKA 2XZDG 2I2OA 4JEUA 4R7LA 4C48B 5C1DA 5CECB 3ZXSA 4U04A 3URZA 3BEEA 4AY5A 4I1MA 3ENEA 1OWNA 3C3OA 2XS8A 5EIBE 1UJKA 3FTVA 2AXZA 3PEVB 3ZYKA 3ULEG 3D9MA 3CVWA 1OXJA 4HBDA 2AWIA 2X6FA 1FPPA 4BY6A 1HXIA 4GZ6A 1Y6IA 5CBNA 5JHAA 5JJ7A 3ZHEB 1Z3YA 2KZTA 3Q4AB 5HI7A 4FJYA 3G2WA 4XZ4A 4ATZD 3G2VA 5ENNA 2VYIA 2MHKA 5JMND 3AS5A 2XEEA 2CFUA 4J8DA 3SZ7A 3ISMC 3APFA 3EDTB 1QNFA 1N95A 3SQVA 4JW1A 1BU9A 2X6KA 1TEZA 2KBXA 3QDNA 5E76A 4NQ0A 3S7JA 1UW4B 3E33A 4B89A 1OWOA 2E0IA 3TJPA 1BI8B 4P29A 1TN8A 3ONKA 4N39A 1DCQA 1B89A 2VSNA 5CMYA 4LCTA 2I1JA 1Q2ZA 3IKOB 2GROB 2CFZA 4J8YA 3DSWA 1MX6A 1D8DA 3D9LA 2H6IA 4I9EA 2R02A 5EYPF 4J8SA 3MA5A 4CT0A 4QFVA 1H6PA 2GRLA 3DXKG 4U8HA 3O48A 3I4GA 4ILGA 3MGBA 4A3VA 1EPUA 1S64A 3QJZA 5AYWD 2DZNA 4HFGA 3RRUA 4G23A 4A55A 3AU5A 3S2AA 5ANLA 3L13A 5CHEE 4EECA 5AQBA 3UUXA 3LXUX 4F7AA 5ENRD 4RLYA 1QYMA 1H2TC 5LCWC 4U8YD 3U66A 3JYSA 4OVUA 2L6BA 2KM4A 3VLDA 4GCNA 3CK9A 3LCAA 2X38A 3FTUA 2OEVA 3TWRA 4PS8A 3I3NA 2L0TB 3CHPA 2P9NG 1UN8A 3FUMA 3TG4A 4CCAA 4JPSA 1PY1A 4B8CB 5D2MC 2V8SE 2XQ0A 1U3DA 3UINC 4NURA 1N94A 1JCRA 4XKBA 3MYVA 3LJ3A 3FDHA 3PZ1A 4I6JA 4N2SA 2VGEA 1ZB1A 4KVOA 3NZSA 3DSVA 1SA4A 4ILHB 2XCBA 3DPYA 3CQCB 3FU6A 2UY1A 2A4ZA 2PQNA 3SGHA 3E37A 2BKKB 1DC2A 4BERA 4UWLA 1JUQA 3ASNE 4HRMB 2IFUA 1MQSA 5BT1A 5FJYA 3ZKJA 1TNZA 2ETAA 2GW1A 3HXFA 4BEPA 5CCLA 2F8XK 1KPSB 3C72A 5HRYA 1Y8MA 4HRLA 4OYSA 3TWXA 3PZDA 4UQYA 2H6HA 1HFAA 3C98A 5E75A 4E85A 2LAHA 2Y4TA 3EHRA 5B1AE 3QNKA 1A17A 2R17C 4EZLA 3UI2A 2WXFA 4FLBA 1TYQG 2PZIA 5G05J 4LRZA 3TWSA 3ASOE 1HO8A 1NP7A 4LUNU 3AJIA 3IEGA 4CDRA 1MX2A 4Y6WA 3F6QA 4KYOB 3ABLE 2L9BA 3BG0B 3AG4E 2Y1LE 1D9SA 1WM5A 1OCOE 3NOCD 2ZGGA 1E8XA 4U0SA 4JL0A 3ZYQA 4DX7D 3Q73A 2WQ6A 2LSUA 2B6CA 3DWLG 2IF4A 3E34A 2WPVA 4N3AA 4DJAA 4ABNA 1E8ZA 4N5QA 2IQCA 2GRPB 4JB8P 3PZ4A 3B7RL 3TL5A 3FTYA 3Q7AA 4DLQA 4EBAA 4FADA 3ZU7B 2I1KA 1H6OA 1MHQA 3Q75A 3TG5A 3ABME 3FWVA 2P9KG 2FF4A 3G2TA 4XEIG 4L23A 3B7TA 5BV0A 2C0MA 1UJJA 1IYGA 4GMLA 5G04J 1XNFA 2OOEA 5LX8A 4BTBA 2FEZA 2M63A 3IBEA 4GMJA 5D0QD 4GMRA 2NYJA 3FEYA 3LVRE 3FEXA 1X81A 2Y3AA 2QY7A 3PVLA 2J8SD 2MYOA 3PS6A 4G8KA 4UQZA 5CRUA 5AJDA 3OAWA 2P9UG 3LPZA 2AVPA 3ZN3A 4L2LA 2ILRA 2VTBB 4N3BA 3NAWA 2QC9A 3RAUA 2ZGDA 4B93B 1TNBA 2F0YA 5JA4D 2OVBA 4UWHA 3Q7FA 3FUKA 4GZ5A 5EYLA 3E30A 3U64A 3T9KA 2HO1A 3PZ2A 2WM9A 4XI0A 2R05A 3CVPA 3S7DA 3N71A 3FUIA 4FU3A 3I4RB 4KVMA 2XGOA 3NZUA 2QYJA 3RIBA 2VQ2A 5ARFA 4K5BA 2XGSA 4J6IA 3MKRA 5KWDA 2HM8A 3SNXA 4LERA 2HYZA 3T5XA 3UM3A 3CKCA 3PZ3A 4JD2G 2BEDA 4GZ3A 4HLLA 2YINA 3MCXA 4L1BA 5CMWA 3CHMA 3D9KA 3CHSA 3EHMA 3LEWA 3CKBA 4JA7A 3TWVA 4GZDA 2QFCA 2YHEA 2IOSA 2JEKA 4YDOA 2B0OE 3VTXA 3CHRA 4FC8A 5ENOD 1N0RA 1UOHA 1HG5A 3FHEA 3D9HA 3AS8A 5FIOA 4JHRA 3OXLA 2VGXB 3CK7A 3TXNA 5D0OD 3D9OA 4WWPA 3TWTA 3AS4A 3MV3B 2L6JA 3UX4A 3FUHA 3GZ2A 4C0EA 1N4RA 2ZU6B 4K5CA 1BLXB 4G2VA 3SI5A 1N4SA 4KMOA 3SFZA 5BXOA 1NFIE 2P9SG 1TJCA 2DYSE 3UM1A 2WXPA 1DVPA 1O5MA 4ACLA 4HLEA 2JABA 5B1BE 1HH8A 1GW6A 2WQ7A 3LKUA 5FQ6A 2RFMA 4XI9A 3MV2B 4A63B 4RVBA 5CBOA 3U9WA 2EIME 4U96D 4F1SA 2V0PA 3C3QA 4U7EB 5DIZA 4Y6CA 2IY0C 1E96B 2QZAA 2RD0A 2WXLA 1QZ2A 4I1OB 4ZFHA 3FU3A 4XIFA 3GW4A 4YVOA 3HXEA 4WNEA 4EHMA 5AAOA 2J4DA 4HVBA 4AV7A 4HB5A 3HIZA 3FTXA 4MS6A 4L7TA 2BUGA 1NL4A 3AG3E 3G2SA 3PNTB 3UQ3A 3MX3A 3PNLB 4G1TA 5AN8A 1MYOA 4BSXA 3CVXA 3V30A 3DBSA 2RG8A 5FINA 4G24A 5T4YA 5ENPD 4N2QA 2FBNA 4GTSA 3IXEA 5DBKA 2L0IA 5ARGA 4GTVA 3D9PA 3Q78A 3ULQA 5G05C 1H19A 4NACA 3FU5A 3EHNA 4JC8A 3U3WA 3QOUA 1TNUA 2WXKA 3HXDA 4YDWA 4M3OA 4YNDA 1KT1A 5HQ8A 5ITZF 4CEMA 3RK6A 1P5QA 2AJAA 5EILA 3CK8A 3ML8A 3VTYA 2DZOA 2V4HC 2VJ8A 4J8EA 1WY6A 3NBNB 3RRMB 3KSQA 4JHKA 4TUUA 4UI9J 4B94A 4CRWA 2GGFA 3MZLB 1HF8A 4TXPA 3B7UX 3P1UA 3ESLA 1L5JA 3BUAA 3FTWA 4HRNA 1VDYA 3SF4A 3O4ZA 3L9TA 3CSFA 1HX8A 4CGWA 2VTBA 3RO2A 1E8YA 1OWLA 3FUDA 3NQPA 4DI4A 1K8KG 4I17A 3EIJA 1NA0A 4I6EA 2X6HA 3FFLA 4LEUA 4DX6D 3CLJA 2EINE 3PRZA 2CHXA 3RSEG 2P58C 1KZOA 3I5PA 4ANWA 3GZSA 1JCQA 4UWFA 5EN5D 3UXGA 4ANVA 3UT8A 3V2XA 1ELKA 4U8VD 1BI7B 3Q49B 3R7RA 1YMPA 4CT4A 2PL2A 3ZPJA 2P9IG 5KJMA 3ZRHA 3HVEA 2LO6A 1OWPA 4FHKA 1N4PA 4JZYA 3ZGQA 2BF0X 5FQ8A 4DX1A 1IHBA 2X6JA 4WWNA 3B7BA 2WMOA 1O1TA 5EX3A 4WAFA 4GB9A 4TXQA 4LNUD 3JQ1A 2ZXWE 4OAUC 3PUJA 2ETCA 2XZTG 1OCRE 3TAXA 5EDSA 2YNQA 3B95A 1N9AA 2J9QA 3WXXA 1AP7A 1UG3A 1OT8A 3V2OA 1YA0A 4HOSA 2GRQB 4DPRA 3SBSA 5CERB 4U0UA 4IYPA 2AW6A 3P2BA 3UT4A 2LNIA 4BT9A 3EIQC 1O1RA 4CDNA 1QQEA 3EHQA 3L17A 1V55E 2KXPC 4I43A 2FULA 4BFRA 1ZBPA 3X2QE 2V5FA 3HXBA 2Y4UA 2VGYA 3QAQA 3LY9A 4M7CA 4GA0A 4C9BB 4G8LA 3EU5A 4ATGA 3CVYA 1NI1A 3ZEFA 3TWUA 3G2UA 1N11A 4GYOA 3R9AB 1N54A 2PNNA 3DSUA 3LS8A 3WG7E 4K03A 1E7UA 4K5AB 1S63A 1E8WA 1UN9A 2LAIA 3T5VA 3OXGA 3ZHEA 4GYYA 4Q94A 2DCPA 4I2WA 4HOUA 4A1SA 1SZ9A 2WXGA 2YQ8A 4ANXA 4ME2A 1H2VC 3AG2E 5ENQD 5KCMA 4GTQA 3ASFA 5H7PA 4E6HA 4V3IA 4YDYA 4L9PA 5FZQA 1IHGA 3ZYLA 3MJWA 4AY6A 5J08A 4WWOA 3D9JA 1PAQA 3PE4A 3ZUVB 5G55A 2XCCA 4H7XA 2ONDA 4EPZA 3ASGA 3FTZA 3W9GA 4FA6A 1RZ4A 2R59A 4GA2A 1WAO1 3UTMA 1OCCE 1EF1C 4PS3A 3HDXA 3RRNB 1U2VG 2WXNA 5LOZA 4HS2A 2A5EA 4EQFA 3Q9UC 2XHEA 2IOLA 4BX8A 2NXPA 3C5RA 4BETA 5KJKA 4GZCA 1V54E 4FLHA 3ESKA 4HORA 4MBGA 4RG6A 2IONA 1WG0A 4AEZC 3LDZA 2C2LA 3KAEA 1IQUA 4HOQA 2XGMA 3ZYMA 4GTPA 3PE3A 3TGOA 3FY4A 5AIJA 3KEAA 2AXUA 3ULYA 4I1AA 5AQ9A 1Z6TA 3L16A 3B13A 4DX2A 3HHMA 4LSZE 3HXCA 3J5QB 4ZHBA 2NC9A 1H0AA 3RJVA 4H7YA 4AOFA 3L6AA 2VSYA 4O60A 2CHZA 4MRUA 1SW6A 4J8FA 2J08A 3S7BA 1BD8A 5FQ7A 3MKQB 1IXVA 3EUVA 4O6FA 1LF8A 1WDYA 1N52A 3JUIA 5LFAA 4UI9C 3ASHA 4OVVA 1DNPA 4IN3B 3FH8A 2WVIA 5FQ4A 4GTTA 3CHOA 4B0ZA 2UY1B 4HNAD 4F1PA 5BW8C 3UKUG 3UT7A 3DEPA 3CVNA 1FCHA 3UM0A 3D9IA 1E7VA 4OAVB 3L82A 3HRAA 2LXLA 4KZ0A 2ZISA 4CGVA 4WUYA 5T3RA 3UM2A 4AVXA 3CIAA 3Q15A 3AU4A 3NF1A 3QB2A 1FT2A 4ACKA 5LP0A 2WXQA 4URKA 3SFXA 4FP7A 4BTAA 3QC1A 4JA9A 4NRHB 3DRAA 3QKYA 4GPKA 1HE8A 5KBAA 5FT9A 3JQ0A 3AG1E 1K3ZD 4MKTA 3LY8A 4O1PA 2WXHA 3JXIA 2MRIA 4BX9A 2QYUA 2VSXE 1SZAA 4GU5A 2FO7A 4AP2A 3CV0A 2F8YA 2GRMA 4WNFA 2WXMA 5AARA 1LD8A 4AXHA 5KJNA 2XS1A 3J5PA 4TRQA 4UI9K 5FWQA 4JEHA 4WNDA 3E32A 1INZA 1SVXA 3VLFA 4EZJA 2ZIRA 5KJLA 3BQOA 3HYMB 4BWRA 3C3RA 4EZKA 3QWWA 3S7FA 3IHYA 3VLEA 3EU9A 5CEAA 1ZU2A 1D8EA 2FO1E 2P9PG 1TNYA 2EILE 4UQXA 4N3CA 3B7SA 4HQDA 1N4QA 5C2YA 4D10C 2DYRE 2JLBA 4F6RD 3NB2A 2LSVA 5BNWA 1JCSA 4G25A 3T8KA 3FP3A 4XKCA 4QQIA 1XGWA 3APDA 3CVQA 2FI7A 2GRRB 3ZXPA 4XX5A 3IHVA 1HS6A 4W9RA 4HI8A 3CGHA 2HE0A 4IRUA 4U95D 3PUKA 5ENTD 5FTPA 3CR3A 3RO3A 3SFYA 3JUEA 4APFA 2PQRA 2Q7FA 4K0RA 1OCZE 2Y69E 3IV0A 3ZW3A 3LJNA 3HG0D 3FUEA 3CQGB 4GYWA 3JXJA 5EX0A 4WNGA 1TN7A 2KC7A 3QK0A 3FULA 1NZNA 5CCMA 3DSTA 4ILIA 4JHJA 1OUVA 5CEDB 4I6GA 5KNHD 1E90A 4TV3A 3SHFA 2HR2A 1ELWA 4APOA
chains in the Genus database with same CATH topology
3D9MA 2XRZA 3CVWA 1JWFA 2AWIA 2X6FA 4BY6A 4ATGA 5A7DB 3CVYA 2OVBA 5JHBA 4UWHA 3L08A 3ZEFA 1HXIA 5AENA 3FUKA 4GZ5A 3G2UA 5G04C 3U64A 2E2EA 2X6IA 2HO1A 4G11A 4XI0A 2WM9A 4GZ6A 1Y6IA 3CVPA 4GYOA 4PH4B 3S7DA 4AJWA 3FU0A 3R9AB 3N71A 1N54A 3FUIA 4FU3A 3I4RB 4J0UA 4KVMA 4RG9A 1KT0A 2XGOA 5JHAA 3LS8A 3NZUA 4K03A 5JJ7A 1E7UA 3RIBA 3ZHEB 4AIFA 2VQ2A 5ARFA 1Z3YA 2XGSA 1E8WA 1UN9A 2I6HA 4J6IA 2EQXA 2LAIA 2KZTA 3MKRA 5T8IA 2HM8A 4F53A 1TJFA 4A1GA 3Q4AB 4KT6B 1HZ4A 3OXGA 3ZHEA 3T5VA 4C0MA 4GYYA 4Q94A 5HI7A 4FJYA 1W3BA 3G2WA 3SNXA 2DCPA 4LERA 4GAAA 2HYZA 4I2WA 4XZ4A 4HOUA 3T5XA 4DK5A 4A1SA 3CKCA 4A3TA 3G2VA 1H2UA 1SZ9A 5ENNA 2VYIA 2MHKA 2WXGA 2YQ8A 4ANXA 3AS5A 1S0PA 4ME2A 4GZ3A 1H2VC 5KCMA 1H6KA 2YINA 3CHQA 4FULA 2CFUA 3BG1B 3MCXA 3APCA 2WMNA 3QWVA 4J8DA 3SZ7A 3ASFA 4L1BA 5CMWA 3APFA 3MKQA 4N5CA 3QWPA 3CHMA 3EDTB 4L2YA 1QNFA 4V3IA 4E6HA 3D9KA 4G26A 3CHSA 3EHMA 3LEWA 1IHGA 5FZQA 3ZYLA 1JWGA 3CKBA 3MJWA 4JW1A 3GYZA 3Q5MA 4JA7A 4UWKA 4GZDA 4AY6A 5J08A 4WWOA 2QFCA 2WXJA 4RSYA 3D9JA 2YHEA 2IOSA 2JEKA 1PAQA 2X6KA 2AXVA 3PE4A 1TEZA 3QDNA 1X5BA 5E76A 3VTXA 4NQ0A 5G55A 3S7JA 2XCCA 3CHRA 1UW4B 4B89A 4FC8A 4H7XA 4MLPA 1OWOA 2XPZA 4JXTA 2E0IA 2ONDA 4EPZA 4CDMA 3KS2A 3TJPA 3OTNA 3ASGA 3FTZA 1HG5A 4P29A 3ZVVA 3TXMA 4FA6A 3FHEA 2KCLA 2R59A 3AS8A 4GA2A 4Q69A 4DI3A 4JHRA 3OXLA 2VGXB 1WAO1 2XPYA 3ONKA 4N39A 1EF1C 4PS3A 3HDXA 2J07A 3CK7A 2WXNA 5LOZA 3RRNB 3TXNA 2XEVA 5D0OD 2PM7A 1B89A 3D9OA 3MEKA 4WWPA 2VGXA 4KZCA 2VSNA 3AS4A 2L6JA 3MV3B 3FUHA 3GZ2A 4GA1A 2I1JA 4HS2A 4LCTA 3UX4A 4ANUA 3IKOB 4C0EA 2CFZA 2OV8A 4EQFA 2ZU6B 5G2NA 3CSTA 2V4LA 3D9LA 4G2VA 2NSZA 3SI5A 1OWMA 2XHEA 2IOLA 4I9EA 4KMOA 4BX8A 4J8SA 5AJLA 2NXPA 3SFZA 3MA5A 2I9CA 4CT0A 4GZCA 4PS7A 5KJKA 4QFVA 2GRLA 4FLHA 1TJCA 2OVFA 4U8HA 3O48A 1KLXA 3ESKA 4HORA 2WXPA 1DVPA 2UWJG 2IONA 3I4GA 4RG6A 4BT8A 4AEZC 4ACLA 4ILGA 4HLEA 3LDZA 4KXKB 3MGBA 2C2LA 4Q96A 4A3VA 5BV1A 1EPUA 2WB2A 1HH8A 1IQUA 1GW6A 3KAEA 3QJZA 2WQ7A 5AYWD 3LKUA 4HFGA 5FQ6A 4HOQA 1BPOA 3RRUA 4XI9A 2XGMA 3CVLA 3ZYMA 4UWGA 2WQHA 3PE3A 3RKVA 3TGOA 3MV2B 4G23A 3FY4A 4AM9A 4GCOA 3FH5A 4A55A 5AIJA 2AXUA 3AU5A 4I1AA 4RVBA 1Z6TA 3L16A 3L13A 5CHEE 5ANLA 3S2AA 4EECA 3U9WA 3B13A 4F1SA 2V0PA 3UUXA 3LXUX 3HHMA 2CG2A 4F7AA 2WXIA 5DIZA 2XRYA 4Y6CA 1E96B 1H2TC 5LCWC 2RD0A 5FZRA 2NC9A 4HOTA 2KZTB 2WXLA 3ML9A 3U66A 1H0AA 1QZ2A 3JYSA 4I1OB 4PUCA 4I9CA 3FU3A 4OVUA 4XIFA 3T8MA 2X3MA 2KM4A 3GW4A 3VLDA 4GCNA 3CK9A 3LCAA 4YVOA 3ZIMA 2X38A 3FTUA 3RJVA 4H7YA 4AOFA 4WNEA 3L6AA 2VSYA 4PS8A 1HU3A 4B8AA 3I3NA 3RU0A 2L0TB 4I2ZA 2CHZA 2J4DA 3CHPA 4MRUA 3QARA 1UN8A 3HIZA 4AV7A 4J8FA 4HVBA 3FUMA 3FTXA 2J08A 3ONLA 2KCVA 4L7TA 4MS6A 3S7BA 3TG4A 2BUGA 5FQ7A 2KCKA 4CCAA 3G2SA 3PNTB 3MKQB 4U63A 3UQ3A 4JPSA 3MX3A 3PNLB 4G1TA 1PY1A 4DLOA 4B8CB 4BSXA 3CVXA 2V8SE 2XQ0A 3D9NA 2RG8A 3DBSA 4O6FA 4JVSA 1LF8A 1U3DA 3ZFWA 5M72A 4G24A 4NURA 5T4YA 4N2QA 1N52A 2FBNA 3JUIA 4XKBA 5LFAA 5DBKA 4UI9C 3ASHA 3MYVA 3LJ3A 3FDHA 4OVVA 2L0IA 1DNPA 2CG3A 3FH8A 4IN3B 4I6JA 5ARGA 4N2SA 5BPPA 2WVIA 3L22A 3D9PA 5FQ4A 3SBTB 3ULQA 4KVOA 3NZSA 5J90A 5G05C 3CHOA 4B0ZA 4ILHB 1H19A 2UY1B 3K9IA 3LY7A 2XCBA 4NACA 2C0LA 5BW8C 3CQCB 4F3VA 3OXFA 3FU6A 3UT7A 4U0ZA 3CVNA 3FU5A 2UY1A 1FCHA 2A4ZA 2PQNA 3EHNA 3SGHA 4JC8A 5LCWJ 3U3WA 3QOUA 3D9IA 1E7VA 1Z3XA 3JCKC 2KATA 2WXKA 3FUJA 4UWLA 1JUQA 3UPVA 1EDUA 3FUNA 4M3OA 4KZ0A 3EJNA 2IFUA 4PDXA 4CGVA 1MQSA 3GZ1A 3CVUA 5BT1A 3D3MA 4WUYA 3DPDA 4XE0A 4YNDA 3PREA 5FJYA 5T3RA 1KT1A 5HQ8A 2GW1A 4AVXA 3CIAA 5CCLA 1PC2A 3Q15A 4CEMA 2BTDA 3AU4A 3NF1A 4U07A 3RK6A 1P5QA 3QB2A 1Y8MA 3CK8A 4OYSA 4ACKA 2WXQA 5LP0A 3PZDA 3ML8A 4UQYA 3VTYA 4URKA 3CVVA 1HFAA 4FP7A 3C98A 4BTAA 3QC1A 5E75A 5A6CA 2VJ8A 4J8EA 1WY6A 4JA9A 4E85A 3RRMB 2LAHA 4NRHB 4TUUA 4JHKA 3L54A 2YHCA 3QKYA 4GPKA 2Y4TA 5CMYA 1HE8A 5FT9A 3JQ0A 4UI9J 4B94A 4MKTA 3LY8A 3QNKA 4CRWA 1A17A 4EBAG 2J49A 2R17C 4EZLA 2GGFA 3MZLB 2WXFA 1HF8A 4FLBA 3B7UX 2WXHA 2VSOE 2A5UA 3P1UA 2PZIA 5G05J 4LRZA 2MOWA 3ESLA 2J09A 2MRIA 1L5JA 4BX9A 3FTWA 1VDYA 2VSXE 2WXRA 1SZAA 3O4ZA 3SF4A 4GU5A 2FO7A 4AP2A 3CV0A 2DBAA 2GRMA 3CSFA 3CEQA 1HO8A 1HX8A 1NP7A 2DIWA 4CGWA 4WNFA 4LUNU 2WXMA 2VTBA 1EYHA 3IEGA 3RO2A 4CDRA 4KBQA 1E8YA 3UMVA 1OWLA 4AXHA 5FZSA 3FUDA 3NQPA 5KJNA 4TRQA 4DI4A 4UI9K 4Y6WA 5FWQA 2R5SA 4I17A 4JEHA 4KYOB 4WNDA 1INZA 3VLFA 4EZJA 5KJLA 1SQMA 3EIJA 1NA0A 3HYMB 3KD7A 4BWRA 2L9BA 3PH0C 3BG0B 2X6HA 4I6EA 3FFLA 4EZKA 3QWWA 3S7FA 3SD5A 4LEUA 1WM5A 3IHYA 3VLEA 5JJTA 3CLJA 3ASDA 3PRZA 1JPLA 1ZU2A 2J4BA 2CHXA 4FHJA 1E8XA 2CHWA 4U0SA 2P58C 4JL0A 3ZYQA 2WXOA 3I5PA 4IULA 4UQXA 2WQ6A 4ANWA 3GZSA 4N3CA 4UWFA 3B7SA 2LSUA 4ANVA 3UT8A 2PM6A 5C2YA 1ELKA 4D10C 3KEZA 3Q49B 2XPIA 2IF4A 3HVEB 3R7RA 3Q47B 2WPVA 4CT4A 2IJGX 2PL2A 2JLBA 4N3AA 3U4TA 1FVHA 3ZPJA 4DJAA 2LSVA 4ABNA 1E8ZA 1FVFA 5BNWA 4G25A 5KJMA 4FJZA 3FP3A 3HVEA 1IQRA 2LO6A 3ZRHA 1OWPA 3LVQE 4FHKA 2IQCA 4XKCA 4JZYA 3ZGQA 5A23A 3B7RL 3TL5A 1XGWA 3FTYA 3R7QA 2IU1A 2BF0X 5FQ8A 3APDA 5EKQD 3ZN3A 4DLQA 4EBAA 4FADA 2X6JA 3CVQA 2FI7A 4YVQC 4WWNA 2I1KA 4XX5A 1MHQA 2WMOA 3PDNA 3IHVA 1NA3A 1HS6A 5ANRA 3TG5A 5JJ6A 5EX3A 4WAFA 4GB9A 3FWVA 4W9RA 3FTSA 3CGHA 3JQ1A 4HXIA 4IRUA 2FF4A 1HG2A 3LYAA 3PUKA 3G2TA 3FH7A 3PUJA 3B7TA 4L23A 3E4BA 2C0MA 3CR3A 5FTPA 5BV0A 3RO3A 1UJJA 3TAXA 1IYGA 4GMLA 5G04J 4APFA 5EDSA 2YNQA 5BUZA 1XNFA 2J9QA 2OOEA 2PQRA 2Q7FA 4K0RA 3WXXA 5LX8A 4BTBA 1UG3A 2FEZA 2M63A 3IV0A 3ZW3A 3IBEA 1U3CA 4GMJA 5D0QD 3PEUB 1YA0A 4HOSA 3FUEA 4DPRA 3SBSA 3CQGB 2AW6A 3P2BA 4IYPA 4U0UA 2LNIA 3FEYA 3LVRE 4GYWA 3EIQC 3FEXA 3UT4A 2Y3AA 4BT9A 2QY7A 3PVLA 5EX0A 4CDNA 4WNGA 1QQEA 1ELRA 3FUFA 2I2OA 3L17A 3PS6A 4JEUA 2KC7A 4R7LA 3QK0A 5C1DA 4I43A 3ZXSA 4UQZA 3FULA 1NZNA 2FULA 4U04A 4BFRA 5CCMA 5AJDA 3OAWA 4ILIA 4JHJA 3URZA 1ZBPA 1OUVA 3BEEA 3LPZA 4I6GA 2AVPA 2V5FA 4AY5A 3ENEA 2Y4UA 1OWNA 2ILRA 1E90A 2VGYA 3QAQA 4I1MA 4L2LA 4TV3A 3LY9A 4C9BB 4GA0A 2VTBB 3SHFA 2HR2A 4N3BA 1UJKA 3FTVA 1ELWA 2AXZA 3PEVB 4APOA 3ZYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2T A;  3D9M A;  1EYH A;  3G2S A;  3ZYQ A;  1XGW A;  4HFG A;  1JWF A;  1UJJ A;  1PY1 A;  4JXT A;  1EDU A;  2BF0 X;  4NAC A;  3RRU A;  1H0A A;  2V8S E;  3ZYM A;  3D9N A;  3D9L A;  1LF8 A;  4AVX A;  5CMW A;  1INZ A;  1ELK A;  1HG5 A;  2KM4 A;  3ZYK A;  1HF8 A;  4FLB A;  3D9K A;  4GZC A;  1JWG A;  3ZYL A;  1MHQ A;  4Q94 A;  5LP0 A;  2MOW A;  3G2U A;  3D9I A;  4GZD A;  3ONK A;  5J08 A;  3G2W A;  2L0T B;  2DCP A;  3CLJ A;  2L0I A;  1HFA A;  1VDY A;  3D9J A;  5LOZ A;  1SZA A;  1JPL A;  1DVP A;  3D9O A;  1UJK A;  3D9P A;  3G2V A;  1X5B A;  1JUQ A;  1SZ9 A;  2LO6 A;  5CMY A;  1HX8 A;  3LDZ A;  2DIW A;  2QY7 A;  3ONL A;  4Q96 A;  4FU3 A;  1HG2 A; 
#chains in the Genus database with same CATH topology
 2XRZ A;  4DUI A;  1JWF A;  2BKG A;  5A7D B;  1QBQ A;  5JHB A;  1SA5 A;  3L08 A;  5AEN A;  3BU8 A;  4GTM A;  5G04 C;  2E2E A;  2X6I A;  4G11 A;  3SBT B;  4O1O A;  4PH4 B;  4AJW A;  3FU0 A;  2XEN A;  4J0U A;  4RG9 A;  4GTO A;  1KT0 A;  4AIF A;  2I6H A;  2EQX A;  5T8I A;  3SO8 A;  4F53 A;  1TJF A;  4A1G A;  4KT6 B;  4HI9 A;  1HZ4 A;  4C0M A;  1W3B A;  1TN6 A;  4GAA A;  4BSZ B;  4DK5 A;  4A3T A;  1H2U A;  1S0P A;  1H6K A;  3CHQ A;  4FUL A;  3U4T A;  3BG1 B;  3QWV A;  3APC A;  2WMN A;  3Q9N C;  3MKQ A;  4N5C A;  3QWP A;  4L2Y A;  4G26 A;  1JWG A;  3GYZ A;  3Q5M A;  4UWK A;  2WXJ A;  2RFA A;  3DSS A;  5B3S E;  4RSY A;  2AXV A;  1X5B A;  3DSX A;  4MLP A;  1K1B A;  1K1A A;  2XPZ A;  4JXT A;  4CDM A;  3KS2 A;  3OTN A;  2H6G A;  3ZVV A;  3TXM A;  2KCL A;  4Q69 A;  4DI3 A;  5AQA A;  1N0Q A;  2XPY A;  2J07 A;  2XEV A;  3V31 A;  2PM7 A;  3MEK A;  2VGX A;  4KZC A;  3NOG D;  4ANU A;  4GA1 A;  2OV8 A;  2R03 A;  5G2N A;  4GTR A;  3CST A;  2V4L A;  2NSZ A;  2IO3 C;  1OWM A;  4TUM A;  2DVW A;  5AJL A;  1TNO A;  2I9C A;  4PS7 A;  2H6F A;  4X8Q A;  2OVF A;  4Z68 A;  3AAA C;  3UIO C;  4YDE A;  1KLX A;  2UWJ G;  2OCC E;  4BES A;  4BT8 A;  3KSL A;  4KXK B;  4Q96 A;  5BV1 A;  2WB2 A;  1MJ0 A;  1BPO A;  3CVL A;  3TWW A;  4UWG A;  5HS0 A;  2WQH A;  3RKV A;  4AM9 A;  4GCO A;  3FH5 A;  2RKK A;  2CG2 A;  3ZNG A;  2XEH A;  2WXI A;  2XRY A;  2EIJ E;  5CRV A;  5FZR A;  2GRN B;  4HOT A;  2LXM A;  2KZT B;  3ML9 A;  4PUC A;  3T8M A;  4I9C A;  2X3M A;  3ZIM A;  2V5Q C;  1HU3 A;  4B8A A;  3RU0 A;  4I2Z A;  5EID A;  4DX5 D;  3QAR A;  3ONL A;  2KCV A;  2KCK A;  4U63 A;  4DLO A;  2P2C P;  3D9N A;  3ZFW A;  5M72 A;  3Q79 A;  4JVS A;  2F37 A;  1KZP A;  4CZ2 D;  2CG3 A;  5BPP A;  2LUH A;  3L22 A;  5J90 A;  2EIK E;  3K9I A;  3LY7 A;  2C0L A;  4F3V A;  2OEW A;  3OXF A;  3UIP C;  4U0Z A;  5LCW J;  1Z3X A;  3JCK C;  2KAT A;  3FUJ A;  3UPV A;  1MZC A;  1EDU A;  3FUN A;  1A5E A;  3EJN A;  4PDX A;  3GZ1 A;  3CVU A;  4TXR A;  3D3M A;  3DPD A;  4XE0 A;  3PRE A;  1PC2 A;  5KNG A;  1DCE A;  1FT1 A;  2BTD A;  1LD7 A;  4U07 A;  3CVV A;  5A6C A;  3W9F A;  3L54 A;  2YHC A;  3R9M A;  4EBA G;  2J49 A;  2VSO E;  1S70 B;  2A5U A;  2MOW A;  2J09 A;  5AQ7 A;  2WXR A;  4LG6 A;  2DBA A;  3CEQ A;  2DIW A;  2IEJ A;  1EYH A;  4KBQ A;  3UMV A;  5FZS A;  1YYH A;  3ABK E;  2R5S A;  1SQM A;  3KD7 A;  3PH0 C;  3SY2 A;  3SD5 A;  1YCS B;  5HKP A;  5JJT A;  1RW2 A;  3ASD A;  1JPL A;  4DRX E;  3V79 K;  2J4B A;  4FHJ A;  1Z5S C;  4LNG A;  3DEO A;  2CHW A;  5ENS D;  2WXO A;  4IUL A;  1OY3 D;  1O1S A;  2PM6 A;  3KEZ A;  2XPI A;  1LTX A;  3HVE B;  3Q47 B;  2IJG X;  1FVH A;  2Y0B G;  2DWZ A;  1FVF A;  4FJZ A;  5D66 A;  1IQR A;  3LVQ E;  4GPM A;  5A23 A;  3R7Q A;  2IU1 A;  5IY5 E;  5EKQ D;  4CYM D;  4YVQ C;  3TWQ A;  4J7W A;  5ANR A;  3PDN A;  1NA3 A;  4RQI A;  3DXM G;  5JJ6 A;  2P9L G;  3FTS A;  4HXI A;  1HG2 A;  3LYA A;  4UUC A;  1IKN D;  3FH7 A;  3E4B A;  4LNB A;  3UKR G;  5BUZ A;  1MX4 A;  5BXU A;  1AWC B;  1TR4 A;  1U3C A;  2R2L A;  3PEU B;  2IO2 C;  2ETB A;  1G3N B;  1ELR A;  3FUF A;  4NIK A;  2XZD G;  2I2O A;  4JEU A;  4R7L A;  4C48 B;  5C1D A;  5CEC B;  3ZXS A;  4U04 A;  3URZ A;  3BEE A;  4AY5 A;  4I1M A;  3ENE A;  1OWN A;  3C3O A;  2XS8 A;  5EIB E;  1UJK A;  3FTV A;  2AXZ A;  3PEV B;  3ZYK A;  3ULE G;  3D9M A;  3CVW A;  1OXJ A;  4HBD A;  2AWI A;  2X6F A;  1FPP A;  4BY6 A;  1HXI A;  4GZ6 A;  1Y6I A;  5CBN A;  5JHA A;  5JJ7 A;  3ZHE B;  1Z3Y A;  2KZT A;  3Q4A B;  5HI7 A;  4FJY A;  3G2W A;  4XZ4 A;  4ATZ D;  3G2V A;  5ENN A;  2VYI A;  2MHK A;  5JMN D;  3AS5 A;  2XEE A;  2CFU A;  4J8D A;  3SZ7 A;  3ISM C;  3APF A;  3EDT B;  1QNF A;  1N95 A;  3SQV A;  4JW1 A;  1BU9 A;  2X6K A;  1TEZ A;  2KBX A;  3QDN A;  5E76 A;  4NQ0 A;  3S7J A;  1UW4 B;  3E33 A;  4B89 A;  1OWO A;  2E0I A;  3TJP A;  1BI8 B;  4P29 A;  1TN8 A;  3ONK A;  4N39 A;  1DCQ A;  1B89 A;  2VSN A;  5CMY A;  4LCT A;  2I1J A;  1Q2Z A;  3IKO B;  2GRO B;  2CFZ A;  4J8Y A;  3DSW A;  1MX6 A;  1D8D A;  3D9L A;  2H6I A;  4I9E A;  2R02 A;  5EYP F;  4J8S A;  3MA5 A;  4CT0 A;  4QFV A;  1H6P A;  2GRL A;  3DXK G;  4U8H A;  3O48 A;  3I4G A;  4ILG A;  3MGB A;  4A3V A;  1EPU A;  1S64 A;  3QJZ A;  5AYW D;  2DZN A;  4HFG A;  3RRU A;  4G23 A;  4A55 A;  3AU5 A;  3S2A A;  5ANL A;  3L13 A;  5CHE E;  4EEC A;  5AQB A;  3UUX A;  3LXU X;  4F7A A;  5ENR D;  4RLY A;  1QYM A;  1H2T C;  5LCW C;  4U8Y D;  3U66 A;  3JYS A;  4OVU A;  2L6B A;  2KM4 A;  3VLD A;  4GCN A;  3CK9 A;  3LCA A;  2X38 A;  3FTU A;  2OEV A;  3TWR A;  4PS8 A;  3I3N A;  2L0T B;  3CHP A;  2P9N G;  1UN8 A;  3FUM A;  3TG4 A;  4CCA A;  4JPS A;  1PY1 A;  4B8C B;  5D2M C;  2V8S E;  2XQ0 A;  1U3D A;  3UIN C;  4NUR A;  1N94 A;  1JCR A;  4XKB A;  3MYV A;  3LJ3 A;  3FDH A;  3PZ1 A;  4I6J A;  4N2S A;  2VGE A;  1ZB1 A;  4KVO A;  3NZS A;  3DSV A;  1SA4 A;  4ILH B;  2XCB A;  3DPY A;  3CQC B;  3FU6 A;  2UY1 A;  2A4Z A;  2PQN A;  3SGH A;  3E37 A;  2BKK B;  1DC2 A;  4BER A;  4UWL A;  1JUQ A;  3ASN E;  4HRM B;  2IFU A;  1MQS A;  5BT1 A;  5FJY A;  3ZKJ A;  1TNZ A;  2ETA A;  2GW1 A;  3HXF A;  4BEP A;  5CCL A;  2F8X K;  1KPS B;  3C72 A;  5HRY A;  1Y8M A;  4HRL A;  4OYS A;  3TWX A;  3PZD A;  4UQY A;  2H6H A;  1HFA A;  3C98 A;  5E75 A;  4E85 A;  2LAH A;  2Y4T A;  3EHR A;  5B1A E;  3QNK A;  1A17 A;  2R17 C;  4EZL A;  3UI2 A;  2WXF A;  4FLB A;  1TYQ G;  2PZI A;  5G05 J;  4LRZ A;  3TWS A;  3ASO E;  1HO8 A;  1NP7 A;  4LUN U;  3AJI A;  3IEG A;  4CDR A;  1MX2 A;  4Y6W A;  3F6Q A;  4KYO B;  3ABL E;  2L9B A;  3BG0 B;  3AG4 E;  2Y1L E;  1D9S A;  1WM5 A;  1OCO E;  3NOC D;  2ZGG A;  1E8X A;  4U0S A;  4JL0 A;  3ZYQ A;  4DX7 D;  3Q73 A;  2WQ6 A;  2LSU A;  2B6C A;  3DWL G;  2IF4 A;  3E34 A;  2WPV A;  4N3A A;  4DJA A;  4ABN A;  1E8Z A;  4N5Q A;  2IQC A;  2GRP B;  4JB8 P;  3PZ4 A;  3B7R L;  3TL5 A;  3FTY A;  3Q7A A;  4DLQ A;  4EBA A;  4FAD A;  3ZU7 B;  2I1K A;  1H6O A;  1MHQ A;  3Q75 A;  3TG5 A;  3ABM E;  3FWV A;  2P9K G;  2FF4 A;  3G2T A;  4XEI G;  4L23 A;  3B7T A;  5BV0 A;  2C0M A;  1UJJ A;  1IYG A;  4GML A;  5G04 J;  1XNF A;  2OOE A;  5LX8 A;  4BTB A;  2FEZ A;  2M63 A;  3IBE A;  4GMJ A;  5D0Q D;  4GMR A;  2NYJ A;  3FEY A;  3LVR E;  3FEX A;  1X81 A;  2Y3A A;  2QY7 A;  3PVL A;  2J8S D;  2MYO A;  3PS6 A;  4G8K A;  4UQZ A;  5CRU A;  5AJD A;  3OAW A;  2P9U G;  3LPZ A;  2AVP A;  3ZN3 A;  4L2L A;  2ILR A;  2VTB B;  4N3B A;  3NAW A;  2QC9 A;  3RAU A;  2ZGD A;  4B93 B;  1TNB A;  2F0Y A;  5JA4 D;  2OVB A;  4UWH A;  3Q7F A;  3FUK A;  4GZ5 A;  5EYL A;  3E30 A;  3U64 A;  3T9K A;  2HO1 A;  3PZ2 A;  2WM9 A;  4XI0 A;  2R05 A;  3CVP A;  3S7D A;  3N71 A;  3FUI A;  4FU3 A;  3I4R B;  4KVM A;  2XGO A;  3NZU A;  2QYJ A;  3RIB A;  2VQ2 A;  5ARF A;  4K5B A;  2XGS A;  4J6I A;  3MKR A;  5KWD A;  2HM8 A;  3SNX A;  4LER A;  2HYZ A;  3T5X A;  3UM3 A;  3CKC A;  3PZ3 A;  4JD2 G;  2BED A;  4GZ3 A;  4HLL A;  2YIN A;  3MCX A;  4L1B A;  5CMW A;  3CHM A;  3D9K A;  3CHS A;  3EHM A;  3LEW A;  3CKB A;  4JA7 A;  3TWV A;  4GZD A;  2QFC A;  2YHE A;  2IOS A;  2JEK A;  4YDO A;  2B0O E;  3VTX A;  3CHR A;  4FC8 A;  5ENO D;  1N0R A;  1UOH A;  1HG5 A;  3FHE A;  3D9H A;  3AS8 A;  5FIO A;  4JHR A;  3OXL A;  2VGX B;  3CK7 A;  3TXN A;  5D0O D;  3D9O A;  4WWP A;  3TWT A;  3AS4 A;  3MV3 B;  2L6J A;  3UX4 A;  3FUH A;  3GZ2 A;  4C0E A;  1N4R A;  2ZU6 B;  4K5C A;  1BLX B;  4G2V A;  3SI5 A;  1N4S A;  4KMO A;  3SFZ A;  5BXO A;  1NFI E;  2P9S G;  1TJC A;  2DYS E;  3UM1 A;  2WXP A;  1DVP A;  1O5M A;  4ACL A;  4HLE A;  2JAB A;  5B1B E;  1HH8 A;  1GW6 A;  2WQ7 A;  3LKU A;  5FQ6 A;  2RFM A;  4XI9 A;  3MV2 B;  4A63 B;  4RVB A;  5CBO A;  3U9W A;  2EIM E;  4U96 D;  4F1S A;  2V0P A;  3C3Q A;  4U7E B;  5DIZ A;  4Y6C A;  2IY0 C;  1E96 B;  2QZA A;  2RD0 A;  2WXL A;  1QZ2 A;  4I1O B;  4ZFH A;  3FU3 A;  4XIF A;  3GW4 A;  4YVO A;  3HXE A;  4WNE A;  4EHM A;  5AAO A;  2J4D A;  4HVB A;  4AV7 A;  4HB5 A;  3HIZ A;  3FTX A;  4MS6 A;  4L7T A;  2BUG A;  1NL4 A;  3AG3 E;  3G2S A;  3PNT B;  3UQ3 A;  3MX3 A;  3PNL B;  4G1T A;  5AN8 A;  1MYO A;  4BSX A;  3CVX A;  3V30 A;  3DBS A;  2RG8 A;  5FIN A;  4G24 A;  5T4Y A;  5ENP D;  4N2Q A;  2FBN A;  4GTS A;  3IXE A;  5DBK A;  2L0I A;  5ARG A;  4GTV A;  3D9P A;  3Q78 A;  3ULQ A;  5G05 C;  1H19 A;  4NAC A;  3FU5 A;  3EHN A;  4JC8 A;  3U3W A;  3QOU A;  1TNU A;  2WXK A;  3HXD A;  4YDW A;  4M3O A;  4YND A;  1KT1 A;  5HQ8 A;  5ITZ F;  4CEM A;  3RK6 A;  1P5Q A;  2AJA A;  5EIL A;  3CK8 A;  3ML8 A;  3VTY A;  2DZO A;  2V4H C;  2VJ8 A;  4J8E A;  1WY6 A;  3NBN B;  3RRM B;  3KSQ A;  4JHK A;  4TUU A;  4UI9 J;  4B94 A;  4CRW A;  2GGF A;  3MZL B;  1HF8 A;  4TXP A;  3B7U X;  3P1U A;  3ESL A;  1L5J A;  3BUA A;  3FTW A;  4HRN A;  1VDY A;  3SF4 A;  3O4Z A;  3L9T A;  3CSF A;  1HX8 A;  4CGW A;  2VTB A;  3RO2 A;  1E8Y A;  1OWL A;  3FUD A;  3NQP A;  4DI4 A;  1K8K G;  4I17 A;  3EIJ A;  1NA0 A;  4I6E A;  2X6H A;  3FFL A;  4LEU A;  4DX6 D;  3CLJ A;  2EIN E;  3PRZ A;  2CHX A;  3RSE G;  2P58 C;  1KZO A;  3I5P A;  4ANW A;  3GZS A;  1JCQ A;  4UWF A;  5EN5 D;  3UXG A;  4ANV A;  3UT8 A;  3V2X A;  1ELK A;  4U8V D;  1BI7 B;  3Q49 B;  3R7R A;  1YMP A;  4CT4 A;  2PL2 A;  3ZPJ A;  2P9I G;  5KJM A;  3ZRH A;  3HVE A;  2LO6 A;  1OWP A;  4FHK A;  1N4P A;  4JZY A;  3ZGQ A;  2BF0 X;  5FQ8 A;  4DX1 A;  1IHB A;  2X6J A;  4WWN A;  3B7B A;  2WMO A;  1O1T A;  5EX3 A;  4WAF A;  4GB9 A;  4TXQ A;  4LNU D;  3JQ1 A;  2ZXW E;  4OAU C;  3PUJ A;  2ETC A;  2XZT G;  1OCR E;  3TAX A;  5EDS A;  2YNQ A;  3B95 A;  1N9A A;  2J9Q A;  3WXX A;  1AP7 A;  1UG3 A;  1OT8 A;  3V2O A;  1YA0 A;  4HOS A;  2GRQ B;  4DPR A;  3SBS A;  5CER B;  4U0U A;  4IYP A;  2AW6 A;  3P2B A;  3UT4 A;  2LNI A;  4BT9 A;  3EIQ C;  1O1R A;  4CDN A;  1QQE A;  3EHQ A;  3L17 A;  1V55 E;  2KXP C;  4I43 A;  2FUL A;  4BFR A;  1ZBP A;  3X2Q E;  2V5F A;  3HXB A;  2Y4U A;  2VGY A;  3QAQ A;  3LY9 A;  4M7C A;  4GA0 A;  4C9B B;  4G8L A;  3EU5 A;  4ATG A;  3CVY A;  1NI1 A;  3ZEF A;  3TWU A;  3G2U A;  1N11 A;  4GYO A;  3R9A B;  1N54 A;  2PNN A;  3DSU A;  3LS8 A;  3WG7 E;  4K03 A;  1E7U A;  4K5A B;  1S63 A;  1E8W A;  1UN9 A;  2LAI A;  3T5V A;  3OXG A;  3ZHE A;  4GYY A;  4Q94 A;  2DCP A;  4I2W A;  4HOU A;  4A1S A;  1SZ9 A;  2WXG A;  2YQ8 A;  4ANX A;  4ME2 A;  1H2V C;  3AG2 E;  5ENQ D;  5KCM A;  4GTQ A;  3ASF A;  5H7P A;  4E6H A;  4V3I A;  4YDY A;  4L9P A;  5FZQ A;  1IHG A;  3ZYL A;  3MJW A;  4AY6 A;  5J08 A;  4WWO A;  3D9J A;  1PAQ A;  3PE4 A;  3ZUV B;  5G55 A;  2XCC A;  4H7X A;  2OND A;  4EPZ A;  3ASG A;  3FTZ A;  3W9G A;  4FA6 A;  1RZ4 A;  2R59 A;  4GA2 A;  1WAO 1;  3UTM A;  1OCC E;  1EF1 C;  4PS3 A;  3HDX A;  3RRN B;  1U2V G;  2WXN A;  5LOZ A;  4HS2 A;  2A5E A;  4EQF A;  3Q9U C;  2XHE A;  2IOL A;  4BX8 A;  2NXP A;  3C5R A;  4BET A;  5KJK A;  4GZC A;  1V54 E;  4FLH A;  3ESK A;  4HOR A;  4MBG A;  4RG6 A;  2ION A;  1WG0 A;  4AEZ C;  3LDZ A;  2C2L A;  3KAE A;  1IQU A;  4HOQ A;  2XGM A;  3ZYM A;  4GTP A;  3PE3 A;  3TGO A;  3FY4 A;  5AIJ A;  3KEA A;  2AXU A;  3ULY A;  4I1A A;  5AQ9 A;  1Z6T A;  3L16 A;  3B13 A;  4DX2 A;  3HHM A;  4LSZ E;  3HXC A;  3J5Q B;  4ZHB A;  2NC9 A;  1H0A A;  3RJV A;  4H7Y A;  4AOF A;  3L6A A;  2VSY A;  4O60 A;  2CHZ A;  4MRU A;  1SW6 A;  4J8F A;  2J08 A;  3S7B A;  1BD8 A;  5FQ7 A;  3MKQ B;  1IXV A;  3EUV A;  4O6F A;  1LF8 A;  1WDY A;  1N52 A;  3JUI A;  5LFA A;  4UI9 C;  3ASH A;  4OVV A;  1DNP A;  4IN3 B;  3FH8 A;  2WVI A;  5FQ4 A;  4GTT A;  3CHO A;  4B0Z A;  2UY1 B;  4HNA D;  4F1P A;  5BW8 C;  3UKU G;  3UT7 A;  3DEP A;  3CVN A;  1FCH A;  3UM0 A;  3D9I A;  1E7V A;  4OAV B;  3L82 A;  3HRA A;  2LXL A;  4KZ0 A;  2ZIS A;  4CGV A;  4WUY A;  5T3R A;  3UM2 A;  4AVX A;  3CIA A;  3Q15 A;  3AU4 A;  3NF1 A;  3QB2 A;  1FT2 A;  4ACK A;  5LP0 A;  2WXQ A;  4URK A;  3SFX A;  4FP7 A;  4BTA A;  3QC1 A;  4JA9 A;  4NRH B;  3DRA A;  3QKY A;  4GPK A;  1HE8 A;  5KBA A;  5FT9 A;  3JQ0 A;  3AG1 E;  1K3Z D;  4MKT A;  3LY8 A;  4O1P A;  2WXH A;  3JXI A;  2MRI A;  4BX9 A;  2QYU A;  2VSX E;  1SZA A;  4GU5 A;  2FO7 A;  4AP2 A;  3CV0 A;  2F8Y A;  2GRM A;  4WNF A;  2WXM A;  5AAR A;  1LD8 A;  4AXH A;  5KJN A;  2XS1 A;  3J5P A;  4TRQ A;  4UI9 K;  5FWQ A;  4JEH A;  4WND A;  3E32 A;  1INZ A;  1SVX A;  3VLF A;  4EZJ A;  2ZIR A;  5KJL A;  3BQO A;  3HYM B;  4BWR A;  3C3R A;  4EZK A;  3QWW A;  3S7F A;  3IHY A;  3VLE A;  3EU9 A;  5CEA A;  1ZU2 A;  1D8E A;  2FO1 E;  2P9P G;  1TNY A;  2EIL E;  4UQX A;  4N3C A;  3B7S A;  4HQD A;  1N4Q A;  5C2Y A;  4D10 C;  2DYR E;  2JLB A;  4F6R D;  3NB2 A;  2LSV A;  5BNW A;  1JCS A;  4G25 A;  3T8K A;  3FP3 A;  4XKC A;  4QQI A;  1XGW A;  3APD A;  3CVQ A;  2FI7 A;  2GRR B;  3ZXP A;  4XX5 A;  3IHV A;  1HS6 A;  4W9R A;  4HI8 A;  3CGH A;  2HE0 A;  4IRU A;  4U95 D;  3PUK A;  5ENT D;  5FTP A;  3CR3 A;  3RO3 A;  3SFY A;  3JUE A;  4APF A;  2PQR A;  2Q7F A;  4K0R A;  1OCZ E;  2Y69 E;  3IV0 A;  3ZW3 A;  3LJN A;  3HG0 D;  3FUE A;  3CQG B;  4GYW A;  3JXJ A;  5EX0 A;  4WNG A;  1TN7 A;  2KC7 A;  3QK0 A;  3FUL A;  1NZN A;  5CCM A;  3DST A;  4ILI A;  4JHJ A;  1OUV A;  5CED B;  4I6G A;  5KNH D;  1E90 A;  4TV3 A;  3SHF A;  2HR2 A;  1ELW A;  4APO A; 
#chains in the Genus database with same CATH homology
 3D9M A;  2XRZ A;  3CVW A;  1JWF A;  2AWI A;  2X6F A;  4BY6 A;  4ATG A;  5A7D B;  3CVY A;  2OVB A;  5JHB A;  4UWH A;  3L08 A;  3ZEF A;  1HXI A;  5AEN A;  3FUK A;  4GZ5 A;  3G2U A;  5G04 C;  3U64 A;  2E2E A;  2X6I A;  2HO1 A;  4G11 A;  4XI0 A;  2WM9 A;  4GZ6 A;  1Y6I A;  3CVP A;  4GYO A;  4PH4 B;  3S7D A;  4AJW A;  3FU0 A;  3R9A B;  3N71 A;  1N54 A;  3FUI A;  4FU3 A;  3I4R B;  4J0U A;  4KVM A;  4RG9 A;  1KT0 A;  2XGO A;  5JHA A;  3LS8 A;  3NZU A;  4K03 A;  5JJ7 A;  1E7U A;  3RIB A;  3ZHE B;  4AIF A;  2VQ2 A;  5ARF A;  1Z3Y A;  2XGS A;  1E8W A;  1UN9 A;  2I6H A;  4J6I A;  2EQX A;  2LAI A;  2KZT A;  3MKR A;  5T8I A;  2HM8 A;  4F53 A;  1TJF A;  4A1G A;  3Q4A B;  4KT6 B;  1HZ4 A;  3OXG A;  3ZHE A;  3T5V A;  4C0M A;  4GYY A;  4Q94 A;  5HI7 A;  4FJY A;  1W3B A;  3G2W A;  3SNX A;  2DCP A;  4LER A;  4GAA A;  2HYZ A;  4I2W A;  4XZ4 A;  4HOU A;  3T5X A;  4DK5 A;  4A1S A;  3CKC A;  4A3T A;  3G2V A;  1H2U A;  1SZ9 A;  5ENN A;  2VYI A;  2MHK A;  2WXG A;  2YQ8 A;  4ANX A;  3AS5 A;  1S0P A;  4ME2 A;  4GZ3 A;  1H2V C;  5KCM A;  1H6K A;  2YIN A;  3CHQ A;  4FUL A;  2CFU A;  3BG1 B;  3MCX A;  3APC A;  2WMN A;  3QWV A;  4J8D A;  3SZ7 A;  3ASF A;  4L1B A;  5CMW A;  3APF A;  3MKQ A;  4N5C A;  3QWP A;  3CHM A;  3EDT B;  4L2Y A;  1QNF A;  4V3I A;  4E6H A;  3D9K A;  4G26 A;  3CHS A;  3EHM A;  3LEW A;  1IHG A;  5FZQ A;  3ZYL A;  1JWG A;  3CKB A;  3MJW A;  4JW1 A;  3GYZ A;  3Q5M A;  4JA7 A;  4UWK A;  4GZD A;  4AY6 A;  5J08 A;  4WWO A;  2QFC A;  2WXJ A;  4RSY A;  3D9J A;  2YHE A;  2IOS A;  2JEK A;  1PAQ A;  2X6K A;  2AXV A;  3PE4 A;  1TEZ A;  3QDN A;  1X5B A;  5E76 A;  3VTX A;  4NQ0 A;  5G55 A;  3S7J A;  2XCC A;  3CHR A;  1UW4 B;  4B89 A;  4FC8 A;  4H7X A;  4MLP A;  1OWO A;  2XPZ A;  4JXT A;  2E0I A;  2OND A;  4EPZ A;  4CDM A;  3KS2 A;  3TJP A;  3OTN A;  3ASG A;  3FTZ A;  1HG5 A;  4P29 A;  3ZVV A;  3TXM A;  4FA6 A;  3FHE A;  2KCL A;  2R59 A;  3AS8 A;  4GA2 A;  4Q69 A;  4DI3 A;  4JHR A;  3OXL A;  2VGX B;  1WAO 1;  2XPY A;  3ONK A;  4N39 A;  1EF1 C;  4PS3 A;  3HDX A;  2J07 A;  3CK7 A;  2WXN A;  5LOZ A;  3RRN B;  3TXN A;  2XEV A;  5D0O D;  2PM7 A;  1B89 A;  3D9O A;  3MEK A;  4WWP A;  2VGX A;  4KZC A;  2VSN A;  3AS4 A;  2L6J A;  3MV3 B;  3FUH A;  3GZ2 A;  4GA1 A;  2I1J A;  4HS2 A;  4LCT A;  3UX4 A;  4ANU A;  3IKO B;  4C0E A;  2CFZ A;  2OV8 A;  4EQF A;  2ZU6 B;  5G2N A;  3CST A;  2V4L A;  3D9L A;  4G2V A;  2NSZ A;  3SI5 A;  1OWM A;  2XHE A;  2IOL A;  4I9E A;  4KMO A;  4BX8 A;  4J8S A;  5AJL A;  2NXP A;  3SFZ A;  3MA5 A;  2I9C A;  4CT0 A;  4GZC A;  4PS7 A;  5KJK A;  4QFV A;  2GRL A;  4FLH A;  1TJC A;  2OVF A;  4U8H A;  3O48 A;  1KLX A;  3ESK A;  4HOR A;  2WXP A;  1DVP A;  2UWJ G;  2ION A;  3I4G A;  4RG6 A;  4BT8 A;  4AEZ C;  4ACL A;  4ILG A;  4HLE A;  3LDZ A;  4KXK B;  3MGB A;  2C2L A;  4Q96 A;  4A3V A;  5BV1 A;  1EPU A;  2WB2 A;  1HH8 A;  1IQU A;  1GW6 A;  3KAE A;  3QJZ A;  2WQ7 A;  5AYW D;  3LKU A;  4HFG A;  5FQ6 A;  4HOQ A;  1BPO A;  3RRU A;  4XI9 A;  2XGM A;  3CVL A;  3ZYM A;  4UWG A;  2WQH A;  3PE3 A;  3RKV A;  3TGO A;  3MV2 B;  4G23 A;  3FY4 A;  4AM9 A;  4GCO A;  3FH5 A;  4A55 A;  5AIJ A;  2AXU A;  3AU5 A;  4I1A A;  4RVB A;  1Z6T A;  3L16 A;  3L13 A;  5CHE E;  5ANL A;  3S2A A;  4EEC A;  3U9W A;  3B13 A;  4F1S A;  2V0P A;  3UUX A;  3LXU X;  3HHM A;  2CG2 A;  4F7A A;  2WXI A;  5DIZ A;  2XRY A;  4Y6C A;  1E96 B;  1H2T C;  5LCW C;  2RD0 A;  5FZR A;  2NC9 A;  4HOT A;  2KZT B;  2WXL A;  3ML9 A;  3U66 A;  1H0A A;  1QZ2 A;  3JYS A;  4I1O B;  4PUC A;  4I9C A;  3FU3 A;  4OVU A;  4XIF A;  3T8M A;  2X3M A;  2KM4 A;  3GW4 A;  3VLD A;  4GCN A;  3CK9 A;  3LCA A;  4YVO A;  3ZIM A;  2X38 A;  3FTU A;  3RJV A;  4H7Y A;  4AOF A;  4WNE A;  3L6A A;  2VSY A;  4PS8 A;  1HU3 A;  4B8A A;  3I3N A;  3RU0 A;  2L0T B;  4I2Z A;  2CHZ A;  2J4D A;  3CHP A;  4MRU A;  3QAR A;  1UN8 A;  3HIZ A;  4AV7 A;  4J8F A;  4HVB A;  3FUM A;  3FTX A;  2J08 A;  3ONL A;  2KCV A;  4L7T A;  4MS6 A;  3S7B A;  3TG4 A;  2BUG A;  5FQ7 A;  2KCK A;  4CCA A;  3G2S A;  3PNT B;  3MKQ B;  4U63 A;  3UQ3 A;  4JPS A;  3MX3 A;  3PNL B;  4G1T A;  1PY1 A;  4DLO A;  4B8C B;  4BSX A;  3CVX A;  2V8S E;  2XQ0 A;  3D9N A;  2RG8 A;  3DBS A;  4O6F A;  4JVS A;  1LF8 A;  1U3D A;  3ZFW A;  5M72 A;  4G24 A;  4NUR A;  5T4Y A;  4N2Q A;  1N52 A;  2FBN A;  3JUI A;  4XKB A;  5LFA A;  5DBK A;  4UI9 C;  3ASH A;  3MYV A;  3LJ3 A;  3FDH A;  4OVV A;  2L0I A;  1DNP A;  2CG3 A;  3FH8 A;  4IN3 B;  4I6J A;  5ARG A;  4N2S A;  5BPP A;  2WVI A;  3L22 A;  3D9P A;  5FQ4 A;  3SBT B;  3ULQ A;  4KVO A;  3NZS A;  5J90 A;  5G05 C;  3CHO A;  4B0Z A;  4ILH B;  1H19 A;  2UY1 B;  3K9I A;  3LY7 A;  2XCB A;  4NAC A;  2C0L A;  5BW8 C;  3CQC B;  4F3V A;  3OXF A;  3FU6 A;  3UT7 A;  4U0Z A;  3CVN A;  3FU5 A;  2UY1 A;  1FCH A;  2A4Z A;  2PQN A;  3EHN A;  3SGH A;  4JC8 A;  5LCW J;  3U3W A;  3QOU A;  3D9I A;  1E7V A;  1Z3X A;  3JCK C;  2KAT A;  2WXK A;  3FUJ A;  4UWL A;  1JUQ A;  3UPV A;  1EDU A;  3FUN A;  4M3O A;  4KZ0 A;  3EJN A;  2IFU A;  4PDX A;  4CGV A;  1MQS A;  3GZ1 A;  3CVU A;  5BT1 A;  3D3M A;  4WUY A;  3DPD A;  4XE0 A;  4YND A;  3PRE A;  5FJY A;  5T3R A;  1KT1 A;  5HQ8 A;  2GW1 A;  4AVX A;  3CIA A;  5CCL A;  1PC2 A;  3Q15 A;  4CEM A;  2BTD A;  3AU4 A;  3NF1 A;  4U07 A;  3RK6 A;  1P5Q A;  3QB2 A;  1Y8M A;  3CK8 A;  4OYS A;  4ACK A;  2WXQ A;  5LP0 A;  3PZD A;  3ML8 A;  4UQY A;  3VTY A;  4URK A;  3CVV A;  1HFA A;  4FP7 A;  3C98 A;  4BTA A;  3QC1 A;  5E75 A;  5A6C A;  2VJ8 A;  4J8E A;  1WY6 A;  4JA9 A;  4E85 A;  3RRM B;  2LAH A;  4NRH B;  4TUU A;  4JHK A;  3L54 A;  2YHC A;  3QKY A;  4GPK A;  2Y4T A;  5CMY A;  1HE8 A;  5FT9 A;  3JQ0 A;  4UI9 J;  4B94 A;  4MKT A;  3LY8 A;  3QNK A;  4CRW A;  1A17 A;  4EBA G;  2J49 A;  2R17 C;  4EZL A;  2GGF A;  3MZL B;  2WXF A;  1HF8 A;  4FLB A;  3B7U X;  2WXH A;  2VSO E;  2A5U A;  3P1U A;  2PZI A;  5G05 J;  4LRZ A;  2MOW A;  3ESL A;  2J09 A;  2MRI A;  1L5J A;  4BX9 A;  3FTW A;  1VDY A;  2VSX E;  2WXR A;  1SZA A;  3O4Z A;  3SF4 A;  4GU5 A;  2FO7 A;  4AP2 A;  3CV0 A;  2DBA A;  2GRM A;  3CSF A;  3CEQ A;  1HO8 A;  1HX8 A;  1NP7 A;  2DIW A;  4CGW A;  4WNF A;  4LUN U;  2WXM A;  2VTB A;  1EYH A;  3IEG A;  3RO2 A;  4CDR A;  4KBQ A;  1E8Y A;  3UMV A;  1OWL A;  4AXH A;  5FZS A;  3FUD A;  3NQP A;  5KJN A;  4TRQ A;  4DI4 A;  4UI9 K;  4Y6W A;  5FWQ A;  2R5S A;  4I17 A;  4JEH A;  4KYO B;  4WND A;  1INZ A;  3VLF A;  4EZJ A;  5KJL A;  1SQM A;  3EIJ A;  1NA0 A;  3HYM B;  3KD7 A;  4BWR A;  2L9B A;  3PH0 C;  3BG0 B;  2X6H A;  4I6E A;  3FFL A;  4EZK A;  3QWW A;  3S7F A;  3SD5 A;  4LEU A;  1WM5 A;  3IHY A;  3VLE A;  5JJT A;  3CLJ A;  3ASD A;  3PRZ A;  1JPL A;  1ZU2 A;  2J4B A;  2CHX A;  4FHJ A;  1E8X A;  2CHW A;  4U0S A;  2P58 C;  4JL0 A;  3ZYQ A;  2WXO A;  3I5P A;  4IUL A;  4UQX A;  2WQ6 A;  4ANW A;  3GZS A;  4N3C A;  4UWF A;  3B7S A;  2LSU A;  4ANV A;  3UT8 A;  2PM6 A;  5C2Y A;  1ELK A;  4D10 C;  3KEZ A;  3Q49 B;  2XPI A;  2IF4 A;  3HVE B;  3R7R A;  3Q47 B;  2WPV A;  4CT4 A;  2IJG X;  2PL2 A;  2JLB A;  4N3A A;  3U4T A;  1FVH A;  3ZPJ A;  4DJA A;  2LSV A;  4ABN A;  1E8Z A;  1FVF A;  5BNW A;  4G25 A;  5KJM A;  4FJZ A;  3FP3 A;  3HVE A;  1IQR A;  2LO6 A;  3ZRH A;  1OWP A;  3LVQ E;  4FHK A;  2IQC A;  4XKC A;  4JZY A;  3ZGQ A;  5A23 A;  3B7R L;  3TL5 A;  1XGW A;  3FTY A;  3R7Q A;  2IU1 A;  2BF0 X;  5FQ8 A;  3APD A;  5EKQ D;  3ZN3 A;  4DLQ A;  4EBA A;  4FAD A;  2X6J A;  3CVQ A;  2FI7 A;  4YVQ C;  4WWN A;  2I1K A;  4XX5 A;  1MHQ A;  2WMO A;  3PDN A;  3IHV A;  1NA3 A;  1HS6 A;  5ANR A;  3TG5 A;  5JJ6 A;  5EX3 A;  4WAF A;  4GB9 A;  3FWV A;  4W9R A;  3FTS A;  3CGH A;  3JQ1 A;  4HXI A;  4IRU A;  2FF4 A;  1HG2 A;  3LYA A;  3PUK A;  3G2T A;  3FH7 A;  3PUJ A;  3B7T A;  4L23 A;  3E4B A;  2C0M A;  3CR3 A;  5FTP A;  5BV0 A;  3RO3 A;  1UJJ A;  3TAX A;  1IYG A;  4GML A;  5G04 J;  4APF A;  5EDS A;  2YNQ A;  5BUZ A;  1XNF A;  2J9Q A;  2OOE A;  2PQR A;  2Q7F A;  4K0R A;  3WXX A;  5LX8 A;  4BTB A;  1UG3 A;  2FEZ A;  2M63 A;  3IV0 A;  3ZW3 A;  3IBE A;  1U3C A;  4GMJ A;  5D0Q D;  3PEU B;  1YA0 A;  4HOS A;  3FUE A;  4DPR A;  3SBS A;  3CQG B;  2AW6 A;  3P2B A;  4IYP A;  4U0U A;  2LNI A;  3FEY A;  3LVR E;  4GYW A;  3EIQ C;  3FEX A;  3UT4 A;  2Y3A A;  4BT9 A;  2QY7 A;  3PVL A;  5EX0 A;  4CDN A;  4WNG A;  1QQE A;  1ELR A;  3FUF A;  2I2O A;  3L17 A;  3PS6 A;  4JEU A;  2KC7 A;  4R7L A;  3QK0 A;  5C1D A;  4I43 A;  3ZXS A;  4UQZ A;  3FUL A;  1NZN A;  2FUL A;  4U04 A;  4BFR A;  5CCM A;  5AJD A;  3OAW A;  4ILI A;  4JHJ A;  3URZ A;  1ZBP A;  1OUV A;  3BEE A;  3LPZ A;  4I6G A;  2AVP A;  2V5F A;  4AY5 A;  3ENE A;  2Y4U A;  1OWN A;  2ILR A;  1E90 A;  2VGY A;  3QAQ A;  4I1M A;  4L2L A;  4TV3 A;  3LY9 A;  4C9B B;  4GA0 A;  2VTB B;  3SHF A;  2HR2 A;  4N3B A;  1UJK A;  3FTV A;  1ELW A;  2AXZ A;  3PEV B;  4APO A;  3ZYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...