2L0RA

Conformational dynamics of the anthrax lethal factor catalytic center
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
b'GSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal factor
publication title Conformational dynamics of the anthrax lethal factor catalytic center.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase,toxin
total genus 35
structure length 106
sequence length 106
ec nomenclature ec 3.4.24.83: Anthrax lethal factor endopeptidase.
pdb deposition date 2010-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2l0rA00
2W13A 4XBHA 3EHXA 1QIBA 1XUCA 2OXWA 5D2BA 4JPAA 1GE5A 4GQLA 1HV5A 3KHIA 1GKDA 4GUYA 1KAPP 4JIJA 1ATLA 1H71P 1XURA 1QICA 3L0VA 5CUHA 2DDFA 5L79A 1RMZA 1EB6A 3Q2GA 1JKYA 1YP1A 3DPEA 1IAAA 3K7LA 3LK8A 1CGFA 1YQYA 2WO8A 1KBCA 1BIWA 3LIKA 1O0QA 5I12A 4XCTA 1BKCI 3KEKA 1PWQA 2V4BA 3ELMA 3LJGA 1C3IA 3O2XA 2Z2DA 1I73A 1MMQA 2AIGP 3F16A 3G5CA 5D1SA 3HDBA 1D8FA 1GO8P 2E2DA 1HFCA 5I4OA 2ERPA 3TT4A 1XFXA 4PKWA 4DPEA 2YIGA 3HDAP 4ZR5A 1D7XA 3HBVP 3DL1A 3LQ0A 3EDZA 1JJ9A 2SRTA 3O64A 2MZIA 1OS2A 3CKIA 1CXVA 2D1OA 1KUFA 3KRYA 2X3BA 4GWNA 2FV9A 3LUMA 1ZXVA 3Q2HA 4XM8A 3USNA 1PWWA 1R1JA 3KECA 1USNA 4GR8A 4J4MA 1G9KA 1JAQA 5D7WA 1Y8JA 1JIWP 3B2ZA 2MZEA 3LILA 4DF9A 1SMPA 3LEAA 3F15A 4FXYP 4AXQA 5I43A 2W0DA 1B8YA 1CGLA 2OI0A 5D1UA 5BOTA 4H84A 2O3EA 1QJJA 3EHYA 2N8RA 1JK3A 2W14A 1MMBA 1OM6A 3LJTA 1XFUA 3ZVSA 4CTHA 3ZUKA 1R54A 2OY2A 3UVCA 2TCLA 1BKCA 2J0TA 3EDHA 3N2UA 1CQRA 1Y93A 1JH1A 1D5JA 1QIAA 1OM7A 1XFZA 4GR3A 1I1IP 3AYUA 3F18A 3LQBA 2OZRA 1ZVXA 3LIRA 3U1RA 830CA 4PKQA 1OS9A 3B8ZA 1RM8A 4JP4A 1KUHA 4DV8A 5L7FA 1FLSA 2MZHA 3K7NA 1IACA 2JNPA 4Q1LA 2JT6A 2J83A 4L19A 1G12A 1D8MA 1K7QA 3HY7A 2OVZA 1XFWA 3MA2A 4GR0A 3BA0A 3ZXHA 3EDGA 1G49A 3HYGA 1IAGA 4PKRA 4WZVA 2AYKA 1R1IA 1MMPA 2X3AA 1YOUA 1FM1A 3F19A 2OW2A 3AYKA 4H1QA 3P1VA 1IADA 2MLSA 3LMCA 4AYKA 3KEJA 1L6JA 1WNIA 1XUDA 2MLRA 3L0TA 1SATA 1SRPA 2ERQA 4FU4A 966CA 1XFYA 2DW2A 3I7GA 4ON1A 1SU3A 2RJPA 4H49A 1AKLA 1C8TA 4WKIA 1XFVA 1G4KA 2JIHA 2OW0A 5CXAA 4AUOA 5CZMA 3HBUP 1ZTQA 1BQQM 1S4BP 3E8RA 3KMEA 1QJIA 4WKEA 2L0RA 3LGPA 1UMTA 1JIZA 4H76A 5I3MA 1GE7A 1OM8A 3LUNA 3F1AA 1G05A 2DW1A 4HMAA 4PKSA 1C7KA 3V96B 4R3VA 1FBLA 2Y6DA 1DMTA 4H82A 2OXUA 2OY4A 1DTHA 2K9CA 3EWJA 1BQOA 1KUIA 4PKTA 1BM6A 4IJOA 3WV2A 2I47A 2YB9A 5BOYA 4QKZA 1A85A 3WV3A 5B5PA 3TVCA 1JAPA 1ZS0A 1MMRA 3VTGA 1EAKA 4H2EA 5H8XA 1BUDA 2QPJA 1CAQA 1JAOA 1IAEA 1PWPA 3KMCA 4WF6A 1GXDA 4FVLA 1UEAA 1KUKA 1K7GA 1ND1A 3SHIA 1R1HA 2RJQA 1K7IA 3VI1A 4L63A 4I35A 2W12A 2DW0A 5JMYA 1O0TA 5LABA 4JQGA 4IN9A 1CK7A 1IABA 1HFSA 1ROSA 4I03A 1Z3JA 2OVXA 2OW1A 2WO9A 1AYKA 4L6TA 2JT5A 1SLMA 3WV1A 2USNA 4DD8A 1I76A 1QUAA 3LE9A 2OW9A 3TSKA 1MNCA 2CKIA 1CIZA 1SLNA 3F17A 2JSDA 1GO7P 2X7MA 1PWUA 4GF1A 3AIGA 1HY7A 2W15A 4G0DA 4XM6A 4A7BA 3N2VA 1HOVA 5I0LA 1GKCA 3DPFA 1CGEA 5B5OA 5I2ZA 4PKUA 2XS3A 3G42A 2K2GA 2EROA 3HY9A 3OHOA 4FXQA 3EDIA 3DWBA 1OMJA 4IUWA 1B3DA 1Y0VA 1J7NA 3GBOA 1A86A 5D3CA 2FV5A 1ZP5A 4WK7A 3LJZA 2X3CA 2CLTA 2E3XA 2OXZA 3I7IA 1Q3AA 1PWVA 1R55A 1EUBA 3B92A 1BUVM 1KUGA 1YCMA 3RTTA 2XS4A 4G9LA 1GE6A 4PKVA 2KRJA 4XM7A 2D1NA 4H3XA 2HU6A 1AF0A 2PJTA 1BSWA 2O36A 3TS4A 4EFSA 1JANA 2Y6CA 2DDYA 1UTTA 4H30A 4AIGA 1ASTA 1UMSA 1UTZA 3KWVC 3LKAA 1HTDA 4HX3A 4GWMA 3HB2P 3P24A 4A3WA 2POJA 3DSLA 3DNGA 2WOAA 1BZSA 1BKCE 2A8HA 5D1TA 4JA1A 456CA 3OHLA 5BPAA 3NX7A 1ZXCA 3RTSA 1OO9A 4ILWD
chains in the Genus database with same CATH superfamily
2W13A 4XBHA 3EHXA 1QIBA 1XUCA 2OXWA 5D2BA 4JPAA 1GE5A 4GQLA 1HV5A 3KHIA 1GKDA 4GUYA 1KAPP 4JIJA 1ATLA 1H71P 1XURA 1QICA 3L0VA 5CUHA 2DDFA 5L79A 1RMZA 1EB6A 3Q2GA 1JKYA 1YP1A 3DPEA 1IAAA 3K7LA 3LK8A 1CGFA 1YQYA 2WO8A 1KBCA 1BIWA 3LIKA 1O0QA 5I12A 4XCTA 1BKCI 3KEKA 1PWQA 2V4BA 3ELMA 3LJGA 1C3IA 3O2XA 2Z2DA 1I73A 1MMQA 2AIGP 3F16A 3G5CA 5D1SA 3HDBA 1D8FA 1GO8P 2E2DA 1HFCA 5I4OA 2ERPA 3TT4A 1XFXA 4PKWA 4DPEA 2YIGA 3HDAP 4ZR5A 1D7XA 3HBVP 3DL1A 3LQ0A 3EDZA 1JJ9A 2SRTA 3O64A 2MZIA 1OS2A 3CKIA 1CXVA 2D1OA 1KUFA 3KRYA 2X3BA 4GWNA 2FV9A 3LUMA 1ZXVA 3Q2HA 4XM8A 3USNA 1PWWA 1R1JA 3KECA 1USNA 4GR8A 4J4MA 1G9KA 1JAQA 5D7WA 1Y8JA 1JIWP 3B2ZA 2MZEA 3LILA 4DF9A 1SMPA 3LEAA 3F15A 4FXYP 4AXQA 5I43A 2W0DA 1B8YA 1CGLA 2OI0A 5D1UA 5BOTA 4H84A 2O3EA 1QJJA 3EHYA 2N8RA 1JK3A 2W14A 1MMBA 1OM6A 3LJTA 1XFUA 3ZVSA 4CTHA 3ZUKA 1R54A 2OY2A 3UVCA 2TCLA 1BKCA 2J0TA 3EDHA 3N2UA 1CQRA 1Y93A 1JH1A 1D5JA 1QIAA 1OM7A 1XFZA 4GR3A 1I1IP 3AYUA 3F18A 3LQBA 2OZRA 1ZVXA 3LIRA 3U1RA 830CA 4PKQA 1OS9A 3B8ZA 1XAXA 1RM8A 4JP4A 1KUHA 4DV8A 5L7FA 1FLSA 2MZHA 3K7NA 1IACA 2JNPA 4Q1LA 2JT6A 2J83A 4L19A 1G12A 1D8MA 1K7QA 3HY7A 2OVZA 1XFWA 3MA2A 4GR0A 3BA0A 3ZXHA 3EDGA 1G49A 3HYGA 1IAGA 4PKRA 4WZVA 2AYKA 1R1IA 1MMPA 2X3AA 1YOUA 1FM1A 3F19A 2OW2A 3AYKA 4H1QA 3P1VA 1IADA 2MLSA 3LMCA 4AYKA 3KEJA 1L6JA 1WNIA 1XUDA 2MLRA 3L0TA 1SATA 1SRPA 2ERQA 4FU4A 966CA 1XFYA 2DW2A 3I7GA 4ON1A 1SU3A 2RJPA 4H49A 1AKLA 1C8TA 4WKIA 1XFVA 1G4KA 2JIHA 1OZ9A 2YUFA 2OW0A 5CXAA 4AUOA 5CZMA 3HBUP 1ZTQA 3DTEA 1BQQM 1S4BP 3E8RA 3KMEA 1QJIA 4WKEA 2L0RA 3LGPA 1UMTA 1JIZA 4H76A 3DTKA 5I3MA 1GE7A 1OM8A 3LUNA 3F1AA 1G05A 2DW1A 4HMAA 4PKSA 1C7KA 3V96B 4R3VA 1FBLA 2Y6DA 1DMTA 4H82A 2OXUA 2OY4A 1DTHA 2K9CA 3EWJA 1BQOA 1KUIA 4PKTA 1BM6A 4IJOA 3WV2A 3DTIA 2I47A 2YB9A 1XM5A 5BOYA 4QKZA 1A85A 3WV3A 5B5PA 3TVCA 1JAPA 1ZS0A 1MMRA 3VTGA 1EAKA 4H2EA 5H8XA 1BUDA 2QPJA 1CAQA 1JAOA 1IAEA 1PWPA 3KMCA 4WF6A 1GXDA 4FVLA 1UEAA 1KUKA 1K7GA 1ND1A 3SHIA 1R1HA 2RJQA 1K7IA 3VI1A 4L63A 4I35A 2W12A 2DW0A 5JMYA 1O0TA 5LABA 4JQGA 4IN9A 1CK7A 1IABA 1HFSA 1ROSA 4I03A 1Z3JA 2OVXA 2OW1A 2WO9A 1AYKA 4L6TA 2JT5A 1SLMA 4L7AA 3WV1A 2USNA 4DD8A 1I76A 1QUAA 3LE9A 2OW9A 3TSKA 1MNCA 2CKIA 1CIZA 1SLNA 3F17A 2JSDA 1GO7P 2X7MA 1PWUA 4GF1A 3AIGA 1HY7A 2W15A 4G0DA 4XM6A 4A7BA 3N2VA 1HOVA 5I0LA 1GKCA 3DPFA 1CGEA 5B5OA 5I2ZA 4PKUA 2XS3A 3G42A 2K2GA 2EROA 3HY9A 3OHOA 4FXQA 3EDIA 3DWBA 1OMJA 4IUWA 1B3DA 1Y0VA 1J7NA 3GBOA 1A86A 5D3CA 2FV5A 1ZP5A 4WK7A 3LJZA 2X3CA 2CLTA 2E3XA 2OXZA 3I7IA 1Q3AA 1PWVA 1R55A 1EUBA 3B92A 1BUVM 1KUGA 1YCMA 3RTTA 2XS4A 4G9LA 1TVIA 1GE6A 4PKVA 2KRJA 4XM7A 2D1NA 4H3XA 2HU6A 1AF0A 2PJTA 1BSWA 2O36A 3TS4A 4EFSA 1JANA 2Y6CA 2DDYA 1UTTA 4H30A 4AIGA 1ASTA 1UMSA 1UTZA 3KWVC 3LKAA 1HTDA 4HX3A 4GWMA 3HB2P 3P24A 4A3WA 2POJA 3DSLA 3DNGA 2WOAA 1BZSA 1BKCE 2A8HA 5D1TA 4JA1A 456CA 3OHLA 5BPAA 3NX7A 1ZXCA 3RTSA 1OO9A 4ILWD
chains in the Genus database with same CATH topology
2W13A 4XBHA 3EHXA 1QIBA 1XUCA 2OXWA 5D2BA 4JPAA 1GE5A 4GQLA 1HV5A 3KHIA 1GKDA 4GUYA 1KAPP 4JIJA 1ATLA 1H71P 1XURA 1QICA 3L0VA 5CUHA 2DDFA 5L79A 1RMZA 1EB6A 3Q2GA 1JKYA 1YP1A 3DPEA 1IAAA 3K7LA 3LK8A 1CGFA 1YQYA 2WO8A 1KBCA 1BIWA 3LIKA 1O0QA 5I12A 4XCTA 1BKCI 3KEKA 1PWQA 2V4BA 3ELMA 3LJGA 1C3IA 3O2XA 2Z2DA 1I73A 1MMQA 2AIGP 3F16A 3G5CA 5D1SA 3HDBA 1D8FA 1GO8P 2E2DA 1HFCA 5I4OA 2ERPA 3TT4A 1XFXA 4PKWA 4DPEA 2YIGA 3HDAP 4ZR5A 1D7XA 3HBVP 3DL1A 3LQ0A 3EDZA 1JJ9A 2SRTA 3O64A 2MZIA 1OS2A 3CKIA 1CXVA 2D1OA 1KUFA 3KRYA 2X3BA 4GWNA 2FV9A 3LUMA 1ZXVA 3Q2HA 4XM8A 3USNA 1PWWA 1R1JA 3KECA 1USNA 4GR8A 4J4MA 1G9KA 1JAQA 5D7WA 1Y8JA 1JIWP 3B2ZA 2MZEA 3LILA 4DF9A 1SMPA 3LEAA 3F15A 4FXYP 4AXQA 5I43A 2W0DA 1B8YA 1CGLA 2OI0A 5D1UA 5BOTA 4H84A 2O3EA 1QJJA 3EHYA 2N8RA 1JK3A 2W14A 1MMBA 1OM6A 3LJTA 1XFUA 3ZVSA 4CTHA 3ZUKA 1R54A 2OY2A 3UVCA 2TCLA 1BKCA 2J0TA 3EDHA 3N2UA 1CQRA 1Y93A 1JH1A 1D5JA 1QIAA 1OM7A 1XFZA 4GR3A 1I1IP 3AYUA 3F18A 3LQBA 2OZRA 1ZVXA 3LIRA 3U1RA 830CA 4PKQA 1OS9A 3B8ZA 1RM8A 4JP4A 1KUHA 4DV8A 5L7FA 1FLSA 2MZHA 3K7NA 1IACA 2JNPA 4Q1LA 2JT6A 2J83A 4L19A 1G12A 1D8MA 1K7QA 3HY7A 2OVZA 1XFWA 3MA2A 4GR0A 3BA0A 3ZXHA 3EDGA 1G49A 3HYGA 1IAGA 4PKRA 4WZVA 2AYKA 1R1IA 1MMPA 2X3AA 1YOUA 1FM1A 3F19A 2OW2A 3AYKA 4H1QA 3P1VA 1IADA 2MLSA 3LMCA 4AYKA 3KEJA 1L6JA 1WNIA 1XUDA 2MLRA 3L0TA 1SATA 1SRPA 2ERQA 4FU4A 966CA 1XFYA 2DW2A 3I7GA 4ON1A 1SU3A 2RJPA 4H49A 1AKLA 1C8TA 4WKIA 1XFVA 1G4KA 2JIHA 2YUFA 2OW0A 5CXAA 4AUOA 5CZMA 3HBUP 1ZTQA 3DTEA 1BQQM 1S4BP 3E8RA 3KMEA 1QJIA 4WKEA 2L0RA 3LGPA 1UMTA 1JIZA 4H76A 3DTKA 5I3MA 1GE7A 1OM8A 3LUNA 3F1AA 1G05A 2DW1A 4HMAA 4PKSA 1C7KA 3V96B 4R3VA 1FBLA 2Y6DA 1DMTA 4H82A 2OXUA 2OY4A 1DTHA 2K9CA 3EWJA 1BQOA 1KUIA 4PKTA 1BM6A 4IJOA 3WV2A 3DTIA 2I47A 2YB9A 5BOYA 4QKZA 1A85A 3WV3A 5B5PA 3TVCA 1JAPA 1ZS0A 1MMRA 3VTGA 1EAKA 4H2EA 5H8XA 1BUDA 2QPJA 1CAQA 1JAOA 1IAEA 1PWPA 3KMCA 4WF6A 1GXDA 4FVLA 1UEAA 1KUKA 1K7GA 1ND1A 3SHIA 1R1HA 2RJQA 1K7IA 3VI1A 4L63A 4I35A 2W12A 2DW0A 5JMYA 1O0TA 5LABA 4JQGA 4IN9A 1CK7A 1IABA 1HFSA 1ROSA 4I03A 1Z3JA 2OVXA 2OW1A 2WO9A 1AYKA 4L6TA 2JT5A 1SLMA 4L7AA 3WV1A 2USNA 4DD8A 1I76A 1QUAA 3LE9A 2OW9A 3TSKA 1MNCA 2CKIA 1CIZA 1SLNA 3F17A 2JSDA 1GO7P 2X7MA 1PWUA 4GF1A 3AIGA 1HY7A 2W15A 4G0DA 4XM6A 4A7BA 3N2VA 1HOVA 5I0LA 1GKCA 3DPFA 1CGEA 5B5OA 5I2ZA 4PKUA 2XS3A 3G42A 2K2GA 2EROA 3HY9A 3OHOA 4FXQA 3EDIA 3DWBA 1OMJA 4IUWA 1B3DA 1Y0VA 1J7NA 3GBOA 1A86A 5D3CA 2FV5A 1ZP5A 4WK7A 3LJZA 2X3CA 2CLTA 2E3XA 2OXZA 3I7IA 1Q3AA 1PWVA 1R55A 1EUBA 3B92A 1BUVM 1KUGA 1YCMA 3RTTA 2XS4A 4G9LA 1GE6A 4PKVA 2KRJA 4XM7A 2D1NA 4H3XA 2HU6A 1AF0A 2PJTA 1BSWA 2O36A 3TS4A 4EFSA 1JANA 2Y6CA 2DDYA 1UTTA 4H30A 4AIGA 1ASTA 1UMSA 1UTZA 3KWVC 3LKAA 1HTDA 4HX3A 4GWMA 3HB2P 3P24A 4A3WA 2POJA 3DSLA 3DNGA 2WOAA 1BZSA 1BKCE 2A8HA 5D1TA 4JA1A 456CA 3OHLA 5BPAA 3NX7A 1ZXCA 3RTSA 1OO9A 4ILWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W13 A;  4XBH A;  3EHX A;  1QIB A;  1XUC A;  2OXW A;  5D2B A;  4JPA A;  1GE5 A;  4GQL A;  1HV5 A;  3KHI A;  1GKD A;  4GUY A;  1KAP P;  4JIJ A;  1ATL A;  1H71 P;  1XUR A;  1QIC A;  3L0V A;  5CUH A;  2DDF A;  5L79 A;  1RMZ A;  1EB6 A;  3Q2G A;  1JKY A;  1YP1 A;  3DPE A;  1IAA A;  3K7L A;  3LK8 A;  1CGF A;  1YQY A;  2WO8 A;  1KBC A;  1BIW A;  3LIK A;  1O0Q A;  5I12 A;  4XCT A;  1BKC I;  3KEK A;  1PWQ A;  2V4B A;  3ELM A;  3LJG A;  1C3I A;  3O2X A;  2Z2D A;  1I73 A;  1MMQ A;  2AIG P;  3F16 A;  3G5C A;  5D1S A;  3HDB A;  1D8F A;  1GO8 P;  2E2D A;  1HFC A;  5I4O A;  2ERP A;  3TT4 A;  1XFX A;  4PKW A;  4DPE A;  2YIG A;  3HDA P;  4ZR5 A;  1D7X A;  3HBV P;  3DL1 A;  3LQ0 A;  3EDZ A;  1JJ9 A;  2SRT A;  3O64 A;  2MZI A;  1OS2 A;  3CKI A;  1CXV A;  2D1O A;  1KUF A;  3KRY A;  2X3B A;  4GWN A;  2FV9 A;  3LUM A;  1ZXV A;  3Q2H A;  4XM8 A;  3USN A;  1PWW A;  1R1J A;  3KEC A;  1USN A;  4GR8 A;  4J4M A;  1G9K A;  1JAQ A;  5D7W A;  1Y8J A;  1JIW P;  3B2Z A;  2MZE A;  3LIL A;  4DF9 A;  1SMP A;  3LEA A;  3F15 A;  4FXY P;  4AXQ A;  5I43 A;  2W0D A;  1B8Y A;  1CGL A;  2OI0 A;  5D1U A;  5BOT A;  4H84 A;  2O3E A;  1QJJ A;  3EHY A;  2N8R A;  1JK3 A;  2W14 A;  1MMB A;  1OM6 A;  3LJT A;  1XFU A;  3ZVS A;  4CTH A;  3ZUK A;  1R54 A;  2OY2 A;  3UVC A;  2TCL A;  1BKC A;  2J0T A;  3EDH A;  3N2U A;  1CQR A;  1Y93 A;  1JH1 A;  1D5J A;  1QIA A;  1OM7 A;  1XFZ A;  4GR3 A;  1I1I P;  3AYU A;  3F18 A;  3LQB A;  2OZR A;  1ZVX A;  3LIR A;  3U1R A;  830C A;  4PKQ A;  1OS9 A;  3B8Z A;  1RM8 A;  4JP4 A;  1KUH A;  4DV8 A;  5L7F A;  1FLS A;  2MZH A;  3K7N A;  1IAC A;  2JNP A;  4Q1L A;  2JT6 A;  2J83 A;  4L19 A;  1G12 A;  1D8M A;  1K7Q A;  3HY7 A;  2OVZ A;  1XFW A;  3MA2 A;  4GR0 A;  3BA0 A;  3ZXH A;  3EDG A;  1G49 A;  3HYG A;  1IAG A;  4PKR A;  4WZV A;  2AYK A;  1R1I A;  1MMP A;  2X3A A;  1YOU A;  1FM1 A;  3F19 A;  2OW2 A;  3AYK A;  4H1Q A;  3P1V A;  1IAD A;  2MLS A;  3LMC A;  4AYK A;  3KEJ A;  1L6J A;  1WNI A;  1XUD A;  2MLR A;  3L0T A;  1SAT A;  1SRP A;  2ERQ A;  4FU4 A;  966C A;  1XFY A;  2DW2 A;  3I7G A;  4ON1 A;  1SU3 A;  2RJP A;  4H49 A;  1AKL A;  1C8T A;  4WKI A;  1XFV A;  1G4K A;  2JIH A;  2OW0 A;  5CXA A;  4AUO A;  5CZM A;  3HBU P;  1ZTQ A;  1BQQ M;  1S4B P;  3E8R A;  3KME A;  1QJI A;  4WKE A;  2L0R A;  3LGP A;  1UMT A;  1JIZ A;  4H76 A;  5I3M A;  1GE7 A;  1OM8 A;  3LUN A;  3F1A A;  1G05 A;  2DW1 A;  4HMA A;  4PKS A;  1C7K A;  3V96 B;  4R3V A;  1FBL A;  2Y6D A;  1DMT A;  4H82 A;  2OXU A;  2OY4 A;  1DTH A;  2K9C A;  3EWJ A;  1BQO A;  1KUI A;  4PKT A;  1BM6 A;  4IJO A;  3WV2 A;  2I47 A;  2YB9 A;  5BOY A;  4QKZ A;  1A85 A;  3WV3 A;  5B5P A;  3TVC A;  1JAP A;  1ZS0 A;  1MMR A;  3VTG A;  1EAK A;  4H2E A;  5H8X A;  1BUD A;  2QPJ A;  1CAQ A;  1JAO A;  1IAE A;  1PWP A;  3KMC A;  4WF6 A;  1GXD A;  4FVL A;  1UEA A;  1KUK A;  1K7G A;  1ND1 A;  3SHI A;  1R1H A;  2RJQ A;  1K7I A;  3VI1 A;  4L63 A;  4I35 A;  2W12 A;  2DW0 A;  5JMY A;  1O0T A;  5LAB A;  4JQG A;  4IN9 A;  1CK7 A;  1IAB A;  1HFS A;  1ROS A;  4I03 A;  1Z3J A;  2OVX A;  2OW1 A;  2WO9 A;  1AYK A;  4L6T A;  2JT5 A;  1SLM A;  3WV1 A;  2USN A;  4DD8 A;  1I76 A;  1QUA A;  3LE9 A;  2OW9 A;  3TSK A;  1MNC A;  2CKI A;  1CIZ A;  1SLN A;  3F17 A;  2JSD A;  1GO7 P;  2X7M A;  1PWU A;  4GF1 A;  3AIG A;  1HY7 A;  2W15 A;  4G0D A;  4XM6 A;  4A7B A;  3N2V A;  1HOV A;  5I0L A;  1GKC A;  3DPF A;  1CGE A;  5B5O A;  5I2Z A;  4PKU A;  2XS3 A;  3G42 A;  2K2G A;  2ERO A;  3HY9 A;  3OHO A;  4FXQ A;  3EDI A;  3DWB A;  1OMJ A;  4IUW A;  1B3D A;  1Y0V A;  1J7N A;  3GBO A;  1A86 A;  5D3C A;  2FV5 A;  1ZP5 A;  4WK7 A;  3LJZ A;  2X3C A;  2CLT A;  2E3X A;  2OXZ A;  3I7I A;  1Q3A A;  1PWV A;  1R55 A;  1EUB A;  3B92 A;  1BUV M;  1KUG A;  1YCM A;  3RTT A;  2XS4 A;  4G9L A;  1GE6 A;  4PKV A;  2KRJ A;  4XM7 A;  2D1N A;  4H3X A;  2HU6 A;  1AF0 A;  2PJT A;  1BSW A;  2O36 A;  3TS4 A;  4EFS A;  1JAN A;  2Y6C A;  2DDY A;  1UTT A;  4H30 A;  4AIG A;  1AST A;  1UMS A;  1UTZ A;  3KWV C;  3LKA A;  1HTD A;  4HX3 A;  4GWM A;  3HB2 P;  3P24 A;  4A3W A;  2POJ A;  3DSL A;  3DNG A;  2WOA A;  1BZS A;  1BKC E;  2A8H A;  5D1T A;  4JA1 A;  456C A;  3OHL A;  5BPA A;  3NX7 A;  1ZXC A;  3RTS A;  1OO9 A;  4ILW D; 
#chains in the Genus database with same CATH topology
 2W13 A;  4XBH A;  3EHX A;  1QIB A;  1XUC A;  2OXW A;  5D2B A;  4JPA A;  1GE5 A;  4GQL A;  1HV5 A;  3KHI A;  1GKD A;  4GUY A;  1KAP P;  4JIJ A;  1ATL A;  1H71 P;  1XUR A;  1QIC A;  3L0V A;  5CUH A;  2DDF A;  5L79 A;  1RMZ A;  1EB6 A;  3Q2G A;  1JKY A;  1YP1 A;  3DPE A;  1IAA A;  3K7L A;  3LK8 A;  1CGF A;  1YQY A;  2WO8 A;  1KBC A;  1BIW A;  3LIK A;  1O0Q A;  5I12 A;  4XCT A;  1BKC I;  3KEK A;  1PWQ A;  2V4B A;  3ELM A;  3LJG A;  1C3I A;  3O2X A;  2Z2D A;  1I73 A;  1MMQ A;  2AIG P;  3F16 A;  3G5C A;  5D1S A;  3HDB A;  1D8F A;  1GO8 P;  2E2D A;  1HFC A;  5I4O A;  2ERP A;  3TT4 A;  1XFX A;  4PKW A;  4DPE A;  2YIG A;  3HDA P;  4ZR5 A;  1D7X A;  3HBV P;  3DL1 A;  3LQ0 A;  3EDZ A;  1JJ9 A;  2SRT A;  3O64 A;  2MZI A;  1OS2 A;  3CKI A;  1CXV A;  2D1O A;  1KUF A;  3KRY A;  2X3B A;  4GWN A;  2FV9 A;  3LUM A;  1ZXV A;  3Q2H A;  4XM8 A;  3USN A;  1PWW A;  1R1J A;  3KEC A;  1USN A;  4GR8 A;  4J4M A;  1G9K A;  1JAQ A;  5D7W A;  1Y8J A;  1JIW P;  3B2Z A;  2MZE A;  3LIL A;  4DF9 A;  1SMP A;  3LEA A;  3F15 A;  4FXY P;  4AXQ A;  5I43 A;  2W0D A;  1B8Y A;  1CGL A;  2OI0 A;  5D1U A;  5BOT A;  4H84 A;  2O3E A;  1QJJ A;  3EHY A;  2N8R A;  1JK3 A;  2W14 A;  1MMB A;  1OM6 A;  3LJT A;  1XFU A;  3ZVS A;  4CTH A;  3ZUK A;  1R54 A;  2OY2 A;  3UVC A;  2TCL A;  1BKC A;  2J0T A;  3EDH A;  3N2U A;  1CQR A;  1Y93 A;  1JH1 A;  1D5J A;  1QIA A;  1OM7 A;  1XFZ A;  4GR3 A;  1I1I P;  3AYU A;  3F18 A;  3LQB A;  2OZR A;  1ZVX A;  3LIR A;  3U1R A;  830C A;  4PKQ A;  1OS9 A;  3B8Z A;  1XAX A;  1RM8 A;  4JP4 A;  1KUH A;  4DV8 A;  5L7F A;  1FLS A;  2MZH A;  3K7N A;  1IAC A;  2JNP A;  4Q1L A;  2JT6 A;  2J83 A;  4L19 A;  1G12 A;  1D8M A;  1K7Q A;  3HY7 A;  2OVZ A;  1XFW A;  3MA2 A;  4GR0 A;  3BA0 A;  3ZXH A;  3EDG A;  1G49 A;  3HYG A;  1IAG A;  4PKR A;  4WZV A;  2AYK A;  1R1I A;  1MMP A;  2X3A A;  1YOU A;  1FM1 A;  3F19 A;  2OW2 A;  3AYK A;  4H1Q A;  3P1V A;  1IAD A;  2MLS A;  3LMC A;  4AYK A;  3KEJ A;  1L6J A;  1WNI A;  1XUD A;  2MLR A;  3L0T A;  1SAT A;  1SRP A;  2ERQ A;  4FU4 A;  966C A;  1XFY A;  2DW2 A;  3I7G A;  4ON1 A;  1SU3 A;  2RJP A;  4H49 A;  1AKL A;  1C8T A;  4WKI A;  1XFV A;  1G4K A;  2JIH A;  1OZ9 A;  2YUF A;  2OW0 A;  5CXA A;  4AUO A;  5CZM A;  3HBU P;  1ZTQ A;  3DTE A;  1BQQ M;  1S4B P;  3E8R A;  3KME A;  1QJI A;  4WKE A;  2L0R A;  3LGP A;  1UMT A;  1JIZ A;  4H76 A;  3DTK A;  5I3M A;  1GE7 A;  1OM8 A;  3LUN A;  3F1A A;  1G05 A;  2DW1 A;  4HMA A;  4PKS A;  1C7K A;  3V96 B;  4R3V A;  1FBL A;  2Y6D A;  1DMT A;  4H82 A;  2OXU A;  2OY4 A;  1DTH A;  2K9C A;  3EWJ A;  1BQO A;  1KUI A;  4PKT A;  1BM6 A;  4IJO A;  3WV2 A;  3DTI A;  2I47 A;  2YB9 A;  1XM5 A;  5BOY A;  4QKZ A;  1A85 A;  3WV3 A;  5B5P A;  3TVC A;  1JAP A;  1ZS0 A;  1MMR A;  3VTG A;  1EAK A;  4H2E A;  5H8X A;  1BUD A;  2QPJ A;  1CAQ A;  1JAO A;  1IAE A;  1PWP A;  3KMC A;  4WF6 A;  1GXD A;  4FVL A;  1UEA A;  1KUK A;  1K7G A;  1ND1 A;  3SHI A;  1R1H A;  2RJQ A;  1K7I A;  3VI1 A;  4L63 A;  4I35 A;  2W12 A;  2DW0 A;  5JMY A;  1O0T A;  5LAB A;  4JQG A;  4IN9 A;  1CK7 A;  1IAB A;  1HFS A;  1ROS A;  4I03 A;  1Z3J A;  2OVX A;  2OW1 A;  2WO9 A;  1AYK A;  4L6T A;  2JT5 A;  1SLM A;  4L7A A;  3WV1 A;  2USN A;  4DD8 A;  1I76 A;  1QUA A;  3LE9 A;  2OW9 A;  3TSK A;  1MNC A;  2CKI A;  1CIZ A;  1SLN A;  3F17 A;  2JSD A;  1GO7 P;  2X7M A;  1PWU A;  4GF1 A;  3AIG A;  1HY7 A;  2W15 A;  4G0D A;  4XM6 A;  4A7B A;  3N2V A;  1HOV A;  5I0L A;  1GKC A;  3DPF A;  1CGE A;  5B5O A;  5I2Z A;  4PKU A;  2XS3 A;  3G42 A;  2K2G A;  2ERO A;  3HY9 A;  3OHO A;  4FXQ A;  3EDI A;  3DWB A;  1OMJ A;  4IUW A;  1B3D A;  1Y0V A;  1J7N A;  3GBO A;  1A86 A;  5D3C A;  2FV5 A;  1ZP5 A;  4WK7 A;  3LJZ A;  2X3C A;  2CLT A;  2E3X A;  2OXZ A;  3I7I A;  1Q3A A;  1PWV A;  1R55 A;  1EUB A;  3B92 A;  1BUV M;  1KUG A;  1YCM A;  3RTT A;  2XS4 A;  4G9L A;  1TVI A;  1GE6 A;  4PKV A;  2KRJ A;  4XM7 A;  2D1N A;  4H3X A;  2HU6 A;  1AF0 A;  2PJT A;  1BSW A;  2O36 A;  3TS4 A;  4EFS A;  1JAN A;  2Y6C A;  2DDY A;  1UTT A;  4H30 A;  4AIG A;  1AST A;  1UMS A;  1UTZ A;  3KWV C;  3LKA A;  1HTD A;  4HX3 A;  4GWM A;  3HB2 P;  3P24 A;  4A3W A;  2POJ A;  3DSL A;  3DNG A;  2WOA A;  1BZS A;  1BKC E;  2A8H A;  5D1T A;  4JA1 A;  456C A;  3OHL A;  5BPA A;  3NX7 A;  1ZXC A;  3RTS A;  1OO9 A;  4ILW D; 
#chains in the Genus database with same CATH homology
 2W13 A;  4XBH A;  3EHX A;  1QIB A;  1XUC A;  2OXW A;  5D2B A;  4JPA A;  1GE5 A;  4GQL A;  1HV5 A;  3KHI A;  1GKD A;  4GUY A;  1KAP P;  4JIJ A;  1ATL A;  1H71 P;  1XUR A;  1QIC A;  3L0V A;  5CUH A;  2DDF A;  5L79 A;  1RMZ A;  1EB6 A;  3Q2G A;  1JKY A;  1YP1 A;  3DPE A;  1IAA A;  3K7L A;  3LK8 A;  1CGF A;  1YQY A;  2WO8 A;  1KBC A;  1BIW A;  3LIK A;  1O0Q A;  5I12 A;  4XCT A;  1BKC I;  3KEK A;  1PWQ A;  2V4B A;  3ELM A;  3LJG A;  1C3I A;  3O2X A;  2Z2D A;  1I73 A;  1MMQ A;  2AIG P;  3F16 A;  3G5C A;  5D1S A;  3HDB A;  1D8F A;  1GO8 P;  2E2D A;  1HFC A;  5I4O A;  2ERP A;  3TT4 A;  1XFX A;  4PKW A;  4DPE A;  2YIG A;  3HDA P;  4ZR5 A;  1D7X A;  3HBV P;  3DL1 A;  3LQ0 A;  3EDZ A;  1JJ9 A;  2SRT A;  3O64 A;  2MZI A;  1OS2 A;  3CKI A;  1CXV A;  2D1O A;  1KUF A;  3KRY A;  2X3B A;  4GWN A;  2FV9 A;  3LUM A;  1ZXV A;  3Q2H A;  4XM8 A;  3USN A;  1PWW A;  1R1J A;  3KEC A;  1USN A;  4GR8 A;  4J4M A;  1G9K A;  1JAQ A;  5D7W A;  1Y8J A;  1JIW P;  3B2Z A;  2MZE A;  3LIL A;  4DF9 A;  1SMP A;  3LEA A;  3F15 A;  4FXY P;  4AXQ A;  5I43 A;  2W0D A;  1B8Y A;  1CGL A;  2OI0 A;  5D1U A;  5BOT A;  4H84 A;  2O3E A;  1QJJ A;  3EHY A;  2N8R A;  1JK3 A;  2W14 A;  1MMB A;  1OM6 A;  3LJT A;  1XFU A;  3ZVS A;  4CTH A;  3ZUK A;  1R54 A;  2OY2 A;  3UVC A;  2TCL A;  1BKC A;  2J0T A;  3EDH A;  3N2U A;  1CQR A;  1Y93 A;  1JH1 A;  1D5J A;  1QIA A;  1OM7 A;  1XFZ A;  4GR3 A;  1I1I P;  3AYU A;  3F18 A;  3LQB A;  2OZR A;  1ZVX A;  3LIR A;  3U1R A;  830C A;  4PKQ A;  1OS9 A;  3B8Z A;  1RM8 A;  4JP4 A;  1KUH A;  4DV8 A;  5L7F A;  1FLS A;  2MZH A;  3K7N A;  1IAC A;  2JNP A;  4Q1L A;  2JT6 A;  2J83 A;  4L19 A;  1G12 A;  1D8M A;  1K7Q A;  3HY7 A;  2OVZ A;  1XFW A;  3MA2 A;  4GR0 A;  3BA0 A;  3ZXH A;  3EDG A;  1G49 A;  3HYG A;  1IAG A;  4PKR A;  4WZV A;  2AYK A;  1R1I A;  1MMP A;  2X3A A;  1YOU A;  1FM1 A;  3F19 A;  2OW2 A;  3AYK A;  4H1Q A;  3P1V A;  1IAD A;  2MLS A;  3LMC A;  4AYK A;  3KEJ A;  1L6J A;  1WNI A;  1XUD A;  2MLR A;  3L0T A;  1SAT A;  1SRP A;  2ERQ A;  4FU4 A;  966C A;  1XFY A;  2DW2 A;  3I7G A;  4ON1 A;  1SU3 A;  2RJP A;  4H49 A;  1AKL A;  1C8T A;  4WKI A;  1XFV A;  1G4K A;  2JIH A;  2YUF A;  2OW0 A;  5CXA A;  4AUO A;  5CZM A;  3HBU P;  1ZTQ A;  3DTE A;  1BQQ M;  1S4B P;  3E8R A;  3KME A;  1QJI A;  4WKE A;  2L0R A;  3LGP A;  1UMT A;  1JIZ A;  4H76 A;  3DTK A;  5I3M A;  1GE7 A;  1OM8 A;  3LUN A;  3F1A A;  1G05 A;  2DW1 A;  4HMA A;  4PKS A;  1C7K A;  3V96 B;  4R3V A;  1FBL A;  2Y6D A;  1DMT A;  4H82 A;  2OXU A;  2OY4 A;  1DTH A;  2K9C A;  3EWJ A;  1BQO A;  1KUI A;  4PKT A;  1BM6 A;  4IJO A;  3WV2 A;  3DTI A;  2I47 A;  2YB9 A;  5BOY A;  4QKZ A;  1A85 A;  3WV3 A;  5B5P A;  3TVC A;  1JAP A;  1ZS0 A;  1MMR A;  3VTG A;  1EAK A;  4H2E A;  5H8X A;  1BUD A;  2QPJ A;  1CAQ A;  1JAO A;  1IAE A;  1PWP A;  3KMC A;  4WF6 A;  1GXD A;  4FVL A;  1UEA A;  1KUK A;  1K7G A;  1ND1 A;  3SHI A;  1R1H A;  2RJQ A;  1K7I A;  3VI1 A;  4L63 A;  4I35 A;  2W12 A;  2DW0 A;  5JMY A;  1O0T A;  5LAB A;  4JQG A;  4IN9 A;  1CK7 A;  1IAB A;  1HFS A;  1ROS A;  4I03 A;  1Z3J A;  2OVX A;  2OW1 A;  2WO9 A;  1AYK A;  4L6T A;  2JT5 A;  1SLM A;  4L7A A;  3WV1 A;  2USN A;  4DD8 A;  1I76 A;  1QUA A;  3LE9 A;  2OW9 A;  3TSK A;  1MNC A;  2CKI A;  1CIZ A;  1SLN A;  3F17 A;  2JSD A;  1GO7 P;  2X7M A;  1PWU A;  4GF1 A;  3AIG A;  1HY7 A;  2W15 A;  4G0D A;  4XM6 A;  4A7B A;  3N2V A;  1HOV A;  5I0L A;  1GKC A;  3DPF A;  1CGE A;  5B5O A;  5I2Z A;  4PKU A;  2XS3 A;  3G42 A;  2K2G A;  2ERO A;  3HY9 A;  3OHO A;  4FXQ A;  3EDI A;  3DWB A;  1OMJ A;  4IUW A;  1B3D A;  1Y0V A;  1J7N A;  3GBO A;  1A86 A;  5D3C A;  2FV5 A;  1ZP5 A;  4WK7 A;  3LJZ A;  2X3C A;  2CLT A;  2E3X A;  2OXZ A;  3I7I A;  1Q3A A;  1PWV A;  1R55 A;  1EUB A;  3B92 A;  1BUV M;  1KUG A;  1YCM A;  3RTT A;  2XS4 A;  4G9L A;  1GE6 A;  4PKV A;  2KRJ A;  4XM7 A;  2D1N A;  4H3X A;  2HU6 A;  1AF0 A;  2PJT A;  1BSW A;  2O36 A;  3TS4 A;  4EFS A;  1JAN A;  2Y6C A;  2DDY A;  1UTT A;  4H30 A;  4AIG A;  1AST A;  1UMS A;  1UTZ A;  3KWV C;  3LKA A;  1HTD A;  4HX3 A;  4GWM A;  3HB2 P;  3P24 A;  4A3W A;  2POJ A;  3DSL A;  3DNG A;  2WOA A;  1BZS A;  1BKC E;  2A8H A;  5D1T A;  4JA1 A;  456C A;  3OHL A;  5BPA A;  3NX7 A;  1ZXC A;  3RTS A;  1OO9 A;  4ILW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...