2L0RA

Conformational dynamics of the anthrax lethal factor catalytic center
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
GSKGVELRNDSEGFIHEFGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHSTDHAERLKVQKNAPKTFQFINDQIKFIINS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal factor
publication title Conformational dynamics of the anthrax lethal factor catalytic center.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Hydrolase,toxin
total genus 35
structure length 106
sequence length 106
ec nomenclature ec 3.4.24.83: Anthrax lethal factor endopeptidase.
pdb deposition date 2010-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2l0rA00
2OW0A 1BKCA 4IUWA 1BQOA 1UMTA 1HOVA 1C3IA 4AIGA 1Y93A 2EROA 1Y8JA 1USNA 4J4MA 1ZXVA 2YB9A 1Y0VA 1IAEA 5I2ZA 3OHLA 2V4BA 3LIRA 4IJOA 1C8TA 2FV5A 4I35A 1QJJA 1D5JA 1C7KA 4AXQA 1CIZA 4L63A 3HYGA 2W0DA 1XUDA 3LGPA 3TSKA 5D2BA 3O64A 1QICA 1AKLA 2OI0A 4A3WA 1SLMA 3MA2A 1ROSA 3RTTA 2Y6CA 2X3CA 1KUHA 4GWMA 1GKDA 3N2UA 3EDHA 1ATLA 5I12A 1WNIA 1SATA 1EAKA 1MMQA 1AYKA 3LKAA 1BKCE 3U1RA 4JP4A 2A8HA 2OVZA 1OM8A 1MNCA 5I4OA 2OZRA 2W13A 1XFWA 1RM8A 2FV9A 2X3BA 2TCLA 2MZEA 4GUYA 1BM6A 4H1QA 2E3XA 2JSDA 3VI1A 4XCTA 3AIGA 1XFXA 1YP1A 4HMAA 5I3MA 456CA 3EDIA 3WV1A 1GE6A 1R1HA 1KUKA 3F18A 5B5OA 3E8RA 4AYKA 2YIGA 1OO9A 3NX7A 1QIAA 2OY4A 3K7LA 4PKUA 3I7GA 4PKVA 3ZUKA 3F19A 4GQLA 4DV8A 4H3XA 1HFSA 4WKIA 1IABA 1PWUA 1ZTQA 3F16A 3F15A 2HU6A 2Z2DA 1I1IP 3GBOA 3KEKA 3EHXA 2J83A 1Z3JA 1KUFA 1J7NA 3LUNA 4L19A 5BPAA 3L0TA 4GR8A 3O2XA 4R3VA 2JT5A 2SRTA 3L0VA 3UVCA 1JAOA 4WZVA 2WO9A 3ZXHA 2AYKA 1AF0A 4WKEA 4GR3A 1ASTA 3DPFA 4FXYP 4FU4A 1JAQA 3HB2P 2CLTA 4JPAA 1EB6A 1QJIA 1FM1A 3LIKA 3ZVSA 1ZXCA 2L0RA 1IACA 1XFUA 1G12A 1CQRA 2PJTA 4G0DA 2QPJA 4JA1A 4XM8A 3LJZA 1D8MA 1JH1A 1L6JA 1H71P 3AYKA 2DDFA 4CTHA 5D1TA 3B92A 1JANA 1KAPP 4A7BA 4PKRA 2OVXA 3SHIA 1JKYA 1JIWP 3TT4A 1FBLA 1MMBA 3LK8A 2MLSA 4DPEA 1HFCA 2DW1A 2OXZA 2OY2A 1GKCA 3N2VA 1HTDA 1KUGA 2OXWA 3RTSA 3KEJA 3HDAP 1SMPA 1PWPA 1GXDA 1CGFA 1MMPA 2JIHA 3HBUP 3KMEA 2E2DA 3BA0A 1IADA 1BKCI 1IAAA 2X3AA 1XFVA 4ZR5A 1SRPA 1O0TA 1YCMA 3HY9A 3P24A 1Q3AA 3TVCA 3KRYA 1G4KA 1G9KA 1XFZA 4XM6A 2D1OA 4PKTA 4EFSA 2OW2A 1A85A 2N8RA 2XS3A 1ZS0A 1KUIA 5I43A 1D7XA 3K7NA 1QUAA 2X7MA 4ON1A 1PWVA 4JQGA 1B3DA 1BZSA 3F17A 1ND1A 5BOTA 1R1JA 1YOUA 2J0TA 1XURA 4FXQA 3USNA 4GF1A 2DDYA 1G05A 2DW0A 5CUHA 3ELMA 1BIWA 1DMTA 1GO7P 3VTGA 2WOAA 5LABA 1UTTA 2CKIA 2I47A 1CGEA 1A86A 5D3CA 1YQYA 3G5CA 3LMCA 1MMRA 5H8XA 4XBHA 2K9CA 3P1VA 4PKQA 2OW9A 3HY7A 5L79A 3B2ZA 3Q2GA 5D1UA 3Q2HA 3LQ0A 1B8YA 3AYUA 5D7WA 4XM7A 1GE5A 3WV2A 830CA 1DTHA 1OM7A 1K7GA 2ERQA 2JT6A 966CA 5L7FA 3EDGA 3KMCA 4H76A 1G49A 1GE7A 4H2EA 1PWQA 3V96B 1I76A 1CK7A 2W14A 5JMYA 5D1SA 1JAPA 1I73A 4L6TA 1PWWA 3KHIA 2WO8A 1JIZA 1ZP5A 5I0LA 1OS2A 2Y6DA 2MZHA 2W15A 4GR0A 1IAGA 1R55A 1RMZA 2MZIA 3LILA 5CZMA 2O3EA 3LJGA 3F1AA 4JIJA 1GO8P 1UMSA 3EWJA 4I03A 2K2GA 4IN9A 4H82A 4H84A 1HY7A 2AIGP 2RJPA 3G42A 4GWNA 3HBVP 1R54A 3KWVC 4G9LA 1ZVXA 3CKIA 4H30A 1UTZA 2W12A 1BSWA 4H49A 1FLSA 1SLNA 1EUBA 3LUMA 1BQQM 2RJQA 4ILWD 3LE9A 1D8FA 2ERPA 3DWBA 4DF9A 1HV5A 4Q1LA 1S4BP 1BUVM 5BOYA 1CAQA 1JJ9A 3DL1A 2JNPA 4PKWA 2USNA 3LEAA 4AUOA 4PKSA 4DD8A 1CXVA 3DSLA 3B8ZA 3DPEA 1K7IA 1CGLA 3WV3A 1OS9A 1UEAA 4WF6A 1QIBA 3HDBA 2OW1A 2DW2A 5B5PA 2O36A 4QKZA 1KBCA 4WK7A 3I7IA 1K7QA 1OM6A 5CXAA 2KRJA 3LQBA 4HX3A 1XUCA 3KECA 1R1IA 4FVLA 3DNGA 1XFYA 2OXUA 1BUDA 3EHYA 3TS4A 3LJTA 1OMJA 1O0QA 3OHOA 1SU3A 2MLRA 2XS4A 3EDZA 2POJA 1JK3A 2D1NA
chains in the Genus database with same CATH superfamily
2OW0A 1BKCA 4IUWA 1BQOA 3DTKA 1UMTA 1HOVA 1C3IA 4AIGA 1Y93A 2EROA 1Y8JA 1USNA 4J4MA 1ZXVA 2YB9A 1Y0VA 1IAEA 5I2ZA 3OHLA 2V4BA 3LIRA 4IJOA 1C8TA 2FV5A 4I35A 1QJJA 1D5JA 1C7KA 4AXQA 1CIZA 4L63A 3HYGA 2W0DA 1XUDA 3LGPA 3TSKA 5D2BA 3O64A 1QICA 1AKLA 2OI0A 4A3WA 1SLMA 3MA2A 1ROSA 3RTTA 2Y6CA 2X3CA 1KUHA 4GWMA 1GKDA 3N2UA 3EDHA 1ATLA 5I12A 1WNIA 1SATA 1EAKA 1MMQA 1AYKA 3LKAA 1BKCE 3U1RA 3DTIA 4JP4A 2A8HA 2OVZA 1OM8A 1MNCA 5I4OA 2OZRA 2W13A 1XFWA 1RM8A 2FV9A 2X3BA 2TCLA 2MZEA 4GUYA 1BM6A 4H1QA 2E3XA 2JSDA 3VI1A 4XCTA 3AIGA 1XFXA 1YP1A 4HMAA 5I3MA 456CA 3EDIA 3WV1A 1GE6A 1R1HA 1KUKA 3F18A 5B5OA 3E8RA 1TVIA 4AYKA 2YIGA 1OO9A 3NX7A 1QIAA 2OY4A 3K7LA 4PKUA 3I7GA 4PKVA 3ZUKA 3F19A 4GQLA 4DV8A 4H3XA 1HFSA 4WKIA 1IABA 1PWUA 1ZTQA 3F16A 3F15A 2HU6A 2Z2DA 1I1IP 3GBOA 3KEKA 3EHXA 2J83A 1Z3JA 1KUFA 1J7NA 3LUNA 4L19A 5BPAA 3L0TA 4GR8A 3O2XA 4R3VA 2JT5A 2SRTA 3L0VA 3UVCA 1JAOA 4WZVA 2WO9A 3ZXHA 2AYKA 1AF0A 4WKEA 4GR3A 1ASTA 3DPFA 4FXYP 4FU4A 1JAQA 3HB2P 2CLTA 4JPAA 1OZ9A 1EB6A 1QJIA 1FM1A 3LIKA 3ZVSA 1ZXCA 2L0RA 1IACA 1XFUA 1G12A 1CQRA 2PJTA 4G0DA 2QPJA 4JA1A 4XM8A 3LJZA 1D8MA 1JH1A 1L6JA 1H71P 3AYKA 2DDFA 4CTHA 5D1TA 3B92A 1JANA 1KAPP 4A7BA 4PKRA 2OVXA 3SHIA 1JKYA 1JIWP 3TT4A 1FBLA 1MMBA 3LK8A 2MLSA 4DPEA 1HFCA 2DW1A 2OXZA 2OY2A 1GKCA 3N2VA 1HTDA 1KUGA 2OXWA 3RTSA 3KEJA 3HDAP 1SMPA 1PWPA 1GXDA 4L7AA 1CGFA 1MMPA 2JIHA 3HBUP 3KMEA 2E2DA 3BA0A 1IADA 1BKCI 1IAAA 2X3AA 1XFVA 4ZR5A 1SRPA 1O0TA 1YCMA 3HY9A 3P24A 1Q3AA 3TVCA 3KRYA 1G4KA 1G9KA 1XFZA 4XM6A 2D1OA 4PKTA 4EFSA 2OW2A 1A85A 2N8RA 2XS3A 1ZS0A 1KUIA 5I43A 1D7XA 3K7NA 1QUAA 2X7MA 4ON1A 1PWVA 4JQGA 1B3DA 1BZSA 2YUFA 3F17A 1ND1A 3DTEA 5BOTA 1R1JA 1YOUA 2J0TA 1XURA 4FXQA 3USNA 4GF1A 2DDYA 1G05A 2DW0A 5CUHA 3ELMA 1BIWA 1DMTA 1GO7P 3VTGA 2WOAA 5LABA 1UTTA 2CKIA 2I47A 1CGEA 1A86A 5D3CA 1YQYA 3G5CA 3LMCA 1MMRA 5H8XA 4XBHA 2K9CA 3P1VA 4PKQA 2OW9A 3HY7A 5L79A 3B2ZA 3Q2GA 5D1UA 3Q2HA 3LQ0A 1B8YA 3AYUA 5D7WA 4XM7A 1GE5A 3WV2A 830CA 1DTHA 1OM7A 1K7GA 2ERQA 2JT6A 966CA 5L7FA 3EDGA 3KMCA 4H76A 1G49A 1GE7A 4H2EA 1PWQA 3V96B 1I76A 1CK7A 2W14A 5JMYA 5D1SA 1JAPA 1I73A 4L6TA 1PWWA 3KHIA 2WO8A 1JIZA 1ZP5A 5I0LA 1OS2A 2Y6DA 2MZHA 2W15A 4GR0A 1IAGA 1R55A 1RMZA 2MZIA 3LILA 5CZMA 2O3EA 3LJGA 3F1AA 4JIJA 1GO8P 1UMSA 3EWJA 4I03A 2K2GA 4IN9A 4H82A 4H84A 1HY7A 2AIGP 2RJPA 3G42A 4GWNA 3HBVP 1R54A 3KWVC 4G9LA 1ZVXA 1XM5A 3CKIA 4H30A 1UTZA 2W12A 1BSWA 4H49A 1FLSA 1SLNA 1EUBA 3LUMA 1BQQM 2RJQA 4ILWD 3LE9A 1D8FA 2ERPA 3DWBA 4DF9A 1HV5A 4Q1LA 1S4BP 1BUVM 5BOYA 1CAQA 1JJ9A 3DL1A 2JNPA 4PKWA 2USNA 3LEAA 4AUOA 4PKSA 4DD8A 1CXVA 3DSLA 3B8ZA 3DPEA 1K7IA 1CGLA 3WV3A 1OS9A 1UEAA 4WF6A 1QIBA 3HDBA 2OW1A 2DW2A 5B5PA 2O36A 4QKZA 1KBCA 4WK7A 3I7IA 1K7QA 1OM6A 5CXAA 2KRJA 3LQBA 4HX3A 1XUCA 3KECA 1R1IA 4FVLA 3DNGA 1XFYA 2OXUA 1BUDA 3EHYA 3TS4A 3LJTA 1OMJA 1O0QA 3OHOA 1SU3A 2MLRA 2XS4A 3EDZA 2POJA 1JK3A 2D1NA 1XAXA
chains in the Genus database with same CATH topology
2OW0A 1BKCA 4IUWA 1BQOA 3DTKA 1UMTA 1HOVA 1C3IA 4AIGA 1Y93A 2EROA 1Y8JA 1USNA 4J4MA 1ZXVA 2YB9A 1Y0VA 1IAEA 5I2ZA 3OHLA 2V4BA 3LIRA 4IJOA 1C8TA 2FV5A 4I35A 1QJJA 1D5JA 1C7KA 4AXQA 1CIZA 4L63A 3HYGA 2W0DA 1XUDA 3LGPA 3TSKA 5D2BA 3O64A 1QICA 1AKLA 2OI0A 4A3WA 1SLMA 3MA2A 1ROSA 3RTTA 2Y6CA 2X3CA 1KUHA 4GWMA 1GKDA 3N2UA 3EDHA 1ATLA 5I12A 1WNIA 1SATA 1EAKA 1MMQA 1AYKA 3LKAA 1BKCE 3U1RA 3DTIA 4JP4A 2A8HA 2OVZA 1OM8A 1MNCA 5I4OA 2OZRA 2W13A 1XFWA 1RM8A 2FV9A 2X3BA 2TCLA 2MZEA 4GUYA 1BM6A 4H1QA 2E3XA 2JSDA 3VI1A 4XCTA 3AIGA 1XFXA 1YP1A 4HMAA 5I3MA 456CA 3EDIA 3WV1A 1GE6A 1R1HA 1KUKA 3F18A 5B5OA 3E8RA 4AYKA 2YIGA 1OO9A 3NX7A 1QIAA 2OY4A 3K7LA 4PKUA 3I7GA 4PKVA 3ZUKA 3F19A 4GQLA 4DV8A 4H3XA 1HFSA 4WKIA 1IABA 1PWUA 1ZTQA 3F16A 3F15A 2HU6A 2Z2DA 1I1IP 3GBOA 3KEKA 3EHXA 2J83A 1Z3JA 1KUFA 1J7NA 3LUNA 4L19A 5BPAA 3L0TA 4GR8A 3O2XA 4R3VA 2JT5A 2SRTA 3L0VA 3UVCA 1JAOA 4WZVA 2WO9A 3ZXHA 2AYKA 1AF0A 4WKEA 4GR3A 1ASTA 3DPFA 4FXYP 4FU4A 1JAQA 3HB2P 2CLTA 4JPAA 1EB6A 1QJIA 1FM1A 3LIKA 3ZVSA 1ZXCA 2L0RA 1IACA 1XFUA 1G12A 1CQRA 2PJTA 4G0DA 2QPJA 4JA1A 4XM8A 3LJZA 1D8MA 1JH1A 1L6JA 1H71P 3AYKA 2DDFA 4CTHA 5D1TA 3B92A 1JANA 1KAPP 4A7BA 4PKRA 2OVXA 3SHIA 1JKYA 1JIWP 3TT4A 1FBLA 1MMBA 3LK8A 2MLSA 4DPEA 1HFCA 2DW1A 2OXZA 2OY2A 1GKCA 3N2VA 1HTDA 1KUGA 2OXWA 3RTSA 3KEJA 3HDAP 1SMPA 1PWPA 1GXDA 4L7AA 1CGFA 1MMPA 2JIHA 3HBUP 3KMEA 2E2DA 3BA0A 1IADA 1BKCI 1IAAA 2X3AA 1XFVA 4ZR5A 1SRPA 1O0TA 1YCMA 3HY9A 3P24A 1Q3AA 3TVCA 3KRYA 1G4KA 1G9KA 1XFZA 4XM6A 2D1OA 4PKTA 4EFSA 2OW2A 1A85A 2N8RA 2XS3A 1ZS0A 1KUIA 5I43A 1D7XA 3K7NA 1QUAA 2X7MA 4ON1A 1PWVA 4JQGA 1B3DA 1BZSA 2YUFA 3F17A 1ND1A 3DTEA 5BOTA 1R1JA 1YOUA 2J0TA 1XURA 4FXQA 3USNA 4GF1A 2DDYA 1G05A 2DW0A 5CUHA 3ELMA 1BIWA 1DMTA 1GO7P 3VTGA 2WOAA 5LABA 1UTTA 2CKIA 2I47A 1CGEA 1A86A 5D3CA 1YQYA 3G5CA 3LMCA 1MMRA 5H8XA 4XBHA 2K9CA 3P1VA 4PKQA 2OW9A 3HY7A 5L79A 3B2ZA 3Q2GA 5D1UA 3Q2HA 3LQ0A 1B8YA 3AYUA 5D7WA 4XM7A 1GE5A 3WV2A 830CA 1DTHA 1OM7A 1K7GA 2ERQA 2JT6A 966CA 5L7FA 3EDGA 3KMCA 4H76A 1G49A 1GE7A 4H2EA 1PWQA 3V96B 1I76A 1CK7A 2W14A 5JMYA 5D1SA 1JAPA 1I73A 4L6TA 1PWWA 3KHIA 2WO8A 1JIZA 1ZP5A 5I0LA 1OS2A 2Y6DA 2MZHA 2W15A 4GR0A 1IAGA 1R55A 1RMZA 2MZIA 3LILA 5CZMA 2O3EA 3LJGA 3F1AA 4JIJA 1GO8P 1UMSA 3EWJA 4I03A 2K2GA 4IN9A 4H82A 4H84A 1HY7A 2AIGP 2RJPA 3G42A 4GWNA 3HBVP 1R54A 3KWVC 4G9LA 1ZVXA 3CKIA 4H30A 1UTZA 2W12A 1BSWA 4H49A 1FLSA 1SLNA 1EUBA 3LUMA 1BQQM 2RJQA 4ILWD 3LE9A 1D8FA 2ERPA 3DWBA 4DF9A 1HV5A 4Q1LA 1S4BP 1BUVM 5BOYA 1CAQA 1JJ9A 3DL1A 2JNPA 4PKWA 2USNA 3LEAA 4AUOA 4PKSA 4DD8A 1CXVA 3DSLA 3B8ZA 3DPEA 1K7IA 1CGLA 3WV3A 1OS9A 1UEAA 4WF6A 1QIBA 3HDBA 2OW1A 2DW2A 5B5PA 2O36A 4QKZA 1KBCA 4WK7A 3I7IA 1K7QA 1OM6A 5CXAA 2KRJA 3LQBA 4HX3A 1XUCA 3KECA 1R1IA 4FVLA 3DNGA 1XFYA 2OXUA 1BUDA 3EHYA 3TS4A 3LJTA 1OMJA 1O0QA 3OHOA 1SU3A 2MLRA 2XS4A 3EDZA 2POJA 1JK3A 2D1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OW0 A;  1BKC A;  4IUW A;  1BQO A;  1UMT A;  1HOV A;  1C3I A;  4AIG A;  1Y93 A;  2ERO A;  1Y8J A;  1USN A;  4J4M A;  1ZXV A;  2YB9 A;  1Y0V A;  1IAE A;  5I2Z A;  3OHL A;  2V4B A;  3LIR A;  4IJO A;  1C8T A;  2FV5 A;  4I35 A;  1QJJ A;  1D5J A;  1C7K A;  4AXQ A;  1CIZ A;  4L63 A;  3HYG A;  2W0D A;  1XUD A;  3LGP A;  3TSK A;  5D2B A;  3O64 A;  1QIC A;  1AKL A;  2OI0 A;  4A3W A;  1SLM A;  3MA2 A;  1ROS A;  3RTT A;  2Y6C A;  2X3C A;  1KUH A;  4GWM A;  1GKD A;  3N2U A;  3EDH A;  1ATL A;  5I12 A;  1WNI A;  1SAT A;  1EAK A;  1MMQ A;  1AYK A;  3LKA A;  1BKC E;  3U1R A;  4JP4 A;  2A8H A;  2OVZ A;  1OM8 A;  1MNC A;  5I4O A;  2OZR A;  2W13 A;  1XFW A;  1RM8 A;  2FV9 A;  2X3B A;  2TCL A;  2MZE A;  4GUY A;  1BM6 A;  4H1Q A;  2E3X A;  2JSD A;  3VI1 A;  4XCT A;  3AIG A;  1XFX A;  1YP1 A;  4HMA A;  5I3M A;  456C A;  3EDI A;  3WV1 A;  1GE6 A;  1R1H A;  1KUK A;  3F18 A;  5B5O A;  3E8R A;  4AYK A;  2YIG A;  1OO9 A;  3NX7 A;  1QIA A;  2OY4 A;  3K7L A;  4PKU A;  3I7G A;  4PKV A;  3ZUK A;  3F19 A;  4GQL A;  4DV8 A;  4H3X A;  1HFS A;  4WKI A;  1IAB A;  1PWU A;  1ZTQ A;  3F16 A;  3F15 A;  2HU6 A;  2Z2D A;  1I1I P;  3GBO A;  3KEK A;  3EHX A;  2J83 A;  1Z3J A;  1KUF A;  1J7N A;  3LUN A;  4L19 A;  5BPA A;  3L0T A;  4GR8 A;  3O2X A;  4R3V A;  2JT5 A;  2SRT A;  3L0V A;  3UVC A;  1JAO A;  4WZV A;  2WO9 A;  3ZXH A;  2AYK A;  1AF0 A;  4WKE A;  4GR3 A;  1AST A;  3DPF A;  4FXY P;  4FU4 A;  1JAQ A;  3HB2 P;  2CLT A;  4JPA A;  1EB6 A;  1QJI A;  1FM1 A;  3LIK A;  3ZVS A;  1ZXC A;  2L0R A;  1IAC A;  1XFU A;  1G12 A;  1CQR A;  2PJT A;  4G0D A;  2QPJ A;  4JA1 A;  4XM8 A;  3LJZ A;  1D8M A;  1JH1 A;  1L6J A;  1H71 P;  3AYK A;  2DDF A;  4CTH A;  5D1T A;  3B92 A;  1JAN A;  1KAP P;  4A7B A;  4PKR A;  2OVX A;  3SHI A;  1JKY A;  1JIW P;  3TT4 A;  1FBL A;  1MMB A;  3LK8 A;  2MLS A;  4DPE A;  1HFC A;  2DW1 A;  2OXZ A;  2OY2 A;  1GKC A;  3N2V A;  1HTD A;  1KUG A;  2OXW A;  3RTS A;  3KEJ A;  3HDA P;  1SMP A;  1PWP A;  1GXD A;  1CGF A;  1MMP A;  2JIH A;  3HBU P;  3KME A;  2E2D A;  3BA0 A;  1IAD A;  1BKC I;  1IAA A;  2X3A A;  1XFV A;  4ZR5 A;  1SRP A;  1O0T A;  1YCM A;  3HY9 A;  3P24 A;  1Q3A A;  3TVC A;  3KRY A;  1G4K A;  1G9K A;  1XFZ A;  4XM6 A;  2D1O A;  4PKT A;  4EFS A;  2OW2 A;  1A85 A;  2N8R A;  2XS3 A;  1ZS0 A;  1KUI A;  5I43 A;  1D7X A;  3K7N A;  1QUA A;  2X7M A;  4ON1 A;  1PWV A;  4JQG A;  1B3D A;  1BZS A;  3F17 A;  1ND1 A;  5BOT A;  1R1J A;  1YOU A;  2J0T A;  1XUR A;  4FXQ A;  3USN A;  4GF1 A;  2DDY A;  1G05 A;  2DW0 A;  5CUH A;  3ELM A;  1BIW A;  1DMT A;  1GO7 P;  3VTG A;  2WOA A;  5LAB A;  1UTT A;  2CKI A;  2I47 A;  1CGE A;  1A86 A;  5D3C A;  1YQY A;  3G5C A;  3LMC A;  1MMR A;  5H8X A;  4XBH A;  2K9C A;  3P1V A;  4PKQ A;  2OW9 A;  3HY7 A;  5L79 A;  3B2Z A;  3Q2G A;  5D1U A;  3Q2H A;  3LQ0 A;  1B8Y A;  3AYU A;  5D7W A;  4XM7 A;  1GE5 A;  3WV2 A;  830C A;  1DTH A;  1OM7 A;  1K7G A;  2ERQ A;  2JT6 A;  966C A;  5L7F A;  3EDG A;  3KMC A;  4H76 A;  1G49 A;  1GE7 A;  4H2E A;  1PWQ A;  3V96 B;  1I76 A;  1CK7 A;  2W14 A;  5JMY A;  5D1S A;  1JAP A;  1I73 A;  4L6T A;  1PWW A;  3KHI A;  2WO8 A;  1JIZ A;  1ZP5 A;  5I0L A;  1OS2 A;  2Y6D A;  2MZH A;  2W15 A;  4GR0 A;  1IAG A;  1R55 A;  1RMZ A;  2MZI A;  3LIL A;  5CZM A;  2O3E A;  3LJG A;  3F1A A;  4JIJ A;  1GO8 P;  1UMS A;  3EWJ A;  4I03 A;  2K2G A;  4IN9 A;  4H82 A;  4H84 A;  1HY7 A;  2AIG P;  2RJP A;  3G42 A;  4GWN A;  3HBV P;  1R54 A;  3KWV C;  4G9L A;  1ZVX A;  3CKI A;  4H30 A;  1UTZ A;  2W12 A;  1BSW A;  4H49 A;  1FLS A;  1SLN A;  1EUB A;  3LUM A;  1BQQ M;  2RJQ A;  4ILW D;  3LE9 A;  1D8F A;  2ERP A;  3DWB A;  4DF9 A;  1HV5 A;  4Q1L A;  1S4B P;  1BUV M;  5BOY A;  1CAQ A;  1JJ9 A;  3DL1 A;  2JNP A;  4PKW A;  2USN A;  3LEA A;  4AUO A;  4PKS A;  4DD8 A;  1CXV A;  3DSL A;  3B8Z A;  3DPE A;  1K7I A;  1CGL A;  3WV3 A;  1OS9 A;  1UEA A;  4WF6 A;  1QIB A;  3HDB A;  2OW1 A;  2DW2 A;  5B5P A;  2O36 A;  4QKZ A;  1KBC A;  4WK7 A;  3I7I A;  1K7Q A;  1OM6 A;  5CXA A;  2KRJ A;  3LQB A;  4HX3 A;  1XUC A;  3KEC A;  1R1I A;  4FVL A;  3DNG A;  1XFY A;  2OXU A;  1BUD A;  3EHY A;  3TS4 A;  3LJT A;  1OMJ A;  1O0Q A;  3OHO A;  1SU3 A;  2MLR A;  2XS4 A;  3EDZ A;  2POJ A;  1JK3 A;  2D1N A; 
#chains in the Genus database with same CATH topology
 2OW0 A;  1BKC A;  4IUW A;  1BQO A;  3DTK A;  1UMT A;  1HOV A;  1C3I A;  4AIG A;  1Y93 A;  2ERO A;  1Y8J A;  1USN A;  4J4M A;  1ZXV A;  2YB9 A;  1Y0V A;  1IAE A;  5I2Z A;  3OHL A;  2V4B A;  3LIR A;  4IJO A;  1C8T A;  2FV5 A;  4I35 A;  1QJJ A;  1D5J A;  1C7K A;  4AXQ A;  1CIZ A;  4L63 A;  3HYG A;  2W0D A;  1XUD A;  3LGP A;  3TSK A;  5D2B A;  3O64 A;  1QIC A;  1AKL A;  2OI0 A;  4A3W A;  1SLM A;  3MA2 A;  1ROS A;  3RTT A;  2Y6C A;  2X3C A;  1KUH A;  4GWM A;  1GKD A;  3N2U A;  3EDH A;  1ATL A;  5I12 A;  1WNI A;  1SAT A;  1EAK A;  1MMQ A;  1AYK A;  3LKA A;  1BKC E;  3U1R A;  3DTI A;  4JP4 A;  2A8H A;  2OVZ A;  1OM8 A;  1MNC A;  5I4O A;  2OZR A;  2W13 A;  1XFW A;  1RM8 A;  2FV9 A;  2X3B A;  2TCL A;  2MZE A;  4GUY A;  1BM6 A;  4H1Q A;  2E3X A;  2JSD A;  3VI1 A;  4XCT A;  3AIG A;  1XFX A;  1YP1 A;  4HMA A;  5I3M A;  456C A;  3EDI A;  3WV1 A;  1GE6 A;  1R1H A;  1KUK A;  3F18 A;  5B5O A;  3E8R A;  1TVI A;  4AYK A;  2YIG A;  1OO9 A;  3NX7 A;  1QIA A;  2OY4 A;  3K7L A;  4PKU A;  3I7G A;  4PKV A;  3ZUK A;  3F19 A;  4GQL A;  4DV8 A;  4H3X A;  1HFS A;  4WKI A;  1IAB A;  1PWU A;  1ZTQ A;  3F16 A;  3F15 A;  2HU6 A;  2Z2D A;  1I1I P;  3GBO A;  3KEK A;  3EHX A;  2J83 A;  1Z3J A;  1KUF A;  1J7N A;  3LUN A;  4L19 A;  5BPA A;  3L0T A;  4GR8 A;  3O2X A;  4R3V A;  2JT5 A;  2SRT A;  3L0V A;  3UVC A;  1JAO A;  4WZV A;  2WO9 A;  3ZXH A;  2AYK A;  1AF0 A;  4WKE A;  4GR3 A;  1AST A;  3DPF A;  4FXY P;  4FU4 A;  1JAQ A;  3HB2 P;  2CLT A;  4JPA A;  1OZ9 A;  1EB6 A;  1QJI A;  1FM1 A;  3LIK A;  3ZVS A;  1ZXC A;  2L0R A;  1IAC A;  1XFU A;  1G12 A;  1CQR A;  2PJT A;  4G0D A;  2QPJ A;  4JA1 A;  4XM8 A;  3LJZ A;  1D8M A;  1JH1 A;  1L6J A;  1H71 P;  3AYK A;  2DDF A;  4CTH A;  5D1T A;  3B92 A;  1JAN A;  1KAP P;  4A7B A;  4PKR A;  2OVX A;  3SHI A;  1JKY A;  1JIW P;  3TT4 A;  1FBL A;  1MMB A;  3LK8 A;  2MLS A;  4DPE A;  1HFC A;  2DW1 A;  2OXZ A;  2OY2 A;  1GKC A;  3N2V A;  1HTD A;  1KUG A;  2OXW A;  3RTS A;  3KEJ A;  3HDA P;  1SMP A;  1PWP A;  1GXD A;  4L7A A;  1CGF A;  1MMP A;  2JIH A;  3HBU P;  3KME A;  2E2D A;  3BA0 A;  1IAD A;  1BKC I;  1IAA A;  2X3A A;  1XFV A;  4ZR5 A;  1SRP A;  1O0T A;  1YCM A;  3HY9 A;  3P24 A;  1Q3A A;  3TVC A;  3KRY A;  1G4K A;  1G9K A;  1XFZ A;  4XM6 A;  2D1O A;  4PKT A;  4EFS A;  2OW2 A;  1A85 A;  2N8R A;  2XS3 A;  1ZS0 A;  1KUI A;  5I43 A;  1D7X A;  3K7N A;  1QUA A;  2X7M A;  4ON1 A;  1PWV A;  4JQG A;  1B3D A;  1BZS A;  2YUF A;  3F17 A;  1ND1 A;  3DTE A;  5BOT A;  1R1J A;  1YOU A;  2J0T A;  1XUR A;  4FXQ A;  3USN A;  4GF1 A;  2DDY A;  1G05 A;  2DW0 A;  5CUH A;  3ELM A;  1BIW A;  1DMT A;  1GO7 P;  3VTG A;  2WOA A;  5LAB A;  1UTT A;  2CKI A;  2I47 A;  1CGE A;  1A86 A;  5D3C A;  1YQY A;  3G5C A;  3LMC A;  1MMR A;  5H8X A;  4XBH A;  2K9C A;  3P1V A;  4PKQ A;  2OW9 A;  3HY7 A;  5L79 A;  3B2Z A;  3Q2G A;  5D1U A;  3Q2H A;  3LQ0 A;  1B8Y A;  3AYU A;  5D7W A;  4XM7 A;  1GE5 A;  3WV2 A;  830C A;  1DTH A;  1OM7 A;  1K7G A;  2ERQ A;  2JT6 A;  966C A;  5L7F A;  3EDG A;  3KMC A;  4H76 A;  1G49 A;  1GE7 A;  4H2E A;  1PWQ A;  3V96 B;  1I76 A;  1CK7 A;  2W14 A;  5JMY A;  5D1S A;  1JAP A;  1I73 A;  4L6T A;  1PWW A;  3KHI A;  2WO8 A;  1JIZ A;  1ZP5 A;  5I0L A;  1OS2 A;  2Y6D A;  2MZH A;  2W15 A;  4GR0 A;  1IAG A;  1R55 A;  1RMZ A;  2MZI A;  3LIL A;  5CZM A;  2O3E A;  3LJG A;  3F1A A;  4JIJ A;  1GO8 P;  1UMS A;  3EWJ A;  4I03 A;  2K2G A;  4IN9 A;  4H82 A;  4H84 A;  1HY7 A;  2AIG P;  2RJP A;  3G42 A;  4GWN A;  3HBV P;  1R54 A;  3KWV C;  4G9L A;  1ZVX A;  1XM5 A;  3CKI A;  4H30 A;  1UTZ A;  2W12 A;  1BSW A;  4H49 A;  1FLS A;  1SLN A;  1EUB A;  3LUM A;  1BQQ M;  2RJQ A;  4ILW D;  3LE9 A;  1D8F A;  2ERP A;  3DWB A;  4DF9 A;  1HV5 A;  4Q1L A;  1S4B P;  1BUV M;  5BOY A;  1CAQ A;  1JJ9 A;  3DL1 A;  2JNP A;  4PKW A;  2USN A;  3LEA A;  4AUO A;  4PKS A;  4DD8 A;  1CXV A;  3DSL A;  3B8Z A;  3DPE A;  1K7I A;  1CGL A;  3WV3 A;  1OS9 A;  1UEA A;  4WF6 A;  1QIB A;  3HDB A;  2OW1 A;  2DW2 A;  5B5P A;  2O36 A;  4QKZ A;  1KBC A;  4WK7 A;  3I7I A;  1K7Q A;  1OM6 A;  5CXA A;  2KRJ A;  3LQB A;  4HX3 A;  1XUC A;  3KEC A;  1R1I A;  4FVL A;  3DNG A;  1XFY A;  2OXU A;  1BUD A;  3EHY A;  3TS4 A;  3LJT A;  1OMJ A;  1O0Q A;  3OHO A;  1SU3 A;  2MLR A;  2XS4 A;  3EDZ A;  2POJ A;  1JK3 A;  2D1N A;  1XAX A; 
#chains in the Genus database with same CATH homology
 2OW0 A;  1BKC A;  4IUW A;  1BQO A;  3DTK A;  1UMT A;  1HOV A;  1C3I A;  4AIG A;  1Y93 A;  2ERO A;  1Y8J A;  1USN A;  4J4M A;  1ZXV A;  2YB9 A;  1Y0V A;  1IAE A;  5I2Z A;  3OHL A;  2V4B A;  3LIR A;  4IJO A;  1C8T A;  2FV5 A;  4I35 A;  1QJJ A;  1D5J A;  1C7K A;  4AXQ A;  1CIZ A;  4L63 A;  3HYG A;  2W0D A;  1XUD A;  3LGP A;  3TSK A;  5D2B A;  3O64 A;  1QIC A;  1AKL A;  2OI0 A;  4A3W A;  1SLM A;  3MA2 A;  1ROS A;  3RTT A;  2Y6C A;  2X3C A;  1KUH A;  4GWM A;  1GKD A;  3N2U A;  3EDH A;  1ATL A;  5I12 A;  1WNI A;  1SAT A;  1EAK A;  1MMQ A;  1AYK A;  3LKA A;  1BKC E;  3U1R A;  3DTI A;  4JP4 A;  2A8H A;  2OVZ A;  1OM8 A;  1MNC A;  5I4O A;  2OZR A;  2W13 A;  1XFW A;  1RM8 A;  2FV9 A;  2X3B A;  2TCL A;  2MZE A;  4GUY A;  1BM6 A;  4H1Q A;  2E3X A;  2JSD A;  3VI1 A;  4XCT A;  3AIG A;  1XFX A;  1YP1 A;  4HMA A;  5I3M A;  456C A;  3EDI A;  3WV1 A;  1GE6 A;  1R1H A;  1KUK A;  3F18 A;  5B5O A;  3E8R A;  4AYK A;  2YIG A;  1OO9 A;  3NX7 A;  1QIA A;  2OY4 A;  3K7L A;  4PKU A;  3I7G A;  4PKV A;  3ZUK A;  3F19 A;  4GQL A;  4DV8 A;  4H3X A;  1HFS A;  4WKI A;  1IAB A;  1PWU A;  1ZTQ A;  3F16 A;  3F15 A;  2HU6 A;  2Z2D A;  1I1I P;  3GBO A;  3KEK A;  3EHX A;  2J83 A;  1Z3J A;  1KUF A;  1J7N A;  3LUN A;  4L19 A;  5BPA A;  3L0T A;  4GR8 A;  3O2X A;  4R3V A;  2JT5 A;  2SRT A;  3L0V A;  3UVC A;  1JAO A;  4WZV A;  2WO9 A;  3ZXH A;  2AYK A;  1AF0 A;  4WKE A;  4GR3 A;  1AST A;  3DPF A;  4FXY P;  4FU4 A;  1JAQ A;  3HB2 P;  2CLT A;  4JPA A;  1EB6 A;  1QJI A;  1FM1 A;  3LIK A;  3ZVS A;  1ZXC A;  2L0R A;  1IAC A;  1XFU A;  1G12 A;  1CQR A;  2PJT A;  4G0D A;  2QPJ A;  4JA1 A;  4XM8 A;  3LJZ A;  1D8M A;  1JH1 A;  1L6J A;  1H71 P;  3AYK A;  2DDF A;  4CTH A;  5D1T A;  3B92 A;  1JAN A;  1KAP P;  4A7B A;  4PKR A;  2OVX A;  3SHI A;  1JKY A;  1JIW P;  3TT4 A;  1FBL A;  1MMB A;  3LK8 A;  2MLS A;  4DPE A;  1HFC A;  2DW1 A;  2OXZ A;  2OY2 A;  1GKC A;  3N2V A;  1HTD A;  1KUG A;  2OXW A;  3RTS A;  3KEJ A;  3HDA P;  1SMP A;  1PWP A;  1GXD A;  4L7A A;  1CGF A;  1MMP A;  2JIH A;  3HBU P;  3KME A;  2E2D A;  3BA0 A;  1IAD A;  1BKC I;  1IAA A;  2X3A A;  1XFV A;  4ZR5 A;  1SRP A;  1O0T A;  1YCM A;  3HY9 A;  3P24 A;  1Q3A A;  3TVC A;  3KRY A;  1G4K A;  1G9K A;  1XFZ A;  4XM6 A;  2D1O A;  4PKT A;  4EFS A;  2OW2 A;  1A85 A;  2N8R A;  2XS3 A;  1ZS0 A;  1KUI A;  5I43 A;  1D7X A;  3K7N A;  1QUA A;  2X7M A;  4ON1 A;  1PWV A;  4JQG A;  1B3D A;  1BZS A;  2YUF A;  3F17 A;  1ND1 A;  3DTE A;  5BOT A;  1R1J A;  1YOU A;  2J0T A;  1XUR A;  4FXQ A;  3USN A;  4GF1 A;  2DDY A;  1G05 A;  2DW0 A;  5CUH A;  3ELM A;  1BIW A;  1DMT A;  1GO7 P;  3VTG A;  2WOA A;  5LAB A;  1UTT A;  2CKI A;  2I47 A;  1CGE A;  1A86 A;  5D3C A;  1YQY A;  3G5C A;  3LMC A;  1MMR A;  5H8X A;  4XBH A;  2K9C A;  3P1V A;  4PKQ A;  2OW9 A;  3HY7 A;  5L79 A;  3B2Z A;  3Q2G A;  5D1U A;  3Q2H A;  3LQ0 A;  1B8Y A;  3AYU A;  5D7W A;  4XM7 A;  1GE5 A;  3WV2 A;  830C A;  1DTH A;  1OM7 A;  1K7G A;  2ERQ A;  2JT6 A;  966C A;  5L7F A;  3EDG A;  3KMC A;  4H76 A;  1G49 A;  1GE7 A;  4H2E A;  1PWQ A;  3V96 B;  1I76 A;  1CK7 A;  2W14 A;  5JMY A;  5D1S A;  1JAP A;  1I73 A;  4L6T A;  1PWW A;  3KHI A;  2WO8 A;  1JIZ A;  1ZP5 A;  5I0L A;  1OS2 A;  2Y6D A;  2MZH A;  2W15 A;  4GR0 A;  1IAG A;  1R55 A;  1RMZ A;  2MZI A;  3LIL A;  5CZM A;  2O3E A;  3LJG A;  3F1A A;  4JIJ A;  1GO8 P;  1UMS A;  3EWJ A;  4I03 A;  2K2G A;  4IN9 A;  4H82 A;  4H84 A;  1HY7 A;  2AIG P;  2RJP A;  3G42 A;  4GWN A;  3HBV P;  1R54 A;  3KWV C;  4G9L A;  1ZVX A;  3CKI A;  4H30 A;  1UTZ A;  2W12 A;  1BSW A;  4H49 A;  1FLS A;  1SLN A;  1EUB A;  3LUM A;  1BQQ M;  2RJQ A;  4ILW D;  3LE9 A;  1D8F A;  2ERP A;  3DWB A;  4DF9 A;  1HV5 A;  4Q1L A;  1S4B P;  1BUV M;  5BOY A;  1CAQ A;  1JJ9 A;  3DL1 A;  2JNP A;  4PKW A;  2USN A;  3LEA A;  4AUO A;  4PKS A;  4DD8 A;  1CXV A;  3DSL A;  3B8Z A;  3DPE A;  1K7I A;  1CGL A;  3WV3 A;  1OS9 A;  1UEA A;  4WF6 A;  1QIB A;  3HDB A;  2OW1 A;  2DW2 A;  5B5P A;  2O36 A;  4QKZ A;  1KBC A;  4WK7 A;  3I7I A;  1K7Q A;  1OM6 A;  5CXA A;  2KRJ A;  3LQB A;  4HX3 A;  1XUC A;  3KEC A;  1R1I A;  4FVL A;  3DNG A;  1XFY A;  2OXU A;  1BUD A;  3EHY A;  3TS4 A;  3LJT A;  1OMJ A;  1O0Q A;  3OHO A;  1SU3 A;  2MLR A;  2XS4 A;  3EDZ A;  2POJ A;  1JK3 A;  2D1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...