2L0IA

Solution structure of rtt103 ctd-interacting domain bound to a ser2 phosphorylated ctd peptide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
136
structure length
136
Chain Sequence
AFSSEQFTTKLNTLEDSQESISSASKWLLLQYRDAPKVAEMWKEYMLRPSVNTRRKLLGLYLMNHVVQQAKGQKIIQFQDSFGKVAAEVLGRINQEFPRDLKKKLSRVVNILKERNIFSKQVVNDIERSLAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cooperative interaction of transcription termination factors with the RNA polymerase II C-terminal domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Regulator of Ty1 transposition protein 103
total genus 53
structure length 136
sequence length 136
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2l0iA00
2DIWA 3D9OA 1JWGA 3G2UA 3G2TA 3LDZA 3D9JA 5LOZA 3ZYLA 2L0TB 1H0AA 4Q94A 1HFAA 2DCPA 1VDYA 5J08A 4GZDA 1MHQA 4NACA 3RRUA 3D9NA 1EDUA 5LP0A 2BF0X 3ZYKA 3ZYMA 4AVXA 1JUQA 3ONKA 1INZA 1SZAA 3G2SA 1DVPA 1UJJA 3D9MA 5CMYA 2LO6A 3D9LA 3ZYQA 4FLBA 2V8SE 2QY7A 3D9KA 4GZCA 4Q96A 4HFGA 1XGWA 4FU3A 1HX8A 3ONLA 1EYHA 1LF8A 1ELKA 4JXTA 1HF8A 1UJKA 3CLJA 1X5BA 1PY1A 1HG5A 3D9IA 1JWFA 1HG2A 2KM4A 2L0IA 1SZ9A 3G2WA 2MOWA 5CMWA 1JPLA 3G2VA 3D9PA
chains in the Genus database with same CATH superfamily
3KEZA 2KATA 3G2UA 4U8HA 4RSYA 2WVIA 1SVXA 1FT1A 4F7AA 3FY4A 3FUIA 4B8CB 4BSZB 4A3TA 2F8YA 3EU9A 3GW4A 3T8KA 3E4BA 3Q15A 4B0ZA 2E0IA 1TN6A 3SBTB 3UKUG 3RRUA 1UW4B 3NZSA 3CK9A 3GZ1A 4ANVA 4FULA 4LERA 4DJAA 1Q2ZA 3LPZA 5CCLA 2OVBA 2KCLA 4O60A 4MRUA 2QZAA 4AXHA 1ZB1A 2ONDA 5EX0A 2AVPA 3S7JA 3QARA 5ENPD 3URZA 2ZISA 1H6OA 3LJ3A 2IOLA 3FTYA 2VQ2A 2GRPB 3FWVA 4ANWA 3VTXA 2LXLA 3ZXPA 2XGSA 4J8FA 3Q5MA 2WXLA 1PY1A 3C72A 3AG1E 3CVWA 4G1TA 1SZ9A 3RSEG 1TR4A 4XEIG 2P9IG 4MLPA 4TV3A 5LP0A 3LVRE 1DVPA 3UT8A 2KCVA 3MKQB 5CRVA 4LRZA 4U0UA 3BG1B 3ZN3A 3CK8A 2NC9A 3F6QA 5KBAA 1WY6A 5FWQA 3IKOB 3AJIA 2P9KG 3SFZA 3SI5A 1OWOA 2WXGA 4GTTA 3PZDA 4K5BA 4UWGA 1TJCA 1OCCE 4ILIA 5BXOA 1E90A 3PH0C 3HXFA 4PS8A 5G2NA 4DUIA 1A5EA 2VSOE 1TN8A 2OOEA 2VSXE 2NSZA 4BT9A 3HIZA 4CT0A 2WM9A 3UT7A 5CEAA 1IKND 4GA1A 1RW2A 5H7PA 2FO7A 4J0UA 3AAAC 5CCMA 1LD8A 4FJZA 3EIQC 2CFUA 2ZGGA 2VSYA 3D9KA 5C1DA 3CVVA 3ASNE 4GZ6A 4XKBA 1BI8B 2EQXA 1QYMA 4WWNA 3FU5A 1MX6A 2WXKA 4DX2A 5EN5D 1LTXA 2RFAA 4TUMA 3EJNA 5D66A 3BG0B 3CLJA 3EU5A 4JEHA 3BEEA 4BERA 3FTVA 4IN3B 4FLHA 5EYPF 5BV1A 1OWPA 5LCWJ 2F37A 2MRIA 3NOGD 4G8KA 2V8SE 3OXFA 4HBDA 1HG5A 3FUJA 1O5MA 1KPSB 4OYSA 2KCKA 5D0QD 4Q94A 1YCSB 3JXJA 2VGEA 4BWRA 3HDXA 4AY5A 4B93B 5AENA 2VTBA 3UQ3A 3ENEA 5J90A 3RK6A 1N95A 3JYSA 3Q75A 3FUFA 4DI3A 1PC2A 3G2WA 4ZHBA 1OCZE 4L2YA 2GROB 4GYYA 3RO3A 1HH8A 1JWGA 5AQAA 4XZ4A 4KXKB 3VLFA 4L1BA 4I43A 3FFLA 4BETA 1Z3XA 3ZIMA 4JD2G 2IFUA 4GAAA 1QQEA 3C5RA 5FT9A 2X6HA 3RU0A 5M72A 1TNOA 1HX8A 4C9BB 3MA5A 2KM4A 1QNFA 2HM8A 3FP3A 1D8EA 2FI7A 1HE8A 4HLEA 3DEPA 4OVVA 5T8IA 2YINA 3ASGA 3FHEA 3FTUA 2VTBB 1AP7A 4MS6A 3UI2A 4BEPA 5ENSD 3DSSA 4I6GA 4KZCA 2ZIRA 1V54E 2DZOA 5ARFA 3ZPJA 4U0SA 3B7BA 4B94A 4XIFA 2ILRA 4URKA 3MV3B 4NRHB 2F0YA 1E7UA 1WM5A 2YNQA 2JABA 2JLBA 1S64A 1NL4A 2V5QC 2L0TB 1Y8MA 2AW6A 2UY1B 1INZA 2V4LA 2XENA 5ARGA 4GTSA 4D10C 2HR2A 4I1OB 1FT2A 2WXMA 5ANRA 2PQNA 4I2ZA 2AXZA 2PM6A 1FVHA 2XHEA 2WXQA 1A17A 5G04J 5BW8C 3IV0A 4I2WA 3G2SA 3D9HA 3JUEA 3SGHA 4GPMA 2C2LA 5JA4D 4DX6D 3JQ0A 2L0IA 2MOWA 3TWTA 2P9UG 4WWPA 1OCOE 3ML9A 2ETBA 3Q78A 4J6IA 4I9EA 4H7XA 4U8YD 4K0RA 4UWKA 3TG4A 4APFA 2R05A 2J4BA 3ONKA 1IHBA 1IXVA 3AS5A 3AS8A 4BESA 3KSLA 5EIDA 3V79K 5DIZA 4GMLA 1S0PA 5G05C 1BD8A 4GTPA 2A5EA 2P9NG 5KJKA 1JCRA 2E2EA 3PS6A 5B3SE 3SO8A 2AXUA 3DEOA 1ELWA 5AYWD 1WDYA 3SBSA 3UXGA 1BU9A 3Q9NC 3UT4A 4DI4A 1W3BA 1YYHA 3QNKA 5FQ8A 1DNPA 3KD7A 1N9AA 4JHKA 4YDYA 5JHBA 1MX4A 4APOA 4Q96A 3FH8A 4CT4A 2EIJE 4LNUD 4PDXA 4M7CA 3C3OA 2WMNA 3PVLA 2KXPC 1NFIE 2V5FA 2L6BA 2IO2C 4GTVA 3ZGQA 4I9CA 3RAUA 4J7WA 3Q47B 3ESKA 4F1SA 2XRYA 4BY6A 3SFYA 2JEKA 3FH5A 2DYSE 3SHFA 1N4RA 4WAFA 5AAOA 2WPVA 3D9JA 4GZDA 3MX3A 4AOFA 2MYOA 3S7FA 5AIJA 4A1SA 1N4QA 3D9IA 1H6KA 1OWLA 4O6FA 3TWXA 3TWRA 5D0OD 5LOZA 5E76A 3B7RL 5JJ6A 3MJWA 4FHJA 3HRAA 3UM0A 3DSTA 3S2AA 2XGMA 1ELKA 2WQ6A 2I1JA 2X6FA 4CZ2D 3UX4A 4U7EB 3PUKA 2DCPA 3QWWA 4DLOA 3OAWA 3TJPA 3ASDA 4EBAG 2RG8A 3LEWA 1ZU2A 3Q7FA 1QZ2A 1Y6IA 4ACKA 3Q7AA 1KLXA 3VLEA 1S63A 1H6PA 2YHEA 2QYUA 2WXIA 2IF4A 3ZNGA 3LS8A 4CGVA 3QK0A 3RIBA 4U63A 4A55A 3MKRA 4F3VA 4LNBA 3ASFA 1N94A 4E6HA 2RKKA 4EZKA 3VTYA 1NA3A 4HRNA 3V30A 2PM7A 3PZ4A 1UJJA 3CHMA 5FIOA 1N54A 3Q49B 3PZ2A 1H2UA 3FTZA 3CHSA 1UG3A 4UUCA 3LJNA 2XCCA 5AQBA 1HZ4A 1IHGA 3FEYA 3FUMA 1YMPA 2FO1E 3AU5A 3B7TA 2BF0X 5BNWA 4DPRA 5CHEE 4UWLA 3UINC 1EF1C 2XEEA 2R17C 1XGWA 2IO3C 3JQ1A 4XE0A 1H2VC 5KNGA 4I6JA 3APFA 2WXJA 5FINA 2XPIA 3FUKA 4HLLA 2R03A 1N4SA 3D3MA 4OVUA 4FA6A 3BUAA 2BTDA 3QB2A 1UOHA 2VGXB 4TXRA 4E85A 3ZVVA 3FUDA 1TYQG 1FCHA 4LSZE 5AJDA 2LXMA 4JA7A 1HXIA 1MX2A 2XS1A 3UTMA 4GA2A 1OY3D 5EILA 1NP7A 5T3RA 2C0MA 4RG9A 3MZLB 5CECB 3NB2A 4A63B 3ZW3A 3NQPA 1SZAA 3UKRG 5BPPA 1Z3YA 1IQRA 1OCRE 3O48A 1E96B 3HYMB 4ATGA 2MHKA 2X3MA 3ML8A 2C0LA 2J49A 4AM9A 2IEJA 2AWIA 3D9PA 1N4PA 3L17A 4U96D 2AJAA 4CEMA 1BI7B 3V2XA 2VGYA 4JC8A 5BV0A 5ENRD 5CEDB 3MGBA 3R9MA 3HXEA 4PUCA 3CHOA 4C0MA 3PE3A 4AIFA 5ENTD 3KS2A 4PS7A 4B89A 2GW1A 2WXNA 4MBGA 4BT8A 1U3DA 3J5QB 1JCQA 1JUQA 1Z5SC 2LNIA 4RVBA 2QYJA 2LSVA 4LUNU 3NAWA 3VLDA 2FULA 2R59A 4JW1A 3CGHA 1FPPA 3E30A 3GZSA 3TWQA 2V0PA 1RZ4A 4BFRA 1TNBA 1KT0A 2DWZA 1D8DA 3MYVA 4HQDA 2AXVA 4N3BA 4UI9J 1E8ZA 1KZPA 3FU0A 4GTRA 4GCOA 2VYIA 4WWOA 5FTPA 4FC8A 5JMND 3V2OA 4KBQA 4XI9A 2WB2A 4EZLA 4HI8A 4IULA 3T9KA 4AY6A 1NI1A 4JXTA 5A7DB 2X38A 4HOQA 1O1RA 2Y0BG 3GZ2A 3FEXA 3ASOE 3AS4A 2EIKE 1VDYA 2EINE 1N0QA 4N5QA 1OWNA 1E7VA 3TG5A 2GRRB 1BLXB 1LF8A 5HRYA 3L54A 2LSUA 3SY2A 3QAQA 3QKYA 3R7QA 3CVQA 5HI7A 1TNZA 2PZIA 2IQCA 4WNGA 4Q69A 3QOUA 4EBAA 2Y1LE 1SW6A 5HKPA 1K3ZD 1UJKA 3P2BA 2FEZA 3ISMC 5HS0A 1X5BA 4O1PA 4U8VD 3CKBA 2P2CP 3AU4A 4N5CA 5FZRA 2WXOA 5BXUA 2J07A 3SF4A 5LX8A 2GRLA 2ETAA 3DSVA 3LCAA 5EKQD 3FUHA 4L2LA 2WXFA 4GMJA 2XEVA 2IJGX 2OV8A 3CSFA 3LY7A 3U64A 5G55A 4GCNA 4I1MA 1K1BA 3ZKJA 2CFZA 5FQ6A 3BQOA 4V3IA 3PDNA 2WQ7A 3EHMA 4N3CA 4K5CA 2Q7FA 4HORA 3Q4AB 2IOSA 4KZ0A 5A6CA 1NA0A 4HXIA 3FTXA 3KAEA 4A3VA 4J8SA 4F6RD 2NXPA 1U2VG 3WG7E 5T4YA 3NOCD 3ZHEB 4DLQA 5JJ7A 3B7UX 3E32A 3L9TA 2XEHA 3PEUB 4KVOA 4EZJA 3OXLA 1KZOA 4XKCA 4WNFA 3ULEG 5JHAA 3CVNA 5G05J 5ENNA 3UM2A 3TWVA 3FDHA 4TUUA 2IONA 4OAVB 3LY9A 1X81A 3RKVA 3DSXA 4IYPA 3JCKC 3Q73A 3G2VA 4J8EA 2H6FA 3U9WA 4CRWA 3LDZA 1E8WA 2J9QA 5KCMA 4RG6A 4G24A 1LD7A 4Z68A 2PL2A 3MKQA 3D9LA 3QWPA 3HVEA 2Y69E 2P58C 1HF8A 1GW6A 1B89A 3PZ3A 5CRUA 3CEQA 3EIJA 5KWDA 3UIPC 1DC2A 4J8DA 3B95A 3ZUVB 2P9SG 5CERB 1OUVA 1E8YA 4LNGA 3CK7A 4RQIA 4DX5D 2R02A 4I6EA 4PH4B 3GYZA 2PNNA 2DZNA 4UQYA 4UQXA 3HXBA 1KT1A 1O1TA 1U3CA 1WAO1 3RO2A 2KBXA 1N11A 3L6AA 3N71A 3DSUA 4CDRA 4ANUA 2LUHA 5FQ7A 3FU3A 3V31A 3TWUA 2XZTG 3J5PA 2WQHA 4K03A 4B8AA 3FTSA 4KT6B 4TXQA 3CIAA 1TNUA 3FTWA 3L08A 5FZQA 4NIKA 2OVFA 4WNEA 1SA4A 3QWVA 3JXIA 4JB8P 1PAQA 2FF4A 4GTMA 3NZUA 2DBAA 2DYRE 3SQVA 3R9AB 4C0EA 3WXXA 4F53A 3EHQA 3U3WA 4W9RA 4BTBA 2BUGA 2V4HC 4F1PA 2ZU6B 4GPKA 1H19A 4HB5A 4GTOA 4YNDA 3D9MA 4M3OA 4HI9A 1UN9A 3MV2B 2BEDA 5AN8A 1JWFA 1HG2A 4HRMB 1UN8A 3I4RB 1BPOA 2DIWA 3L16A 1MZCA 5ENOD 4GYOA 2GRNB 5ENQD 4CDNA 5EDSA 3TXMA 1WG0A 5JJTA 4BX8A 2CG3A 2LAHA 3TXNA 3B7SA 1O1SA 3RJVA 5B1BE 3UMVA 3T5VA 4KVMA 1K8KG 3KEAA 3BU8A 3SZ7A 4XX5A 3PE4A 2WXPA 3LVQE 5IY5E 4GZ3A 4GYWA 5HQ8A 4JZYA 3ABME 3C98A 5EIBE 4AJWA 1JCSA 5J08A 2BKKB 1DCEA 5DBKA 2HE0A 1IQUA 2I9CA 2XZDG 3R7RA 3QJZA 3ONLA 2UY1A 1MJ0A 4JHRA 2I2OA 5KNHD 4UQZA 4AV7A 4TXPA 1ELRA 5C2YA 3KSQA 1TN7A 2QC9A 4C48B 1TNYA 3SD5A 4CGWA 4FLBA 4GZCA 4WNDA 3CVYA 3HHMA 4U04A 3PNTB 4MKTA 3UUXA 1OWMA 4YVQC 2EILE 4P29A 3O4ZA 3X2QE 1DCQA 2EIME 3D9NA 1HU3A 4IRUA 3ZYMA 4UI9K 3FULA 1AWCB 1P5QA 5ITZF 1EPUA 2RFMA 3T5XA 3E34A 4HRLA 3QC1A 2GRMA 3AG4E 2XPZA 4H7YA 4ATZD 1HFAA 5FZSA 5AJLA 4PS3A 2P9PG 5E75A 2QY7A 1K1AA 3ZXSA 3CHRA 5KJNA 3CHPA 4GZ5A 1H2TC 2PQRA 4OAUC 2GRQB 3NF1A 2VSNA 3ZHEA 4AVXA 1IYGA 1Z6TA 5CMYA 4FU3A 5AQ9A 4ILHB 2HO1A 2R5SA 5EYLA 5G04C 4N2QA 4O1OA 2J09A 3MCXA 2XGOA 3Q9UC 4K5AB 4HFGA 4DX7D 3APCA 5LCWC 3LKUA 4QFVA 2CHWA 4AP2A 2ZXWE 4N2SA 3IBEA 2P9LG 2LAIA 3CQCB 3QDNA 4JVSA 5FQ4A 2XQ0A 3HVEB 3I4GA 4JA9A 3ZRHA 4U07A 2XS8A 2ZGDA 1N0RA 4UWFA 2A5UA 2LO6A 4Y6CA 1EYHA 1YA0A 4A1GA 2H6HA 3L22A 5CBOA 3RRNB 3PNLB 3DPYA 4BSXA 1E8XA 3K9IA 1H0AA 3FUNA 3CVXA 3FU6A 4CCAA 3ULYA 4X8QA 4EHMA 4FHKA 4LEUA 4NURA 3TL5A 2KZTB 1NZNA 4YDEA 4EECA 4JL0A 4FJYA 2F8XK 4UWHA 4GB9A 4G23A 2UWJG 4HOTA 3HG0D 2NYJA 2KZTA 2VJ8A 2L9BA 3ZU7B 2DVWA 2CG2A 3LY8A 3E37A 2WMOA 4ME2A 1HS6A 4G8LA 3SNXA 4KMOA 2R2LA 3ASHA 3W9GA 2J4DA 5KJMA 3TWSA 3L13A 3ZFWA 1S70B 3EHNA 4JEUA 3LYAA 2XRZA 2IY0C 3ZYQA 4CYMD 4YVOA 1TJFA 3C3QA 4HVBA 4ABNA 4QQIA 3EHRA 2Y4UA 4YDWA 3AG3E 3EDTB 3D9OA 4GU5A 3CVLA 3CR3A 2GGFA 3ZEFA 4ZFHA 3LXUX 3ZYKA 3I3NA 2X6IA 1SQMA 3OXGA 4L23A 4G2VA 2Y3AA 2M63A 2WXRA 4G11A 4NQ0A 5A23A 3IHVA 3Q79A 4TRQA 2J8SD 3DRAA 3C3RA 2WXHA 4LG6A 3G2TA 3DBSA 5B1AE 5BUZA 2I1KA 3PREA 2B6CA 3UIOC 3UM1A 3PEVB 1OT8A 5LFAA 3P1UA 1JPLA 4ACLA 3ESLA 1QBQA 4JHJA 2J08A 2BKGA 4J8YA 2L6JA 3MEKA 3DXKG 3DPDA 3I5PA 4EPZA 4HOSA 3ULQA 4KYOB 4WUYA 3FH7A 4GMRA 5CMWA 3TAXA 2I6HA 4AEZC 4JPSA 1MHQA 4DK5A 3IEGA 4N3AA 4BTAA 3AG2E 2FBNA 3L82A 4I17A 3RRMB 3NBNB 3CKCA 1MYOA 3HXCA 1XNFA 2X6JA 5FJYA 1D9SA 4ANXA 1MQSA 2OCCE 4BX9A 4R7LA 1FVFA 3DWLG 4HOUA 2XCBA 2OEVA 3CV0A 1N52A 5EX3A 4EQFA 3UM3A 2OEWA 3CSTA 3W9FA 4GTQA 4L9PA 4DX1A 3E33A 4FP7A 3EUVA 3U4TA 3PUJA 2HYZA 4XI0A 2X6KA 2XPYA 5ANLA 4Y6WA 3UPVA 3DXMG 1OXJA 3DSWA 5AQ7A 4U95D 4DRXE 2VGXA 3CVUA 2CHZA 3IXEA 4I1AA 4CDMA 4U0ZA 4YDOA 3IHYA 2H6GA 4HS2A 2IU1A 4LCTA 4G25A 3ABLE 5D2MC 1V55E 3PZ1A 3T8MA 2H6IA 2A4ZA 1SA5A 3CHQA 3SFXA 2YHCA 3FUEA 3APDA 5CBNA 5KJLA 1L5JA 4ILGA 4FADA 2Y4TA 3ZYLA 2B0OE 3JUIA 1EDUA 1G3NB 3U66A 2YQ8A 2CHXA 4UI9C 2QFCA 5BT1A 5AARA 3CQGB 4GA0A 4HNAD 3TWWA 4G26A 2ETCA 3PRZA 3HXDA 1ZBPA 4L7TA 1TEZA 4NACA 3B13A 3OTNA 2KC7A 1HO8A 4N39A 3TGOA 3ABKE 4RLYA 2RD0A 3S7DA 3S7BA 3CVPA
chains in the Genus database with same CATH topology
3KEZA 2XPZA 3QNKA 3QKYA 3R7QA 2KATA 3CVQA 3G2UA 5FQ8A 4U8HA 4RSYA 4H7YA 2WVIA 5HI7A 1DNPA 1HFAA 5FZSA 3KD7A 2PZIA 2IQCA 4WNGA 4Q69A 4F7AA 5AJLA 3QOUA 4JHKA 3FY4A 3FUIA 4PS3A 4EBAA 4B8CB 5JHBA 4APOA 5E75A 2QY7A 4Q96A 3FH8A 4A3TA 4CT4A 3ZXSA 1UJKA 3P2BA 2FEZA 3GW4A 1X5BA 3CHRA 5KJNA 4PDXA 3CHPA 3E4BA 3Q15A 3CKBA 4GZ5A 1H2TC 2E0IA 4B0ZA 2WMNA 2PQRA 3AU4A 3PVLA 3NF1A 4N5CA 5FZRA 3SBTB 2V5FA 2WXOA 2VSNA 2J07A 3SF4A 3RRUA 3ZHEA 1UW4B 3NZSA 4AVXA 2GRLA 3ZGQA 5LX8A 4I9CA 3CK9A 3GZ1A 4ANVA 4FULA 1IYGA 3Q47B 3LCAA 1Z6TA 3ESKA 5CMYA 2XRYA 5EKQD 4LERA 4F1SA 3FUHA 4L2LA 4BY6A 4FU3A 2WXFA 4DJAA 4ILHB 4GMJA 2JEKA 3LPZA 5CCLA 2XEVA 2HO1A 2R5SA 2OVBA 2IJGX 2OV8A 3CSFA 3LY7A 3U64A 3FH5A 2KCLA 4MRUA 5G55A 4GCNA 3SHFA 5G04C 4WAFA 2WPVA 3D9JA 4AXHA 4N2QA 4I1MA 2ONDA 5EX0A 2CFZA 2J09A 4GZDA 5FQ6A 4V3IA 3MX3A 3PDNA 4AOFA 2WQ7A 2AVPA 3EHMA 3MCXA 3S7FA 2XGOA 4N3CA 5AIJA 3S7JA 4HFGA 3QARA 3APCA 4A1SA 3URZA 5LCWC 3LKUA 2Q7FA 4QFVA 3D9IA 2CHWA 2IOSA 3Q4AB 1H6KA 4KZ0A 4HORA 1OWLA 4O6FA 5A6CA 4AP2A 1NA0A 4N2SA 3LJ3A 3IBEA 2IOLA 3FTYA 5D0OD 2LAIA 3CQCB 2VQ2A 4HXIA 5LOZA 3QDNA 5E76A 4JVSA 3B7RL 2XQ0A 5FQ4A 3FWVA 4ANWA 3VTXA 3HVEB 3I4GA 4JA9A 3FTXA 3ZRHA 5JJ6A 2XGSA 3MJWA 4J8FA 3KAEA 4FHJA 4U07A 4A3VA 4J8SA 2NXPA 4UWFA 2A5UA 2LO6A 3S2AA 2XGMA 5T4YA 3ZHEB 3Q5MA 4DLQA 4Y6CA 5JJ7A 1EYHA 2WXLA 3B7UX 1ELKA 2WQ6A 1YA0A 2I1JA 1PY1A 2X6FA 4A1GA 3PEUB 4G1TA 1SZ9A 4KVOA 4EZJA 3CVWA 3L22A 3OXLA 4XKCA 4WNFA 3RRNB 3PNLB 3UX4A 4BSXA 5JHAA 3PUKA 3CVNA 1E8XA 3K9IA 1H0AA 3FUNA 5G05J 2DCPA 3QWWA 3FU6A 3CVXA 5ENNA 4CCAA 4MLPA 4TV3A 4DI4A 4DLOA 5LP0A 4FHKA 3OAWA 3LVRE 1DVPA 3FDHA 3UT8A 4TUUA 2KCVA 3ASDA 2IONA 3MKQB 4LEUA 3TJPA 3LY9A 3RKVA 4EBAG 2RG8A 4NURA 3LEWA 4IYPA 3JCKC 1ZU2A 3TL5A 4LRZA 2KZTB 4U0UA 3BG1B 3ZN3A 1QZ2A 1NZNA 1Y6IA 2NC9A 3CK8A 4EECA 3G2VA 4J8EA 4JL0A 1WY6A 4FJYA 4UWHA 5FWQA 4ACKA 3IKOB 4GB9A 1KLXA 4G23A 3U9WA 4CRWA 3VLEA 2UWJG 3LDZA 1E8WA 2J9QA 5KCMA 4HOTA 4RG6A 4G24A 3SFZA 1OWOA 2KZTA 2VJ8A 2WXGA 2YHEA 3PZDA 4UWGA 3SI5A 1TJCA 4ILIA 2L9BA 1E90A 2WXIA 2PL2A 3MKQA 2IF4A 2CG2A 3LS8A 3D9LA 3LY8A 3QK0A 4CGVA 3PH0C 2WMOA 3QWPA 3HVEA 4PS8A 4U63A 5G2NA 3RIBA 4A55A 2P58C 4ME2A 2VSOE 1HF8A 3MKRA 1GW6A 2OOEA 1B89A 2VSXE 4F3VA 3CEQA 3EIJA 2NSZA 4BT9A 1HS6A 3HIZA 4CT0A 3ASFA 4J8DA 3SNXA 4KMOA 4E6HA 2WM9A 3UT7A 3ASHA 4EZKA 2J4DA 3VTYA 4GA1A 5KJMA 1NA3A 1OUVA 3L13A 1E8YA 2FO7A 3ZFWA 3EHNA 4J0UA 4JEUA 5CCMA 3LYAA 3CK7A 4FJZA 3EIQC 2PM7A 2XRZA 2CFUA 1UJJA 3ZYQA 4YVOA 3CHMA 1TJFA 4HVBA 2VSYA 3D9KA 5C1DA 4ABNA 4I6EA 3CVVA 4PH4B 1N54A 3Q49B 3GYZA 4GZ6A 4XKBA 1H2UA 3FTZA 3CHSA 2Y4UA 1UG3A 2EQXA 3EDTB 4WWNA 2XCCA 3FU5A 3D9OA 1HZ4A 4UQYA 1IHGA 3FEYA 3FUMA 2WXKA 4GU5A 4UQXA 3CVLA 1KT1A 3CR3A 2GGFA 3AU5A 1U3CA 3ZEFA 3B7TA 3LXUX 1WAO1 2BF0X 3ZYKA 5BNWA 3RO2A 4DPRA 5CHEE 3I3NA 4UWLA 2X6IA 1EF1C 1SQMA 3OXGA 3EJNA 4L23A 2R17C 4G2VA 1XGWA 2Y3AA 2M63A 2WXRA 3BG0B 3JQ1A 3L6AA 4G11A 4NQ0A 5A23A 3N71A 3CLJA 4XE0A 4CDRA 3IHVA 4ANUA 1H2VC 4TRQA 5FQ7A 4I6JA 3BEEA 3APFA 3FU3A 4JEHA 3FTVA 2WXHA 4FLHA 4IN3B 3G2TA 5BV1A 1OWPA 2WXJA 3DBSA 5BUZA 5LCWJ 2WQHA 2I1KA 4K03A 2XPIA 2MRIA 3FUKA 3PREA 4B8AA 3FTSA 4KT6B 3CIAA 3D3MA 3FTWA 4OVUA 2V8SE 3OXFA 3L08A 5FZQA 4FA6A 3PEVB 2BTDA 2OVFA 3P1UA 4WNEA 5LFAA 1HG5A 3QB2A 3FUJA 1JPLA 3QWVA 2VGXB 4ACLA 4OYSA 3ESLA 4E85A 2KCKA 1PAQA 3ZVVA 3FUDA 5D0QD 2FF4A 3NZUA 2DBAA 4Q94A 1FCHA 3R9AB 4C0EA 4JHJA 3WXXA 4F53A 5AJDA 2J08A 4JA7A 4BWRA 3U3WA 4W9RA 3HDXA 4AY5A 1HXIA 2L6JA 4BTBA 3MEKA 3DPDA 3I5PA 4EPZA 5AENA 2VTBA 4HOSA 3UQ3A 3ENEA 3ULQA 5J90A 3RK6A 4KYOB 4WUYA 3JYSA 3FUFA 3FH7A 4GA2A 5CMWA 4DI3A 1PC2A 2BUGA 3G2WA 3TAXA 4L2YA 2I6HA 2ZU6B 4GYYA 1NP7A 3RO3A 1HH8A 5T3RA 4GPKA 1H19A 2C0MA 1JWGA 4RG9A 4XZ4A 4KXKB 3VLFA 4L1BA 4I43A 3FFLA 3MZLB 4AEZC 4JPSA 1Z3XA 3ZIMA 1MHQA 2IFUA 4GAAA 4DK5A 1QQEA 3ZW3A 3NQPA 3IEGA 1SZAA 4N3AA 5FT9A 4BTAA 5BPPA 2X6HA 4YNDA 3RU0A 2FBNA 3D9MA 1Z3YA 1IQRA 4I17A 4M3OA 3RRMB 3CKCA 5M72A 3O48A 1E96B 1HX8A 4C9BB 3HYMB 4ATGA 3MA5A 1XNFA 2MHKA 1UN9A 3MV2B 2X6JA 5FJYA 2X3MA 3ML8A 2C0LA 2J49A 1JWFA 1HG2A 1QNFA 2AWIA 2HM8A 1MQSA 1UN8A 2KM4A 3FP3A 4AM9A 4ANXA 3D9PA 4BX9A 2FI7A 3I4RB 1BPOA 1HE8A 2DIWA 4HLEA 3L16A 3L17A 4R7LA 4OVVA 5T8IA 1FVFA 4CEMA 2YINA 3ASGA 4GYOA 3FHEA 3FTUA 2VTBB 4HOUA 2VGYA 4JC8A 4MS6A 4CDNA 5BV0A 5EDSA 3MGBA 3TXMA 5JJTA 4BX8A 2XCBA 2CG3A 3CV0A 1N52A 5EX3A 4EQFA 2LAHA 4I6GA 4KZCA 3CSTA 4PUCA 3CHOA 4C0MA 3PE3A 5ARFA 3ZPJA 4U0SA 3TXNA 4B94A 4XIFA 2ILRA 3B7SA 4URKA 4AIFA 3RJVA 3MV3B 4NRHB 1E7UA 1WM5A 2YNQA 4FP7A 2JLBA 3PUJA 3U4TA 2HYZA 4XI0A 3KS2A 2X6KA 2XPYA 5ANLA 4PS7A 4B89A 4Y6WA 2L0TB 3UT4A 3UPVA 1Y8MA 2GW1A 2WXNA 3UMVA 4CGWA 4BT8A 1U3DA 2AW6A 2UY1B 3T5VA 1INZA 2V4LA 4KVMA 1JUQA 5ARGA 2LNIA 2VGXA 4RVBA 4D10C 2LSVA 2HR2A 3CVUA 4LUNU 3SZ7A 4I1OB 2CHZA 4XX5A 2WXMA 5ANRA 2PQNA 3PE4A 4I1AA 2WXPA 4I2ZA 3LVQE 2FULA 3VLDA 4CDMA 2R59A 2AXZA 4GZ3A 2PM6A 4JW1A 4U0ZA 3CGHA 3IHYA 1FVHA 4GYWA 3GZSA 4HS2A 2XHEA 2V0PA 5HQ8A 4JZYA 2IU1A 2WXQA 4LCTA 4BFRA 1A17A 1KT0A 4G25A 3C98A 3QC1A 4AJWA 5G04J 5BW8C 3IV0A 5J08A 4I2WA 5DBKA 3T8MA 3MYVA 1IQUA 3G2SA 2AXVA 2I9CA 4N3BA 2A4ZA 3R7RA 3CHQA 3QJZA 3SGHA 2C2LA 2UY1A 2YHCA 3ONLA 1E8ZA 3FUEA 3APDA 4UI9J 5KJLA 4JHRA 1L5JA 3JQ0A 2L0IA 4ILGA 2I2OA 2MOWA 4FADA 2Y4TA 4WWPA 4UQZA 4AV7A 3ML9A 3FU0A 4GCOA 2VYIA 4WWOA 5FTPA 3ZYLA 4J6IA 1ELRA 4FC8A 4I9EA 5C2YA 4H7XA 4K0RA 3JUIA 4KBQA 4UWKA 3TG4A 1EDUA 4APFA 2J4BA 3ONKA 4XI9A 2WB2A 3U66A 2YQ8A 4EZLA 3AS5A 4FLBA 4GZCA 2CHXA 4IULA 4UI9C 2QFCA 4WNDA 3SD5A 3AS8A 5BT1A 4AY6A 4JXTA 5A7DB 2X38A 3CVYA 3CQGB 4HOQA 3HHMA 3GZ2A 5DIZA 4U04A 4GA0A 3FEXA 4GMLA 1S0PA 5G05C 3AS4A 3PNTB 4MKTA 4G26A 3UUXA 3PRZA 1OWMA 4YVQC 1ZBPA 4P29A 4L7TA 3O4ZA 1VDYA 1TEZA 5KJKA 4NACA 2E2EA 1HU3A 1OWNA 3D9NA 3PS6A 4IRUA 3ZYMA 3B13A 4UI9K 2AXUA 3OTNA 1E7VA 2KC7A 3TG5A 1ELWA 1HO8A 5AYWD 3FULA 4N39A 1P5QA 3TGOA 3SBSA 1LF8A 2RD0A 3L54A 1EPUA 3T5XA 2LSUA 3S7DA 3QAQA 3S7BA 2GRMA 1W3BA 3CVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIW A;  3D9O A;  1JWG A;  3G2U A;  3G2T A;  3LDZ A;  3D9J A;  5LOZ A;  3ZYL A;  2L0T B;  1H0A A;  4Q94 A;  1HFA A;  2DCP A;  1VDY A;  5J08 A;  4GZD A;  1MHQ A;  4NAC A;  3RRU A;  3D9N A;  1EDU A;  5LP0 A;  2BF0 X;  3ZYK A;  3ZYM A;  4AVX A;  1JUQ A;  3ONK A;  1INZ A;  1SZA A;  3G2S A;  1DVP A;  1UJJ A;  3D9M A;  5CMY A;  2LO6 A;  3D9L A;  3ZYQ A;  4FLB A;  2V8S E;  2QY7 A;  3D9K A;  4GZC A;  4Q96 A;  4HFG A;  1XGW A;  4FU3 A;  1HX8 A;  3ONL A;  1EYH A;  1LF8 A;  1ELK A;  4JXT A;  1HF8 A;  1UJK A;  3CLJ A;  1X5B A;  1PY1 A;  1HG5 A;  3D9I A;  1JWF A;  1HG2 A;  2KM4 A;  2L0I A;  1SZ9 A;  3G2W A;  2MOW A;  5CMW A;  1JPL A;  3G2V A;  3D9P A; 
#chains in the Genus database with same CATH topology
 3KEZ A;  2KAT A;  3G2U A;  4U8H A;  4RSY A;  2WVI A;  1SVX A;  1FT1 A;  4F7A A;  3FY4 A;  3FUI A;  4B8C B;  4BSZ B;  4A3T A;  2F8Y A;  3EU9 A;  3GW4 A;  3T8K A;  3E4B A;  3Q15 A;  4B0Z A;  2E0I A;  1TN6 A;  3SBT B;  3UKU G;  3RRU A;  1UW4 B;  3NZS A;  3CK9 A;  3GZ1 A;  4ANV A;  4FUL A;  4LER A;  4DJA A;  1Q2Z A;  3LPZ A;  5CCL A;  2OVB A;  2KCL A;  4O60 A;  4MRU A;  2QZA A;  4AXH A;  1ZB1 A;  2OND A;  5EX0 A;  2AVP A;  3S7J A;  3QAR A;  5ENP D;  3URZ A;  2ZIS A;  1H6O A;  3LJ3 A;  2IOL A;  3FTY A;  2VQ2 A;  2GRP B;  3FWV A;  4ANW A;  3VTX A;  2LXL A;  3ZXP A;  2XGS A;  4J8F A;  3Q5M A;  2WXL A;  1PY1 A;  3C72 A;  3AG1 E;  3CVW A;  4G1T A;  1SZ9 A;  3RSE G;  1TR4 A;  4XEI G;  2P9I G;  4MLP A;  4TV3 A;  5LP0 A;  3LVR E;  1DVP A;  3UT8 A;  2KCV A;  3MKQ B;  5CRV A;  4LRZ A;  4U0U A;  3BG1 B;  3ZN3 A;  3CK8 A;  2NC9 A;  3F6Q A;  5KBA A;  1WY6 A;  5FWQ A;  3IKO B;  3AJI A;  2P9K G;  3SFZ A;  3SI5 A;  1OWO A;  2WXG A;  4GTT A;  3PZD A;  4K5B A;  4UWG A;  1TJC A;  1OCC E;  4ILI A;  5BXO A;  1E90 A;  3PH0 C;  3HXF A;  4PS8 A;  5G2N A;  4DUI A;  1A5E A;  2VSO E;  1TN8 A;  2OOE A;  2VSX E;  2NSZ A;  4BT9 A;  3HIZ A;  4CT0 A;  2WM9 A;  3UT7 A;  5CEA A;  1IKN D;  4GA1 A;  1RW2 A;  5H7P A;  2FO7 A;  4J0U A;  3AAA C;  5CCM A;  1LD8 A;  4FJZ A;  3EIQ C;  2CFU A;  2ZGG A;  2VSY A;  3D9K A;  5C1D A;  3CVV A;  3ASN E;  4GZ6 A;  4XKB A;  1BI8 B;  2EQX A;  1QYM A;  4WWN A;  3FU5 A;  1MX6 A;  2WXK A;  4DX2 A;  5EN5 D;  1LTX A;  2RFA A;  4TUM A;  3EJN A;  5D66 A;  3BG0 B;  3CLJ A;  3EU5 A;  4JEH A;  3BEE A;  4BER A;  3FTV A;  4IN3 B;  4FLH A;  5EYP F;  5BV1 A;  1OWP A;  5LCW J;  2F37 A;  2MRI A;  3NOG D;  4G8K A;  2V8S E;  3OXF A;  4HBD A;  1HG5 A;  3FUJ A;  1O5M A;  1KPS B;  4OYS A;  2KCK A;  5D0Q D;  4Q94 A;  1YCS B;  3JXJ A;  2VGE A;  4BWR A;  3HDX A;  4AY5 A;  4B93 B;  5AEN A;  2VTB A;  3UQ3 A;  3ENE A;  5J90 A;  3RK6 A;  1N95 A;  3JYS A;  3Q75 A;  3FUF A;  4DI3 A;  1PC2 A;  3G2W A;  4ZHB A;  1OCZ E;  4L2Y A;  2GRO B;  4GYY A;  3RO3 A;  1HH8 A;  1JWG A;  5AQA A;  4XZ4 A;  4KXK B;  3VLF A;  4L1B A;  4I43 A;  3FFL A;  4BET A;  1Z3X A;  3ZIM A;  4JD2 G;  2IFU A;  4GAA A;  1QQE A;  3C5R A;  5FT9 A;  2X6H A;  3RU0 A;  5M72 A;  1TNO A;  1HX8 A;  4C9B B;  3MA5 A;  2KM4 A;  1QNF A;  2HM8 A;  3FP3 A;  1D8E A;  2FI7 A;  1HE8 A;  4HLE A;  3DEP A;  4OVV A;  5T8I A;  2YIN A;  3ASG A;  3FHE A;  3FTU A;  2VTB B;  1AP7 A;  4MS6 A;  3UI2 A;  4BEP A;  5ENS D;  3DSS A;  4I6G A;  4KZC A;  2ZIR A;  1V54 E;  2DZO A;  5ARF A;  3ZPJ A;  4U0S A;  3B7B A;  4B94 A;  4XIF A;  2ILR A;  4URK A;  3MV3 B;  4NRH B;  2F0Y A;  1E7U A;  1WM5 A;  2YNQ A;  2JAB A;  2JLB A;  1S64 A;  1NL4 A;  2V5Q C;  2L0T B;  1Y8M A;  2AW6 A;  2UY1 B;  1INZ A;  2V4L A;  2XEN A;  5ARG A;  4GTS A;  4D10 C;  2HR2 A;  4I1O B;  1FT2 A;  2WXM A;  5ANR A;  2PQN A;  4I2Z A;  2AXZ A;  2PM6 A;  1FVH A;  2XHE A;  2WXQ A;  1A17 A;  5G04 J;  5BW8 C;  3IV0 A;  4I2W A;  3G2S A;  3D9H A;  3JUE A;  3SGH A;  4GPM A;  2C2L A;  5JA4 D;  4DX6 D;  3JQ0 A;  2L0I A;  2MOW A;  3TWT A;  2P9U G;  4WWP A;  1OCO E;  3ML9 A;  2ETB A;  3Q78 A;  4J6I A;  4I9E A;  4H7X A;  4U8Y D;  4K0R A;  4UWK A;  3TG4 A;  4APF A;  2R05 A;  2J4B A;  3ONK A;  1IHB A;  1IXV A;  3AS5 A;  3AS8 A;  4BES A;  3KSL A;  5EID A;  3V79 K;  5DIZ A;  4GML A;  1S0P A;  5G05 C;  1BD8 A;  4GTP A;  2A5E A;  2P9N G;  5KJK A;  1JCR A;  2E2E A;  3PS6 A;  5B3S E;  3SO8 A;  2AXU A;  3DEO A;  1ELW A;  5AYW D;  1WDY A;  3SBS A;  3UXG A;  1BU9 A;  3Q9N C;  3UT4 A;  4DI4 A;  1W3B A;  1YYH A;  3QNK A;  5FQ8 A;  1DNP A;  3KD7 A;  1N9A A;  4JHK A;  4YDY A;  5JHB A;  1MX4 A;  4APO A;  4Q96 A;  3FH8 A;  4CT4 A;  2EIJ E;  4LNU D;  4PDX A;  4M7C A;  3C3O A;  2WMN A;  3PVL A;  2KXP C;  1NFI E;  2V5F A;  2L6B A;  2IO2 C;  4GTV A;  3ZGQ A;  4I9C A;  3RAU A;  4J7W A;  3Q47 B;  3ESK A;  4F1S A;  2XRY A;  4BY6 A;  3SFY A;  2JEK A;  3FH5 A;  2DYS E;  3SHF A;  1N4R A;  4WAF A;  5AAO A;  2WPV A;  3D9J A;  4GZD A;  3MX3 A;  4AOF A;  2MYO A;  3S7F A;  5AIJ A;  4A1S A;  1N4Q A;  3D9I A;  1H6K A;  1OWL A;  4O6F A;  3TWX A;  3TWR A;  5D0O D;  5LOZ A;  5E76 A;  3B7R L;  5JJ6 A;  3MJW A;  4FHJ A;  3HRA A;  3UM0 A;  3DST A;  3S2A A;  2XGM A;  1ELK A;  2WQ6 A;  2I1J A;  2X6F A;  4CZ2 D;  3UX4 A;  4U7E B;  3PUK A;  2DCP A;  3QWW A;  4DLO A;  3OAW A;  3TJP A;  3ASD A;  4EBA G;  2RG8 A;  3LEW A;  1ZU2 A;  3Q7F A;  1QZ2 A;  1Y6I A;  4ACK A;  3Q7A A;  1KLX A;  3VLE A;  1S63 A;  1H6P A;  2YHE A;  2QYU A;  2WXI A;  2IF4 A;  3ZNG A;  3LS8 A;  4CGV A;  3QK0 A;  3RIB A;  4U63 A;  4A55 A;  3MKR A;  4F3V A;  4LNB A;  3ASF A;  1N94 A;  4E6H A;  2RKK A;  4EZK A;  3VTY A;  1NA3 A;  4HRN A;  3V30 A;  2PM7 A;  3PZ4 A;  1UJJ A;  3CHM A;  5FIO A;  1N54 A;  3Q49 B;  3PZ2 A;  1H2U A;  3FTZ A;  3CHS A;  1UG3 A;  4UUC A;  3LJN A;  2XCC A;  5AQB A;  1HZ4 A;  1IHG A;  3FEY A;  3FUM A;  1YMP A;  2FO1 E;  3AU5 A;  3B7T A;  2BF0 X;  5BNW A;  4DPR A;  5CHE E;  4UWL A;  3UIN C;  1EF1 C;  2XEE A;  2R17 C;  1XGW A;  2IO3 C;  3JQ1 A;  4XE0 A;  1H2V C;  5KNG A;  4I6J A;  3APF A;  2WXJ A;  5FIN A;  2XPI A;  3FUK A;  4HLL A;  2R03 A;  1N4S A;  3D3M A;  4OVU A;  4FA6 A;  3BUA A;  2BTD A;  3QB2 A;  1UOH A;  2VGX B;  4TXR A;  4E85 A;  3ZVV A;  3FUD A;  1TYQ G;  1FCH A;  4LSZ E;  5AJD A;  2LXM A;  4JA7 A;  1HXI A;  1MX2 A;  2XS1 A;  3UTM A;  4GA2 A;  1OY3 D;  5EIL A;  1NP7 A;  5T3R A;  2C0M A;  4RG9 A;  3MZL B;  5CEC B;  3NB2 A;  4A63 B;  3ZW3 A;  3NQP A;  1SZA A;  3UKR G;  5BPP A;  1Z3Y A;  1IQR A;  1OCR E;  3O48 A;  1E96 B;  3HYM B;  4ATG A;  2MHK A;  2X3M A;  3ML8 A;  2C0L A;  2J49 A;  4AM9 A;  2IEJ A;  2AWI A;  3D9P A;  1N4P A;  3L17 A;  4U96 D;  2AJA A;  4CEM A;  1BI7 B;  3V2X A;  2VGY A;  4JC8 A;  5BV0 A;  5ENR D;  5CED B;  3MGB A;  3R9M A;  3HXE A;  4PUC A;  3CHO A;  4C0M A;  3PE3 A;  4AIF A;  5ENT D;  3KS2 A;  4PS7 A;  4B89 A;  2GW1 A;  2WXN A;  4MBG A;  4BT8 A;  1U3D A;  3J5Q B;  1JCQ A;  1JUQ A;  1Z5S C;  2LNI A;  4RVB A;  2QYJ A;  2LSV A;  4LUN U;  3NAW A;  3VLD A;  2FUL A;  2R59 A;  4JW1 A;  3CGH A;  1FPP A;  3E30 A;  3GZS A;  3TWQ A;  2V0P A;  1RZ4 A;  4BFR A;  1TNB A;  1KT0 A;  2DWZ A;  1D8D A;  3MYV A;  4HQD A;  2AXV A;  4N3B A;  4UI9 J;  1E8Z A;  1KZP A;  3FU0 A;  4GTR A;  4GCO A;  2VYI A;  4WWO A;  5FTP A;  4FC8 A;  5JMN D;  3V2O A;  4KBQ A;  4XI9 A;  2WB2 A;  4EZL A;  4HI8 A;  4IUL A;  3T9K A;  4AY6 A;  1NI1 A;  4JXT A;  5A7D B;  2X38 A;  4HOQ A;  1O1R A;  2Y0B G;  3GZ2 A;  3FEX A;  3ASO E;  3AS4 A;  2EIK E;  1VDY A;  2EIN E;  1N0Q A;  4N5Q A;  1OWN A;  1E7V A;  3TG5 A;  2GRR B;  1BLX B;  1LF8 A;  5HRY A;  3L54 A;  2LSU A;  3SY2 A;  3QAQ A;  3QKY A;  3R7Q A;  3CVQ A;  5HI7 A;  1TNZ A;  2PZI A;  2IQC A;  4WNG A;  4Q69 A;  3QOU A;  4EBA A;  2Y1L E;  1SW6 A;  5HKP A;  1K3Z D;  1UJK A;  3P2B A;  2FEZ A;  3ISM C;  5HS0 A;  1X5B A;  4O1P A;  4U8V D;  3CKB A;  2P2C P;  3AU4 A;  4N5C A;  5FZR A;  2WXO A;  5BXU A;  2J07 A;  3SF4 A;  5LX8 A;  2GRL A;  2ETA A;  3DSV A;  3LCA A;  5EKQ D;  3FUH A;  4L2L A;  2WXF A;  4GMJ A;  2XEV A;  2IJG X;  2OV8 A;  3CSF A;  3LY7 A;  3U64 A;  5G55 A;  4GCN A;  4I1M A;  1K1B A;  3ZKJ A;  2CFZ A;  5FQ6 A;  3BQO A;  4V3I A;  3PDN A;  2WQ7 A;  3EHM A;  4N3C A;  4K5C A;  2Q7F A;  4HOR A;  3Q4A B;  2IOS A;  4KZ0 A;  5A6C A;  1NA0 A;  4HXI A;  3FTX A;  3KAE A;  4A3V A;  4J8S A;  4F6R D;  2NXP A;  1U2V G;  3WG7 E;  5T4Y A;  3NOC D;  3ZHE B;  4DLQ A;  5JJ7 A;  3B7U X;  3E32 A;  3L9T A;  2XEH A;  3PEU B;  4KVO A;  4EZJ A;  3OXL A;  1KZO A;  4XKC A;  4WNF A;  3ULE G;  5JHA A;  3CVN A;  5G05 J;  5ENN A;  3UM2 A;  3TWV A;  3FDH A;  4TUU A;  2ION A;  4OAV B;  3LY9 A;  1X81 A;  3RKV A;  3DSX A;  4IYP A;  3JCK C;  3Q73 A;  3G2V A;  4J8E A;  2H6F A;  3U9W A;  4CRW A;  3LDZ A;  1E8W A;  2J9Q A;  5KCM A;  4RG6 A;  4G24 A;  1LD7 A;  4Z68 A;  2PL2 A;  3MKQ A;  3D9L A;  3QWP A;  3HVE A;  2Y69 E;  2P58 C;  1HF8 A;  1GW6 A;  1B89 A;  3PZ3 A;  5CRU A;  3CEQ A;  3EIJ A;  5KWD A;  3UIP C;  1DC2 A;  4J8D A;  3B95 A;  3ZUV B;  2P9S G;  5CER B;  1OUV A;  1E8Y A;  4LNG A;  3CK7 A;  4RQI A;  4DX5 D;  2R02 A;  4I6E A;  4PH4 B;  3GYZ A;  2PNN A;  2DZN A;  4UQY A;  4UQX A;  3HXB A;  1KT1 A;  1O1T A;  1U3C A;  1WAO 1;  3RO2 A;  2KBX A;  1N11 A;  3L6A A;  3N71 A;  3DSU A;  4CDR A;  4ANU A;  2LUH A;  5FQ7 A;  3FU3 A;  3V31 A;  3TWU A;  2XZT G;  3J5P A;  2WQH A;  4K03 A;  4B8A A;  3FTS A;  4KT6 B;  4TXQ A;  3CIA A;  1TNU A;  3FTW A;  3L08 A;  5FZQ A;  4NIK A;  2OVF A;  4WNE A;  1SA4 A;  3QWV A;  3JXI A;  4JB8 P;  1PAQ A;  2FF4 A;  4GTM A;  3NZU A;  2DBA A;  2DYR E;  3SQV A;  3R9A B;  4C0E A;  3WXX A;  4F53 A;  3EHQ A;  3U3W A;  4W9R A;  4BTB A;  2BUG A;  2V4H C;  4F1P A;  2ZU6 B;  4GPK A;  1H19 A;  4HB5 A;  4GTO A;  4YND A;  3D9M A;  4M3O A;  4HI9 A;  1UN9 A;  3MV2 B;  2BED A;  5AN8 A;  1JWF A;  1HG2 A;  4HRM B;  1UN8 A;  3I4R B;  1BPO A;  2DIW A;  3L16 A;  1MZC A;  5ENO D;  4GYO A;  2GRN B;  5ENQ D;  4CDN A;  5EDS A;  3TXM A;  1WG0 A;  5JJT A;  4BX8 A;  2CG3 A;  2LAH A;  3TXN A;  3B7S A;  1O1S A;  3RJV A;  5B1B E;  3UMV A;  3T5V A;  4KVM A;  1K8K G;  3KEA A;  3BU8 A;  3SZ7 A;  4XX5 A;  3PE4 A;  2WXP A;  3LVQ E;  5IY5 E;  4GZ3 A;  4GYW A;  5HQ8 A;  4JZY A;  3ABM E;  3C98 A;  5EIB E;  4AJW A;  1JCS A;  5J08 A;  2BKK B;  1DCE A;  5DBK A;  2HE0 A;  1IQU A;  2I9C A;  2XZD G;  3R7R A;  3QJZ A;  3ONL A;  2UY1 A;  1MJ0 A;  4JHR A;  2I2O A;  5KNH D;  4UQZ A;  4AV7 A;  4TXP A;  1ELR A;  5C2Y A;  3KSQ A;  1TN7 A;  2QC9 A;  4C48 B;  1TNY A;  3SD5 A;  4CGW A;  4FLB A;  4GZC A;  4WND A;  3CVY A;  3HHM A;  4U04 A;  3PNT B;  4MKT A;  3UUX A;  1OWM A;  4YVQ C;  2EIL E;  4P29 A;  3O4Z A;  3X2Q E;  1DCQ A;  2EIM E;  3D9N A;  1HU3 A;  4IRU A;  3ZYM A;  4UI9 K;  3FUL A;  1AWC B;  1P5Q A;  5ITZ F;  1EPU A;  2RFM A;  3T5X A;  3E34 A;  4HRL A;  3QC1 A;  2GRM A;  3AG4 E;  2XPZ A;  4H7Y A;  4ATZ D;  1HFA A;  5FZS A;  5AJL A;  4PS3 A;  2P9P G;  5E75 A;  2QY7 A;  1K1A A;  3ZXS A;  3CHR A;  5KJN A;  3CHP A;  4GZ5 A;  1H2T C;  2PQR A;  4OAU C;  2GRQ B;  3NF1 A;  2VSN A;  3ZHE A;  4AVX A;  1IYG A;  1Z6T A;  5CMY A;  4FU3 A;  5AQ9 A;  4ILH B;  2HO1 A;  2R5S A;  5EYL A;  5G04 C;  4N2Q A;  4O1O A;  2J09 A;  3MCX A;  2XGO A;  3Q9U C;  4K5A B;  4HFG A;  4DX7 D;  3APC A;  5LCW C;  3LKU A;  4QFV A;  2CHW A;  4AP2 A;  2ZXW E;  4N2S A;  3IBE A;  2P9L G;  2LAI A;  3CQC B;  3QDN A;  4JVS A;  5FQ4 A;  2XQ0 A;  3HVE B;  3I4G A;  4JA9 A;  3ZRH A;  4U07 A;  2XS8 A;  2ZGD A;  1N0R A;  4UWF A;  2A5U A;  2LO6 A;  4Y6C A;  1EYH A;  1YA0 A;  4A1G A;  2H6H A;  3L22 A;  5CBO A;  3RRN B;  3PNL B;  3DPY A;  4BSX A;  1E8X A;  3K9I A;  1H0A A;  3FUN A;  3CVX A;  3FU6 A;  4CCA A;  3ULY A;  4X8Q A;  4EHM A;  4FHK A;  4LEU A;  4NUR A;  3TL5 A;  2KZT B;  1NZN A;  4YDE A;  4EEC A;  4JL0 A;  4FJY A;  2F8X K;  4UWH A;  4GB9 A;  4G23 A;  2UWJ G;  4HOT A;  3HG0 D;  2NYJ A;  2KZT A;  2VJ8 A;  2L9B A;  3ZU7 B;  2DVW A;  2CG2 A;  3LY8 A;  3E37 A;  2WMO A;  4ME2 A;  1HS6 A;  4G8L A;  3SNX A;  4KMO A;  2R2L A;  3ASH A;  3W9G A;  2J4D A;  5KJM A;  3TWS A;  3L13 A;  3ZFW A;  1S70 B;  3EHN A;  4JEU A;  3LYA A;  2XRZ A;  2IY0 C;  3ZYQ A;  4CYM D;  4YVO A;  1TJF A;  3C3Q A;  4HVB A;  4ABN A;  4QQI A;  3EHR A;  2Y4U A;  4YDW A;  3AG3 E;  3EDT B;  3D9O A;  4GU5 A;  3CVL A;  3CR3 A;  2GGF A;  3ZEF A;  4ZFH A;  3LXU X;  3ZYK A;  3I3N A;  2X6I A;  1SQM A;  3OXG A;  4L23 A;  4G2V A;  2Y3A A;  2M63 A;  2WXR A;  4G11 A;  4NQ0 A;  5A23 A;  3IHV A;  3Q79 A;  4TRQ A;  2J8S D;  3DRA A;  3C3R A;  2WXH A;  4LG6 A;  3G2T A;  3DBS A;  5B1A E;  5BUZ A;  2I1K A;  3PRE A;  2B6C A;  3UIO C;  3UM1 A;  3PEV B;  1OT8 A;  5LFA A;  3P1U A;  1JPL A;  4ACL A;  3ESL A;  1QBQ A;  4JHJ A;  2J08 A;  2BKG A;  4J8Y A;  2L6J A;  3MEK A;  3DXK G;  3DPD A;  3I5P A;  4EPZ A;  4HOS A;  3ULQ A;  4KYO B;  4WUY A;  3FH7 A;  4GMR A;  5CMW A;  3TAX A;  2I6H A;  4AEZ C;  4JPS A;  1MHQ A;  4DK5 A;  3IEG A;  4N3A A;  4BTA A;  3AG2 E;  2FBN A;  3L82 A;  4I17 A;  3RRM B;  3NBN B;  3CKC A;  1MYO A;  3HXC A;  1XNF A;  2X6J A;  5FJY A;  1D9S A;  4ANX A;  1MQS A;  2OCC E;  4BX9 A;  4R7L A;  1FVF A;  3DWL G;  4HOU A;  2XCB A;  2OEV A;  3CV0 A;  1N52 A;  5EX3 A;  4EQF A;  3UM3 A;  2OEW A;  3CST A;  3W9F A;  4GTQ A;  4L9P A;  4DX1 A;  3E33 A;  4FP7 A;  3EUV A;  3U4T A;  3PUJ A;  2HYZ A;  4XI0 A;  2X6K A;  2XPY A;  5ANL A;  4Y6W A;  3UPV A;  3DXM G;  1OXJ A;  3DSW A;  5AQ7 A;  4U95 D;  4DRX E;  2VGX A;  3CVU A;  2CHZ A;  3IXE A;  4I1A A;  4CDM A;  4U0Z A;  4YDO A;  3IHY A;  2H6G A;  4HS2 A;  2IU1 A;  4LCT A;  4G25 A;  3ABL E;  5D2M C;  1V55 E;  3PZ1 A;  3T8M A;  2H6I A;  2A4Z A;  1SA5 A;  3CHQ A;  3SFX A;  2YHC A;  3FUE A;  3APD A;  5CBN A;  5KJL A;  1L5J A;  4ILG A;  4FAD A;  2Y4T A;  3ZYL A;  2B0O E;  3JUI A;  1EDU A;  1G3N B;  3U66 A;  2YQ8 A;  2CHX A;  4UI9 C;  2QFC A;  5BT1 A;  5AAR A;  3CQG B;  4GA0 A;  4HNA D;  3TWW A;  4G26 A;  2ETC A;  3PRZ A;  3HXD A;  1ZBP A;  4L7T A;  1TEZ A;  4NAC A;  3B13 A;  3OTN A;  2KC7 A;  1HO8 A;  4N39 A;  3TGO A;  3ABK E;  4RLY A;  2RD0 A;  3S7D A;  3S7B A;  3CVP A; 
#chains in the Genus database with same CATH homology
 3KEZ A;  2XPZ A;  3QNK A;  3QKY A;  3R7Q A;  2KAT A;  3CVQ A;  3G2U A;  5FQ8 A;  4U8H A;  4RSY A;  4H7Y A;  2WVI A;  5HI7 A;  1DNP A;  1HFA A;  5FZS A;  3KD7 A;  2PZI A;  2IQC A;  4WNG A;  4Q69 A;  4F7A A;  5AJL A;  3QOU A;  4JHK A;  3FY4 A;  3FUI A;  4PS3 A;  4EBA A;  4B8C B;  5JHB A;  4APO A;  5E75 A;  2QY7 A;  4Q96 A;  3FH8 A;  4A3T A;  4CT4 A;  3ZXS A;  1UJK A;  3P2B A;  2FEZ A;  3GW4 A;  1X5B A;  3CHR A;  5KJN A;  4PDX A;  3CHP A;  3E4B A;  3Q15 A;  3CKB A;  4GZ5 A;  1H2T C;  2E0I A;  4B0Z A;  2WMN A;  2PQR A;  3AU4 A;  3PVL A;  3NF1 A;  4N5C A;  5FZR A;  3SBT B;  2V5F A;  2WXO A;  2VSN A;  2J07 A;  3SF4 A;  3RRU A;  3ZHE A;  1UW4 B;  3NZS A;  4AVX A;  2GRL A;  3ZGQ A;  5LX8 A;  4I9C A;  3CK9 A;  3GZ1 A;  4ANV A;  4FUL A;  1IYG A;  3Q47 B;  3LCA A;  1Z6T A;  3ESK A;  5CMY A;  2XRY A;  5EKQ D;  4LER A;  4F1S A;  3FUH A;  4L2L A;  4BY6 A;  4FU3 A;  2WXF A;  4DJA A;  4ILH B;  4GMJ A;  2JEK A;  3LPZ A;  5CCL A;  2XEV A;  2HO1 A;  2R5S A;  2OVB A;  2IJG X;  2OV8 A;  3CSF A;  3LY7 A;  3U64 A;  3FH5 A;  2KCL A;  4MRU A;  5G55 A;  4GCN A;  3SHF A;  5G04 C;  4WAF A;  2WPV A;  3D9J A;  4AXH A;  4N2Q A;  4I1M A;  2OND A;  5EX0 A;  2CFZ A;  2J09 A;  4GZD A;  5FQ6 A;  4V3I A;  3MX3 A;  3PDN A;  4AOF A;  2WQ7 A;  2AVP A;  3EHM A;  3MCX A;  3S7F A;  2XGO A;  4N3C A;  5AIJ A;  3S7J A;  4HFG A;  3QAR A;  3APC A;  4A1S A;  3URZ A;  5LCW C;  3LKU A;  2Q7F A;  4QFV A;  3D9I A;  2CHW A;  2IOS A;  3Q4A B;  1H6K A;  4KZ0 A;  4HOR A;  1OWL A;  4O6F A;  5A6C A;  4AP2 A;  1NA0 A;  4N2S A;  3LJ3 A;  3IBE A;  2IOL A;  3FTY A;  5D0O D;  2LAI A;  3CQC B;  2VQ2 A;  4HXI A;  5LOZ A;  3QDN A;  5E76 A;  4JVS A;  3B7R L;  2XQ0 A;  5FQ4 A;  3FWV A;  4ANW A;  3VTX A;  3HVE B;  3I4G A;  4JA9 A;  3FTX A;  3ZRH A;  5JJ6 A;  2XGS A;  3MJW A;  4J8F A;  3KAE A;  4FHJ A;  4U07 A;  4A3V A;  4J8S A;  2NXP A;  4UWF A;  2A5U A;  2LO6 A;  3S2A A;  2XGM A;  5T4Y A;  3ZHE B;  3Q5M A;  4DLQ A;  4Y6C A;  5JJ7 A;  1EYH A;  2WXL A;  3B7U X;  1ELK A;  2WQ6 A;  1YA0 A;  2I1J A;  1PY1 A;  2X6F A;  4A1G A;  3PEU B;  4G1T A;  1SZ9 A;  4KVO A;  4EZJ A;  3CVW A;  3L22 A;  3OXL A;  4XKC A;  4WNF A;  3RRN B;  3PNL B;  3UX4 A;  4BSX A;  5JHA A;  3PUK A;  3CVN A;  1E8X A;  3K9I A;  1H0A A;  3FUN A;  5G05 J;  2DCP A;  3QWW A;  3FU6 A;  3CVX A;  5ENN A;  4CCA A;  4MLP A;  4TV3 A;  4DI4 A;  4DLO A;  5LP0 A;  4FHK A;  3OAW A;  3LVR E;  1DVP A;  3FDH A;  3UT8 A;  4TUU A;  2KCV A;  3ASD A;  2ION A;  3MKQ B;  4LEU A;  3TJP A;  3LY9 A;  3RKV A;  4EBA G;  2RG8 A;  4NUR A;  3LEW A;  4IYP A;  3JCK C;  1ZU2 A;  3TL5 A;  4LRZ A;  2KZT B;  4U0U A;  3BG1 B;  3ZN3 A;  1QZ2 A;  1NZN A;  1Y6I A;  2NC9 A;  3CK8 A;  4EEC A;  3G2V A;  4J8E A;  4JL0 A;  1WY6 A;  4FJY A;  4UWH A;  5FWQ A;  4ACK A;  3IKO B;  4GB9 A;  1KLX A;  4G23 A;  3U9W A;  4CRW A;  3VLE A;  2UWJ G;  3LDZ A;  1E8W A;  2J9Q A;  5KCM A;  4HOT A;  4RG6 A;  4G24 A;  3SFZ A;  1OWO A;  2KZT A;  2VJ8 A;  2WXG A;  2YHE A;  3PZD A;  4UWG A;  3SI5 A;  1TJC A;  4ILI A;  2L9B A;  1E90 A;  2WXI A;  2PL2 A;  3MKQ A;  2IF4 A;  2CG2 A;  3LS8 A;  3D9L A;  3LY8 A;  3QK0 A;  4CGV A;  3PH0 C;  2WMO A;  3QWP A;  3HVE A;  4PS8 A;  4U63 A;  5G2N A;  3RIB A;  4A55 A;  2P58 C;  4ME2 A;  2VSO E;  1HF8 A;  3MKR A;  1GW6 A;  2OOE A;  1B89 A;  2VSX E;  4F3V A;  3CEQ A;  3EIJ A;  2NSZ A;  4BT9 A;  1HS6 A;  3HIZ A;  4CT0 A;  3ASF A;  4J8D A;  3SNX A;  4KMO A;  4E6H A;  2WM9 A;  3UT7 A;  3ASH A;  4EZK A;  2J4D A;  3VTY A;  4GA1 A;  5KJM A;  1NA3 A;  1OUV A;  3L13 A;  1E8Y A;  2FO7 A;  3ZFW A;  3EHN A;  4J0U A;  4JEU A;  5CCM A;  3LYA A;  3CK7 A;  4FJZ A;  3EIQ C;  2PM7 A;  2XRZ A;  2CFU A;  1UJJ A;  3ZYQ A;  4YVO A;  3CHM A;  1TJF A;  4HVB A;  2VSY A;  3D9K A;  5C1D A;  4ABN A;  4I6E A;  3CVV A;  4PH4 B;  1N54 A;  3Q49 B;  3GYZ A;  4GZ6 A;  4XKB A;  1H2U A;  3FTZ A;  3CHS A;  2Y4U A;  1UG3 A;  2EQX A;  3EDT B;  4WWN A;  2XCC A;  3FU5 A;  3D9O A;  1HZ4 A;  4UQY A;  1IHG A;  3FEY A;  3FUM A;  2WXK A;  4GU5 A;  4UQX A;  3CVL A;  1KT1 A;  3CR3 A;  2GGF A;  3AU5 A;  1U3C A;  3ZEF A;  3B7T A;  3LXU X;  1WAO 1;  2BF0 X;  3ZYK A;  5BNW A;  3RO2 A;  4DPR A;  5CHE E;  3I3N A;  4UWL A;  2X6I A;  1EF1 C;  1SQM A;  3OXG A;  3EJN A;  4L23 A;  2R17 C;  4G2V A;  1XGW A;  2Y3A A;  2M63 A;  2WXR A;  3BG0 B;  3JQ1 A;  3L6A A;  4G11 A;  4NQ0 A;  5A23 A;  3N71 A;  3CLJ A;  4XE0 A;  4CDR A;  3IHV A;  4ANU A;  1H2V C;  4TRQ A;  5FQ7 A;  4I6J A;  3BEE A;  3APF A;  3FU3 A;  4JEH A;  3FTV A;  2WXH A;  4FLH A;  4IN3 B;  3G2T A;  5BV1 A;  1OWP A;  2WXJ A;  3DBS A;  5BUZ A;  5LCW J;  2WQH A;  2I1K A;  4K03 A;  2XPI A;  2MRI A;  3FUK A;  3PRE A;  4B8A A;  3FTS A;  4KT6 B;  3CIA A;  3D3M A;  3FTW A;  4OVU A;  2V8S E;  3OXF A;  3L08 A;  5FZQ A;  4FA6 A;  3PEV B;  2BTD A;  2OVF A;  3P1U A;  4WNE A;  5LFA A;  1HG5 A;  3QB2 A;  3FUJ A;  1JPL A;  3QWV A;  2VGX B;  4ACL A;  4OYS A;  3ESL A;  4E85 A;  2KCK A;  1PAQ A;  3ZVV A;  3FUD A;  5D0Q D;  2FF4 A;  3NZU A;  2DBA A;  4Q94 A;  1FCH A;  3R9A B;  4C0E A;  4JHJ A;  3WXX A;  4F53 A;  5AJD A;  2J08 A;  4JA7 A;  4BWR A;  3U3W A;  4W9R A;  3HDX A;  4AY5 A;  1HXI A;  2L6J A;  4BTB A;  3MEK A;  3DPD A;  3I5P A;  4EPZ A;  5AEN A;  2VTB A;  4HOS A;  3UQ3 A;  3ENE A;  3ULQ A;  5J90 A;  3RK6 A;  4KYO B;  4WUY A;  3JYS A;  3FUF A;  3FH7 A;  4GA2 A;  5CMW A;  4DI3 A;  1PC2 A;  2BUG A;  3G2W A;  3TAX A;  4L2Y A;  2I6H A;  2ZU6 B;  4GYY A;  1NP7 A;  3RO3 A;  1HH8 A;  5T3R A;  4GPK A;  1H19 A;  2C0M A;  1JWG A;  4RG9 A;  4XZ4 A;  4KXK B;  3VLF A;  4L1B A;  4I43 A;  3FFL A;  3MZL B;  4AEZ C;  4JPS A;  1Z3X A;  3ZIM A;  1MHQ A;  2IFU A;  4GAA A;  4DK5 A;  1QQE A;  3ZW3 A;  3NQP A;  3IEG A;  1SZA A;  4N3A A;  5FT9 A;  4BTA A;  5BPP A;  2X6H A;  4YND A;  3RU0 A;  2FBN A;  3D9M A;  1Z3Y A;  1IQR A;  4I17 A;  4M3O A;  3RRM B;  3CKC A;  5M72 A;  3O48 A;  1E96 B;  1HX8 A;  4C9B B;  3HYM B;  4ATG A;  3MA5 A;  1XNF A;  2MHK A;  1UN9 A;  3MV2 B;  2X6J A;  5FJY A;  2X3M A;  3ML8 A;  2C0L A;  2J49 A;  1JWF A;  1HG2 A;  1QNF A;  2AWI A;  2HM8 A;  1MQS A;  1UN8 A;  2KM4 A;  3FP3 A;  4AM9 A;  4ANX A;  3D9P A;  4BX9 A;  2FI7 A;  3I4R B;  1BPO A;  1HE8 A;  2DIW A;  4HLE A;  3L16 A;  3L17 A;  4R7L A;  4OVV A;  5T8I A;  1FVF A;  4CEM A;  2YIN A;  3ASG A;  4GYO A;  3FHE A;  3FTU A;  2VTB B;  4HOU A;  2VGY A;  4JC8 A;  4MS6 A;  4CDN A;  5BV0 A;  5EDS A;  3MGB A;  3TXM A;  5JJT A;  4BX8 A;  2XCB A;  2CG3 A;  3CV0 A;  1N52 A;  5EX3 A;  4EQF A;  2LAH A;  4I6G A;  4KZC A;  3CST A;  4PUC A;  3CHO A;  4C0M A;  3PE3 A;  5ARF A;  3ZPJ A;  4U0S A;  3TXN A;  4B94 A;  4XIF A;  2ILR A;  3B7S A;  4URK A;  4AIF A;  3RJV A;  3MV3 B;  4NRH B;  1E7U A;  1WM5 A;  2YNQ A;  4FP7 A;  2JLB A;  3PUJ A;  3U4T A;  2HYZ A;  4XI0 A;  3KS2 A;  2X6K A;  2XPY A;  5ANL A;  4PS7 A;  4B89 A;  4Y6W A;  2L0T B;  3UT4 A;  3UPV A;  1Y8M A;  2GW1 A;  2WXN A;  3UMV A;  4CGW A;  4BT8 A;  1U3D A;  2AW6 A;  2UY1 B;  3T5V A;  1INZ A;  2V4L A;  4KVM A;  1JUQ A;  5ARG A;  2LNI A;  2VGX A;  4RVB A;  4D10 C;  2LSV A;  2HR2 A;  3CVU A;  4LUN U;  3SZ7 A;  4I1O B;  2CHZ A;  4XX5 A;  2WXM A;  5ANR A;  2PQN A;  3PE4 A;  4I1A A;  2WXP A;  4I2Z A;  3LVQ E;  2FUL A;  3VLD A;  4CDM A;  2R59 A;  2AXZ A;  4GZ3 A;  2PM6 A;  4JW1 A;  4U0Z A;  3CGH A;  3IHY A;  1FVH A;  4GYW A;  3GZS A;  4HS2 A;  2XHE A;  2V0P A;  5HQ8 A;  4JZY A;  2IU1 A;  2WXQ A;  4LCT A;  4BFR A;  1A17 A;  1KT0 A;  4G25 A;  3C98 A;  3QC1 A;  4AJW A;  5G04 J;  5BW8 C;  3IV0 A;  5J08 A;  4I2W A;  5DBK A;  3T8M A;  3MYV A;  1IQU A;  3G2S A;  2AXV A;  2I9C A;  4N3B A;  2A4Z A;  3R7R A;  3CHQ A;  3QJZ A;  3SGH A;  2C2L A;  2UY1 A;  2YHC A;  3ONL A;  1E8Z A;  3FUE A;  3APD A;  4UI9 J;  5KJL A;  4JHR A;  1L5J A;  3JQ0 A;  2L0I A;  4ILG A;  2I2O A;  2MOW A;  4FAD A;  2Y4T A;  4WWP A;  4UQZ A;  4AV7 A;  3ML9 A;  3FU0 A;  4GCO A;  2VYI A;  4WWO A;  5FTP A;  3ZYL A;  4J6I A;  1ELR A;  4FC8 A;  4I9E A;  5C2Y A;  4H7X A;  4K0R A;  3JUI A;  4KBQ A;  4UWK A;  3TG4 A;  1EDU A;  4APF A;  2J4B A;  3ONK A;  4XI9 A;  2WB2 A;  3U66 A;  2YQ8 A;  4EZL A;  3AS5 A;  4FLB A;  4GZC A;  2CHX A;  4IUL A;  4UI9 C;  2QFC A;  4WND A;  3SD5 A;  3AS8 A;  5BT1 A;  4AY6 A;  4JXT A;  5A7D B;  2X38 A;  3CVY A;  3CQG B;  4HOQ A;  3HHM A;  3GZ2 A;  5DIZ A;  4U04 A;  4GA0 A;  3FEX A;  4GML A;  1S0P A;  5G05 C;  3AS4 A;  3PNT B;  4MKT A;  4G26 A;  3UUX A;  3PRZ A;  1OWM A;  4YVQ C;  1ZBP A;  4P29 A;  4L7T A;  3O4Z A;  1VDY A;  1TEZ A;  5KJK A;  4NAC A;  2E2E A;  1HU3 A;  1OWN A;  3D9N A;  3PS6 A;  4IRU A;  3ZYM A;  3B13 A;  4UI9 K;  2AXU A;  3OTN A;  1E7V A;  2KC7 A;  3TG5 A;  1ELW A;  1HO8 A;  5AYW D;  3FUL A;  4N39 A;  1P5Q A;  3TGO A;  3SBS A;  1LF8 A;  2RD0 A;  3L54 A;  1EPU A;  3T5X A;  2LSU A;  3S7D A;  3QAQ A;  3S7B A;  2GRM A;  1W3B A;  3CVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...