2L0KA

Nmr solution structure of a transcription factor spoiiid in complex with dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
93
structure length
93
Chain Sequence
MHDYIKERTIKIGKYIVETKKTVRVIAKEFGVSKSTVHKDLTERLPEINPDLANEVKEILDYHKSIRHLRGGEATKLKYKKDEILEGEPVQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage III sporulation protein D
publication title Novel Mode of DNA Binding by Bacterial Transcription Factor SpoIIID
rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 20
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2010-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12116 SpoIIID Stage III sporulation protein D
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2l0kA00
4S0HB 5EGOB 5FLMJ 3S2HJ 2E2JJ 2AHQA 3NARA 3RQIA 1JKPC 1HOMA 4QIWN 1A5JA 4A93J 2R7ZJ 1JUMA 2DMNA 3CMYA 3S16J 1VFCA 3TW6A 2OPTA 3HOVJ 1ORKA 1Z0XA 3A02A 1MBKA 3BR5A 1GT0C 2K9NA 3CCYA 5C4JJ 3BR1A 3BR3A 3HB9A 2XPVA 4QSHA 1SFOJ 4IHYA 3WHCA 1JKRC 3JRGA 5IP7J 4J19A 2L7ZA 2X48A 4G12A 4IHXA 2M2EA 1OCPA 2HI3A 5EEAA 4L5EA 4A3BJ 4V2GA 3C2BA 2QF7A 1EF4A 3FK6A 2K9QA 3G1OA 4A3KJ 1OCTC 2LK2A 3GTGJ 3GBGA 4XICA 2M9HA 3LOCA 3HOWJ 3WHBA 2VI6A 2CQXA 3GTPJ 2MGQA 5DS9A 2DA5A 4MIMA 1IV6A 1BW6A 3JRFA 4M3DA 1WH5A 2Y31A 4FE4A 2DTZA 1MBHA 4MLOA 1DU0A 5M3FJ 5FKKA 1RPWA 1RETA 1F43A 2P81A 3ZQFA 1P7IA 2Y30A 3QPSA 5IP9J 2CRGA 2JJ7A 2MW8A 3F0CA 1OFCX 1ETVA 3I4NJ 4I76A 2XB0X 1AHDP 5E3LA 5F1JA 1XC5A 3W6VA 2VUMJ 3A03A 3SJMA 1TC3C 1D5YA 3K2AA 3TP0A 1GDTA 1E3OC 1IJWC 4A3DJ 2XPWA 4IEJA 9ANTA 3BTIA 3FK7A 1T33A 4DW6A 4JX4A 4A3IJ 1SANA 3HOYJ 1ETKA 5FKOA 5EYRA 1ZQ3P 1HDPA 5J1UA 5GP9A 3LSJA 5F08A 1GUUA 2DA4A 1WCMJ 1APLC 2EZHA 5F0HA 1QRYA 5C3EJ 3TP3A 2JA8J 1H89C 3S1NJ 1FTTA 3BTLA 3CDLA 4A3CJ 1RKWA 2W48A 4JP0A 4MFDA 1MSEC 1I3QJ 1S7EA 1UHSA 2HXIA 1ZR2A 4X1EA 2L7MP 4UUTA 3RZDJ 4DYCA 2NVQJ 1JTYA 3HOXJ 3D1NI 3JR9A 1TWFJ 1ZR4A 5M5WJ 2ZB9A 3GTJJ 2DN0A 3LNQA 1U8BA 1FIAA 2FJ1A 3FIWA 4A69C 3A01A 3HEFA 1X58A 3A01B 3HGGA 4M3GA 1I50J 2O8KA 3I4MJ 5J1YA 1ENHA 1MH4A 5IYCJ 3JRAA 4XRMA 4BY1J 4A3EJ 1BL0A 2E2HJ 4IHWA 1Q1VA 1XG1A 4DZPA 3HOUJ 2H8RA 2NS7A 4D7MA 1RESA 2ID3A 4DZJA 5K7HA 5E3MA 4I6ZA 3HOZJ 2Y9ZA 1NK3P 2L0KA 3PO3J 1G2HA 4D5FA 3MVPA 3SFIA 2RAEA 1JJ8C 3K7AJ 3RZOJ 3UKGA 4M6VA 2GLOA 2DMQA 3S1MJ 5IPAA 2X6OA 2GM4A 1Y1VJ 3B6CA 5EF6A 3HBLA 3PO2J 5FKMA 1QVUA 2DA6A 1R9TJ 4BXXJ 1HDDC 1UG2A 1MH3A 1IC8A 5EDNA 1TWAJ 2FQ4A 1FEXA 3FISA 2NVTJ 1RKTA 3OIOA 4C2MJ 3S15J 5IYDJ 2XPUA 1A6IA 3H3VK 3QPLA 3HKZN 4Y52J 1K83J 3L1PA 2Y2ZA 5JLWA 4IHVA 1WH7A 5IOYA 5FKLA 4X6AJ 2ELKA 2Y9YA 1JTXA 4BKXA 2L9RA 5F04A 1H8AC 3GTQJ 2DA2A 2NS8A 4M3EA 4MO7A 1JJ6C 2LP0A 2DJNA 3G1MA 1ITYA 3OSGA 4D5CA 1ZK8A 3Q3SA 1IDZA 2ECCA 2WB1N 1MBEA 1PUFB 1RR7A 1YRNB 2DMUA 4AYBN 1H88C 2ME6A 1T56A 5HODA 2HOTA 2IEKA 5F0FA 5K7ZA 2XB5A 4W1UA 4BBSJ 4JX5A 2MG4A 2HDDA 1BW5A 1JUSA 3BTCA 3S1QJ 2AO9A 1MNMC 2EZLA 1K61A 3DCFA 3DEWA 3O8GA 2H1KA 1IDYA 2DA1A 2HYJA 4MFEA 2DA3A 4DYRA 1OJLA 3BG3A 3IH4A 4JX6A 2YUSA 3ZQLA 2ID6A 1I6HJ 5M3MJ 1MBFA 2YU9J 5EZHA 4XK4A 2CU7A 3HGYA 3HM5A 4BY7J 2LFBA 3ZQHA 1HLVA 1MBGA 2LLKA 3OSFA 4A3GJ 4A3MJ 2EBIA 5C44J 2LR8A 3SDGA 1Z77A 1ETQA 1NTCA 4A3JJ 1WGXA 5EG0B 4NDLA 1B8IA 2OF7A 1B8IB 2XRLA 5IP6A 1AU7A 1JT0A 2JN6A 3BR2A 2O9LA 4RDUA 4UUSA 4UUSB 3M4OJ 2D5VA 5JLXA 5IYBJ 4FCYA 2IAIA 2MSYA 2VPRA 2CUEA 1UMQA 4JYKA 2NVXJ 2DMPA 3GTMJ 2COBA 2JK3A 4FISA 1FIPA 2EZIA 2N8GA 5K7FA 4B4CA 2R5ZA 3Q0VA 2R5ZB 3Q0WA 2PMZN 2Y0SN 3TEDA 2M34A 3BG9A 2LVSA 2K40A 4B1RA 1GVDA 3ZQGA 2KT0A 5F27A 4C3JJ 1ETYA 2HOSA 2EZKA 2XGEA 2LD5A 2QCOA 5GPAA 1WPKA 3JRCA 3IV5A 1O4XA 1CQTA 2G0EA 2CUFA 2I10A 2M8GX 2WAQN 3JRHA 5E3NA 1ETXA 3TW7A 1BA5A 2LY9A 1ETWA 2TRTA 1LFBA 2GBYA 4HNVA 1QPIA 4A3LJ 1TWGJ 3ZOBA 4RBOA 2IBDA 3OOUA 2E2IJ 1HF0A 1LE8A 1LE8B 1ZKGA 2XGDA 2K9SA 5FKNA 1IG7A 5M5XJ 1U78A 3MKLA 1POGA 1ZGWA 3MN2A 1W0TA 4FE7A 5C4XJ 3BG5A 5F0CA 3JRDA 2XGCA 3O8HA 1GV2A 1IGNA 5EZGA 3BTJA 1ZTRA 2VKVA 4M3FA 3HDDA 3Q0UA 1NK2P 5GPCA 1HCRA 2LKXA 1ETOA 4QTRA 2X9DA 3H0GJ 3BQYA 5M5YJ 4V2FA 3E7LA 3JRBA 2L7FP 1U9NA 3S1RJ 4C3IJ 2O7OA 1PUFA 4W97A 1YRNA 3VPRA 3LSGA 1P7JA 4C3HJ 4M3BA 3GTKJ 1U9OA 1TWHJ 2JA7J 3S14J 2KDZA 4LOCA 3LSRA 3FKIJ 3IH2A 1X2NA 1JGGA 1WI3A 3PM1A 2NVYJ 2M0CA 2VKEA 2B63J 2XSDC 2DA7A 4B3AA 4FTHA 4XIDA 1MBJA 3G1LA 1JKOC 2R93J 1VI0A 3JREA 2LTPA 5J1RA 2TCTA 1B72A 1B72B 2WV1A 2E19A 4AUXA 4CYCA 4CYCB 3JRIA 2R0QC 1JKQC 2NOGA 5BNGA 3GTLJ 3QQAA 4BBRJ 3BR0A 3LSPA 5EG0A 1JT6A 4GFBA 1LFUP 1IUFA 1VNDA 5FLVA 2ECBA 2FD5A 1FJLA 2ME0A 3ZQCA 3NAUA 5IOZA 1QVTA 3BT9A 1W0UA 4DYQA 4AC0A 3B6AA 4EEFG 3S2DJ 2FX0A 1TWCJ 2CQQA 2HQ5A 4XRSA 3CQZJ 2JA6J 2JA5J 5DTDA 4D7NA 3IH3A 1FTZA 1VF9A 3ZQIA 2EQRA 1IRZA 5E3OA 1F36A 2DMTA 2EH3A 4Y7NJ 2JMWA 5J3LA 1GV5A 3BR6A 1JUPA 4ABZA 1BJZA 5EGOA 1AKHA 1AKHB 4A3FJ 2HXOA 1X2MA 2JWTA 3RKQA 1Y1WJ 2YS9A 1XS9A 2R92J 3M3YJ 3GTOJ 2HOAA 2E1OA 3S17J 4XRSG 2R5YA 2R5YB 1MSFC 2CJJA 5FJ8J 1DU6A 3BQZA
chains in the Genus database with same CATH superfamily
5FLMJ 3S2HJ 2DO7A 1MW7A 4BS9A 4YFNF 1G3YA 1ONVA 1J5YA 2LREA 2R7ZJ 4A93J 2ZMEB 2QQ9A 2XDVA 4ZDOA 3LAJA 1AWCA 3DPTA 4NNJA 4XKWA 1WQ2A 1Z05A 1TQPA 2NRAC 4NBQA 3OWTA 1Z21A 3G4SI 3LL7A 2K9NA 1Z7LA 2NYXA 3MWMA 3MKYB 2MD0A 3BR3A 2JSPA 3HB9A 5ICFA 2FUG2 3ECHA 3TL4X 1SFOJ 2V7FA 1UJ8A 3MKWB 4I09A 3RYPA 4DBQA 4D1QA 1JI8A 4J19A 3AG3H 4GRIA 2L7ZA 3ZN0A 4C9YA 1D3YA 2L4MA 4PGGA 4V2GA 4I0BA 1EF4A 2QBYA 2PJPA 1Y8QB 2QBYB 3V4GA 3TBIA 4A3KJ 2R3SA 4ZDPA 4BE1A 3WU2C 5B1AH 3LOCA 5HDGA 3CDHA 2P4WA 1SVMA 3ROUA 2CQXA 3K1PA 2CWEA 1VQMI 1BI1A 4A0ZA 1TQIA 2LH9A 3SZPA 1T39A 3GCMA 3JRFA 4M3DA 1WH5A 3SZGA 1ZLKA 2F4OB 1SVLA 2QSFX 3CP8A 2F2EA 4CCOA 4LD5A 1UELB 1RPWA 2VJ4A 3QAHA 3GEZA 5FKKA 3ZQFA 4CXFA 3FMSA 3QPSA 2X1EA 2MW8A 3F0CA 2KFDA 2L5QA 3K1MA 2COMA 3PIPF 3BY6A 3I4NJ 1BI2A 2DXIA 3J81Z 1G3TA 3I5UA 4PJNA 4U7DA 3BJ6A 5F1JA 2VUMJ 3SJMA 2W7NA 3I55I 3P9IA 4EJOA 3TOBA 5H6RA 1E3OC 1IJWC 4IEJA 3CMMA 3BTIA 1T08B 1QZZA 2M8EA 3A4CA 1T33A 3FXRA 2DFHA 1R00A 4JX4A 2M7BA 3HOYJ 3OY9A 2A61A 5J1UA 5GP9A 1UZCA 5F08A 1UG0A 2JVHA 2EFOA 4XORA 1QRYA 4KICA 5IT9K 4LFUA 1DPUA 2FOWA 4ZH4F 4IJAA 2XASA 5LRSA 1P2FA 5HDNA 3HG9A 5AIQA 1EKEA 3WGHA 2EB7A 3HHGA 1ZR2A 3BZ6A 2L7MP 2R7SA 1KU7A 2ZNZA 1WVRA 3JTHA 3RZDJ 4DYCA 1G6NA 4HSRA 4XM3A 3HOXJ 2R7XA 1YFHA 4QLCU 4GO1A 2ZB9A 4ENJA 4UVCA 3H1CA 1WHUA 1USSA 1K4TA 2FJ1A 3BPVA 1H0MA 4EJUA 1D0YA 2HOEA 3M1EA 3ERED 2ELJA 5IYCJ 2E1MC 4XRMA 4BY1J 2L9NA 2E2HJ 2LKSA 3ZPLA 2E1MB 2MC4A 3WG7H 4KA4A 3ZMZA 3CCQI 2LRDA 2WC2A 4IHSA 3EQLF 2E34A 1XPXA 4HRIA 5E8GA 4C2TA 2ID3A 4DZJA 3DKWA 3DTEA 5L3DA 3V8LA 1I3AA 2JPBA 2CQ7A 3LSTA 1PP8F 1MNDA 1V5EA 2OQGA 1RNLA 5TGTA 3OYIA 1MD0A 4Q48A 2ZJRF 1HSTA 3F8BA 3MAJA 3DQVC 3KP6A 2GLOA 1MMNA 3S1MJ 2A5YB 3QYBA 3FMQA 1J2XA 2JA2A 3GW2A 3OIQA 3PO2J 1YS6A 5FLXK 1DDNA 1QVUA 1JGSA 2ZSHB 3I9V2 2KIMA 1HC8A 2BOLA 2L3DA 3ZXSA 1BR4A 5TRDA 2CO5A 5L3CA 1FEXA 2Q0OA 1RKTA 3S15J 2Q2EB 3KYDB 3A2KA 2XPUA 4E7HA 3HKZN 1K83J 4LJZF 2Y2ZA 4IHVA 2E5NA 1Z6TA 2Y9YA 1OCZH 1K6OA 2K4BA 3GFJA 4BKXA 5F04A 2JRMA 3EYYA 1FX7A 3ZR8X 5J8FA 2IA0A 2EV6A 1E3PA 1WZ2A 2YR2A 1W4MA 2Z2SB 3OYFA 4RGUA 4IQ4A 2DYRH 2LBFB 1RC9A 3L2VA 4B8XA 1S7AA 2DMUA 4AYBN 3OYNA 1H88C 2IEKA 2OQRA 5F0FA 3L2CA 4XLHA 1SAXA 1ZG1A 1WJDA 2OTJI 1TNTA 4IO9F 3BP8A 3KX2A 2EZLA 3PNVA 3WTSC 1K61A 2H1KA 4YFKF 5DM7F 3NQOA 2BY2A 3KCCA 3R0AA 3IH4A 4HDVA 2EV5A 3JCUC 5LD2C 5KAIC 5M3MJ 2PG4A 4HV6A 2IP2A 5L3EA 2ZJ2A 3SEZA 3SXYA 3LA7A 4E7LA 4FX4A 4XK4A 1YJ9I 2CU7A 1A36A 3OYLA 2KIUA 5E18F 1MBGA 2FSWA 4A3GJ 4L9VA 2IJLA 1MDMA 1VTNC 1MDMB 4IRIA 1GVJA 3OL3A 4IZZA 2VC1A 5C44J 4D9JA 1Z77A 3AG1H 2WAEA 3VFZA 3PQKA 4NDLA 3DF8A 1YJNI 1B8IA 1B8IB 1F4KA 3HYIA 4ITVA 3ZMTA 2JVGA 4G6TB 3WTXC 1JT0A 4PJMA 1LVAA 2O9LA 2D5VA 2IAIA 2MSYA 3FBIB 2M5WA 1SD6A 4DJAA 5ICGA 1UMQA 2JTVA 2J5OA 3K2ZA 2HVRA 4I2OA 3GTMJ 1BI3A 1XMXA 1W1WE 5E79C 1RZ4A 2EZIA 4PJLA 2V1UA 5K7FA 3OS0A 2B9SA 3M8FA 1IN8A 2PMZN 3F72A 3TEDA 2Q1ZB 3BG9A 4R1HA 2MC3A 2LVSA 2FBKA 4CZZA 3RI4A 1GVDA 4AU7A 3O6BB 4ZZDA 1LVKA 1LNWA 1ODDA 5BMZA 2EZKA 2XGEA 1FC3A 2CQKA 2GA1A 3E3VA 2LD5A 4MEXF 5GPAA 3ZN1A 3F9KA 1CQTA 4ON0A 2M3AA 2F6CA 1J59A 4OIOF 3V8JA 1ETXA 2RN7A 1S5LC 1QPMA 5DCMA 3S3MA 1GLNA 4HQEA 3H92A 3E1SA 1P9QC 4LIUA 1OCOH 1U3EM 3K4MA 3IRRA 5FO5A 3OOUA 4PFOA 5IT9Z 4LITA 2FA5A 1HF0A 3D5SC 2BXYA 2P5VA 3G3ZA 4J01A 2XGDA 4U0YA 2K9SA 4Y13A 1S9HA 2KMUA 3ZQQA 2QQ8A 4DIQA 1U78A 3MMYB 2PQ8A 3MN2A 3T8RA 3BG5A 1ZGJA 2PLYA 1HKTA 3H3ZA 2LNBA 3F8CA 3Q0UA 3HDDA 2L7KA 4ZJZA 3BPXA 4XSXF 3KETA 1SMTA 4XL9A 3E7LA 3OYJA 5FD5A 1YRNA 2ZC2A 5CQEA 2CYYA 2MYSA 1BI0A 5D5XB 2HKXA 2Z33A 1VQPI 1VQNI 2ACJA 2KDZA 1YIJI 4LOCA 3O3KA 3GUDA 4BH9A 3VYUB 3IH2A 3LSKA 4RB1A 4ZTJA 4GXOA 1LFPA 3IL2A 4LLGF 3CCSI 2V6CA 3QPHA 3WU0A 1B4AA 1ZAOA 2W57A 2M0CA 1KU3A 4EMSA 2XSDC 2B63J 2RKHA 4B3AA 4FTHA 4XIDA 4UV8A 4XONA 2DOEA 1MBJA 2RQQA 4L5IA 1JKOC 2R93J 1VI0A 3VSKA 2LKPA 2K7LA 4LB6B 3JREA 1K79A 3AG4H 3Q9SA 5F64A 2CSOA 4FETA 3W6JB 2WV1A 2OU2A 1OISA 4B3XA 3ECOA 3ZMUA 5FROA 5DUIA 3TO9A 1V3FA 4BQNA 3A1YA 3HTUA 3R6SA 4A5NA 3RCOA 5J8CA 1JKQC 2R7OA 4AVPA 1G4DA 3F3XA 5JHFA 1BR2A 4Y3OA 5FLXZ 4BDYA 2MH2A 1R36A 3CO6C 1JT6A 5FLVA 3TQNA 1O7LA 1J7KA 1IRXA 1TBXA 2ZO4A 4ZTFA 3F6OA 3QPTA 1FJLA 1BR1A 1ERDA 1WJEA 3GO5A 1FMVA 3H5RA 3NAUA 1QVTA 3BT9A 1HBXG 2FQ3A 1YW9A 4M74A 4DYQA 3LA3A 3B6AA 3S2DJ 4L9TA 1MZBA 4XOPA 1Z9CA 3HSEA 3IWFA 2JA5J 2JA6J 5DTDA 2ISZA 1U6GA 3IH3A 3BCBA 2A3SA 3X2QH 3RQ4A 4RB0A 1IRZA 1WKMA 2VQGA 3LQQA 4Y7NJ 2A07F 1GV5A 4A6EA 3V8KA 1F9NA 4HDUA 4ABZA 1BJZA 3CC4I 3BZCA 3DEUA 3LWFA 4PJ0C 3CESA 4KUMA 1AKHA 4E7JA 1AKHB 3OS2A 3KYCB 4CUGA 2DTRA 1E17A 2YS9A 1YX3A 1NG6A 2E1OA 1WSUA 2E5ZA 2IW5A 3B73A 4YEJA 2HPMA 1MSFC 4N4NB 2CJJA 1JKPC 2V79A 1DGRM 1DU6A 3IUOA 1IN4A 3IKTA 3P7NA 3RQIA 1FYLA 2WAFA 5DDGA 4KNYA 1A5JA 2O0YA 2FEZA 3CMYA 2DMNA 2PMHA 1VFCA 5K5QA 3HOVJ 3CCMI 3A02A 1GT0C 3C2GA 3K70C 1QU3A 4M71A 3DFGA 2VT3A 5CJ9A 4QWQA 2ZJQF 5D4SA 1G59A 1B1BA 4M73A 3M8JA 4A6DA 2KISA 2KLOA 4M6YA 2K02A 1JKRC 5IP7J 4E7KA 1WJCA 2DW4A 4CCJA 2X48A 2K4JA 1D1AA 2VODA 5DV5A 5EEAA 2W82A 4L5EA 2KZVA 4BXUA 1T0FC 2K9QA 3WGIA 2Z9OA 3G1OA 5KVRA 3W3CA 2M9HA 4AM3A 2ZBKA 1FZPB 1VQ4I 2CQNA 3EUHA 3GTPJ 1E3HA 5FFZA 1U2WA 1Z7UA 1E2XA 1WJBA 4XKVA 4U88A 2DPDA 2DTZA 3HL2A 1DU0A 1UFMA 1V5GA 4CH7A 4BEHA 4BEHB 1P7IA 3J7YJ 3RDIA 3KYLA 4XLEA 2HR3A 3TKYA 4KITB 1XX5A 3TOAA 3TDUC 1OFCX 1O7FA 3C7JA 3DKXA 3E6DA 1YS7A 2DI3A 4A2UA 3AL0C 4I76A 4EV0A 2XB0X 4KMUX 4LK1F 1AHDP 3AL0B 3P9CA 2B7EA 1FYMA 3W6VA 2KIQA 3RTRA 4HNTA 3A03A 4L9JA 1V54H 1YLFA 2NNYA 4RAYA 4WF2A 1TC3C 4XSZF 1KU2A 3H36A 3TP0A 1GDTA 2QSHX 3F23A 4A3DJ 2X6XA 2NXNB 2D1HA 2TDXA 3LA2A 1SANA 4WX9A 5EYRA 2GA2A 2AQFA 3MZ8A 4PCQA 3LFKA 2RVCA 3BOQA 2IPQX 5F0HA 5HNHA 3TP3A 2KP6A 5E17F 1T98A 3AKZA 3CDLA 4A3CJ 1ZRDA 1RKWA 2M0MA 4JP0A 3WTTC 1MSEC 5BOXA 4E7ZA 1LDKB 5HNFA 1R22A 2HEOA 2XAFA 5J6XA 1MMSA 3DBHB 4RLQA 4YRVA 3M07A 2E36A 3GFIA 1P92A 2DLLA 4UUTA 2BGCA 3H9GA 1TWFJ 1ZR4A 5M5WJ 2V1DA 4MHGA 1A31A 4BDZA 2DN0A 3K4BA 3LNQA 2OV7A 3IC7A 3QU3A 3FIWA 1IUYA 2L9VA 1FBUA 4C30A 3CP2A 3A01A 3A01B 2VBZA 3I4MJ 3E0JB 4M9XA 1MH4A 3L00A 5TISC 2QWWA 2BVMA 3W2AA 3VDXA 4IHWA 1PJRA 3K10A 2NS7A 2XKPA 2ZMEC 1TQMA 2R7FA 2XAUA 2ZMEA 2Z1DA 2IA1A 4BHPA 5K7HA 5CLSA 4I6ZA 3K70D 3HOZJ 2Y9ZA 4EM2A 2AXLA 2L0KA 1G2HA 4D5FA 3MVPA 3OR1C 1MMGA 1S72I 2YSRA 1XD7A 3ONQA 4XLFA 5JI6A 4EGZA 2JUGA 2L01A 2WBMA 1IXRC 4BJ5C 3HXLA 1TL8A 3OMYA 4X0GA 3FM3A 5CYVA 5LBQA 1OYWA 2X6OA 3BJAA 4BQAA 2KRFA 4RM2A 1VQ7I 4NHJA 4G7OF 1Y1VJ 5EF6A 5DD8A 4QPOA 4FQGA 2DT6A 3ZCOA 3WTWC 5FKMA 2A6HF 4BE2A 4EATA 2BHZA 1X4OA 2DPUA 3KP3A 3W6KB 1R7JA 2V6EA 2IGNA 1ZH5A 1SVOA 3FISA 4ZDLA 3HOSA 3OIOA 3REOA 2D2WA 1A6IA 3CCJI 1OLTA 3W2WA 4Y52J 1X1DA 1XGOA 1OR7C 3KIOA 4IF4A 5JLWA 1OR7A 3VSLA 4A0YA 3C18A 5JVTA 3U9GA 3JSPA 4ENMA 3H9QA 1R4NB 1FBQA 2VE8A 1EA3A 1H8AC 3OYHA 3DEEA 2NS8A 4M3EA 4MO7A 4O5VA 2EFWA 1ZYRF 4DOZA 4V19K 1ITYA 3OSGA 4D5CA 2HQNA 4RA2A 1FPQA 3S93A 5CVRA 4S05A 3J80K 1OPCA 1TNSA 2ECCA 2WB1N 1HSJA 1MBEA 4XMYA 2MD5A 1DUXC 4E7IA 3KFWX 1XMAA 4YIRX 3WTUC 2XB5A 2QYOA 3KE2A 3ZP5A 2ZXWH 4JX5A 1QQIA 1BW5A 2AO9A 3S8PA 3CCVI 1MNMC 4ESFA 1TW2A 2P8TA 3DCFA 1P6RA 3BG6A 2WADA 4IHTA 2HGCA 4GDFA 3BG3A 1I1SA 1PUEE 1QA6A 4F7ZA 3MKZA 3CCLI 3ZQLA 2ID6A 1YW8A 1Q1HA 2E7WA 3ZMDA 4IKFA 2OUMA 3HJEA 2CV1A 1X3UA 3NEUA 3F6VA 2OZUA 3T5XA 5HLHA 5EZHA 1W5SA 4N4OB 4WXHA 1X1PA 2PFBA 1D0ZA 2M87A 1IXCA 2CUZA 2KDOA 3HGYA 4ZYAA 1HLVA 2LFBA 2IRFG 2LLKA 4G6QA 2GWRA 1YE9A 4MNUA 3MCZA 3CUOA 1Z67A 4KT6A 1LB2A 4ESJA 3FXJA 4GYIA 3SDGA 1ETQA 1D8KA 3C1DA 1FSEA 1WGXA 1N25A 5EG0B 4B47A 3QP6A 5D4RA 2X0LA 1V5FA 1KU9A 4YIFA 5CPRB 3SQNA 1S3JA 2JN6A 3VYRB 4XLPF 5BPDA 4ZYEA 3N97A 3PNYA 4UB8C 3M4OJ 1A6QA 4HLYA 2JQ7A 2R4GA 5L3BA 1FP1D 2HYFA 3G71I 2R7UA 1PVEA 3PNTA 3DU5A 4BJTA 4BQQA 5D5VB 3AAFA 2A69F 4MTEA 1TLHB 1M1EB 2CMPA 2K3FA 4B4CA 1ZHFA 2HPIA 3QOEA 4CICA 2BVLA 3ISPA 4I02A 1EH8A 2GXBA 1MNEA 4XOTA 4B1RA 2VKDA 1Y39A 5BQTA 3KP2A 5F27A 1YG2A 4C3JJ 3VYSB 4RAZA 2M1BA 2QCOA 1WPKA 4I01A 1T38A 3CF2A 3JRCA 2H09A 2WAQN 2M8GX 1BIAA 2XRNA 1R58A 2V9KA 4G8XA 4P1WA 1ETWA 4XLCA 5H6QA 2BXZA 2P0WA 2GBYA 4O3MA 1YQAA 2B0LA 4EJVA 1XTAA 1TWGJ 1X4PA 3F8FA 4N9HA 2L2OA 5E1XA 4RBOA 3A0BC 4QPQA 2Q2EA 3I53A 2V26A 1LE8A 3M1CA 1LE8B 4E70A 3E6CC 1R1TA 4OOIA 1F5TA 4IQJA 2OAZA 4OMZA 5M5XJ 3H3UA 2HTJA 2K86A 2EA2A 2ICWG 2LSOA 1W0TA 4KDPA 3JRDA 2F4IA 4U0VA 3O8HA 1IGNA 4Q47A 4U0WA 2KHMA 4M3FA 1QZYA 1REPC 2UXXA 1SEUA 1NK2P 3HUGA 4LIVA 3HUGB 1HCRA 1W36D 5L3GA 4LMYA 3OS1A 2X9DA 3H0GJ 2MLGA 2LBFA 5M5YJ 4IXAA 3EPZA 4A5MA 2H1LA 5ERIA 2HQRA 5HS9A 1YJWI 1KZHA 2IGOA 3RPQA 4AIKA 3RYRA 4MQ9F 2WY8Q 2CFXA 3R60A 3LSGA 3VPRA 1RRJA 1P4WA 2PJRA 3TO6A 2PJRB 2FBIA 5ILVA 2YU3A 4L0ZB 1W5CC 3IRQA 3S14J 4IOAF 2BZTA 2LMDA 2EILH 5DCFA 2E1CA 3GVAA 4I7HA 2X1DA 1YTYA 5ILUA 3FKJA 1KQ9A 1GXPA 5LRRA 3RIRA 3IP4B 1XSVA 2FXAA 4XR6A 2H6BA 3OYDA 3KZIC 1OCRH 3WG9A 4UVBA 1T2KA 3EDPA 3OYCA 4LG3A 3QOPA 1HQCA 3MQ0A 4PK4A 1FLIA 2LTPA 2Z3YA 2TCTA 5J1RA 5HOOA 2E19A 4G6DA 4AUXA 2W24A 4CYCA 4CYCB 4GYGA 2NOGA 5BNGA 3PQJA 3CLOA 2ZSIB 2PX9A 4BBRJ 3BR0A 3LSPA 1B6AA 3HRMA 3ELKA 1R71A 1WRJA 1VNDA 2ECBA 2FD5A 3H0DA 1TT5B 2FRHA 5IOZA 1OYIA 2DDBA 2K9MA 4N9IA 4E7SA 1BOBA 4EJTA 4JBAA 2FX0A 4XRSA 3CQZJ 5E1WA 1R5ID 4BHBA 5D8KB 4XBFA 2P5KA 1FTZA 3GLLA 3QODA 5E3OA 3D5RC 1HKQA 3E6MA 3I4PA 4P96A 2IS4A 1QZEA 4FASD 2JMWA 3K6GA 2OD5A 5J3LA 1N75A 2HKOA 5D6EA 2FNAA 2L02A 3K4JA 1FOXA 3OYGA 2L4AA 3BJOA 1UHWA 3FBNB 3RKQA 2R92J 2EPFA 3G2BA 2NOJB 2IT0A 1XGSA 2VKHA 3J80Z 2IGMA 2R5YA 4ASNA 2R5YB 5CVUA 4EM1A 2VXDA 2YX4A 2WTEA 4HLXA 2NNNA 3FMRA 2VB6A 2QA4I 4AIDA 2AHQA 5DM6F 3E6BA 4AIHA 4XLNF 5D5WB 1JUMA 2QENA 1ULYA 2XUBA 4Q4ZF 3TW6A 3ABKH 3RPUD 1R1UA 1Z0XA 3BR5A 2Y69H 5JVGF 5C4JJ 5GTIC 2LOOA 2MFZA 4ZYGA 1BIBA 3GXOA 4XKBA 3WODF 4RB3C 4IHYA 2LY1A 4BACA 3WHCA 4AVZA 2O8XA 2XC7A 1VQLI 1X1CA 2HU9A 1X1BA 4G12A 2HI3A 3C2BA 5AIPA 5HS8A 4L5JA 1YO5C 4BYYA 4HSTA 4LK0F 1OCTC 2LK2A 1QHHD 2L9SA 4XICA 2W1OA 3FM5A 3CUQC 2VI6A 4E6KG 4C2UA 1XGNA 3U1DA 3CUQB 3DLLF 3QP5A 2FOKA 5DS9A 2DODA 4HG2A 5LEKA 3QU6A 4RB2C 4IPAA 4FE4A 1I6XA 3U21A 1RR8C 3V7CA 2V4JC 1MBHA 1H9GA 2MABA 2DCEA 3GF2A 5KAFC 2G7UA 1R4MB 1RETA 2P81A 3HPGA 4BU2A 3GFMA 4Z6YA 2Y30A 4F52A 2XIGA 4PSXA 2VQLA 1IO2A 1BN5A 2CRGA 2JJ7A 3NRVA 4RGXA 4E4HA 5LFAA 1IXSB 2VIXA 2G9WA 5D6FA 3LSIA 3PSIA 5HLIA 4OIPF 3P9KA 2O6GE 4IRHA 3DXJF 3CC2I 1ZRCA 4A0XA 1WWXA 2IGKA 3MFKA 4F92B 4Z2YA 4PJJA 1ZREA 2DBBA 1D5YA 3K2AA 1WI9A 2KJCA 3T8TA 1RUOA 9ANTA 4EQQA 3FK7A 1ACIA 4A3IJ 1OCCH 3H5AA 1ZQ3P 4ZYHA 2HZTA 3LSJA 4XN3A 1GUUA 1X19A 1V4RA 2DA4A 2EZHA 5CVVA 2D45A 1APLC 4KN4X 4XRFA 2JA8J 3OYMA 1H89C 1FTTA 3EETA 3BTLA 2W48A 4MFDA 4OWRB 1FY7A 1I3QJ 2NAZA 1O3SA 1S7EA 3HSFA 1UHSA 1W5TA 5TJJA 3G73A 2WV0A 4CZCA 2XF7A 1S7OA 2VE9A 4P9FA 4BJ6C 1B9NA 3FXMA 4MQVA 3GX4X 2Y48A 3GTJJ 3CC7I 2QSGX 4CHUA 2MBFA 3FDYA 1FIAA 3C3WA 3KEOA 5K5RA 4HX7A 2GAUA 4YELA 4RGRA 4I99C 3FXKA 3HEFA 1X58A 3AG2H 3HGGA 4M3GA 1I50J 1R6RA 2O8KA 3ZMVA 4IOCF 5J1YA 1ENHA 2P7CB 2FMLA 1BL0A 2ADUA 2IXSA 4U87A 4O6JA 3UNGC 2ZCWA 1FOWA 3EUAA 4D7MA 3WTYC 1T6SA 2H8RA 1RESA 3F8NA 4R79A 1PDNC 2P6TA 1NK3P 3ERMA 3PO3J 2LF8A 1JJ8C 2QEXI 4II2A 1J75A 3DKYA 3K7AJ 3I59A 3I59B 2R7RA 2W84A 1H9TA 4XKCA 4M6VA 2DMQA 4MTDA 4F55A 1AA7A 5E20A 1K7AA 5IPAA 2DQRA 2XAGA 2GM4A 4D0PA 3HBLA 3K4NA 1BJAA 1D1BA 2ZXHA 5EEGA 1ZARA 4RAFA 3WTZA 1R9TJ 4BXXJ 2YX7A 1WJ5A 4UV9A 1T0FA 1QGPA 1IC8A 1TWAJ 1YI2I 5EJCA 2FQ4A 3GLXA 1QBJA 5GAHJ 2NVTJ 4C2MJ 3GZ6A 4Y33A 1Y8RB 3QPLA 3I0TA 3VODA 4F91B 3OYEA 3ZMSA 2NS0A 3L1PA 1YHQI 3SHFA 1WH7A 4KIFA 5FKLA 2ELKA 3PL8A 4OU0A 4YFXF 1JTXA 2ELHA 1SFEA 5ICCA 1LDDA 2A68F 4PZJA 1WFXA 3KZYA 2DJNA 2FF4A 5L3FA 1UB9A 4HV5A 3PSFA 2EIMH 2HQAA 1WJAA 1U8RA 1ZK8A 2BBYA 1BBYA 2KRHA 4CYDA 5K5OA 1A04A 2M4KA 2BW3A 3BZKA 1UAAA 2BW3B 4WXDA 1PUFB 3L2RA 1T56A 2VQHA 3BG7A 5K7ZA 3LSMA 4BBSJ 1MGTA 2O3FA 2MG4A 1JUSA 1U5TC 3BTCA 3K0LA 2CUJA 4XN0A 1U5TA 2ZNYA 1U5TB 2BEOA 5EEHA 2V1NA 3O8GA 1IDYA 2HYJA 3SDBA 2DA3A 4EJWA 3ABMH 5IT3A 1SMYF 2YUSA 5FRNA 2K9LA 3FF5A 1K6YA 1I6HJ 1NG7A 1MBFA 4KN7X 3L09A 5KNLA 2LC2A 3KPHA 2STWA 2QUFA 2FU4A 2BY1A 1EH7A 3LSHA 3MD2A 1OKRA 5FD6A 3SEQA 3CO7C 3RKXA 5AONA 3HM5A 2OCEA 2XF5A 4BY7J 3ZQHA 1HKSA 2VOOA 1KGSA 3BWGA 5FGMA 2EBIA 4FX0A 4M6XA 3KEYA 3L2QA 2H8WA 2E1NA 4ESBA 5JHUA 4HNUA 3CJNA 5CKTA 2R7TA 4A3JJ 3CJTB 2X1CA 2LG4A 1G8XA 2XRLA 4J00A 3BR2A 3P5JA 5B3SH 4HPQA 4F3QA 5HDKA 2F5EA 3E5QA 1BC8C 5JLXA 4FCYA 2OCCH 1LPQA 5D8LB 2VPRA 5B1BH 2E60A 3U2RA 3VWBA 2CUEA 3SFZA 4RM3A 5F1RA 4JYKA 3GWZA 2NVXJ 1VQOI 4UB6C 5E8IA 3E97A 3O2PE 2DMPA 4A12A 1USTA 1ZG3A 1W7PB 4FISA 1BM9A 2QM3A 3CCRI 5ICEA 2XAQA 2N8GA 4FHTA 2IS6A 1I1GA 3ABTA 2R5ZA 1IF1A 2R5ZB 3Q0WA 1Z3XA 2M34A 4RGSA 3VOEA 1LUJB 4HBLA 1DGWY 3ASNH 2V9PA 2OBPA 3Q5FA 2CW0F 2UUZA 3K69A 3ZQGA 2KQRA 3CTAA 1SFXA 1O57A 3ABLH 1FT9A 2JSCA 3D0SA 2EIJH 2XV4S 3F22A 3GMEA 4I0AA 3IV5A 1NHAA 2CUFA 2G0EA 3R0JA 2BHYA 3TO7A 5E3NA 4G7HF 3F8MA 3TW7A 2LY9A 1TW3A 1J09A 5J40A 2E71A 4M9SA 3CZ6A 1VQ6I 3UR3C 2AQEA 3D5LA 1L3LA 3FXUA 1LEBA 1QPIA 4A3LJ 1HW5A 5CVJA 4UVAA 2JUCA 2ZXJA 2ESHA 4ZZLA 2DOAA 3EUKL 2CG4A 4AD9A 3E5XA 5FKNA 4WCGA 2XKOA 5LGUA 3OYBA 2ZKZA 1POGA 2LY2A 2XHKA 4FE7A 2XGCA 3DP7A 1GV2A 3ML6A 3BTJA 4LB5A 1KYZA 1HXDA 2ZJPF 2A6EF 1A35A 4KJZA 1LDJA 4L9NA 1E0EA 2LKXA 2GQQA 1JHHA 1HW1A 2DOFA 2XVCA 2UZKA 1IZ1A 4KMFA 1FMWA 1XSDA 2BYVE 1W36C 2EFPA 1U9NA 5D5UB 1YOVB 3VYTB 4C3IJ 3S1RJ 4W97A 4YIIA 2PMZA 3SYTA 1FSHA 3DTKA 3LAPA 4M3BA 4K2EA 2JA7J 2QKMB 2EK5A 3K9TA 3LSRA 3FKIJ 2EFNA 2VOPA 2OC6A 5KK1A 3GYHX 1WI3A 2FMYA 2HVQA 3M7GA 3PM1A 2NVYJ 2VLAA 4II3A 1EJ9A 1D5VA 4FT8A 3FXOA 2A05A 4BNCA 2VKEA 1ZGAA 3BCAA 3FXLA 4GGGA 4IL6C 4CCNA 4ANJA 3B02A 3G6EI 1TZLA 3DWLE 3I64A 4CDGA 2IS1A 2QGUA 1B72A 3H9JA 1VQ9I 1B72B 3J7AO 3CCEI 3K4KA 5BPIA 1O3RA 1T95A 3HC7A 2DT7B 4OMYA 1Y0NA 3KP7A 1SFKA 5GTHC 4PSWA 3FXQA 3JAMK 3HRSA 1Z91A 5EG0A 1EV7A 3N4MA 1LFUP 1IUFA 4DNCA 3KP5A 5J47A 2NVUB 4IRGA 2ME0A 3OL4A 3DPUA 2ISYA 1LKXA 3ZQCA 2DQLA 1ZRFA 2VXZA 4ENNA 4PUSA 1W7PD 4OIRF 4AC0A 3HRUA 2CQQA 4KFCA 4D7NA 1FBSA 1SAUA 2EINH 3ZQIA 2W4SA 1FOKA 2EQRA 4KYWA 2MLKA 4CCKA 2DMTA 3BR6A 2QQAA 1JUPA 4UY8I 3JTGA 5F6FA 4N0BA 5BS6A 4A3FJ 2WY7Q 1X2MA 2JWTA 5ILSA 4WXCA 1XS9A 3M3YJ 4F93B 1QHGA 4EM0B 4MEYF 3IHUA 3S17J 2XSJC 4XRSG 2A6TA 4YG2F 4G9YA 4BAYA 3WE3A 3FHNA 4BUPA 4CCMA 5FJ8J 3PFIA 5EGOA 4JK1X 4S0HB 5EGOB 4EGYA 1F1ZA 2E2JJ 4OAYA 3NARA 2FBHA 1HOMA 1KQ0A 4QIWN 1EH6A 3J7ZI 2VL8A 4ZYDA 3MZYA 4NC6A 3MZHA 3S16J 1G3WA 2F5DA 3BC8A 2OPTA 1ORKA 4HW0A 4M72A 1MBKA 3K4CA 1FYKA 4RMNA 2X6YA 2FNPA 1S29A 3CCYA 5CQGA 3ABUA 3BR1A 1YIOA 2HZDA 2XPVA 3RPUA 2Z5UA 4QSHA 1LEAA 3WE2A 1ZELA 1TTYA 4NQWA 2VJJA 4NQWB 3JRGA 4EVIA 2EFQA 4IHXA 2M2EA 1OCPA 4A3BJ 1D0XA 3CJRB 1VZ0A 2QF7A 3FK6A 4RLFA 4XLAA 3GTGJ 3IAM2 1XMKA 3GBGA 3T0YA 1MIJA 2KIFA 3HOWJ 2BY3A 3QYFA 4RAGA 3WHBA 1ON1A 1FNNA 1KONA 5KHDA 1LQ1A 1R23A 2BV6A 3I71A 2MGQA 4Y15A 4AWXB 4NUBA 1MKMA 1MJBA 2DA5A 4MIMA 1IV6A 1BW6A 2Y0SA 4LLLA 2Y31A 2QZ8A 4MLOA 3S3NA 5M3FJ 4P55A 3CLQA 1CGPA 3DBRB 4HAMA 3SZTA 3PUFA 1F43A 3BLYA 5IP9J 4OAZA 2W25A 2BE5F 2C6YA 1T8IA 1ZG5A 1KA8A 2RDPA 5J4YA 2YPRA 3OOPA 1ETVA 2DFIA 2F4MB 1MMAA 1R5GA 4HA8A 3CF5F 1I39A 4B44A 2KZGA 5E3LA 1SD5A 5FFXA 1PYVA 1XC5A 1OQYA 1XSXA 3HIFA 2H27A 1IV8A 2L54A 2XPWA 2PMUA 1K4SA 4DW6A 3AFHA 2EWNA 2A5WA 2X85A 3M8EA 3I56I 3IWZA 2F5CA 3JW4A 1ETKA 5FKOA 2CGPA 2RGVA 3OYAA 1HDPA 1G3SA 2X6WA 1S8NA 1I5ZA 1WCMJ 2R7QA 2UWMA 5C3EJ 3S1NJ 2G7HA 3VEPA 5A2QK 3L2UA 2DDAA 2X51A 2HXIA 1R1VA 1DQUA 2CW8A 3COAC 3ZRGA 4CCLA 4X1EA 3PIOF 2VBWA 3DV8A 1MJAA 2PI0A 4HOBA 2R7VA 5KCMA 2F48A 4L18B 2NVQJ 1JTYA 5LHGA 3D1NI 3JR9A 4B43A 1XN7A 1XGMA 3ASOH 3HOTA 2OA4A 3I54A 4NC8A 3OIPA 5CVIA 4U7BA 2Z99A 1HW2A 3H5NA 5IY5H 1U8BA 3MEXA 1D1CA 1BOAA 4ZC3A 3S3OA 2VPLA 1LJ9A 4A69C 5JR3A 2M45A 2VASA 3JRAA 1RI7A 4A3EJ 4H4KC 3ZQ7A 1FOYA 1Q1VA 1QNTA 1XG1A 4DZPA 5E1ZB 3WU1B 3HOUJ 4BE0A 2GIZA 2UV1A 5E3MA 2AS5F 1R5HA 2GXAA 2M7AA 4HQMA 2I5UA 3SFIA 2RAEA 1STZA 2VT2A 2GZWA 2HVSA 2GOXB 3RZOJ 4HF0A 5B5EC 1XDUA 3UKGA 3PJRA 4UHTA 2RV8A 3H35A 5HVQC 2R7WA 4ETSA 1OYYA 3B6CA 4IVNA 5DCMB 1P4XA 2EJRA 3DU6A 2CFOA 2DA6A 1HDDC 1DP7P 1SFUA 1UG2A 1MH3A 1WJFA 3N05A 3WGGA 5EDNA 1IAWA 3LQRA 2VJIA 3HPHA 3JAMZ 1YYVA 2RNJA 4L0YB 1YW7A 1X1AA 4UNOA 5IYDJ 5LGNA 3H3VK 1VQKI 3CUQA 5HLGA 2VJ5A 2DT5A 5LLQA 2IA2A 2J5PA 5IOYA 4X6AJ 2IS2A 3L2WA 2M30A 3DBLB 2DYSH 2PBIA 2ESNA 3U1KA 2K3PA 2L9RA 2OTLI 5FRMA 5H20A 3W2VA 3V42A 3GTQJ 2DA2A 2E7XA 2IVMA 4OINF 2UXNA 1JJ6C 2LP0A 3JSOA 2XROA 4Y17A 3G1MA 1GXQA 4CGZA 3QRFF 3GFLA 2P6SA 5DEQA 3HRTA 3RKWA 3Q3SA 3TMOA 1IDZA 2KPMA 4DGWB 2Y75A 1BC7C 1IN5A 1RR7A 4BXFA 1YRNB 4BL0B 2ME6A 1UCRA 4G7ZF 2HOTA 5HODA 1S6LA 4UXNA 5LHHA 2M4GA 5DYMA 4B09A 4Q5SF 4W1UA 3TGNA 2JPCA 2DAOA 4HX4A 1AOYA 2HDDA 3S1QJ 3CCUI 2H94A 2P7VB 1O3TA 3EYIA 3DEWA 2EIKH 2DJIA 2DA1A 3GZ5A 4MFEA 2VN2A 1JE8A 4DYRA 1OJLA 5HLTA 3R61A 2CV0A 2F5VA 4JX6A 2BY0A 4TV7A 1XCBA 4BHCA 1ZLJA 3Q9VA 4P5OA 1RUNA 3LFUA 2ZFUA 2YU9J 3FHZA 2CS3A 3CJQB 5LGTA 1IRGA 3OSFA 4A3MJ 2WWYA 2EV0A 3ESWB 4H0EA 1UHMA 1XDSA 2LR8A 2HFHA 1MMDA 1NTCA 4DQ2A 2JZYA 4G94A 3TDZC 5K1YA 4WK8F 1I27A 2P5LC 4AIJA 3KEQA 2CW7A 2OF7A 5IP6A 2QVOA 1SC7A 1AU7A 4HZFA 2GXGA 3CMAI 1FWZA 6PAXA 4RDUA 4KT5C 4UUSA 3BROA 3VB2A 4UUSB 2V1XA 3K1NA 5IYBJ 4XNFA 1N77A 1PP7U 4HF2A 1RIOH 4KIGA 3S2WA 2ZXIA 4HX8A 3QWLA 2COBA 1Z1DA 2JK3A 1U0JA 3FX3A 2WB1A 1FIPA 1Y0UA 3IKVA 3ULQB 3V7RA 5LEJA 5DUKA 1CF7A 1CF7B 5DD4A 3IAS2 2HNHA 1Y6IA 3Q0VA 1Z6RA 2Y0SN 5B66C 2VC0A 4P9UA 3J81K 2STTA 3ZGKA 5HS7A 2K40A 1YITI 3HZJA 3I3LA 2KT0A 2MA3A 2VONA 2MH9A 1ETYA 1SD4A 1O3QA 2HOSA 3HSRA 4HF1A 3V7SA 2KJBA 2DFEA 2XAHA 3M9AA 1K78A 1K78B 3RJPA 4M9ZA 5ED4A 2DU9A 1O4XA 2KKOA 2I10A 3NWTA 4NB5A 4R8HA 4Y4RA 3RSNA 4WWCA 3JRHA 2O5RA 4CA0A 1BA5A 4MGRA 3S32A 2TRTA 1LFBA 2QLZA 3KLOA 2D1VA 4HNVA 4BQOA 2R7DA 2WA0A 2V9VA 1N78A 2KRCA 1Z3YA 3ZOBA 3RKYA 2VQCA 2RREA 2IBDA 2OJED 2RC4A 1JXSA 2ZFWA 4CO8A 2E2IJ 2W85A 1NH3A 3R4KA 1VQ8I 5A2QZ 1ZKGA 2W00A 1D8JA 1B9MA 3DTIA 1J0RA 4KISA 2K5CA 1IG7A 4HEA2 4DBRA 1GHCA 1XCVA 2RQPA 3MKLA 4I98B 4JQFA 1ZGWA 5C4XJ 3PUBA 5F0CA 3OR2C 2GOMA 3DLAA 1J9IA 2VBXA 5EZGA 1ZTRA 2VKVA 2LF7A 1XB4A 1X3ZB 5GPCA 1ON2A 3KP4A 1ETOA 3DPLC 4QTRA 2RNGA 3EUHC 3BQYA 1X3WB 4V2FA 3L9FA 1P4AA 3JRBA 2GIVA 3T1BA 2L7FP 2XGXA 1HA8A 2O7OA 4B48A 1PUFA 5LHIA 3NWSA 2H6CA 3F21A 2LYCA 3J7AY 5GADJ 2CV2A 1P7JA 4C3HJ 3GTKJ 1KYWA 1U9OA 1TWHJ 1JHFA 3CD6I 1IW7F 3FZVA 3FWEA 2CH0A 2O03A 5GAGJ 2JRTA 1X2NA 1JGGA 4LLNA 3OYKA 4PDKA 2VBYA 4PGHA 2EA4A 2XAJA 1DPRA 2LDUA 3C2HA 1IN7A 4LGWA 1FP2A 2WAQA 3K4LA 2JT1A 1QO0D 2KL4A 2AXTC 1C0WA 2HDWA 2FE3A 2DA7A 1IN6A 2O61A 3I58A 3G1LA 2Y0MA 2HS5A 4RS8A 4IX7A 1MJ9A 4GCVA 5J4VA 2F5FA 3HHHA 2HYGD 1DP3A 1B59A 4JOMA 1Y56A 1VQ5I 3JRIA 2R0QC 3HKZA 3GZNB 3LMMA 3GTLJ 1KQ8A 3QQAA 4HYEA 3HTSB 2DK8A 3OV8A 3BDDA 1YX5A 2HWVA 1L0OC 2DK5A 4NC7A 4GFBA 3KZZA 2HTSA 2K85A 2HDCA 2QQBA 4BGDA 1IRFA 1W0UA 1OMIA 2DFFA 4UUVA 4XQFA 2QKLB 3QYEA 4EEFG 1TWCJ 3WTVC 2HQ5A 3A0HC 2PEXA 1VF9A 1W7PA 2X4HA 4PFPA 3PFYA 2Z16A 2E35A 1F36A 4LG0A 4AYBA 5GAEJ 2EH3A 2ETHA 3CMEI 4LG0B 3KLNA 3L7WA 3E5UA 2I8DA 4S04A 1V55H 2HXOA 3CDIA 1Y1WJ 5H2FC 4OIQF 3GTOJ 2HOAA 2K27A 4CSWA 1TT0A 2XF6A 2OZ6A 5JFRA 1TP4A 2Q8KA 1R49A 1SD7A 1ZN2A 2PN6A 4ENKA 5FB2A 4KIBA 3BQZA
chains in the Genus database with same CATH topology
4S0HB 5EGOB 5FLMJ 3S2HJ 2E2JJ 2AHQA 3NARA 3RQIA 1JKPC 1HOMA 4QIWN 1A5JA 4A93J 2R7ZJ 1JUMA 2DMNA 3CMYA 3S16J 1VFCA 3TW6A 2OPTA 3HOVJ 1ORKA 1Z0XA 3A02A 1MBKA 3BR5A 1GT0C 2K9NA 3CCYA 5C4JJ 3BR1A 3BR3A 3HB9A 2XPVA 4QSHA 1SFOJ 4IHYA 3WHCA 1JKRC 3JRGA 5IP7J 4J19A 2L7ZA 2X48A 4G12A 4IHXA 2M2EA 1OCPA 2HI3A 5EEAA 4L5EA 4A3BJ 4V2GA 3C2BA 2QF7A 1EF4A 3FK6A 2K9QA 3G1OA 4A3KJ 1OCTC 2LK2A 3GTGJ 3GBGA 4XICA 2M9HA 3LOCA 3HOWJ 3WHBA 2VI6A 2CQXA 3GTPJ 2MGQA 5DS9A 2DA5A 4MIMA 1IV6A 1BW6A 3JRFA 4M3DA 1WH5A 2Y31A 4FE4A 2DTZA 1MBHA 4MLOA 1DU0A 5M3FJ 5FKKA 1RPWA 1RETA 1F43A 2P81A 3ZQFA 1P7IA 2Y30A 3QPSA 5IP9J 2CRGA 2JJ7A 2MW8A 3F0CA 1OFCX 1ETVA 3I4NJ 4I76A 2XB0X 1AHDP 5E3LA 5F1JA 1XC5A 3W6VA 2VUMJ 3A03A 3SJMA 1TC3C 1D5YA 3K2AA 3TP0A 1GDTA 1E3OC 1IJWC 4A3DJ 2XPWA 4IEJA 9ANTA 3BTIA 3FK7A 1T33A 4DW6A 4JX4A 4A3IJ 1SANA 3HOYJ 1ETKA 5FKOA 5EYRA 1ZQ3P 1HDPA 5J1UA 5GP9A 3LSJA 5F08A 1GUUA 2DA4A 1WCMJ 1APLC 2EZHA 5F0HA 1QRYA 5C3EJ 3TP3A 2JA8J 1H89C 3S1NJ 1FTTA 3BTLA 3CDLA 4A3CJ 1RKWA 2W48A 4JP0A 4MFDA 1MSEC 1I3QJ 1S7EA 1UHSA 2HXIA 1ZR2A 4X1EA 2L7MP 4UUTA 3RZDJ 4DYCA 2NVQJ 1JTYA 3HOXJ 3D1NI 3JR9A 1TWFJ 1ZR4A 5M5WJ 2ZB9A 3GTJJ 2DN0A 3LNQA 1U8BA 1FIAA 2FJ1A 3FIWA 4A69C 3A01A 3HEFA 1X58A 3A01B 3HGGA 4M3GA 1I50J 2O8KA 3I4MJ 5J1YA 1ENHA 1MH4A 5IYCJ 3JRAA 4XRMA 4BY1J 4A3EJ 1BL0A 2E2HJ 4IHWA 1Q1VA 1XG1A 4DZPA 3HOUJ 2H8RA 2NS7A 4D7MA 1RESA 2ID3A 4DZJA 5K7HA 5E3MA 4I6ZA 3HOZJ 2Y9ZA 1NK3P 2L0KA 3PO3J 1G2HA 4D5FA 3MVPA 3SFIA 2RAEA 1JJ8C 3K7AJ 3RZOJ 3UKGA 4M6VA 2GLOA 2DMQA 3S1MJ 5IPAA 2X6OA 2GM4A 1Y1VJ 3B6CA 5EF6A 3HBLA 3PO2J 5FKMA 1QVUA 2DA6A 1R9TJ 4BXXJ 1HDDC 1UG2A 1MH3A 1IC8A 5EDNA 1TWAJ 2FQ4A 1FEXA 3FISA 2NVTJ 1RKTA 3OIOA 4C2MJ 3S15J 5IYDJ 2XPUA 1A6IA 3H3VK 3QPLA 3HKZN 4Y52J 1K83J 3L1PA 2Y2ZA 5JLWA 4IHVA 1WH7A 5IOYA 5FKLA 4X6AJ 2ELKA 2Y9YA 1JTXA 4BKXA 2L9RA 5F04A 1H8AC 3GTQJ 2DA2A 2NS8A 4M3EA 4MO7A 1JJ6C 2LP0A 2DJNA 3G1MA 1ITYA 3OSGA 4D5CA 1ZK8A 3Q3SA 1IDZA 2ECCA 2WB1N 1MBEA 1PUFB 1RR7A 1YRNB 2DMUA 4AYBN 1H88C 2ME6A 1T56A 5HODA 2HOTA 2IEKA 5F0FA 5K7ZA 2XB5A 4W1UA 4BBSJ 4JX5A 2MG4A 2HDDA 1BW5A 1JUSA 3BTCA 3S1QJ 2AO9A 1MNMC 2EZLA 1K61A 3DCFA 3DEWA 3O8GA 2H1KA 1IDYA 2DA1A 2HYJA 4MFEA 2DA3A 4DYRA 1OJLA 3BG3A 3IH4A 4JX6A 2YUSA 3ZQLA 2ID6A 1I6HJ 5M3MJ 1MBFA 2YU9J 5EZHA 4XK4A 2CU7A 3HGYA 3HM5A 4BY7J 2LFBA 3ZQHA 1HLVA 1MBGA 2LLKA 3OSFA 4A3GJ 4A3MJ 2EBIA 5C44J 2LR8A 3SDGA 1Z77A 1ETQA 1NTCA 4A3JJ 1WGXA 5EG0B 4NDLA 1B8IA 2OF7A 1B8IB 2XRLA 5IP6A 1AU7A 1JT0A 2JN6A 3BR2A 2O9LA 4RDUA 4UUSA 4UUSB 3M4OJ 2D5VA 5JLXA 5IYBJ 4FCYA 2IAIA 2MSYA 2VPRA 2CUEA 1UMQA 4JYKA 2NVXJ 2DMPA 3GTMJ 2COBA 2JK3A 4FISA 1FIPA 2EZIA 2N8GA 5K7FA 4B4CA 2R5ZA 3Q0VA 2R5ZB 3Q0WA 2PMZN 2Y0SN 3TEDA 2M34A 3BG9A 2LVSA 2K40A 4B1RA 1GVDA 3ZQGA 2KT0A 5F27A 4C3JJ 1ETYA 2HOSA 2EZKA 2XGEA 2LD5A 2QCOA 5GPAA 1WPKA 3JRCA 3IV5A 1O4XA 1CQTA 2G0EA 2CUFA 2I10A 2M8GX 2WAQN 3JRHA 5E3NA 1ETXA 3TW7A 1BA5A 2LY9A 1ETWA 2TRTA 1LFBA 2GBYA 4HNVA 1QPIA 4A3LJ 1TWGJ 3ZOBA 4RBOA 2IBDA 3OOUA 2E2IJ 1HF0A 1LE8A 1LE8B 1ZKGA 2XGDA 2K9SA 5FKNA 1IG7A 5M5XJ 1U78A 3MKLA 1POGA 1ZGWA 3MN2A 1W0TA 4FE7A 5C4XJ 3BG5A 5F0CA 3JRDA 2XGCA 3O8HA 1GV2A 1IGNA 5EZGA 3BTJA 1ZTRA 2VKVA 4M3FA 3HDDA 3Q0UA 1NK2P 5GPCA 1HCRA 2LKXA 1ETOA 4QTRA 2X9DA 3H0GJ 3BQYA 5M5YJ 4V2FA 3E7LA 3JRBA 2L7FP 1U9NA 3S1RJ 4C3IJ 2O7OA 1PUFA 4W97A 1YRNA 3VPRA 3LSGA 1P7JA 4C3HJ 4M3BA 3GTKJ 1U9OA 1TWHJ 2JA7J 3S14J 2KDZA 4LOCA 3LSRA 3FKIJ 3IH2A 1X2NA 1JGGA 1WI3A 3PM1A 2NVYJ 2M0CA 2VKEA 2B63J 2XSDC 2DA7A 4B3AA 4FTHA 4XIDA 1MBJA 3G1LA 1JKOC 2R93J 1VI0A 3JREA 2LTPA 5J1RA 2TCTA 1B72A 1B72B 2WV1A 2E19A 4AUXA 4CYCA 4CYCB 3JRIA 2R0QC 1JKQC 2NOGA 5BNGA 3GTLJ 3QQAA 4BBRJ 3BR0A 3LSPA 5EG0A 1JT6A 4GFBA 1LFUP 1IUFA 1VNDA 5FLVA 2ECBA 2FD5A 1FJLA 2ME0A 3ZQCA 3NAUA 5IOZA 1QVTA 3BT9A 1W0UA 4DYQA 4AC0A 3B6AA 4EEFG 3S2DJ 2FX0A 1TWCJ 2CQQA 2HQ5A 4XRSA 3CQZJ 2JA6J 2JA5J 5DTDA 4D7NA 3IH3A 1FTZA 1VF9A 3ZQIA 2EQRA 1IRZA 5E3OA 1F36A 2DMTA 2EH3A 4Y7NJ 2JMWA 5J3LA 1GV5A 3BR6A 1JUPA 4ABZA 1BJZA 5EGOA 1AKHA 1AKHB 4A3FJ 2HXOA 1X2MA 2JWTA 3RKQA 1Y1WJ 2YS9A 1XS9A 2R92J 3M3YJ 3GTOJ 2HOAA 2E1OA 3S17J 4XRSG 2R5YA 2R5YB 1MSFC 2CJJA 5FJ8J 1DU6A 3BQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S0H B;  5EGO B;  5FLM J;  3S2H J;  2E2J J;  2AHQ A;  3NAR A;  3RQI A;  1JKP C;  1HOM A;  4QIW N;  1A5J A;  4A93 J;  2R7Z J;  1JUM A;  2DMN A;  3CMY A;  3S16 J;  1VFC A;  3TW6 A;  2OPT A;  3HOV J;  1ORK A;  1Z0X A;  3A02 A;  1MBK A;  3BR5 A;  1GT0 C;  2K9N A;  3CCY A;  5C4J J;  3BR1 A;  3BR3 A;  3HB9 A;  2XPV A;  4QSH A;  1SFO J;  4IHY A;  3WHC A;  1JKR C;  3JRG A;  5IP7 J;  4J19 A;  2L7Z A;  2X48 A;  4G12 A;  4IHX A;  2M2E A;  1OCP A;  2HI3 A;  5EEA A;  4L5E A;  4A3B J;  4V2G A;  3C2B A;  2QF7 A;  1EF4 A;  3FK6 A;  2K9Q A;  3G1O A;  4A3K J;  1OCT C;  2LK2 A;  3GTG J;  3GBG A;  4XIC A;  2M9H A;  3LOC A;  3HOW J;  3WHB A;  2VI6 A;  2CQX A;  3GTP J;  2MGQ A;  5DS9 A;  2DA5 A;  4MIM A;  1IV6 A;  1BW6 A;  3JRF A;  4M3D A;  1WH5 A;  2Y31 A;  4FE4 A;  2DTZ A;  1MBH A;  4MLO A;  1DU0 A;  5M3F J;  5FKK A;  1RPW A;  1RET A;  1F43 A;  2P81 A;  3ZQF A;  1P7I A;  2Y30 A;  3QPS A;  5IP9 J;  2CRG A;  2JJ7 A;  2MW8 A;  3F0C A;  1OFC X;  1ETV A;  3I4N J;  4I76 A;  2XB0 X;  1AHD P;  5E3L A;  5F1J A;  1XC5 A;  3W6V A;  2VUM J;  3A03 A;  3SJM A;  1TC3 C;  1D5Y A;  3K2A A;  3TP0 A;  1GDT A;  1E3O C;  1IJW C;  4A3D J;  2XPW A;  4IEJ A;  9ANT A;  3BTI A;  3FK7 A;  1T33 A;  4DW6 A;  4JX4 A;  4A3I J;  1SAN A;  3HOY J;  1ETK A;  5FKO A;  5EYR A;  1ZQ3 P;  1HDP A;  5J1U A;  5GP9 A;  3LSJ A;  5F08 A;  1GUU A;  2DA4 A;  1WCM J;  1APL C;  2EZH A;  5F0H A;  1QRY A;  5C3E J;  3TP3 A;  2JA8 J;  1H89 C;  3S1N J;  1FTT A;  3BTL A;  3CDL A;  4A3C J;  1RKW A;  2W48 A;  4JP0 A;  4MFD A;  1MSE C;  1I3Q J;  1S7E A;  1UHS A;  2HXI A;  1ZR2 A;  4X1E A;  2L7M P;  4UUT A;  3RZD J;  4DYC A;  2NVQ J;  1JTY A;  3HOX J;  3D1N I;  3JR9 A;  1TWF J;  1ZR4 A;  5M5W J;  2ZB9 A;  3GTJ J;  2DN0 A;  3LNQ A;  1U8B A;  1FIA A;  2FJ1 A;  3FIW A;  4A69 C;  3A01 A;  3HEF A;  1X58 A;  3A01 B;  3HGG A;  4M3G A;  1I50 J;  2O8K A;  3I4M J;  5J1Y A;  1ENH A;  1MH4 A;  5IYC J;  3JRA A;  4XRM A;  4BY1 J;  4A3E J;  1BL0 A;  2E2H J;  4IHW A;  1Q1V A;  1XG1 A;  4DZP A;  3HOU J;  2H8R A;  2NS7 A;  4D7M A;  1RES A;  2ID3 A;  4DZJ A;  5K7H A;  5E3M A;  4I6Z A;  3HOZ J;  2Y9Z A;  1NK3 P;  2L0K A;  3PO3 J;  1G2H A;  4D5F A;  3MVP A;  3SFI A;  2RAE A;  1JJ8 C;  3K7A J;  3RZO J;  3UKG A;  4M6V A;  2GLO A;  2DMQ A;  3S1M J;  5IPA A;  2X6O A;  2GM4 A;  1Y1V J;  3B6C A;  5EF6 A;  3HBL A;  3PO2 J;  5FKM A;  1QVU A;  2DA6 A;  1R9T J;  4BXX J;  1HDD C;  1UG2 A;  1MH3 A;  1IC8 A;  5EDN A;  1TWA J;  2FQ4 A;  1FEX A;  3FIS A;  2NVT J;  1RKT A;  3OIO A;  4C2M J;  3S15 J;  5IYD J;  2XPU A;  1A6I A;  3H3V K;  3QPL A;  3HKZ N;  4Y52 J;  1K83 J;  3L1P A;  2Y2Z A;  5JLW A;  4IHV A;  1WH7 A;  5IOY A;  5FKL A;  4X6A J;  2ELK A;  2Y9Y A;  1JTX A;  4BKX A;  2L9R A;  5F04 A;  1H8A C;  3GTQ J;  2DA2 A;  2NS8 A;  4M3E A;  4MO7 A;  1JJ6 C;  2LP0 A;  2DJN A;  3G1M A;  1ITY A;  3OSG A;  4D5C A;  1ZK8 A;  3Q3S A;  1IDZ A;  2ECC A;  2WB1 N;  1MBE A;  1PUF B;  1RR7 A;  1YRN B;  2DMU A;  4AYB N;  1H88 C;  2ME6 A;  1T56 A;  5HOD A;  2HOT A;  2IEK A;  5F0F A;  5K7Z A;  2XB5 A;  4W1U A;  4BBS J;  4JX5 A;  2MG4 A;  2HDD A;  1BW5 A;  1JUS A;  3BTC A;  3S1Q J;  2AO9 A;  1MNM C;  2EZL A;  1K61 A;  3DCF A;  3DEW A;  3O8G A;  2H1K A;  1IDY A;  2DA1 A;  2HYJ A;  4MFE A;  2DA3 A;  4DYR A;  1OJL A;  3BG3 A;  3IH4 A;  4JX6 A;  2YUS A;  3ZQL A;  2ID6 A;  1I6H J;  5M3M J;  1MBF A;  2YU9 J;  5EZH A;  4XK4 A;  2CU7 A;  3HGY A;  3HM5 A;  4BY7 J;  2LFB A;  3ZQH A;  1HLV A;  1MBG A;  2LLK A;  3OSF A;  4A3G J;  4A3M J;  2EBI A;  5C44 J;  2LR8 A;  3SDG A;  1Z77 A;  1ETQ A;  1NTC A;  4A3J J;  1WGX A;  5EG0 B;  4NDL A;  1B8I A;  2OF7 A;  1B8I B;  2XRL A;  5IP6 A;  1AU7 A;  1JT0 A;  2JN6 A;  3BR2 A;  2O9L A;  4RDU A;  4UUS A;  4UUS B;  3M4O J;  2D5V A;  5JLX A;  5IYB J;  4FCY A;  2IAI A;  2MSY A;  2VPR A;  2CUE A;  1UMQ A;  4JYK A;  2NVX J;  2DMP A;  3GTM J;  2COB A;  2JK3 A;  4FIS A;  1FIP A;  2EZI A;  2N8G A;  5K7F A;  4B4C A;  2R5Z A;  3Q0V A;  2R5Z B;  3Q0W A;  2PMZ N;  2Y0S N;  3TED A;  2M34 A;  3BG9 A;  2LVS A;  2K40 A;  4B1R A;  1GVD A;  3ZQG A;  2KT0 A;  5F27 A;  4C3J J;  1ETY A;  2HOS A;  2EZK A;  2XGE A;  2LD5 A;  2QCO A;  5GPA A;  1WPK A;  3JRC A;  3IV5 A;  1O4X A;  1CQT A;  2G0E A;  2CUF A;  2I10 A;  2M8G X;  2WAQ N;  3JRH A;  5E3N A;  1ETX A;  3TW7 A;  1BA5 A;  2LY9 A;  1ETW A;  2TRT A;  1LFB A;  2GBY A;  4HNV A;  1QPI A;  4A3L J;  1TWG J;  3ZOB A;  4RBO A;  2IBD A;  3OOU A;  2E2I J;  1HF0 A;  1LE8 A;  1LE8 B;  1ZKG A;  2XGD A;  2K9S A;  5FKN A;  1IG7 A;  5M5X J;  1U78 A;  3MKL A;  1POG A;  1ZGW A;  3MN2 A;  1W0T A;  4FE7 A;  5C4X J;  3BG5 A;  5F0C A;  3JRD A;  2XGC A;  3O8H A;  1GV2 A;  1IGN A;  5EZG A;  3BTJ A;  1ZTR A;  2VKV A;  4M3F A;  3HDD A;  3Q0U A;  1NK2 P;  5GPC A;  1HCR A;  2LKX A;  1ETO A;  4QTR A;  2X9D A;  3H0G J;  3BQY A;  5M5Y J;  4V2F A;  3E7L A;  3JRB A;  2L7F P;  1U9N A;  3S1R J;  4C3I J;  2O7O A;  1PUF A;  4W97 A;  1YRN A;  3VPR A;  3LSG A;  1P7J A;  4C3H J;  4M3B A;  3GTK J;  1U9O A;  1TWH J;  2JA7 J;  3S14 J;  2KDZ A;  4LOC A;  3LSR A;  3FKI J;  3IH2 A;  1X2N A;  1JGG A;  1WI3 A;  3PM1 A;  2NVY J;  2M0C A;  2VKE A;  2B63 J;  2XSD C;  2DA7 A;  4B3A A;  4FTH A;  4XID A;  1MBJ A;  3G1L A;  1JKO C;  2R93 J;  1VI0 A;  3JRE A;  2LTP A;  5J1R A;  2TCT A;  1B72 A;  1B72 B;  2WV1 A;  2E19 A;  4AUX A;  4CYC A;  4CYC B;  3JRI A;  2R0Q C;  1JKQ C;  2NOG A;  5BNG A;  3GTL J;  3QQA A;  4BBR J;  3BR0 A;  3LSP A;  5EG0 A;  1JT6 A;  4GFB A;  1LFU P;  1IUF A;  1VND A;  5FLV A;  2ECB A;  2FD5 A;  1FJL A;  2ME0 A;  3ZQC A;  3NAU A;  5IOZ A;  1QVT A;  3BT9 A;  1W0U A;  4DYQ A;  4AC0 A;  3B6A A;  4EEF G;  3S2D J;  2FX0 A;  1TWC J;  2CQQ A;  2HQ5 A;  4XRS A;  3CQZ J;  2JA6 J;  2JA5 J;  5DTD A;  4D7N A;  3IH3 A;  1FTZ A;  1VF9 A;  3ZQI A;  2EQR A;  1IRZ A;  5E3O A;  1F36 A;  2DMT A;  2EH3 A;  4Y7N J;  2JMW A;  5J3L A;  1GV5 A;  3BR6 A;  1JUP A;  4ABZ A;  1BJZ A;  5EGO A;  1AKH A;  1AKH B;  4A3F J;  2HXO A;  1X2M A;  2JWT A;  3RKQ A;  1Y1W J;  2YS9 A;  1XS9 A;  2R92 J;  3M3Y J;  3GTO J;  2HOA A;  2E1O A;  3S17 J;  4XRS G;  2R5Y A;  2R5Y B;  1MSF C;  2CJJ A;  5FJ8 J;  1DU6 A;  3BQZ A; 
#chains in the Genus database with same CATH topology
 5FLM J;  3S2H J;  2DO7 A;  1MW7 A;  4BS9 A;  4YFN F;  1G3Y A;  1ONV A;  1J5Y A;  2LRE A;  2R7Z J;  4A93 J;  2ZME B;  2QQ9 A;  2XDV A;  4ZDO A;  3LAJ A;  1AWC A;  3DPT A;  4NNJ A;  4XKW A;  1WQ2 A;  1Z05 A;  1TQP A;  2NRA C;  4NBQ A;  3OWT A;  1Z21 A;  3G4S I;  3LL7 A;  2K9N A;  1Z7L A;  2NYX A;  3MWM A;  3MKY B;  2MD0 A;  3BR3 A;  2JSP A;  3HB9 A;  5ICF A;  2FUG 2;  3ECH A;  3TL4 X;  1SFO J;  2V7F A;  1UJ8 A;  3MKW B;  4I09 A;  3RYP A;  4DBQ A;  4D1Q A;  1JI8 A;  4J19 A;  3AG3 H;  4GRI A;  2L7Z A;  3ZN0 A;  4C9Y A;  1D3Y A;  2L4M A;  4PGG A;  4V2G A;  4I0B A;  1EF4 A;  2QBY A;  2PJP A;  1Y8Q B;  2QBY B;  3V4G A;  3TBI A;  4A3K J;  2R3S A;  4ZDP A;  4BE1 A;  3WU2 C;  5B1A H;  3LOC A;  5HDG A;  3CDH A;  2P4W A;  1SVM A;  3ROU A;  2CQX A;  3K1P A;  2CWE A;  1VQM I;  1BI1 A;  4A0Z A;  1TQI A;  2LH9 A;  3SZP A;  1T39 A;  3GCM A;  3JRF A;  4M3D A;  1WH5 A;  3SZG A;  1ZLK A;  2F4O B;  1SVL A;  2QSF X;  3CP8 A;  2F2E A;  4CCO A;  4LD5 A;  1UEL B;  1RPW A;  2VJ4 A;  3QAH A;  3GEZ A;  5FKK A;  3ZQF A;  4CXF A;  3FMS A;  3QPS A;  2X1E A;  2MW8 A;  3F0C A;  2KFD A;  2L5Q A;  3K1M A;  2COM A;  3PIP F;  3BY6 A;  3I4N J;  1BI2 A;  2DXI A;  3J81 Z;  1G3T A;  3I5U A;  4PJN A;  4U7D A;  3BJ6 A;  5F1J A;  2VUM J;  3SJM A;  2W7N A;  3I55 I;  3P9I A;  4EJO A;  3TOB A;  5H6R A;  1E3O C;  1IJW C;  4IEJ A;  3CMM A;  3BTI A;  1T08 B;  1QZZ A;  2M8E A;  3A4C A;  1T33 A;  3FXR A;  2DFH A;  1R00 A;  4JX4 A;  2M7B A;  3HOY J;  3OY9 A;  2A61 A;  5J1U A;  5GP9 A;  1UZC A;  5F08 A;  1UG0 A;  2JVH A;  2EFO A;  4XOR A;  1QRY A;  4KIC A;  5IT9 K;  4LFU A;  1DPU A;  2FOW A;  4ZH4 F;  4IJA A;  2XAS A;  5LRS A;  1P2F A;  5HDN A;  3HG9 A;  5AIQ A;  1EKE A;  3WGH A;  2EB7 A;  3HHG A;  1ZR2 A;  3BZ6 A;  2L7M P;  2R7S A;  1KU7 A;  2ZNZ A;  1WVR A;  3JTH A;  3RZD J;  4DYC A;  1G6N A;  4HSR A;  4XM3 A;  3HOX J;  2R7X A;  1YFH A;  4QLC U;  4GO1 A;  2ZB9 A;  4ENJ A;  4UVC A;  3H1C A;  1WHU A;  1USS A;  1K4T A;  2FJ1 A;  3BPV A;  1H0M A;  4EJU A;  1D0Y A;  2HOE A;  3M1E A;  3ERE D;  2ELJ A;  5IYC J;  2E1M C;  4XRM A;  4BY1 J;  2L9N A;  2E2H J;  2LKS A;  3ZPL A;  2E1M B;  2MC4 A;  3WG7 H;  4KA4 A;  3ZMZ A;  3CCQ I;  2LRD A;  2WC2 A;  4IHS A;  3EQL F;  2E34 A;  1XPX A;  4HRI A;  5E8G A;  4C2T A;  2ID3 A;  4DZJ A;  3DKW A;  3DTE A;  5L3D A;  3V8L A;  1I3A A;  2JPB A;  2CQ7 A;  3LST A;  1PP8 F;  1MND A;  1V5E A;  2OQG A;  1RNL A;  5TGT A;  3OYI A;  1MD0 A;  4Q48 A;  2ZJR F;  1HST A;  3F8B A;  3MAJ A;  3DQV C;  3KP6 A;  2GLO A;  1MMN A;  3S1M J;  2A5Y B;  3QYB A;  3FMQ A;  1J2X A;  2JA2 A;  3GW2 A;  3OIQ A;  3PO2 J;  1YS6 A;  5FLX K;  1DDN A;  1QVU A;  1JGS A;  2ZSH B;  3I9V 2;  2KIM A;  1HC8 A;  2BOL A;  2L3D A;  3ZXS A;  1BR4 A;  5TRD A;  2CO5 A;  5L3C A;  1FEX A;  2Q0O A;  1RKT A;  3S15 J;  2Q2E B;  3KYD B;  3A2K A;  2XPU A;  4E7H A;  3HKZ N;  1K83 J;  4LJZ F;  2Y2Z A;  4IHV A;  2E5N A;  1Z6T A;  2Y9Y A;  1OCZ H;  1K6O A;  2K4B A;  3GFJ A;  4BKX A;  5F04 A;  2JRM A;  3EYY A;  1FX7 A;  3ZR8 X;  5J8F A;  2IA0 A;  2EV6 A;  1E3P A;  1WZ2 A;  2YR2 A;  1W4M A;  2Z2S B;  3OYF A;  4RGU A;  4IQ4 A;  2DYR H;  2LBF B;  1RC9 A;  3L2V A;  4B8X A;  1S7A A;  2DMU A;  4AYB N;  3OYN A;  1H88 C;  2IEK A;  2OQR A;  5F0F A;  3L2C A;  4XLH A;  1SAX A;  1ZG1 A;  1WJD A;  2OTJ I;  1TNT A;  4IO9 F;  3BP8 A;  3KX2 A;  2EZL A;  3PNV A;  3WTS C;  1K61 A;  2H1K A;  4YFK F;  5DM7 F;  3NQO A;  2BY2 A;  3KCC A;  3R0A A;  3IH4 A;  4HDV A;  2EV5 A;  3JCU C;  5LD2 C;  5KAI C;  5M3M J;  2PG4 A;  4HV6 A;  2IP2 A;  5L3E A;  2ZJ2 A;  3SEZ A;  3SXY A;  3LA7 A;  4E7L A;  4FX4 A;  4XK4 A;  1YJ9 I;  2CU7 A;  1A36 A;  3OYL A;  2KIU A;  5E18 F;  1MBG A;  2FSW A;  4A3G J;  4L9V A;  2IJL A;  1MDM A;  1VTN C;  1MDM B;  4IRI A;  1GVJ A;  3OL3 A;  4IZZ A;  2VC1 A;  5C44 J;  4D9J A;  1Z77 A;  3AG1 H;  2WAE A;  3VFZ A;  3PQK A;  4NDL A;  3DF8 A;  1YJN I;  1B8I A;  1B8I B;  1F4K A;  3HYI A;  4ITV A;  3ZMT A;  2JVG A;  4G6T B;  3WTX C;  1JT0 A;  4PJM A;  1LVA A;  2O9L A;  2D5V A;  2IAI A;  2MSY A;  3FBI B;  2M5W A;  1SD6 A;  4DJA A;  5ICG A;  1UMQ A;  2JTV A;  2J5O A;  3K2Z A;  2HVR A;  4I2O A;  3GTM J;  1BI3 A;  1XMX A;  1W1W E;  5E79 C;  1RZ4 A;  2EZI A;  4PJL A;  2V1U A;  5K7F A;  3OS0 A;  2B9S A;  3M8F A;  1IN8 A;  2PMZ N;  3F72 A;  3TED A;  2Q1Z B;  3BG9 A;  4R1H A;  2MC3 A;  2LVS A;  2FBK A;  4CZZ A;  3RI4 A;  1GVD A;  4AU7 A;  3O6B B;  4ZZD A;  1LVK A;  1LNW A;  1ODD A;  5BMZ A;  2EZK A;  2XGE A;  1FC3 A;  2CQK A;  2GA1 A;  3E3V A;  2LD5 A;  4MEX F;  5GPA A;  3ZN1 A;  3F9K A;  1CQT A;  4ON0 A;  2M3A A;  2F6C A;  1J59 A;  4OIO F;  3V8J A;  1ETX A;  2RN7 A;  1S5L C;  1QPM A;  5DCM A;  3S3M A;  1GLN A;  4HQE A;  3H92 A;  3E1S A;  1P9Q C;  4LIU A;  1OCO H;  1U3E M;  3K4M A;  3IRR A;  5FO5 A;  3OOU A;  4PFO A;  5IT9 Z;  4LIT A;  2FA5 A;  1HF0 A;  3D5S C;  2BXY A;  2P5V A;  3G3Z A;  4J01 A;  2XGD A;  4U0Y A;  2K9S A;  4Y13 A;  1S9H A;  2KMU A;  3ZQQ A;  2QQ8 A;  4DIQ A;  1U78 A;  3MMY B;  2PQ8 A;  3MN2 A;  3T8R A;  3BG5 A;  1ZGJ A;  2PLY A;  1HKT A;  3H3Z A;  2LNB A;  3F8C A;  3Q0U A;  3HDD A;  2L7K A;  4ZJZ A;  3BPX A;  4XSX F;  3KET A;  1SMT A;  4XL9 A;  3E7L A;  3OYJ A;  5FD5 A;  1YRN A;  2ZC2 A;  5CQE A;  2CYY A;  2MYS A;  1BI0 A;  5D5X B;  2HKX A;  2Z33 A;  1VQP I;  1VQN I;  2ACJ A;  2KDZ A;  1YIJ I;  4LOC A;  3O3K A;  3GUD A;  4BH9 A;  3VYU B;  3IH2 A;  3LSK A;  4RB1 A;  4ZTJ A;  4GXO A;  1LFP A;  3IL2 A;  4LLG F;  3CCS I;  2V6C A;  3QPH A;  3WU0 A;  1B4A A;  1ZAO A;  2W57 A;  2M0C A;  1KU3 A;  4EMS A;  2XSD C;  2B63 J;  2RKH A;  4B3A A;  4FTH A;  4XID A;  4UV8 A;  4XON A;  2DOE A;  1MBJ A;  2RQQ A;  4L5I A;  1JKO C;  2R93 J;  1VI0 A;  3VSK A;  2LKP A;  2K7L A;  4LB6 B;  3JRE A;  1K79 A;  3AG4 H;  3Q9S A;  5F64 A;  2CSO A;  4FET A;  3W6J B;  2WV1 A;  2OU2 A;  1OIS A;  4B3X A;  3ECO A;  3ZMU A;  5FRO A;  5DUI A;  3TO9 A;  1V3F A;  4BQN A;  3A1Y A;  3HTU A;  3R6S A;  4A5N A;  3RCO A;  5J8C A;  1JKQ C;  2R7O A;  4AVP A;  1G4D A;  3F3X A;  5JHF A;  1BR2 A;  4Y3O A;  5FLX Z;  4BDY A;  2MH2 A;  1R36 A;  3CO6 C;  1JT6 A;  5FLV A;  3TQN A;  1O7L A;  1J7K A;  1IRX A;  1TBX A;  2ZO4 A;  4ZTF A;  3F6O A;  3QPT A;  1FJL A;  1BR1 A;  1ERD A;  1WJE A;  3GO5 A;  1FMV A;  3H5R A;  3NAU A;  1QVT A;  3BT9 A;  1HBX G;  2FQ3 A;  1YW9 A;  4M74 A;  4DYQ A;  3LA3 A;  3B6A A;  3S2D J;  4L9T A;  1MZB A;  4XOP A;  1Z9C A;  3HSE A;  3IWF A;  2JA5 J;  2JA6 J;  5DTD A;  2ISZ A;  1U6G A;  3IH3 A;  3BCB A;  2A3S A;  3X2Q H;  3RQ4 A;  4RB0 A;  1IRZ A;  1WKM A;  2VQG A;  3LQQ A;  4Y7N J;  2A07 F;  1GV5 A;  4A6E A;  3V8K A;  1F9N A;  4HDU A;  4ABZ A;  1BJZ A;  3CC4 I;  3BZC A;  3DEU A;  3LWF A;  4PJ0 C;  3CES A;  4KUM A;  1AKH A;  4E7J A;  1AKH B;  3OS2 A;  3KYC B;  4CUG A;  2DTR A;  1E17 A;  2YS9 A;  1YX3 A;  1NG6 A;  2E1O A;  1WSU A;  2E5Z A;  2IW5 A;  3B73 A;  4YEJ A;  2HPM A;  1MSF C;  4N4N B;  2CJJ A;  1JKP C;  2V79 A;  1DGR M;  1DU6 A;  3IUO A;  1IN4 A;  3IKT A;  3P7N A;  3RQI A;  1FYL A;  2WAF A;  5DDG A;  4KNY A;  1A5J A;  2O0Y A;  2FEZ A;  3CMY A;  2DMN A;  2PMH A;  1VFC A;  5K5Q A;  3HOV J;  3CCM I;  3A02 A;  1GT0 C;  3C2G A;  3K70 C;  1QU3 A;  4M71 A;  3DFG A;  2VT3 A;  5CJ9 A;  4QWQ A;  2ZJQ F;  5D4S A;  1G59 A;  1B1B A;  4M73 A;  3M8J A;  4A6D A;  2KIS A;  2KLO A;  4M6Y A;  2K02 A;  1JKR C;  5IP7 J;  4E7K A;  1WJC A;  2DW4 A;  4CCJ A;  2X48 A;  2K4J A;  1D1A A;  2VOD A;  5DV5 A;  5EEA A;  2W82 A;  4L5E A;  2KZV A;  4BXU A;  1T0F C;  2K9Q A;  3WGI A;  2Z9O A;  3G1O A;  5KVR A;  3W3C A;  2M9H A;  4AM3 A;  2ZBK A;  1FZP B;  1VQ4 I;  2CQN A;  3EUH A;  3GTP J;  1E3H A;  5FFZ A;  1U2W A;  1Z7U A;  1E2X A;  1WJB A;  4XKV A;  4U88 A;  2DPD A;  2DTZ A;  3HL2 A;  1DU0 A;  1UFM A;  1V5G A;  4CH7 A;  4BEH A;  4BEH B;  1P7I A;  3J7Y J;  3RDI A;  3KYL A;  4XLE A;  2HR3 A;  3TKY A;  4KIT B;  1XX5 A;  3TOA A;  3TDU C;  1OFC X;  1O7F A;  3C7J A;  3DKX A;  3E6D A;  1YS7 A;  2DI3 A;  4A2U A;  3AL0 C;  4I76 A;  4EV0 A;  2XB0 X;  4KMU X;  4LK1 F;  1AHD P;  3AL0 B;  3P9C A;  2B7E A;  1FYM A;  3W6V A;  2KIQ A;  3RTR A;  4HNT A;  3A03 A;  4L9J A;  1V54 H;  1YLF A;  2NNY A;  4RAY A;  4WF2 A;  1TC3 C;  4XSZ F;  1KU2 A;  3H36 A;  3TP0 A;  1GDT A;  2QSH X;  3F23 A;  4A3D J;  2X6X A;  2NXN B;  2D1H A;  2TDX A;  3LA2 A;  1SAN A;  4WX9 A;  5EYR A;  2GA2 A;  2AQF A;  3MZ8 A;  4PCQ A;  3LFK A;  2RVC A;  3BOQ A;  2IPQ X;  5F0H A;  5HNH A;  3TP3 A;  2KP6 A;  5E17 F;  1T98 A;  3AKZ A;  3CDL A;  4A3C J;  1ZRD A;  1RKW A;  2M0M A;  4JP0 A;  3WTT C;  1MSE C;  5BOX A;  4E7Z A;  1LDK B;  5HNF A;  1R22 A;  2HEO A;  2XAF A;  5J6X A;  1MMS A;  3DBH B;  4RLQ A;  4YRV A;  3M07 A;  2E36 A;  3GFI A;  1P92 A;  2DLL A;  4UUT A;  2BGC A;  3H9G A;  1TWF J;  1ZR4 A;  5M5W J;  2V1D A;  4MHG A;  1A31 A;  4BDZ A;  2DN0 A;  3K4B A;  3LNQ A;  2OV7 A;  3IC7 A;  3QU3 A;  3FIW A;  1IUY A;  2L9V A;  1FBU A;  4C30 A;  3CP2 A;  3A01 A;  3A01 B;  2VBZ A;  3I4M J;  3E0J B;  4M9X A;  1MH4 A;  3L00 A;  5TIS C;  2QWW A;  2BVM A;  3W2A A;  3VDX A;  4IHW A;  1PJR A;  3K10 A;  2NS7 A;  2XKP A;  2ZME C;  1TQM A;  2R7F A;  2XAU A;  2ZME A;  2Z1D A;  2IA1 A;  4BHP A;  5K7H A;  5CLS A;  4I6Z A;  3K70 D;  3HOZ J;  2Y9Z A;  4EM2 A;  2AXL A;  2L0K A;  1G2H A;  4D5F A;  3MVP A;  3OR1 C;  1MMG A;  1S72 I;  2YSR A;  1XD7 A;  3ONQ A;  4XLF A;  5JI6 A;  4EGZ A;  2JUG A;  2L01 A;  2WBM A;  1IXR C;  4BJ5 C;  3HXL A;  1TL8 A;  3OMY A;  4X0G A;  3FM3 A;  5CYV A;  5LBQ A;  1OYW A;  2X6O A;  3BJA A;  4BQA A;  2KRF A;  4RM2 A;  1VQ7 I;  4NHJ A;  4G7O F;  1Y1V J;  5EF6 A;  5DD8 A;  4QPO A;  4FQG A;  2DT6 A;  3ZCO A;  3WTW C;  5FKM A;  2A6H F;  4BE2 A;  4EAT A;  2BHZ A;  1X4O A;  2DPU A;  3KP3 A;  3W6K B;  1R7J A;  2V6E A;  2IGN A;  1ZH5 A;  1SVO A;  3FIS A;  4ZDL A;  3HOS A;  3OIO A;  3REO A;  2D2W A;  1A6I A;  3CCJ I;  1OLT A;  3W2W A;  4Y52 J;  1X1D A;  1XGO A;  1OR7 C;  3KIO A;  4IF4 A;  5JLW A;  1OR7 A;  3VSL A;  4A0Y A;  3C18 A;  5JVT A;  3U9G A;  3JSP A;  4ENM A;  3H9Q A;  1R4N B;  1FBQ A;  2VE8 A;  1EA3 A;  1H8A C;  3OYH A;  3DEE A;  2NS8 A;  4M3E A;  4MO7 A;  4O5V A;  2EFW A;  1ZYR F;  4DOZ A;  4V19 K;  1ITY A;  3OSG A;  4D5C A;  2HQN A;  4RA2 A;  1FPQ A;  3S93 A;  5CVR A;  4S05 A;  3J80 K;  1OPC A;  1TNS A;  2ECC A;  2WB1 N;  1HSJ A;  1MBE A;  4XMY A;  2MD5 A;  1DUX C;  4E7I A;  3KFW X;  1XMA A;  4YIR X;  3WTU C;  2XB5 A;  2QYO A;  3KE2 A;  3ZP5 A;  2ZXW H;  4JX5 A;  1QQI A;  1BW5 A;  2AO9 A;  3S8P A;  3CCV I;  1MNM C;  4ESF A;  1TW2 A;  2P8T A;  3DCF A;  1P6R A;  3BG6 A;  2WAD A;  4IHT A;  2HGC A;  4GDF A;  3BG3 A;  1I1S A;  1PUE E;  1QA6 A;  4F7Z A;  3MKZ A;  3CCL I;  3ZQL A;  2ID6 A;  1YW8 A;  1Q1H A;  2E7W A;  3ZMD A;  4IKF A;  2OUM A;  3HJE A;  2CV1 A;  1X3U A;  3NEU A;  3F6V A;  2OZU A;  3T5X A;  5HLH A;  5EZH A;  1W5S A;  4N4O B;  4WXH A;  1X1P A;  2PFB A;  1D0Z A;  2M87 A;  1IXC A;  2CUZ A;  2KDO A;  3HGY A;  4ZYA A;  1HLV A;  2LFB A;  2IRF G;  2LLK A;  4G6Q A;  2GWR A;  1YE9 A;  4MNU A;  3MCZ A;  3CUO A;  1Z67 A;  4KT6 A;  1LB2 A;  4ESJ A;  3FXJ A;  4GYI A;  3SDG A;  1ETQ A;  1D8K A;  3C1D A;  1FSE A;  1WGX A;  1N25 A;  5EG0 B;  4B47 A;  3QP6 A;  5D4R A;  2X0L A;  1V5F A;  1KU9 A;  4YIF A;  5CPR B;  3SQN A;  1S3J A;  2JN6 A;  3VYR B;  4XLP F;  5BPD A;  4ZYE A;  3N97 A;  3PNY A;  4UB8 C;  3M4O J;  1A6Q A;  4HLY A;  2JQ7 A;  2R4G A;  5L3B A;  1FP1 D;  2HYF A;  3G71 I;  2R7U A;  1PVE A;  3PNT A;  3DU5 A;  4BJT A;  4BQQ A;  5D5V B;  3AAF A;  2A69 F;  4MTE A;  1TLH B;  1M1E B;  2CMP A;  2K3F A;  4B4C A;  1ZHF A;  2HPI A;  3QOE A;  4CIC A;  2BVL A;  3ISP A;  4I02 A;  1EH8 A;  2GXB A;  1MNE A;  4XOT A;  4B1R A;  2VKD A;  1Y39 A;  5BQT A;  3KP2 A;  5F27 A;  1YG2 A;  4C3J J;  3VYS B;  4RAZ A;  2M1B A;  2QCO A;  1WPK A;  4I01 A;  1T38 A;  3CF2 A;  3JRC A;  2H09 A;  2WAQ N;  2M8G X;  1BIA A;  2XRN A;  1R58 A;  2V9K A;  4G8X A;  4P1W A;  1ETW A;  4XLC A;  5H6Q A;  2BXZ A;  2P0W A;  2GBY A;  4O3M A;  1YQA A;  2B0L A;  4EJV A;  1XTA A;  1TWG J;  1X4P A;  3F8F A;  4N9H A;  2L2O A;  5E1X A;  4RBO A;  3A0B C;  4QPQ A;  2Q2E A;  3I53 A;  2V26 A;  1LE8 A;  3M1C A;  1LE8 B;  4E70 A;  3E6C C;  1R1T A;  4OOI A;  1F5T A;  4IQJ A;  2OAZ A;  4OMZ A;  5M5X J;  3H3U A;  2HTJ A;  2K86 A;  2EA2 A;  2ICW G;  2LSO A;  1W0T A;  4KDP A;  3JRD A;  2F4I A;  4U0V A;  3O8H A;  1IGN A;  4Q47 A;  4U0W A;  2KHM A;  4M3F A;  1QZY A;  1REP C;  2UXX A;  1SEU A;  1NK2 P;  3HUG A;  4LIV A;  3HUG B;  1HCR A;  1W36 D;  5L3G A;  4LMY A;  3OS1 A;  2X9D A;  3H0G J;  2MLG A;  2LBF A;  5M5Y J;  4IXA A;  3EPZ A;  4A5M A;  2H1L A;  5ERI A;  2HQR A;  5HS9 A;  1YJW I;  1KZH A;  2IGO A;  3RPQ A;  4AIK A;  3RYR A;  4MQ9 F;  2WY8 Q;  2CFX A;  3R60 A;  3LSG A;  3VPR A;  1RRJ A;  1P4W A;  2PJR A;  3TO6 A;  2PJR B;  2FBI A;  5ILV A;  2YU3 A;  4L0Z B;  1W5C C;  3IRQ A;  3S14 J;  4IOA F;  2BZT A;  2LMD A;  2EIL H;  5DCF A;  2E1C A;  3GVA A;  4I7H A;  2X1D A;  1YTY A;  5ILU A;  3FKJ A;  1KQ9 A;  1GXP A;  5LRR A;  3RIR A;  3IP4 B;  1XSV A;  2FXA A;  4XR6 A;  2H6B A;  3OYD A;  3KZI C;  1OCR H;  3WG9 A;  4UVB A;  1T2K A;  3EDP A;  3OYC A;  4LG3 A;  3QOP A;  1HQC A;  3MQ0 A;  4PK4 A;  1FLI A;  2LTP A;  2Z3Y A;  2TCT A;  5J1R A;  5HOO A;  2E19 A;  4G6D A;  4AUX A;  2W24 A;  4CYC A;  4CYC B;  4GYG A;  2NOG A;  5BNG A;  3PQJ A;  3CLO A;  2ZSI B;  2PX9 A;  4BBR J;  3BR0 A;  3LSP A;  1B6A A;  3HRM A;  3ELK A;  1R71 A;  1WRJ A;  1VND A;  2ECB A;  2FD5 A;  3H0D A;  1TT5 B;  2FRH A;  5IOZ A;  1OYI A;  2DDB A;  2K9M A;  4N9I A;  4E7S A;  1BOB A;  4EJT A;  4JBA A;  2FX0 A;  4XRS A;  3CQZ J;  5E1W A;  1R5I D;  4BHB A;  5D8K B;  4XBF A;  2P5K A;  1FTZ A;  3GLL A;  3QOD A;  5E3O A;  3D5R C;  1HKQ A;  3E6M A;  3I4P A;  4P96 A;  2IS4 A;  1QZE A;  4FAS D;  2JMW A;  3K6G A;  2OD5 A;  5J3L A;  1N75 A;  2HKO A;  5D6E A;  2FNA A;  2L02 A;  3K4J A;  1FOX A;  3OYG A;  2L4A A;  3BJO A;  1UHW A;  3FBN B;  3RKQ A;  2R92 J;  2EPF A;  3G2B A;  2NOJ B;  2IT0 A;  1XGS A;  2VKH A;  3J80 Z;  2IGM A;  2R5Y A;  4ASN A;  2R5Y B;  5CVU A;  4EM1 A;  2VXD A;  2YX4 A;  2WTE A;  4HLX A;  2NNN A;  3FMR A;  2VB6 A;  2QA4 I;  4AID A;  2AHQ A;  5DM6 F;  3E6B A;  4AIH A;  4XLN F;  5D5W B;  1JUM A;  2QEN A;  1ULY A;  2XUB A;  4Q4Z F;  3TW6 A;  3ABK H;  3RPU D;  1R1U A;  1Z0X A;  3BR5 A;  2Y69 H;  5JVG F;  5C4J J;  5GTI C;  2LOO A;  2MFZ A;  4ZYG A;  1BIB A;  3GXO A;  4XKB A;  3WOD F;  4RB3 C;  4IHY A;  2LY1 A;  4BAC A;  3WHC A;  4AVZ A;  2O8X A;  2XC7 A;  1VQL I;  1X1C A;  2HU9 A;  1X1B A;  4G12 A;  2HI3 A;  3C2B A;  5AIP A;  5HS8 A;  4L5J A;  1YO5 C;  4BYY A;  4HST A;  4LK0 F;  1OCT C;  2LK2 A;  1QHH D;  2L9S A;  4XIC A;  2W1O A;  3FM5 A;  3CUQ C;  2VI6 A;  4E6K G;  4C2U A;  1XGN A;  3U1D A;  3CUQ B;  3DLL F;  3QP5 A;  2FOK A;  5DS9 A;  2DOD A;  4HG2 A;  5LEK A;  3QU6 A;  4RB2 C;  4IPA A;  4FE4 A;  1I6X A;  3U21 A;  1RR8 C;  3V7C A;  2V4J C;  1MBH A;  1H9G A;  2MAB A;  2DCE A;  3GF2 A;  5KAF C;  2G7U A;  1R4M B;  1RET A;  2P81 A;  3HPG A;  4BU2 A;  3GFM A;  4Z6Y A;  2Y30 A;  4F52 A;  2XIG A;  4PSX A;  2VQL A;  1IO2 A;  1BN5 A;  2CRG A;  2JJ7 A;  3NRV A;  4RGX A;  4E4H A;  5LFA A;  1IXS B;  2VIX A;  2G9W A;  5D6F A;  3LSI A;  3PSI A;  5HLI A;  4OIP F;  3P9K A;  2O6G E;  4IRH A;  3DXJ F;  3CC2 I;  1ZRC A;  4A0X A;  1WWX A;  2IGK A;  3MFK A;  4F92 B;  4Z2Y A;  4PJJ A;  1ZRE A;  2DBB A;  1D5Y A;  3K2A A;  1WI9 A;  2KJC A;  3T8T A;  1RUO A;  9ANT A;  4EQQ A;  3FK7 A;  1ACI A;  4A3I J;  1OCC H;  3H5A A;  1ZQ3 P;  4ZYH A;  2HZT A;  3LSJ A;  4XN3 A;  1GUU A;  1X19 A;  1V4R A;  2DA4 A;  2EZH A;  5CVV A;  2D45 A;  1APL C;  4KN4 X;  4XRF A;  2JA8 J;  3OYM A;  1H89 C;  1FTT A;  3EET A;  3BTL A;  2W48 A;  4MFD A;  4OWR B;  1FY7 A;  1I3Q J;  2NAZ A;  1O3S A;  1S7E A;  3HSF A;  1UHS A;  1W5T A;  5TJJ A;  3G73 A;  2WV0 A;  4CZC A;  2XF7 A;  1S7O A;  2VE9 A;  4P9F A;  4BJ6 C;  1B9N A;  3FXM A;  4MQV A;  3GX4 X;  2Y48 A;  3GTJ J;  3CC7 I;  2QSG X;  4CHU A;  2MBF A;  3FDY A;  1FIA A;  3C3W A;  3KEO A;  5K5R A;  4HX7 A;  2GAU A;  4YEL A;  4RGR A;  4I99 C;  3FXK A;  3HEF A;  1X58 A;  3AG2 H;  3HGG A;  4M3G A;  1I50 J;  1R6R A;  2O8K A;  3ZMV A;  4IOC F;  5J1Y A;  1ENH A;  2P7C B;  2FML A;  1BL0 A;  2ADU A;  2IXS A;  4U87 A;  4O6J A;  3UNG C;  2ZCW A;  1FOW A;  3EUA A;  4D7M A;  3WTY C;  1T6S A;  2H8R A;  1RES A;  3F8N A;  4R79 A;  1PDN C;  2P6T A;  1NK3 P;  3ERM A;  3PO3 J;  2LF8 A;  1JJ8 C;  2QEX I;  4II2 A;  1J75 A;  3DKY A;  3K7A J;  3I59 A;  3I59 B;  2R7R A;  2W84 A;  1H9T A;  4XKC A;  4M6V A;  2DMQ A;  4MTD A;  4F55 A;  1AA7 A;  5E20 A;  1K7A A;  5IPA A;  2DQR A;  2XAG A;  2GM4 A;  4D0P A;  3HBL A;  3K4N A;  1BJA A;  1D1B A;  2ZXH A;  5EEG A;  1ZAR A;  4RAF A;  3WTZ A;  1R9T J;  4BXX J;  2YX7 A;  1WJ5 A;  4UV9 A;  1T0F A;  1QGP A;  1IC8 A;  1TWA J;  1YI2 I;  5EJC A;  2FQ4 A;  3GLX A;  1QBJ A;  5GAH J;  2NVT J;  4C2M J;  3GZ6 A;  4Y33 A;  1Y8R B;  3QPL A;  3I0T A;  3VOD A;  4F91 B;  3OYE A;  3ZMS A;  2NS0 A;  3L1P A;  1YHQ I;  3SHF A;  1WH7 A;  4KIF A;  5FKL A;  2ELK A;  3PL8 A;  4OU0 A;  4YFX F;  1JTX A;  2ELH A;  1SFE A;  5ICC A;  1LDD A;  2A68 F;  4PZJ A;  1WFX A;  3KZY A;  2DJN A;  2FF4 A;  5L3F A;  1UB9 A;  4HV5 A;  3PSF A;  2EIM H;  2HQA A;  1WJA A;  1U8R A;  1ZK8 A;  2BBY A;  1BBY A;  2KRH A;  4CYD A;  5K5O A;  1A04 A;  2M4K A;  2BW3 A;  3BZK A;  1UAA A;  2BW3 B;  4WXD A;  1PUF B;  3L2R A;  1T56 A;  2VQH A;  3BG7 A;  5K7Z A;  3LSM A;  4BBS J;  1MGT A;  2O3F A;  2MG4 A;  1JUS A;  1U5T C;  3BTC A;  3K0L A;  2CUJ A;  4XN0 A;  1U5T A;  2ZNY A;  1U5T B;  2BEO A;  5EEH A;  2V1N A;  3O8G A;  1IDY A;  2HYJ A;  3SDB A;  2DA3 A;  4EJW A;  3ABM H;  5IT3 A;  1SMY F;  2YUS A;  5FRN A;  2K9L A;  3FF5 A;  1K6Y A;  1I6H J;  1NG7 A;  1MBF A;  4KN7 X;  3L09 A;  5KNL A;  2LC2 A;  3KPH A;  2STW A;  2QUF A;  2FU4 A;  2BY1 A;  1EH7 A;  3LSH A;  3MD2 A;  1OKR A;  5FD6 A;  3SEQ A;  3CO7 C;  3RKX A;  5AON A;  3HM5 A;  2OCE A;  2XF5 A;  4BY7 J;  3ZQH A;  1HKS A;  2VOO A;  1KGS A;  3BWG A;  5FGM A;  2EBI A;  4FX0 A;  4M6X A;  3KEY A;  3L2Q A;  2H8W A;  2E1N A;  4ESB A;  5JHU A;  4HNU A;  3CJN A;  5CKT A;  2R7T A;  4A3J J;  3CJT B;  2X1C A;  2LG4 A;  1G8X A;  2XRL A;  4J00 A;  3BR2 A;  3P5J A;  5B3S H;  4HPQ A;  4F3Q A;  5HDK A;  2F5E A;  3E5Q A;  1BC8 C;  5JLX A;  4FCY A;  2OCC H;  1LPQ A;  5D8L B;  2VPR A;  5B1B H;  2E60 A;  3U2R A;  3VWB A;  2CUE A;  3SFZ A;  4RM3 A;  5F1R A;  4JYK A;  3GWZ A;  2NVX J;  1VQO I;  4UB6 C;  5E8I A;  3E97 A;  3O2P E;  2DMP A;  4A12 A;  1UST A;  1ZG3 A;  1W7P B;  4FIS A;  1BM9 A;  2QM3 A;  3CCR I;  5ICE A;  2XAQ A;  2N8G A;  4FHT A;  2IS6 A;  1I1G A;  3ABT A;  2R5Z A;  1IF1 A;  2R5Z B;  3Q0W A;  1Z3X A;  2M34 A;  4RGS A;  3VOE A;  1LUJ B;  4HBL A;  1DGW Y;  3ASN H;  2V9P A;  2OBP A;  3Q5F A;  2CW0 F;  2UUZ A;  3K69 A;  3ZQG A;  2KQR A;  3CTA A;  1SFX A;  1O57 A;  3ABL H;  1FT9 A;  2JSC A;  3D0S A;  2EIJ H;  2XV4 S;  3F22 A;  3GME A;  4I0A A;  3IV5 A;  1NHA A;  2CUF A;  2G0E A;  3R0J A;  2BHY A;  3TO7 A;  5E3N A;  4G7H F;  3F8M A;  3TW7 A;  2LY9 A;  1TW3 A;  1J09 A;  5J40 A;  2E71 A;  4M9S A;  3CZ6 A;  1VQ6 I;  3UR3 C;  2AQE A;  3D5L A;  1L3L A;  3FXU A;  1LEB A;  1QPI A;  4A3L J;  1HW5 A;  5CVJ A;  4UVA A;  2JUC A;  2ZXJ A;  2ESH A;  4ZZL A;  2DOA A;  3EUK L;  2CG4 A;  4AD9 A;  3E5X A;  5FKN A;  4WCG A;  2XKO A;  5LGU A;  3OYB A;  2ZKZ A;  1POG A;  2LY2 A;  2XHK A;  4FE7 A;  2XGC A;  3DP7 A;  1GV2 A;  3ML6 A;  3BTJ A;  4LB5 A;  1KYZ A;  1HXD A;  2ZJP F;  2A6E F;  1A35 A;  4KJZ A;  1LDJ A;  4L9N A;  1E0E A;  2LKX A;  2GQQ A;  1JHH A;  1HW1 A;  2DOF A;  2XVC A;  2UZK A;  1IZ1 A;  4KMF A;  1FMW A;  1XSD A;  2BYV E;  1W36 C;  2EFP A;  1U9N A;  5D5U B;  1YOV B;  3VYT B;  4C3I J;  3S1R J;  4W97 A;  4YII A;  2PMZ A;  3SYT A;  1FSH A;  3DTK A;  3LAP A;  4M3B A;  4K2E A;  2JA7 J;  2QKM B;  2EK5 A;  3K9T A;  3LSR A;  3FKI J;  2EFN A;  2VOP A;  2OC6 A;  5KK1 A;  3GYH X;  1WI3 A;  2FMY A;  2HVQ A;  3M7G A;  3PM1 A;  2NVY J;  2VLA A;  4II3 A;  1EJ9 A;  1D5V A;  4FT8 A;  3FXO A;  2A05 A;  4BNC A;  2VKE A;  1ZGA A;  3BCA A;  3FXL A;  4GGG A;  4IL6 C;  4CCN A;  4ANJ A;  3B02 A;  3G6E I;  1TZL A;  3DWL E;  3I64 A;  4CDG A;  2IS1 A;  2QGU A;  1B72 A;  3H9J A;  1VQ9 I;  1B72 B;  3J7A O;  3CCE I;  3K4K A;  5BPI A;  1O3R A;  1T95 A;  3HC7 A;  2DT7 B;  4OMY A;  1Y0N A;  3KP7 A;  1SFK A;  5GTH C;  4PSW A;  3FXQ A;  3JAM K;  3HRS A;  1Z91 A;  5EG0 A;  1EV7 A;  3N4M A;  1LFU P;  1IUF A;  4DNC A;  3KP5 A;  5J47 A;  2NVU B;  4IRG A;  2ME0 A;  3OL4 A;  3DPU A;  2ISY A;  1LKX A;  3ZQC A;  2DQL A;  1ZRF A;  2VXZ A;  4ENN A;  4PUS A;  1W7P D;  4OIR F;  4AC0 A;  3HRU A;  2CQQ A;  4KFC A;  4D7N A;  1FBS A;  1SAU A;  2EIN H;  3ZQI A;  2W4S A;  1FOK A;  2EQR A;  4KYW A;  2MLK A;  4CCK A;  2DMT A;  3BR6 A;  2QQA A;  1JUP A;  4UY8 I;  3JTG A;  5F6F A;  4N0B A;  5BS6 A;  4A3F J;  2WY7 Q;  1X2M A;  2JWT A;  5ILS A;  4WXC A;  1XS9 A;  3M3Y J;  4F93 B;  1QHG A;  4EM0 B;  4MEY F;  3IHU A;  3S17 J;  2XSJ C;  4XRS G;  2A6T A;  4YG2 F;  4G9Y A;  4BAY A;  3WE3 A;  3FHN A;  4BUP A;  4CCM A;  5FJ8 J;  3PFI A;  5EGO A;  4JK1 X;  4S0H B;  5EGO B;  4EGY A;  1F1Z A;  2E2J J;  4OAY A;  3NAR A;  2FBH A;  1HOM A;  1KQ0 A;  4QIW N;  1EH6 A;  3J7Z I;  2VL8 A;  4ZYD A;  3MZY A;  4NC6 A;  3MZH A;  3S16 J;  1G3W A;  2F5D A;  3BC8 A;  2OPT A;  1ORK A;  4HW0 A;  4M72 A;  1MBK A;  3K4C A;  1FYK A;  4RMN A;  2X6Y A;  2FNP A;  1S29 A;  3CCY A;  5CQG A;  3ABU A;  3BR1 A;  1YIO A;  2HZD A;  2XPV A;  3RPU A;  2Z5U A;  4QSH A;  1LEA A;  3WE2 A;  1ZEL A;  1TTY A;  4NQW A;  2VJJ A;  4NQW B;  3JRG A;  4EVI A;  2EFQ A;  4IHX A;  2M2E A;  1OCP A;  4A3B J;  1D0X A;  3CJR B;  1VZ0 A;  2QF7 A;  3FK6 A;  4RLF A;  4XLA A;  3GTG J;  3IAM 2;  1XMK A;  3GBG A;  3T0Y A;  1MIJ A;  2KIF A;  3HOW J;  2BY3 A;  3QYF A;  4RAG A;  3WHB A;  1ON1 A;  1FNN A;  1KON A;  5KHD A;  1LQ1 A;  1R23 A;  2BV6 A;  3I71 A;  2MGQ A;  4Y15 A;  4AWX B;  4NUB A;  1MKM A;  1MJB A;  2DA5 A;  4MIM A;  1IV6 A;  1BW6 A;  2Y0S A;  4LLL A;  2Y31 A;  2QZ8 A;  4MLO A;  3S3N A;  5M3F J;  4P55 A;  3CLQ A;  1CGP A;  3DBR B;  4HAM A;  3SZT A;  3PUF A;  1F43 A;  3BLY A;  5IP9 J;  4OAZ A;  2W25 A;  2BE5 F;  2C6Y A;  1T8I A;  1ZG5 A;  1KA8 A;  2RDP A;  5J4Y A;  2YPR A;  3OOP A;  1ETV A;  2DFI A;  2F4M B;  1MMA A;  1R5G A;  4HA8 A;  3CF5 F;  1I39 A;  4B44 A;  2KZG A;  5E3L A;  1SD5 A;  5FFX A;  1PYV A;  1XC5 A;  1OQY A;  1XSX A;  3HIF A;  2H27 A;  1IV8 A;  2L54 A;  2XPW A;  2PMU A;  1K4S A;  4DW6 A;  3AFH A;  2EWN A;  2A5W A;  2X85 A;  3M8E A;  3I56 I;  3IWZ A;  2F5C A;  3JW4 A;  1ETK A;  5FKO A;  2CGP A;  2RGV A;  3OYA A;  1HDP A;  1G3S A;  2X6W A;  1S8N A;  1I5Z A;  1WCM J;  2R7Q A;  2UWM A;  5C3E J;  3S1N J;  2G7H A;  3VEP A;  5A2Q K;  3L2U A;  2DDA A;  2X51 A;  2HXI A;  1R1V A;  1DQU A;  2CW8 A;  3COA C;  3ZRG A;  4CCL A;  4X1E A;  3PIO F;  2VBW A;  3DV8 A;  1MJA A;  2PI0 A;  4HOB A;  2R7V A;  5KCM A;  2F48 A;  4L18 B;  2NVQ J;  1JTY A;  5LHG A;  3D1N I;  3JR9 A;  4B43 A;  1XN7 A;  1XGM A;  3ASO H;  3HOT A;  2OA4 A;  3I54 A;  4NC8 A;  3OIP A;  5CVI A;  4U7B A;  2Z99 A;  1HW2 A;  3H5N A;  5IY5 H;  1U8B A;  3MEX A;  1D1C A;  1BOA A;  4ZC3 A;  3S3O A;  2VPL A;  1LJ9 A;  4A69 C;  5JR3 A;  2M45 A;  2VAS A;  3JRA A;  1RI7 A;  4A3E J;  4H4K C;  3ZQ7 A;  1FOY A;  1Q1V A;  1QNT A;  1XG1 A;  4DZP A;  5E1Z B;  3WU1 B;  3HOU J;  4BE0 A;  2GIZ A;  2UV1 A;  5E3M A;  2AS5 F;  1R5H A;  2GXA A;  2M7A A;  4HQM A;  2I5U A;  3SFI A;  2RAE A;  1STZ A;  2VT2 A;  2GZW A;  2HVS A;  2GOX B;  3RZO J;  4HF0 A;  5B5E C;  1XDU A;  3UKG A;  3PJR A;  4UHT A;  2RV8 A;  3H35 A;  5HVQ C;  2R7W A;  4ETS A;  1OYY A;  3B6C A;  4IVN A;  5DCM B;  1P4X A;  2EJR A;  3DU6 A;  2CFO A;  2DA6 A;  1HDD C;  1DP7 P;  1SFU A;  1UG2 A;  1MH3 A;  1WJF A;  3N05 A;  3WGG A;  5EDN A;  1IAW A;  3LQR A;  2VJI A;  3HPH A;  3JAM Z;  1YYV A;  2RNJ A;  4L0Y B;  1YW7 A;  1X1A A;  4UNO A;  5IYD J;  5LGN A;  3H3V K;  1VQK I;  3CUQ A;  5HLG A;  2VJ5 A;  2DT5 A;  5LLQ A;  2IA2 A;  2J5P A;  5IOY A;  4X6A J;  2IS2 A;  3L2W A;  2M30 A;  3DBL B;  2DYS H;  2PBI A;  2ESN A;  3U1K A;  2K3P A;  2L9R A;  2OTL I;  5FRM A;  5H20 A;  3W2V A;  3V42 A;  3GTQ J;  2DA2 A;  2E7X A;  2IVM A;  4OIN F;  2UXN A;  1JJ6 C;  2LP0 A;  3JSO A;  2XRO A;  4Y17 A;  3G1M A;  1GXQ A;  4CGZ A;  3QRF F;  3GFL A;  2P6S A;  5DEQ A;  3HRT A;  3RKW A;  3Q3S A;  3TMO A;  1IDZ A;  2KPM A;  4DGW B;  2Y75 A;  1BC7 C;  1IN5 A;  1RR7 A;  4BXF A;  1YRN B;  4BL0 B;  2ME6 A;  1UCR A;  4G7Z F;  2HOT A;  5HOD A;  1S6L A;  4UXN A;  5LHH A;  2M4G A;  5DYM A;  4B09 A;  4Q5S F;  4W1U A;  3TGN A;  2JPC A;  2DAO A;  4HX4 A;  1AOY A;  2HDD A;  3S1Q J;  3CCU I;  2H94 A;  2P7V B;  1O3T A;  3EYI A;  3DEW A;  2EIK H;  2DJI A;  2DA1 A;  3GZ5 A;  4MFE A;  2VN2 A;  1JE8 A;  4DYR A;  1OJL A;  5HLT A;  3R61 A;  2CV0 A;  2F5V A;  4JX6 A;  2BY0 A;  4TV7 A;  1XCB A;  4BHC A;  1ZLJ A;  3Q9V A;  4P5O A;  1RUN A;  3LFU A;  2ZFU A;  2YU9 J;  3FHZ A;  2CS3 A;  3CJQ B;  5LGT A;  1IRG A;  3OSF A;  4A3M J;  2WWY A;  2EV0 A;  3ESW B;  4H0E A;  1UHM A;  1XDS A;  2LR8 A;  2HFH A;  1MMD A;  1NTC A;  4DQ2 A;  2JZY A;  4G94 A;  3TDZ C;  5K1Y A;  4WK8 F;  1I27 A;  2P5L C;  4AIJ A;  3KEQ A;  2CW7 A;  2OF7 A;  5IP6 A;  2QVO A;  1SC7 A;  1AU7 A;  4HZF A;  2GXG A;  3CMA I;  1FWZ A;  6PAX A;  4RDU A;  4KT5 C;  4UUS A;  3BRO A;  3VB2 A;  4UUS B;  2V1X A;  3K1N A;  5IYB J;  4XNF A;  1N77 A;  1PP7 U;  4HF2 A;  1RIO H;  4KIG A;  3S2W A;  2ZXI A;  4HX8 A;  3QWL A;  2COB A;  1Z1D A;  2JK3 A;  1U0J A;  3FX3 A;  2WB1 A;  1FIP A;  1Y0U A;  3IKV A;  3ULQ B;  3V7R A;  5LEJ A;  5DUK A;  1CF7 A;  1CF7 B;  5DD4 A;  3IAS 2;  2HNH A;  1Y6I A;  3Q0V A;  1Z6R A;  2Y0S N;  5B66 C;  2VC0 A;  4P9U A;  3J81 K;  2STT A;  3ZGK A;  5HS7 A;  2K40 A;  1YIT I;  3HZJ A;  3I3L A;  2KT0 A;  2MA3 A;  2VON A;  2MH9 A;  1ETY A;  1SD4 A;  1O3Q A;  2HOS A;  3HSR A;  4HF1 A;  3V7S A;  2KJB A;  2DFE A;  2XAH A;  3M9A A;  1K78 A;  1K78 B;  3RJP A;  4M9Z A;  5ED4 A;  2DU9 A;  1O4X A;  2KKO A;  2I10 A;  3NWT A;  4NB5 A;  4R8H A;  4Y4R A;  3RSN A;  4WWC A;  3JRH A;  2O5R A;  4CA0 A;  1BA5 A;  4MGR A;  3S32 A;  2TRT A;  1LFB A;  2QLZ A;  3KLO A;  2D1V A;  4HNV A;  4BQO A;  2R7D A;  2WA0 A;  2V9V A;  1N78 A;  2KRC A;  1Z3Y A;  3ZOB A;  3RKY A;  2VQC A;  2RRE A;  2IBD A;  2OJE D;  2RC4 A;  1JXS A;  2ZFW A;  4CO8 A;  2E2I J;  2W85 A;  1NH3 A;  3R4K A;  1VQ8 I;  5A2Q Z;  1ZKG A;  2W00 A;  1D8J A;  1B9M A;  3DTI A;  1J0R A;  4KIS A;  2K5C A;  1IG7 A;  4HEA 2;  4DBR A;  1GHC A;  1XCV A;  2RQP A;  3MKL A;  4I98 B;  4JQF A;  1ZGW A;  5C4X J;  3PUB A;  5F0C A;  3OR2 C;  2GOM A;  3DLA A;  1J9I A;  2VBX A;  5EZG A;  1ZTR A;  2VKV A;  2LF7 A;  1XB4 A;  1X3Z B;  5GPC A;  1ON2 A;  3KP4 A;  1ETO A;  3DPL C;  4QTR A;  2RNG A;  3EUH C;  3BQY A;  1X3W B;  4V2F A;  3L9F A;  1P4A A;  3JRB A;  2GIV A;  3T1B A;  2L7F P;  2XGX A;  1HA8 A;  2O7O A;  4B48 A;  1PUF A;  5LHI A;  3NWS A;  2H6C A;  3F21 A;  2LYC A;  3J7A Y;  5GAD J;  2CV2 A;  1P7J A;  4C3H J;  3GTK J;  1KYW A;  1U9O A;  1TWH J;  1JHF A;  3CD6 I;  1IW7 F;  3FZV A;  3FWE A;  2CH0 A;  2O03 A;  5GAG J;  2JRT A;  1X2N A;  1JGG A;  4LLN A;  3OYK A;  4PDK A;  2VBY A;  4PGH A;  2EA4 A;  2XAJ A;  1DPR A;  2LDU A;  3C2H A;  1IN7 A;  4LGW A;  1FP2 A;  2WAQ A;  3K4L A;  2JT1 A;  1QO0 D;  2KL4 A;  2AXT C;  1C0W A;  2HDW A;  2FE3 A;  2DA7 A;  1IN6 A;  2O61 A;  3I58 A;  3G1L A;  2Y0M A;  2HS5 A;  4RS8 A;  4IX7 A;  1MJ9 A;  4GCV A;  5J4V A;  2F5F A;  3HHH A;  2HYG D;  1DP3 A;  1B59 A;  4JOM A;  1Y56 A;  1VQ5 I;  3JRI A;  2R0Q C;  3HKZ A;  3GZN B;  3LMM A;  3GTL J;  1KQ8 A;  3QQA A;  4HYE A;  3HTS B;  2DK8 A;  3OV8 A;  3BDD A;  1YX5 A;  2HWV A;  1L0O C;  2DK5 A;  4NC7 A;  4GFB A;  3KZZ A;  2HTS A;  2K85 A;  2HDC A;  2QQB A;  4BGD A;  1IRF A;  1W0U A;  1OMI A;  2DFF A;  4UUV A;  4XQF A;  2QKL B;  3QYE A;  4EEF G;  1TWC J;  3WTV C;  2HQ5 A;  3A0H C;  2PEX A;  1VF9 A;  1W7P A;  2X4H A;  4PFP A;  3PFY A;  2Z16 A;  2E35 A;  1F36 A;  4LG0 A;  4AYB A;  5GAE J;  2EH3 A;  2ETH A;  3CME I;  4LG0 B;  3KLN A;  3L7W A;  3E5U A;  2I8D A;  4S04 A;  1V55 H;  2HXO A;  3CDI A;  1Y1W J;  5H2F C;  4OIQ F;  3GTO J;  2HOA A;  2K27 A;  4CSW A;  1TT0 A;  2XF6 A;  2OZ6 A;  5JFR A;  1TP4 A;  2Q8K A;  1R49 A;  1SD7 A;  1ZN2 A;  2PN6 A;  4ENK A;  5FB2 A;  4KIB A;  3BQZ A; 
#chains in the Genus database with same CATH homology
 4S0H B;  5EGO B;  5FLM J;  3S2H J;  2E2J J;  2AHQ A;  3NAR A;  3RQI A;  1JKP C;  1HOM A;  4QIW N;  1A5J A;  4A93 J;  2R7Z J;  1JUM A;  2DMN A;  3CMY A;  3S16 J;  1VFC A;  3TW6 A;  2OPT A;  3HOV J;  1ORK A;  1Z0X A;  3A02 A;  1MBK A;  3BR5 A;  1GT0 C;  2K9N A;  3CCY A;  5C4J J;  3BR1 A;  3BR3 A;  3HB9 A;  2XPV A;  4QSH A;  1SFO J;  4IHY A;  3WHC A;  1JKR C;  3JRG A;  5IP7 J;  4J19 A;  2L7Z A;  2X48 A;  4G12 A;  4IHX A;  2M2E A;  1OCP A;  2HI3 A;  5EEA A;  4L5E A;  4A3B J;  4V2G A;  3C2B A;  2QF7 A;  1EF4 A;  3FK6 A;  2K9Q A;  3G1O A;  4A3K J;  1OCT C;  2LK2 A;  3GTG J;  3GBG A;  4XIC A;  2M9H A;  3LOC A;  3HOW J;  3WHB A;  2VI6 A;  2CQX A;  3GTP J;  2MGQ A;  5DS9 A;  2DA5 A;  4MIM A;  1IV6 A;  1BW6 A;  3JRF A;  4M3D A;  1WH5 A;  2Y31 A;  4FE4 A;  2DTZ A;  1MBH A;  4MLO A;  1DU0 A;  5M3F J;  5FKK A;  1RPW A;  1RET A;  1F43 A;  2P81 A;  3ZQF A;  1P7I A;  2Y30 A;  3QPS A;  5IP9 J;  2CRG A;  2JJ7 A;  2MW8 A;  3F0C A;  1OFC X;  1ETV A;  3I4N J;  4I76 A;  2XB0 X;  1AHD P;  5E3L A;  5F1J A;  1XC5 A;  3W6V A;  2VUM J;  3A03 A;  3SJM A;  1TC3 C;  1D5Y A;  3K2A A;  3TP0 A;  1GDT A;  1E3O C;  1IJW C;  4A3D J;  2XPW A;  4IEJ A;  9ANT A;  3BTI A;  3FK7 A;  1T33 A;  4DW6 A;  4JX4 A;  4A3I J;  1SAN A;  3HOY J;  1ETK A;  5FKO A;  5EYR A;  1ZQ3 P;  1HDP A;  5J1U A;  5GP9 A;  3LSJ A;  5F08 A;  1GUU A;  2DA4 A;  1WCM J;  1APL C;  2EZH A;  5F0H A;  1QRY A;  5C3E J;  3TP3 A;  2JA8 J;  1H89 C;  3S1N J;  1FTT A;  3BTL A;  3CDL A;  4A3C J;  1RKW A;  2W48 A;  4JP0 A;  4MFD A;  1MSE C;  1I3Q J;  1S7E A;  1UHS A;  2HXI A;  1ZR2 A;  4X1E A;  2L7M P;  4UUT A;  3RZD J;  4DYC A;  2NVQ J;  1JTY A;  3HOX J;  3D1N I;  3JR9 A;  1TWF J;  1ZR4 A;  5M5W J;  2ZB9 A;  3GTJ J;  2DN0 A;  3LNQ A;  1U8B A;  1FIA A;  2FJ1 A;  3FIW A;  4A69 C;  3A01 A;  3HEF A;  1X58 A;  3A01 B;  3HGG A;  4M3G A;  1I50 J;  2O8K A;  3I4M J;  5J1Y A;  1ENH A;  1MH4 A;  5IYC J;  3JRA A;  4XRM A;  4BY1 J;  4A3E J;  1BL0 A;  2E2H J;  4IHW A;  1Q1V A;  1XG1 A;  4DZP A;  3HOU J;  2H8R A;  2NS7 A;  4D7M A;  1RES A;  2ID3 A;  4DZJ A;  5K7H A;  5E3M A;  4I6Z A;  3HOZ J;  2Y9Z A;  1NK3 P;  2L0K A;  3PO3 J;  1G2H A;  4D5F A;  3MVP A;  3SFI A;  2RAE A;  1JJ8 C;  3K7A J;  3RZO J;  3UKG A;  4M6V A;  2GLO A;  2DMQ A;  3S1M J;  5IPA A;  2X6O A;  2GM4 A;  1Y1V J;  3B6C A;  5EF6 A;  3HBL A;  3PO2 J;  5FKM A;  1QVU A;  2DA6 A;  1R9T J;  4BXX J;  1HDD C;  1UG2 A;  1MH3 A;  1IC8 A;  5EDN A;  1TWA J;  2FQ4 A;  1FEX A;  3FIS A;  2NVT J;  1RKT A;  3OIO A;  4C2M J;  3S15 J;  5IYD J;  2XPU A;  1A6I A;  3H3V K;  3QPL A;  3HKZ N;  4Y52 J;  1K83 J;  3L1P A;  2Y2Z A;  5JLW A;  4IHV A;  1WH7 A;  5IOY A;  5FKL A;  4X6A J;  2ELK A;  2Y9Y A;  1JTX A;  4BKX A;  2L9R A;  5F04 A;  1H8A C;  3GTQ J;  2DA2 A;  2NS8 A;  4M3E A;  4MO7 A;  1JJ6 C;  2LP0 A;  2DJN A;  3G1M A;  1ITY A;  3OSG A;  4D5C A;  1ZK8 A;  3Q3S A;  1IDZ A;  2ECC A;  2WB1 N;  1MBE A;  1PUF B;  1RR7 A;  1YRN B;  2DMU A;  4AYB N;  1H88 C;  2ME6 A;  1T56 A;  5HOD A;  2HOT A;  2IEK A;  5F0F A;  5K7Z A;  2XB5 A;  4W1U A;  4BBS J;  4JX5 A;  2MG4 A;  2HDD A;  1BW5 A;  1JUS A;  3BTC A;  3S1Q J;  2AO9 A;  1MNM C;  2EZL A;  1K61 A;  3DCF A;  3DEW A;  3O8G A;  2H1K A;  1IDY A;  2DA1 A;  2HYJ A;  4MFE A;  2DA3 A;  4DYR A;  1OJL A;  3BG3 A;  3IH4 A;  4JX6 A;  2YUS A;  3ZQL A;  2ID6 A;  1I6H J;  5M3M J;  1MBF A;  2YU9 J;  5EZH A;  4XK4 A;  2CU7 A;  3HGY A;  3HM5 A;  4BY7 J;  2LFB A;  3ZQH A;  1HLV A;  1MBG A;  2LLK A;  3OSF A;  4A3G J;  4A3M J;  2EBI A;  5C44 J;  2LR8 A;  3SDG A;  1Z77 A;  1ETQ A;  1NTC A;  4A3J J;  1WGX A;  5EG0 B;  4NDL A;  1B8I A;  2OF7 A;  1B8I B;  2XRL A;  5IP6 A;  1AU7 A;  1JT0 A;  2JN6 A;  3BR2 A;  2O9L A;  4RDU A;  4UUS A;  4UUS B;  3M4O J;  2D5V A;  5JLX A;  5IYB J;  4FCY A;  2IAI A;  2MSY A;  2VPR A;  2CUE A;  1UMQ A;  4JYK A;  2NVX J;  2DMP A;  3GTM J;  2COB A;  2JK3 A;  4FIS A;  1FIP A;  2EZI A;  2N8G A;  5K7F A;  4B4C A;  2R5Z A;  3Q0V A;  2R5Z B;  3Q0W A;  2PMZ N;  2Y0S N;  3TED A;  2M34 A;  3BG9 A;  2LVS A;  2K40 A;  4B1R A;  1GVD A;  3ZQG A;  2KT0 A;  5F27 A;  4C3J J;  1ETY A;  2HOS A;  2EZK A;  2XGE A;  2LD5 A;  2QCO A;  5GPA A;  1WPK A;  3JRC A;  3IV5 A;  1O4X A;  1CQT A;  2G0E A;  2CUF A;  2I10 A;  2M8G X;  2WAQ N;  3JRH A;  5E3N A;  1ETX A;  3TW7 A;  1BA5 A;  2LY9 A;  1ETW A;  2TRT A;  1LFB A;  2GBY A;  4HNV A;  1QPI A;  4A3L J;  1TWG J;  3ZOB A;  4RBO A;  2IBD A;  3OOU A;  2E2I J;  1HF0 A;  1LE8 A;  1LE8 B;  1ZKG A;  2XGD A;  2K9S A;  5FKN A;  1IG7 A;  5M5X J;  1U78 A;  3MKL A;  1POG A;  1ZGW A;  3MN2 A;  1W0T A;  4FE7 A;  5C4X J;  3BG5 A;  5F0C A;  3JRD A;  2XGC A;  3O8H A;  1GV2 A;  1IGN A;  5EZG A;  3BTJ A;  1ZTR A;  2VKV A;  4M3F A;  3HDD A;  3Q0U A;  1NK2 P;  5GPC A;  1HCR A;  2LKX A;  1ETO A;  4QTR A;  2X9D A;  3H0G J;  3BQY A;  5M5Y J;  4V2F A;  3E7L A;  3JRB A;  2L7F P;  1U9N A;  3S1R J;  4C3I J;  2O7O A;  1PUF A;  4W97 A;  1YRN A;  3VPR A;  3LSG A;  1P7J A;  4C3H J;  4M3B A;  3GTK J;  1U9O A;  1TWH J;  2JA7 J;  3S14 J;  2KDZ A;  4LOC A;  3LSR A;  3FKI J;  3IH2 A;  1X2N A;  1JGG A;  1WI3 A;  3PM1 A;  2NVY J;  2M0C A;  2VKE A;  2B63 J;  2XSD C;  2DA7 A;  4B3A A;  4FTH A;  4XID A;  1MBJ A;  3G1L A;  1JKO C;  2R93 J;  1VI0 A;  3JRE A;  2LTP A;  5J1R A;  2TCT A;  1B72 A;  1B72 B;  2WV1 A;  2E19 A;  4AUX A;  4CYC A;  4CYC B;  3JRI A;  2R0Q C;  1JKQ C;  2NOG A;  5BNG A;  3GTL J;  3QQA A;  4BBR J;  3BR0 A;  3LSP A;  5EG0 A;  1JT6 A;  4GFB A;  1LFU P;  1IUF A;  1VND A;  5FLV A;  2ECB A;  2FD5 A;  1FJL A;  2ME0 A;  3ZQC A;  3NAU A;  5IOZ A;  1QVT A;  3BT9 A;  1W0U A;  4DYQ A;  4AC0 A;  3B6A A;  4EEF G;  3S2D J;  2FX0 A;  1TWC J;  2CQQ A;  2HQ5 A;  4XRS A;  3CQZ J;  2JA6 J;  2JA5 J;  5DTD A;  4D7N A;  3IH3 A;  1FTZ A;  1VF9 A;  3ZQI A;  2EQR A;  1IRZ A;  5E3O A;  1F36 A;  2DMT A;  2EH3 A;  4Y7N J;  2JMW A;  5J3L A;  1GV5 A;  3BR6 A;  1JUP A;  4ABZ A;  1BJZ A;  5EGO A;  1AKH A;  1AKH B;  4A3F J;  2HXO A;  1X2M A;  2JWT A;  3RKQ A;  1Y1W J;  2YS9 A;  1XS9 A;  2R92 J;  3M3Y J;  3GTO J;  2HOA A;  2E1O A;  3S17 J;  4XRS G;  2R5Y A;  2R5Y B;  1MSF C;  2CJJ A;  5FJ8 J;  1DU6 A;  3BQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...