2L0WA

Solution nmr structure of the n-terminal pas domain of herg potassium channel
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-Terminal Tail of hERG Contains an Amphipathic alpha-Helix That Regulates Channel Deactivation
pubmed doi rcsb
molecule keywords Potassium voltage-gated channel, subfamily H (Eag-related),
molecule tags Membrane protein
source organism Homo sapiens
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l0wA01
3H82A 3LIBA 3UMDA 3VOLA 4L9EA 2VV7A 5J3WA 3UB6A 3LIAA 2VV6A 3GECA 2H28A 1G28A 4WUJA 2L0WA 4JGPA 4EEUA 4I39A 3BY9A 3UE6A 1OTBA 4HHDA 4LRZE 3NOUC 3C8CA 4F3LA 4NXBA 3LIFA 3K3CA 2Z6CA 2QJ5A 3PYPA 4GS9B 5EFWA 2EA9A 2JHEA 2J80A 1GSXA 1XFNA 4HOIA 5HD3A 4JGRA 3RH8B 3ICYA 1P97A 5KIZA 1F98A 4BBUA 4HJ3A 4HY8A 1S67L 3UB9A 4HH3A 3IBRA 3NOPC 4F3LB 1LSVA 4KUKA 4R70A 4R3AA 2WKPA 4KQDA 2D01A 3LICA 4HQAA 4I38A 1WA9A 2KDKA 1XJ4A 3A0RA 5F5YA 1TS0A 4DJ3A 1Y28A 3D72A 3LIDA 4BBTA 4H6JA 3VE3A 3IS2A 5G4ZA 4R6LA 2PD8A 1X0OA 1UWPX 1D7EA 2GJ3A 1XJ6A 4B9OA 5J4EA 3B33A 3F1NA 5HWVA 1OTEA 1ODVA 4PKYG 3ULFA 3F1OA 5DJTA 4HJ4A 4H6JB 3HJKA 3C2WA 2QKPA 2ZBBA 3IS2B 1XFQA 1BYWA 5HZHA 2INWA 5HWWA 2VEAA 5AVFA 3UMEA 2R78A 3BY8A 4GW9A 1XJ3A 4I3JA 2OWJA 4HP4A 1TS6A 3CWFA 3F1NB 3MQQA 4GS9A 1T1BA 2PHYA 1NWZA 2CMNA 3LYXA 3ZQ5A 1OT6A 3F1OB 2B02A 2ZOIA 4LLOB 2OOLA 1OJGA 2V9AA 5A8BA 5HDDA 1S4SA 2JN7A 3E4OA 4LRYC 2W0NA 3RTYA 4JGOA 4YWZA 1S66L 1T1CA 1DP6A 2KX6A 1XJ2A 3A0VA 4L9FA 4LPZA 5HWTA 4HIAA 3EEHA 5DKLA 1LSXA 2PYPA 1GSWA 4K08A 2HV1A 2VLGA 3MQOA 3P7NA 1TS7A 1UGUA 5I5LA 3MXQA 5F68A 4HNBA 4LRXC 4M4XA 3OLOA 3GDIA 1MZUA 1S1YA 5DJUA 1D06A 2YKFA 3K3DA 1N9LA 4NXEA 1F9IA 3LIEA 3E4PA 2PYRA 5HSQA 1LT0A 1LSWA 4EERA 1OTDA 3E4QA 2VV8A 1DP8A 2QWSA 1OTIA 1GSVA 1N9OA 1V9YA 2I9VA 2BASA 2L4RA 4WN5A 5TBMB 5F69A 3CLOA 2D02A 4XT2A 3LI8A 3KX0X 4I3AA 3LUQA 3CAXA 3SW1A 4BBVA 3VE4A 4I5SA 3F1PA 3MJQA 4I3IA 4PKYA 4WL9A 3MR0A 4EETB 4EEPA 1LL8A 4EXOA 3UB8A 2A24A 3HJIA 5DKKA 4XT2B 1JNUA 5J7EA 4HJ6A 5HDCA 3FG8A 3NHQA 1V9ZA 3H82B 3FC7A 1VB6A 1OTAA 5HD5A 4R38A 3F1PB 1T1AA 4GHIA 3G6OA 1TS8A 2ZOHA 2W27A 3NOTC 2A24B 4NXFA 5HDSA 2PR6A 2V1AA 4JGQA 1DP9A 3H7WA 4HH2A 4HP9A 2QHKA 1UWNX 1KOUA 3T50A 1OJ5A 2P7JA 1T19A 4HI4A 4EESA 2L1MA 4MN6A 1S1ZA 2K7SA 4MN5A 4GHIB 3LI9A 4NXGA 2V0UA 2WKRA 5TBMA 3H7WB 3BWLA 4EQ1A 4GCZA 4RQ9A 1N9NA 5G4YA 2V1BA 2PR5A 4EW7A 1EW0A 3NJAA 4DJ2A 5IS1A 2WKQA 4KUOA 3MFXA 2PDRA 3UB7A 5F6AA 3EWKA 2Z6DA 1DRMA 2OWHA 1P0ZA 2YKHA 5AVEA 4E04A 1OT9A 3A0SA 2M1CA 2V0WA 1T18A 3H9WA 1S4RA 2PD7A 4L9GA 4WF0A 2QJ7A 4WLAA 3PHYA 5IU1A
chains in the Genus database with same CATH superfamily
3HLFA 3S7NA 3LIBA 3VOLA 5C5KA 2HP9A 1KGEA 5HAQA 3SH9A 3IF6A 3ITBA 5J3WA 5DFYA 3LIAA 3UB6A 4N9LA 4WELA 3GRJA 4X68A 3GECA 2JKRI 3DW0A 4BJPA 2ZJ9A 4UAAA 3HUOA 4ETZA 1ONHA 2Y2KA 4MLLA 1OTBA 4MBFA 1NYYA 4NXBA 2MJ6A 3T1SA 3IF6B 2O9BA 5HD3A 2GDNA 2W1TB 3DWZA 3HCYA 2Q0OA 1WYBA 2AVXA 3ICYA 4MBKA 1P97A 1M6KA 3SOIA 1S67L 3QP4A 2E8IA 3KSFA 3DAVA 4R3AA 1L0EA 2OV5A 3UNWA 3WS1A 3A3JA 4ZJ2A 5M19A 5F1FA 4E6XA 3PAEA 1WA9A 4JXGA 2FFYA 3A0RA 4LCLA 3T12B 3EGXC 3DTIA 4H8RA 1YSPA 4EBPA 2Y59A 3C38A 4G3VA 2VGLM 4H6JA 1Q2PA 5CEBA 4C6YA 4DXCA 2VKSA 1NXYA 3MQ0A 4CLCB 3PTEA 1I2SA 1LL9A 5CRFA 4UA7A 1OTEA 3IX8A 1VEUB 3IQAA 4Y0OA 5FI2A 3TW8A 4C75A 4Y15A 2XROA 4ID4A 4H6JB 3HJKA 4MDZA 3P09A 2ZBBA 1XFQA 3HL9A 2Y8HA 2INWA 3L9KA 5HZHA 1H5XA 3UMEA 3BY8A 3HREA 5A93A 5CHJA 4JKTA 3SS5A 5J8XA 1FILA 2HDSA 3MFDA 4U3TA 4HP4A 3MZFA 3OCNA 4BLMA 4OQGA 4O8GA 2CMNA 3A3DA 4O7DA 3ITAA 2W3HA 3W4PA 1G5UA 5EM0A 4BD1A 3PBSA 3BFFA 3S4XA 5GHZA 2X71A 3DTKA 2V9AA 1S4SA 2JN7A 4LRYC 3VOYA 1FCMA 5AQAA 3W8KA 1LLBA 5U47A 4E3OA 3Q7ZA 5TGFA 3UE0A 3V50A 4LPZA 5HPIA 4Y5FA 1Z6FA 3UY6A 3NC8A 2DNSA 4PAUA 3IX3A 2PYPA 1YLZA 3N6IA 4K08A 2XFSA 2HV1A 3UPPA 2ZC7A 1KVMA 3MQOA 3IT9A 1K56A 4ARZA 3ZG0A 2PBYA 5DF7A 4S2IA 5EUAA 1BLPA 1J3WA 4ETXA 1IEMA 3EQUA 3NY4A 4IUHA 2JCHA 1F5MA 1XPBA 3GDIA 2M7VA 4WZ5C 1S1YA 4LV0A 3WS4A 5DJUA 3Q07A 1IYQA 1YMSA 1H3QA 2HP5A 1N9LA 3ZGAB 4LV2A 3TOIA 4X56A 3BFGA 1MWTA 4L0LA 3ZG8B 4A5RA 3T1XA 2J9OA 5A91A 1H8YA 5TR7A 1OTDA 5EVIC 4P6ZM 2ZM2A 3NDEA 2VV8A 5EOEA 1WYCA 1JWPA 2XA7M 4KZAA 2XRNA 4FH2A 4DXBA 4IVIA 2KOIA 4EWFA 3IX4A 2L4RA 1CI8A 1L0FA 2Y2MA 1ERQA 4WYYA 4E3JA 4R3JA 4XT2A 1GHIA 3LI8A 3T1QB 2HPBA 2K31A 1YLJA 4WBGA 4I3AA 3ZFZA 4Y17A 1W63Q 5AQ9A 3HLBA 3LUQA 3A3FA 3CAXA 1FCOA 1TDGA 2EFXA 2Y79A 3EOIA 4PHTA 3TSGA 3MR0A 4D60A 4OQIA 4MCWA 4QY6A 4EEPA 2J3TD 3IWOA 2A24A 3O5YA 4YFMA 3QHYA 5DKKA 4XT2B 4HJ6A 2VK3A 3NHQA 1V9ZA 4KZ6A 1DJBA 3H82B 3FC7A 5DTKA 1ZG4A 1OTAA 3ZDJA 5HD5A 1S0WA 5L8MA 3GV9A 1MY8A 1BTLA 4FOFA 2A24B 4NXFA 3LR4A 3Q81A 5GL9A 1DP9A 3LO7A 4HH2A 1G6OA 4EUZA 5HL6A 5LBRA 3DBAA 4HI4A 2L1MA 4KQRA 4O01A 5AJGA 2P74A 3WRZA 4JPMA 1YPRA 2OSUA 2G2WA 2Y2NA 2EX6A 4QHCA 1PI5A 1Y4OA 4HESA 4HBUA 1K54C 5EVIA 3CHWP 4PM9A 3BFEA 1JTGA 1XXMA 4EW7A 1EW0A 5IS1A 3PBTA 1ES5A 4NK3A 3TRCA 2BG1A 1IELA 2X02A 1MKMA 2Z6DA 1DRMA 4E04A 1OT9A 2M1CA 1TDLA 4NETA 5EVIB 3IH9A 3RFBA 1KE0A 1S4RA 1ALQA 1JVJA 5L10A 4BQMA 4Z9QA 3EQVA 1FSYA 3DWKA 2VA0A 4WLAA 3BECA 3E2KA 1MWRA 3UMDA 4E3MA 2CC1A 1BLCA 5HARA 5EVEA 2VV7A 2VV6A 2WKEA 5KSHA 3HVFA 1G28A 3ZG7B 2WGWA 3CG5A 5CTNA 3G35A 4DN0A 5HL1A 4JGPA 4EEUA 3T4QA 4OOLA 1ES2A 4GDBA 4HHDA 3NOUC 4F3LA 5AQ7A 3CUEC 3LIFA 2Z6CA 3C5AA 5FQQA 5GHXA 4FCFA 2QJ5A 2ZQ7A 2EA9A 4E3LA 1XFNA 4HOIA 2J3WA 4JGRA 1YAXA 4X6TA 1BLHA 5HPFA 2WGWB 5KIZA 4RX2A 3S7PA 1MXOA 3OPLA 4C3QA 5E2HA 4ESPA 3O87A 1RGZA 4HH3A 3T4KA 4F3LB 4KUKA 1PFLA 3LFVA 4QB8A 2C5WB 2EX2A 4R70A 3LEZA 3JPUA 3GMWA 3C4OA 3O86A 3QNCA 1K6RA 2D01A 2I72A 3LICA 4HQAA 4DMZA 4I38A 2H0YA 1K54A 3E0YA 5FSRA 4DE3A 4DJ3A 1W7FA 1Y28A 2BLSA 3NBLA 4BBTA 5HFOA 3ZNTA 4PM7A 3BQ8A 1KDSA 1N9BA 3IS2A 1ZHHB 3SS3A 4NEED 4R6LA 5E2FA 5CHMA 3TG9A 1W79A 4B93A 1XJ6A 1P9RA 4B9OA 1EWZA 1BZAA 3HUNA 1TVFA 4ZRRA 4LGWA 4P87A 5FL3A 1ES3A 1VM1A 4LV1A 4X55A 4DKIA 4HJ4A 1IFQA 3QP5A 2EFUA 3IS2B 1TD5A 4S2NC 4GLQA 3UDXA 4BWIA 5DF9A 2E8JA 2IWDA 3CPTA 1MC0A 1XJ3A 1TS6A 4S2MA 1LI0A 3K2NA 2PHYA 2W1TA 1PWCA 3OZHA 1TF1A 4BD0A 1GCEA 3QP6A 1PW1A 4EQIA 2ZC6B 3CUEA 3BW6A 3ZYTA 1E4DA 4PM5A 3CPTB 2VZWA 3WS5A 5FATA 3GQZA 5HDDA 4JGOA 4ZTKA 4R0QA 5CTMA 2HDUA 1EROA 2ACGA 2W3FA 3MKFA 3BRMA 4UEYA 5AQBA 2PRFA 3LGOA 1YQSA 4JXVA 3HLDA 1XJ2A 3P98A 3EEHA 2A3UA 2HGVA 5DKLA 5M1AA 1LSXA 3G34A 4GD8A 4R4RA 1ESIA 2GX5A 1QMEA 4P6BA 4P0MA 4B4ZA 2VLGA 3MZEA 4CLCA 2ZMFA 1YMXA 3WS2A 3SH7A 1CF0A 1VEUA 3G31A 3ISGA 3Q1FA 5F68A 5E2GA 2WKHA 4LRXC 5FAPA 4PPRA 2JE5A 4EU0A 4DE2A 3B42A 2V20A 4R1GA 1KVLA 3NI9A 2HDRA 2PYRA 1NRFA 5HSQA 1LT0A 4GNUA 1K57C 2JKRM 4EERA 4HBTA 4OP5A 3BQAA 2H5SA 4QU3A 5L2FA 4Y3IA 1H8ZA 1OTIA 1GSVA 1N9OA 1V9YA 5L07A 2X01A 4WN5A 5TBMB 2C6WB 3LR0A 3LR5A 3V67A 3PBNA 2VGLS 3S7OA 4IHQA 5I94A 3HLGA 4YNRA 3IXHA 4OPRA 3DTEA 4GDNA 3VE4A 1HD8A 4WEKA 3NCKA 4OONA 3F1PA 1O07A 3JYIA 5EPHA 1ACFA 3VP3A 1LL8A 2OAP1 2Q9MA 1K0KA 3HJIA 2OLUA 1K55C 1K38A 1H8MA 4JXWA 3IBJA 1W63M 2PU4A 5L09A 1JTDA 1VB6A 2V1ZA 3F1PB 1T1AA 3UDIA 4E6WA 1YT4A 3LR3A 3MXSA 1TS8A 2FH5A 3ZHHA 2DMWA 5A92A 2ZMAA 2PAVP 3LY4A 3PR6A 4N92A 2PR6A 2V1AA 2B5RA 4HP9A 3U2AA 2QHKA 1PI4A 1AWIA 1KOUA 5CERA 3T50A 5KMWA 1ZC2A 3VP4A 2HF6A 2EWVA 2ZQDA 4EESA 2QPNA 3OPHA 1SDEA 4CLCD 1KDWA 1XX2A 2XR0A 1S1ZA 2K7SA 4MN5A 4KZ7A 3Q7VA 4RX3A 3AGFA 2WKRA 4FUWA 1NZUA 2P08A 5CGXA 4N1HA 2Y2JA 2ZQAA 1K57A 4N1XA 4OLGA 4EQ1A 4IEDA 4GCZA 3CZDA 4E3KA 5G4YA 4ZBEA 2QMIA 2ZQ9A 4S2PA 4IBRA 1IKGA 1CI9A 3NJAA 3Q7VB 4KUOA 1AXBA 1SHVA 2EX8A 5F6AA 2XSSA 3OCLA 2ZQCA 2OWHA 1XKZA 2V0WA 3H9WA 2R9XA 4OKPA 1KE3A 4R3BA 4L9GA 4Y0TA 2NUPC 4WZ4A 4LCMA 2QJ7A 3PBQA 3PHYA 4YOFA 4JGQA 1LL5A 3H82A 1HLUP 4MNRA 3OC2A 3V39A 2VJWA 4L9EA 2P9VA 5HAIA 4JF6A 3N7WA 4IBXA 4NG2A 4OLDA 2H28A 5EM1A 4EV4A 2ZLYA 4P6ZS 2L0WA 3BFDA 3NULA 4I39A 1MWSA 3C8CA 1YM1A 3NIAA 5DTSA 2P9VB 3PYPA 3VMAA 4GS9B 5EFWA 2JHEA 4BL3A 4QJGA 4MMNA 4Y13A 1NRJA 3SS4A 3N8RA 4BBUA 3UB5P 4D2OA 5KZHA 4X53A 5E2EA 1G6AA 1Z09A 2ZD8A 3IBRA 4UQIM 2WGIA 1K6SA 1K56D 1SCWA 1MBLA 1RGYA 4WZ5A 1PNEA 3C7VA 1BT5A 3N4IA 4S2KA 2O9CA 3AGDA 1XJ4A 4G3KA 1L2SA 4DRTA 1MPLA 5MC7A 2XDMA 3TJZC 5GLBA 3UPNA 3EGDC 4RVAA 3VE3A 5FEGA 3SH8A 5G4ZA 2R9WA 2XQZA 4Y2FA 2PD8A 5EE8A 3VSKA 5JYPA 2Y2GA 2GJ3A 3P01A 4Q0IA 3S22A 3B33A 3F1NA 2JKTM 2WYXA 4E3NA 2XD1A 3R7WB 4PKYG 3ULFA 3PAGA 3MMHA 3C4PA 3CMZA 3C2WA 4GZBA 2W3EA 1GA9A 1BYWA 3UDFA 2ZC3B 3IHAA 3MSHA 1E3UA 2R78A 4ZAMA 4GW9A 1NYMA 2GZAA 3NECA 2H0TA 2OWJA 3F1NB 3MQQA 3WS0A 4JF4A 3IF5A 4E3IA 3KYQA 4S2LA 3LYXA 3ZQ5A 3BFCA 4WMCA 2ZOIA 1OMEA 4LLOB 4ZJ1A 1KGFA 3FWLA 3GVBA 5TFQA 4DDYA 4X25A 2VGKA 3OPRA 1HZOA 2Y91A 3E4OA 2W0NA 1VQQA 4EBLA 1L3LA 1ZKJA 3UE1A 3CJMA 1JWVA 3G32A 2ZC5B 1XA7A 1DP6A 4QPRA 3ZVTA 2KX6A 3A0VA 4L9FA 5HWTA 2WAFA 1Q2QA 4PM6A 5HAPA 3T4OA 2Y2IA 4IUKA 4JXSA 1GSWA 3LCEA 5G18A 4R23A 1L0GA 4KZ3A 3P7NA 1UGUA 3ZCZA 3WWXA 2B18A 2W1RA 3T1RA 5I5LA 2IA2A 5EV0A 1YLWA 3MXQA 5GHYA 4M4XA 1SZVA 3BLMA 3GTCA 2HDQA 2XK1A 4B4XA 1MZUA 1BLSA 1CJFA 1IOUA 1ONGA 1F9IA 2Y4AA 5EVID 3JVVA 1PIOA 1GHPA 3E4PA 2PU2A 2XGNA 4GD6A 1LSWA 1FR6A 3VOZA 2WUQA 3DTMA 3ZVWA 1SDNA 5IHVA 1DP8A 2QWSA 2IWBA 3A3IA 3OBFA 4BENA 3HLEA 2OAQ1 1FR1A 2I9VA 3U4LP 2BASA 4MEZA 4ZDXA 4K91A 2PBDP 2H10A 3KX0X 2ZL1A 5GLDA 5JYOA 4UA9A 1M40A 4EUVA 3SW1A 3CITA 4BBVA 4U0TA 4I5SA 4KG6A 1PZOA 1J9MA 3E98A 4Z1WA 3W4QA 2XEPA 2Z2MB 2V8CA 3MJQA 1N4OA 4LFUA 3LY3A 4WL9A 5TJJA 2RCXA 4EETB 3B3XA 4WMCD 1SKFA 2K2NA 4FD8A 4M3KA 1PW8A 5FDSA 4OPYA 1JNUA 5J7EA 3KSIA 5DVAA 4KG5A 2ZL1B 3G2ZA 3BLSA 3FG8A 1FIKA 2J3TC 1IKIA 1KE4A 1CQAA 3VV4A 1YKDA 2Y2HA 3G4PA 2Y2LA 4R38A 4X1MA 3UPOA 4DE0A 4KZ8A 3W2ZA 4K0WA 3G6OA 2ZOHA 3VP2A 1XP4A 3NOTC 4RA7A 4XUZA 2WK0A 5HDSA 5K5BA 4G3WA 3H7WA 3G30A 4LV3A 1UWNX 5IT5A 3VFHA 5FDHA 3IH8A 5DF8A 3IWQA 2EXBA 1T19A 4DDSA 5FEFA 2Y2PA 1IYPA 3MBZA 3W4OA 3L7HA 4NXGA 4FTXA 2KLIA 2G7UA 1FOFA 3BM6A 1W8YA 2IWCA 2LB5A 3UE3A 3MKEA 5FAQA 3M6HA 5TBMA 3VP1A 3H7WB 4N9KA 3BWLA 1SKOA 4RQ9A 2M7UA 1PZPA 2Y2OA 1N9NA 4FH4A 4KZ5A 3TE8A 3AGEA 2ZQ8A 2W3GA 4S2NA 3S7QA 4GOGA 3V3SA 2WKQA 5FQMA 3VFFA 2XF3A 1CEFA 3MFXA 3BYDA 3KSGA 1XA1A 4KZ4A 2A2LA 5HX9A 1ZTUA 2EWWA 2YKHA 1WE4A 4OQ0A 4QD4A 4KENB 1SKOB 1T18A 3VP0A 2VX8A 4QY5A 2PD7A 1BUEA 4OPQA 2ZC4B 3GSGA 3BEBA 4WF0A 3FV7A 1FSWA 1XGIA 2BTFP 2O99A 2A49A 3ZG9B 1Y54A 3A3EA 2XH9A 2LB9A 4OQHA 4KG2A 4JF5A 2DCFA 1G68A 1ERMA 2DRWA 4GJ4A 3EEAA 5FAOA 1STZA 2UWXA 3IXDA 4WUJA 5GLCA 4K0XA 1RCJA 5HW3A 2WKIA 3BY9A 1YLTA 3PBRA 3UE6A 2XFTA 3KSHA 2J9PA 4LRZE 5FI7A 3QNBA 3K3CA 1YLPA 3M6BA 5D3OA 1BSGA 4PMAA 2J80A 1GSXA 3WRTA 4KZ9A 3RH8B 3KO6A 5FASA 4XUXA 1F98A 4OPZA 4HJ3A 4HY8A 5CX7A 3UB9A 2FZ0A 4S2OA 3FYZA 3D3OA 3NOPC 3C7UA 1LSVA 1NJ4A 4Y0UA 2PT7A 2J8YA 2UV0E 3HBRA 2WKPA 1ESUA 4KQDA 3HLCA 5F1GA 2KDKA 3CI6A 3OOVA 2GNXA 1FCNA 3G2YA 5F5YA 1TS0A 3HUMA 3D72A 3LIDA 4CJNA 1BULA 1PRQA 4KQQA 2NUTC 3NDGA 1X0OA 4OOMA 1UWPX 3QP1A 4ARZB 1D7EA 1LI9A 1P9WA 3MS6A 5J4EA 5HWVA 1ODVA 5FI6A 2JKFA 1L0DA 3IHBA 4Q8IA 2EXAA 3F1OA 4JBFA 5DJTA 2QKPA 5CGWA 1VETA 2B95A 5FQKA 3N8SA 5HWWA 4BL2A 2VEAA 5AVFA 2QYBA 4PM8A 4EBNA 3ZNYA 3D9YA 2ZM0A 2HZ5A 3I7JA 4I3JA 3S1YA 3CWFA 2HJ9C 4GS9A 5CXWA 4RYEA 1GHMA 1T1BA 5F83A 3E2LA 1K55A 1K4FA 1NWZA 1OT6A 5A90A 3F1OB 2B02A 1W5DA 3RXXA 3FZCA 2EX9A 1A0KA 3HLWA 1MWUA 2OOLA 1OJGA 1VETB 4Q0JA 3C30A 3M2JA 3Q82A 2XA7S 1ZG6A 3PXPA 5CECA 3IXBA 5A8BA 1HVBA 2JKTI 3FPWA 3RTYA 4YWZA 4WM9A 4O0PA 4IJGA 2QZ6A 1S66L 4CQHA 4Q0HA 1YSQA 1T1CA 2HP6A 5EVLA 4AFIA 3SZTA 2RL3A 3T4LA 1C3BA 1QMFA 4OH0A 4HIAA 5FQ9A 1HTZA 1FQGA 4R4SA 2WGVA 5CEDA 1NZOA 1PYYA 2O0YA 1TS7A 5EECA 1ES4A 5F82A 1VHMA 3LEQA 3JVUA 1YLYA 4OVDA 4HEFA 1O7EA 3IWIA 4KQOA 3R7WA 4HNBA 1DY6A 5DFXA 3T4TA 3OLOA 3KYZA 4NKPA 1S6RA 4WEJA 3IXGA 1D06A 2YKFA 3K3DA 3VSLA 2WZZA 4NXEA 5FQJA 1K4EA 4GB7A 3LIEA 1I2WA 2XLNA 5CGSA 4B88A 4YINA 4UQIS 2JKGA 5GLAA 2XD5A 3E4QA 3PBOA 2Y55A 3ZG5A 4ZJ3A 4GN2A 3GR2A 3V3RA 3UO9A 1MKIA 2WAEA 2V2FF 3KYEA 2HJEA 1TEMA 2JC7A 5F69A 3CLOA 4P85A 3MZDA 2D02A 1F2KA 5CHUA 3M2KA 1NLZA 4ME4A 4X69A 4S2JA 3B47A 2J7VA 2G2UA 4JLFA 3FKWA 3MXRA 4XXRA 3RXWA 1KGGA 4I3IA 4PKYA 2V8FA 1NY0A 4EXOA 3UB8A 3IF6C 4X1LA 2O9AA 2VGJA 5KSCA 3T4JA 5HDCA 4LENA 3QP2A 1IYOA 4FSFA 4CLCE 3FPVA 2ZM8A 1E25A 4U0XA 2Z2LB 3MF0A 3T4SA 3QP8A 2WADA 4GHIA 3O88A 2W27A 2Q9NA 3UN7A 1XGJA 4GKUA 1RP5A 5EOOA 4MN7A 1IYSA 3O3VA 1I5QA 2JBFA 5M18A 4QWOA 1OJ5A 1PWDA 2P7JA 2ZMVA 5FQIA 3V5MA 1W8QA 1GA0A 4KZBA 1LHYA 4MN6A 1OPXA 2OLVA 2Y2QA 3LI9A 4GHIB 1EI5A 4UA6A 2V0UA 4CPKA 1CK3A 4CLCC 4OP8A 4DE1A 1DJAA 4Y7PA 5E43A 4OOYA 3N8LA 3D4FA 5DTTA 1JWZA 2P04A 1NLYA 2FFFB 3FKVA 4UHUA 4DF6A 5BOHA 1PWGA 2V1BA 2PR5A 1H0MA 3R4KA 1U60A 4DJ2A 2W3DA 3RJUA 4II7A 2PDRA 3UB7A 3EWKA 1CEGA 1DJCA 2WZXA 1K25A 1P0ZA 5AVEA 3A0SA 4IVKA 3BJNA 4MBHA 4BMWA 1E3UD 4F94A 1D1JA 3OPPA 5FA7A 5IU1A
chains in the Genus database with same CATH topology
3H82A 2O99A 3LIBA 3S7NA 3UMDA 3OC2A 3VOLA 5C5KA 2VJWA 4L9EA 2VV7A 5J3WA 5DFYA 3LIAA 3UB6A 4WELA 2VV6A 2LB9A 3GECA 2JKRI 5KSHA 2H28A 4BJPA 4GJ4A 3EEAA 1G28A 1STZA 4WUJA 4P6ZS 4DN0A 2L0WA 4ETZA 4JGPA 4EEUA 4I39A 3BY9A 3PBRA 3T4QA 3UE6A 1OTBA 4OOLA 3KSHA 4HHDA 4LRZE 3NOUC 3C8CA 4F3LA 4NXBA 3CUEC 3LIFA 3K3CA 2Z6CA 2QJ5A 3PYPA 2MJ6A 4GS9B 5EFWA 2EA9A 2O9BA 2JHEA 2J80A 1GSXA 1XFNA 4HOIA 5HD3A 2J3WA 2W1TB 1YAXA 3HCYA 4JGRA 3RH8B 4MMNA 3KO6A 1NRJA 3ICYA 5HPFA 1P97A 5KIZA 1F98A 4BBUA 3S7PA 5IU1A 4HJ3A 4HY8A 5CX7A 1S67L 3UB9A 3KSFA 2FZ0A 4HH3A 3IBRA 3D3OA 3NOPC 3T4KA 4UQIM 4F3LB 1LSVA 4KUKA 3LFVA 2PT7A 4R70A 4R3AA 2WKPA 4KQDA 2D01A 3LICA 4HQAA 4DMZA 4I38A 1WA9A 2KDKA 2O9CA 3CI6A 1XJ4A 3OOVA 2GNXA 4G3KA 3E0YA 3A0RA 5F5YA 1TS0A 4DJ3A 3TJZC 5MC7A 3EGXC 1YSPA 1Y28A 3D72A 3LIDA 3C38A 4G3VA 4BBTA 3EGDC 2VGLM 3BQ8A 4H6JA 3VE3A 2VKSA 2NUTC 3IS2A 3MQ0A 5G4ZA 1ZHHB 4Y2FA 4NEED 4R6LA 2PD8A 1X0OA 4OOMA 1UWPX 4CLCB 4ARZB 1D7EA 2GJ3A 3P01A 4Q0IA 4B93A 1XJ6A 1P9RA 4B9OA 1P9WA 5J4EA 3B33A 4ZRRA 3F1NA 5HWVA 1OTEA 1ODVA 2JKTM 3TW8A 3R7WB 5FL3A 4PKYG 3ULFA 2XROA 3F1OA 3MMHA 5DJTA 4HJ4A 4H6JB 3HJKA 1IFQA 3C2WA 4MDZA 2QKPA 2W3EA 2ZBBA 3IS2B 1XFQA 1BYWA 2Y8HA 2INWA 1TD5A 4GLQA 5HZHA 5HWWA 2VEAA 5AVFA 2QYBA 4BWIA 5DF9A 3UMEA 2R78A 3BY8A 4GW9A 1MC0A 2GZAA 1XJ3A 4I3JA 2OWJA 4HP4A 1TS6A 3CWFA 2HJ9C 3F1NB 3MQQA 4GS9A 3OCNA 1T1BA 3K2NA 2PHYA 2W1TA 3KYQA 1NWZA 2CMNA 3LYXA 4O8GA 3ZQ5A 1OT6A 3F1OB 2B02A 2W3HA 1TF1A 2ZOIA 4LLOB 2OOLA 1OJGA 4Q0JA 3CUEA 3C30A 3PBSA 2XA7S 3BW6A 3ZYTA 3PXPA 2VZWA 2V9AA 5A8BA 2JKTI 3FPWA 5HDDA 1S4SA 2JN7A 3E4OA 4LRYC 2W0NA 3RTYA 4JGOA 4YWZA 4O0PA 4IJGA 1S66L 2W3FA 4CQHA 4Q0HA 1YSQA 4UEYA 1T1CA 4AFIA 1DP6A 4QPRA 2KX6A 1XJ2A 3A0VA 4L9FA 4LPZA 4YOFA 5HWTA 3T4LA 5HPIA 4Y5FA 3T4OA 4HIAA 3EEHA 2HGVA 5DKLA 4PAUA 1LSXA 2PYPA 4IUKA 1GSWA 2GX5A 4K08A 2HV1A 2O0YA 2VLGA 3MQOA 4CLCA 3P7NA 1TS7A 1UGUA 4ARZA 1VHMA 2ZMFA 2B18A 2W1RA 3JVUA 4ETXA 5I5LA 2IA2A 4KQOA 3EQUA 3R7WA 3MXQA 4IUHA 5F68A 4HNBA 5DFXA 4LRXC 4M4XA 1F5MA 3T4TA 4EU0A 3OLOA 3KYZA 3B42A 3GDIA 4NKPA 2M7VA 1MZUA 4WEJA 1S1YA 5DJUA 1D06A 2YKFA 3K3DA 1H3QA 1IOUA 1N9LA 4NXEA 1F9IA 3JVVA 3LIEA 3E4PA 2PYRA 5HSQA 4L0LA 1LT0A 1LSWA 4UQIS 2JKRM 4EERA 1OTDA 4P6ZM 3E4QA 2VV8A 1DP8A 3PBOA 3BQAA 2QWSA 4Y3IA 2XA7M 1OTIA 2XRNA 3OBFA 1GSVA 1N9OA 2OAQ1 1V9YA 2KOIA 2I9VA 2BASA 2L4RA 4WN5A 2HJEA 5TBMB 5F69A 3LR0A 3LR5A 3CLOA 2D02A 4XT2A 3LI8A 3V67A 2K31A 3PBNA 2VGLS 3KX0X 1NLZA 3S7OA 4IHQA 4I3AA 4YNRA 1W63Q 3LUQA 3CAXA 4EUVA 4ME4A 3SW1A 3CITA 4BBVA 3VE4A 4WEKA 3B47A 4I5SA 2Y79A 3EOIA 3E98A 3F1PA 4Z1WA 4PHTA 3MJQA 4I3IA 4PKYA 4WL9A 3MR0A 5TJJA 4MCWA 4EETB 4EEPA 1LL8A 4EXOA 2OAP1 2K2NA 3UB8A 2J3TD 2A24A 2O9AA 3HJIA 3O5YA 5DKKA 4XT2B 1JNUA 5J7EA 4HJ6A 3KSIA 3T4JA 5HDCA 3FG8A 4FSFA 2J3TC 3FPVA 3NHQA 4CLCE 1V9ZA 1H8MA 3IBJA 1W63M 3VV4A 3H82B 1YKDA 3FC7A 1VB6A 1OTAA 3MF0A 5HD5A 4R38A 3F1PB 3T4SA 5L8MA 1T1AA 4GHIA 3W2ZA 3LR3A 3G6OA 1TS8A 2FH5A 2ZOHA 2DMWA 4FOFA 2W27A 3NOTC 2A24B 4NXFA 5HDSA 3PR6A 2PR6A 3LR4A 2V1AA 4MN7A 5K5BA 4G3WA 1DP9A 3H7WA 4HH2A 4HP9A 3U2AA 2QHKA 1UWNX 1KOUA 5IT5A 3T50A 1OJ5A 1G6OA 5HL6A 2P7JA 5LBRA 1T19A 2EWVA 2HF6A 3DBAA 2ZMVA 4HI4A 4EESA 2L1MA 4O01A 4CLCD 4MN6A 1S1ZA 1OPXA 2K7SA 4MN5A 5AJGA 4GHIB 3LI9A 4NXGA 2V0UA 2KLIA 2G7UA 2WKRA 4CLCC 3UE3A 2LB5A 2P08A 5TBMA 2P04A 3H7WB 1NLYA 3BWLA 4EQ1A 4GCZA 4RQ9A 2M7UA 1N9NA 5G4YA 3TE8A 2V1BA 2PR5A 2W3GA 3S7QA 3R4KA 4EW7A 1EW0A 3NJAA 4DJ2A 5IS1A 3PBTA 2WKQA 4KUOA 2W3DA 3TRCA 4II7A 3MFXA 3KSGA 2PDRA 3UB7A 2A2LA 5F6AA 3EWKA 2XSSA 3OCLA 1ZTUA 1MKMA 2Z6DA 1DRMA 2EWWA 1P0ZA 2OWHA 2YKHA 5AVEA 1OT9A 4E04A 3A0SA 2M1CA 2V0WA 1T18A 3H9WA 3RFBA 3BJNA 2VX8A 4BMWA 1S4RA 2PD7A 3EQVA 4L9GA 2VA0A 2NUPC 4WF0A 2QJ7A 3PBQA 4WLAA 3PHYA 4JGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H82 A;  3LIB A;  3UMD A;  3VOL A;  4L9E A;  2VV7 A;  5J3W A;  3UB6 A;  3LIA A;  2VV6 A;  3GEC A;  2H28 A;  1G28 A;  4WUJ A;  2L0W A;  4JGP A;  4EEU A;  4I39 A;  3BY9 A;  3UE6 A;  1OTB A;  4HHD A;  4LRZ E;  3NOU C;  3C8C A;  4F3L A;  4NXB A;  3LIF A;  3K3C A;  2Z6C A;  2QJ5 A;  3PYP A;  4GS9 B;  5EFW A;  2EA9 A;  2JHE A;  2J80 A;  1GSX A;  1XFN A;  4HOI A;  5HD3 A;  4JGR A;  3RH8 B;  3ICY A;  1P97 A;  5KIZ A;  1F98 A;  4BBU A;  4HJ3 A;  4HY8 A;  1S67 L;  3UB9 A;  4HH3 A;  3IBR A;  3NOP C;  4F3L B;  1LSV A;  4KUK A;  4R70 A;  4R3A A;  2WKP A;  4KQD A;  2D01 A;  3LIC A;  4HQA A;  4I38 A;  1WA9 A;  2KDK A;  1XJ4 A;  3A0R A;  5F5Y A;  1TS0 A;  4DJ3 A;  1Y28 A;  3D72 A;  3LID A;  4BBT A;  4H6J A;  3VE3 A;  3IS2 A;  5G4Z A;  4R6L A;  2PD8 A;  1X0O A;  1UWP X;  1D7E A;  2GJ3 A;  1XJ6 A;  4B9O A;  5J4E A;  3B33 A;  3F1N A;  5HWV A;  1OTE A;  1ODV A;  4PKY G;  3ULF A;  3F1O A;  5DJT A;  4HJ4 A;  4H6J B;  3HJK A;  3C2W A;  2QKP A;  2ZBB A;  3IS2 B;  1XFQ A;  1BYW A;  5HZH A;  2INW A;  5HWW A;  2VEA A;  5AVF A;  3UME A;  2R78 A;  3BY8 A;  4GW9 A;  1XJ3 A;  4I3J A;  2OWJ A;  4HP4 A;  1TS6 A;  3CWF A;  3F1N B;  3MQQ A;  4GS9 A;  1T1B A;  2PHY A;  1NWZ A;  2CMN A;  3LYX A;  3ZQ5 A;  1OT6 A;  3F1O B;  2B02 A;  2ZOI A;  4LLO B;  2OOL A;  1OJG A;  2V9A A;  5A8B A;  5HDD A;  1S4S A;  2JN7 A;  3E4O A;  4LRY C;  2W0N A;  3RTY A;  4JGO A;  4YWZ A;  1S66 L;  1T1C A;  1DP6 A;  2KX6 A;  1XJ2 A;  3A0V A;  4L9F A;  4LPZ A;  5HWT A;  4HIA A;  3EEH A;  5DKL A;  1LSX A;  2PYP A;  1GSW A;  4K08 A;  2HV1 A;  2VLG A;  3MQO A;  3P7N A;  1TS7 A;  1UGU A;  5I5L A;  3MXQ A;  5F68 A;  4HNB A;  4LRX C;  4M4X A;  3OLO A;  3GDI A;  1MZU A;  1S1Y A;  5DJU A;  1D06 A;  2YKF A;  3K3D A;  1N9L A;  4NXE A;  1F9I A;  3LIE A;  3E4P A;  2PYR A;  5HSQ A;  1LT0 A;  1LSW A;  4EER A;  1OTD A;  3E4Q A;  2VV8 A;  1DP8 A;  2QWS A;  1OTI A;  1GSV A;  1N9O A;  1V9Y A;  2I9V A;  2BAS A;  2L4R A;  4WN5 A;  5TBM B;  5F69 A;  3CLO A;  2D02 A;  4XT2 A;  3LI8 A;  3KX0 X;  4I3A A;  3LUQ A;  3CAX A;  3SW1 A;  4BBV A;  3VE4 A;  4I5S A;  3F1P A;  3MJQ A;  4I3I A;  4PKY A;  4WL9 A;  3MR0 A;  4EET B;  4EEP A;  1LL8 A;  4EXO A;  3UB8 A;  2A24 A;  3HJI A;  5DKK A;  4XT2 B;  1JNU A;  5J7E A;  4HJ6 A;  5HDC A;  3FG8 A;  3NHQ A;  1V9Z A;  3H82 B;  3FC7 A;  1VB6 A;  1OTA A;  5HD5 A;  4R38 A;  3F1P B;  1T1A A;  4GHI A;  3G6O A;  1TS8 A;  2ZOH A;  2W27 A;  3NOT C;  2A24 B;  4NXF A;  5HDS A;  2PR6 A;  2V1A A;  4JGQ A;  1DP9 A;  3H7W A;  4HH2 A;  4HP9 A;  2QHK A;  1UWN X;  1KOU A;  3T50 A;  1OJ5 A;  2P7J A;  1T19 A;  4HI4 A;  4EES A;  2L1M A;  4MN6 A;  1S1Z A;  2K7S A;  4MN5 A;  4GHI B;  3LI9 A;  4NXG A;  2V0U A;  2WKR A;  5TBM A;  3H7W B;  3BWL A;  4EQ1 A;  4GCZ A;  4RQ9 A;  1N9N A;  5G4Y A;  2V1B A;  2PR5 A;  4EW7 A;  1EW0 A;  3NJA A;  4DJ2 A;  5IS1 A;  2WKQ A;  4KUO A;  3MFX A;  2PDR A;  3UB7 A;  5F6A A;  3EWK A;  2Z6D A;  1DRM A;  2OWH A;  1P0Z A;  2YKH A;  5AVE A;  4E04 A;  1OT9 A;  3A0S A;  2M1C A;  2V0W A;  1T18 A;  3H9W A;  1S4R A;  2PD7 A;  4L9G A;  4WF0 A;  2QJ7 A;  4WLA A;  3PHY A;  5IU1 A; 
#chains in the Genus database with same CATH topology
 3HLF A;  3S7N A;  3LIB A;  3VOL A;  5C5K A;  2HP9 A;  1KGE A;  5HAQ A;  3SH9 A;  3IF6 A;  3ITB A;  5J3W A;  5DFY A;  3LIA A;  3UB6 A;  4N9L A;  4WEL A;  3GRJ A;  4X68 A;  3GEC A;  2JKR I;  3DW0 A;  4BJP A;  2ZJ9 A;  4UAA A;  3HUO A;  4ETZ A;  1ONH A;  2Y2K A;  4MLL A;  1OTB A;  4MBF A;  1NYY A;  4NXB A;  2MJ6 A;  3T1S A;  3IF6 B;  2O9B A;  5HD3 A;  2GDN A;  2W1T B;  3DWZ A;  3HCY A;  2Q0O A;  1WYB A;  2AVX A;  3ICY A;  4MBK A;  1P97 A;  1M6K A;  3SOI A;  1S67 L;  3QP4 A;  2E8I A;  3KSF A;  3DAV A;  4R3A A;  1L0E A;  2OV5 A;  3UNW A;  3WS1 A;  3A3J A;  4ZJ2 A;  5M19 A;  5F1F A;  4E6X A;  3PAE A;  1WA9 A;  4JXG A;  2FFY A;  3A0R A;  4LCL A;  3T12 B;  3EGX C;  3DTI A;  4H8R A;  1YSP A;  4EBP A;  2Y59 A;  3C38 A;  4G3V A;  2VGL M;  4H6J A;  1Q2P A;  5CEB A;  4C6Y A;  4DXC A;  2VKS A;  1NXY A;  3MQ0 A;  4CLC B;  3PTE A;  1I2S A;  1LL9 A;  5CRF A;  4UA7 A;  1OTE A;  3IX8 A;  1VEU B;  3IQA A;  4Y0O A;  5FI2 A;  3TW8 A;  4C75 A;  4Y15 A;  2XRO A;  4ID4 A;  4H6J B;  3HJK A;  4MDZ A;  3P09 A;  2ZBB A;  1XFQ A;  3HL9 A;  2Y8H A;  2INW A;  3L9K A;  5HZH A;  1H5X A;  3UME A;  3BY8 A;  3HRE A;  5A93 A;  5CHJ A;  4JKT A;  3SS5 A;  5J8X A;  1FIL A;  2HDS A;  3MFD A;  4U3T A;  4HP4 A;  3MZF A;  3OCN A;  4BLM A;  4OQG A;  4O8G A;  2CMN A;  3A3D A;  4O7D A;  3ITA A;  2W3H A;  3W4P A;  1G5U A;  5EM0 A;  4BD1 A;  3PBS A;  3BFF A;  3S4X A;  5GHZ A;  2X71 A;  3DTK A;  2V9A A;  1S4S A;  2JN7 A;  4LRY C;  3VOY A;  1FCM A;  5AQA A;  3W8K A;  1LLB A;  5U47 A;  4E3O A;  3Q7Z A;  5TGF A;  3UE0 A;  3V50 A;  4LPZ A;  5HPI A;  4Y5F A;  1Z6F A;  3UY6 A;  3NC8 A;  2DNS A;  4PAU A;  3IX3 A;  2PYP A;  1YLZ A;  3N6I A;  4K08 A;  2XFS A;  2HV1 A;  3UPP A;  2ZC7 A;  1KVM A;  3MQO A;  3IT9 A;  1K56 A;  4ARZ A;  3ZG0 A;  2PBY A;  5DF7 A;  4S2I A;  5EUA A;  1BLP A;  1J3W A;  4ETX A;  1IEM A;  3EQU A;  3NY4 A;  4IUH A;  2JCH A;  1F5M A;  1XPB A;  3GDI A;  2M7V A;  4WZ5 C;  1S1Y A;  4LV0 A;  3WS4 A;  5DJU A;  3Q07 A;  1IYQ A;  1YMS A;  1H3Q A;  2HP5 A;  1N9L A;  3ZGA B;  4LV2 A;  3TOI A;  4X56 A;  3BFG A;  1MWT A;  4L0L A;  3ZG8 B;  4A5R A;  3T1X A;  2J9O A;  5A91 A;  1H8Y A;  5TR7 A;  1OTD A;  5EVI C;  4P6Z M;  2ZM2 A;  3NDE A;  2VV8 A;  5EOE A;  1WYC A;  1JWP A;  2XA7 M;  4KZA A;  2XRN A;  4FH2 A;  4DXB A;  4IVI A;  2KOI A;  4EWF A;  3IX4 A;  2L4R A;  1CI8 A;  1L0F A;  2Y2M A;  1ERQ A;  4WYY A;  4E3J A;  4R3J A;  4XT2 A;  1GHI A;  3LI8 A;  3T1Q B;  2HPB A;  2K31 A;  1YLJ A;  4WBG A;  4I3A A;  3ZFZ A;  4Y17 A;  1W63 Q;  5AQ9 A;  3HLB A;  3LUQ A;  3A3F A;  3CAX A;  1FCO A;  1TDG A;  2EFX A;  2Y79 A;  3EOI A;  4PHT A;  3TSG A;  3MR0 A;  4D60 A;  4OQI A;  4MCW A;  4QY6 A;  4EEP A;  2J3T D;  3IWO A;  2A24 A;  3O5Y A;  4YFM A;  3QHY A;  5DKK A;  4XT2 B;  4HJ6 A;  2VK3 A;  3NHQ A;  1V9Z A;  4KZ6 A;  1DJB A;  3H82 B;  3FC7 A;  5DTK A;  1ZG4 A;  1OTA A;  3ZDJ A;  5HD5 A;  1S0W A;  5L8M A;  3GV9 A;  1MY8 A;  1BTL A;  4FOF A;  2A24 B;  4NXF A;  3LR4 A;  3Q81 A;  5GL9 A;  1DP9 A;  3LO7 A;  4HH2 A;  1G6O A;  4EUZ A;  5HL6 A;  5LBR A;  3DBA A;  4HI4 A;  2L1M A;  4KQR A;  4O01 A;  5AJG A;  2P74 A;  3WRZ A;  4JPM A;  1YPR A;  2OSU A;  2G2W A;  2Y2N A;  2EX6 A;  4QHC A;  1PI5 A;  1Y4O A;  4HES A;  4HBU A;  1K54 C;  5EVI A;  3CHW P;  4PM9 A;  3BFE A;  1JTG A;  1XXM A;  4EW7 A;  1EW0 A;  5IS1 A;  3PBT A;  1ES5 A;  4NK3 A;  3TRC A;  2BG1 A;  1IEL A;  2X02 A;  1MKM A;  2Z6D A;  1DRM A;  4E04 A;  1OT9 A;  2M1C A;  1TDL A;  4NET A;  5EVI B;  3IH9 A;  3RFB A;  1KE0 A;  1S4R A;  1ALQ A;  1JVJ A;  5L10 A;  4BQM A;  4Z9Q A;  3EQV A;  1FSY A;  3DWK A;  2VA0 A;  4WLA A;  3BEC A;  3E2K A;  1MWR A;  3UMD A;  4E3M A;  2CC1 A;  1BLC A;  5HAR A;  5EVE A;  2VV7 A;  2VV6 A;  2WKE A;  5KSH A;  3HVF A;  1G28 A;  3ZG7 B;  2WGW A;  3CG5 A;  5CTN A;  3G35 A;  4DN0 A;  5HL1 A;  4JGP A;  4EEU A;  3T4Q A;  4OOL A;  1ES2 A;  4GDB A;  4HHD A;  3NOU C;  4F3L A;  5AQ7 A;  3CUE C;  3LIF A;  2Z6C A;  3C5A A;  5FQQ A;  5GHX A;  4FCF A;  2QJ5 A;  2ZQ7 A;  2EA9 A;  4E3L A;  1XFN A;  4HOI A;  2J3W A;  4JGR A;  1YAX A;  4X6T A;  1BLH A;  5HPF A;  2WGW B;  5KIZ A;  4RX2 A;  3S7P A;  1MXO A;  3OPL A;  4C3Q A;  5E2H A;  4ESP A;  3O87 A;  1RGZ A;  4HH3 A;  3T4K A;  4F3L B;  4KUK A;  1PFL A;  3LFV A;  4QB8 A;  2C5W B;  2EX2 A;  4R70 A;  3LEZ A;  3JPU A;  3GMW A;  3C4O A;  3O86 A;  3QNC A;  1K6R A;  2D01 A;  2I72 A;  3LIC A;  4HQA A;  4DMZ A;  4I38 A;  2H0Y A;  1K54 A;  3E0Y A;  5FSR A;  4DE3 A;  4DJ3 A;  1W7F A;  1Y28 A;  2BLS A;  3NBL A;  4BBT A;  5HFO A;  3ZNT A;  4PM7 A;  3BQ8 A;  1KDS A;  1N9B A;  3IS2 A;  1ZHH B;  3SS3 A;  4NEE D;  4R6L A;  5E2F A;  5CHM A;  3TG9 A;  1W79 A;  4B93 A;  1XJ6 A;  1P9R A;  4B9O A;  1EWZ A;  1BZA A;  3HUN A;  1TVF A;  4ZRR A;  4LGW A;  4P87 A;  5FL3 A;  1ES3 A;  1VM1 A;  4LV1 A;  4X55 A;  4DKI A;  4HJ4 A;  1IFQ A;  3QP5 A;  2EFU A;  3IS2 B;  1TD5 A;  4S2N C;  4GLQ A;  3UDX A;  4BWI A;  5DF9 A;  2E8J A;  2IWD A;  3CPT A;  1MC0 A;  1XJ3 A;  1TS6 A;  4S2M A;  1LI0 A;  3K2N A;  2PHY A;  2W1T A;  1PWC A;  3OZH A;  1TF1 A;  4BD0 A;  1GCE A;  3QP6 A;  1PW1 A;  4EQI A;  2ZC6 B;  3CUE A;  3BW6 A;  3ZYT A;  1E4D A;  4PM5 A;  3CPT B;  2VZW A;  3WS5 A;  5FAT A;  3GQZ A;  5HDD A;  4JGO A;  4ZTK A;  4R0Q A;  5CTM A;  2HDU A;  1ERO A;  2ACG A;  2W3F A;  3MKF A;  3BRM A;  4UEY A;  5AQB A;  2PRF A;  3LGO A;  1YQS A;  4JXV A;  3HLD A;  1XJ2 A;  3P98 A;  3EEH A;  2A3U A;  2HGV A;  5DKL A;  5M1A A;  1LSX A;  3G34 A;  4GD8 A;  4R4R A;  1ESI A;  2GX5 A;  1QME A;  4P6B A;  4P0M A;  4B4Z A;  2VLG A;  3MZE A;  4CLC A;  2ZMF A;  1YMX A;  3WS2 A;  3SH7 A;  1CF0 A;  1VEU A;  3G31 A;  3ISG A;  3Q1F A;  5F68 A;  5E2G A;  2WKH A;  4LRX C;  5FAP A;  4PPR A;  2JE5 A;  4EU0 A;  4DE2 A;  3B42 A;  2V20 A;  4R1G A;  1KVL A;  3NI9 A;  2HDR A;  2PYR A;  1NRF A;  5HSQ A;  1LT0 A;  4GNU A;  1K57 C;  2JKR M;  4EER A;  4HBT A;  4OP5 A;  3BQA A;  2H5S A;  4QU3 A;  5L2F A;  4Y3I A;  1H8Z A;  1OTI A;  1GSV A;  1N9O A;  1V9Y A;  5L07 A;  2X01 A;  4WN5 A;  5TBM B;  2C6W B;  3LR0 A;  3LR5 A;  3V67 A;  3PBN A;  2VGL S;  3S7O A;  4IHQ A;  5I94 A;  3HLG A;  4YNR A;  3IXH A;  4OPR A;  3DTE A;  4GDN A;  3VE4 A;  1HD8 A;  4WEK A;  3NCK A;  4OON A;  3F1P A;  1O07 A;  3JYI A;  5EPH A;  1ACF A;  3VP3 A;  1LL8 A;  2OAP 1;  2Q9M A;  1K0K A;  3HJI A;  2OLU A;  1K55 C;  1K38 A;  1H8M A;  4JXW A;  3IBJ A;  1W63 M;  2PU4 A;  5L09 A;  1JTD A;  1VB6 A;  2V1Z A;  3F1P B;  1T1A A;  3UDI A;  4E6W A;  1YT4 A;  3LR3 A;  3MXS A;  1TS8 A;  2FH5 A;  3ZHH A;  2DMW A;  5A92 A;  2ZMA A;  2PAV P;  3LY4 A;  3PR6 A;  4N92 A;  2PR6 A;  2V1A A;  2B5R A;  4HP9 A;  3U2A A;  2QHK A;  1PI4 A;  1AWI A;  1KOU A;  5CER A;  3T50 A;  5KMW A;  1ZC2 A;  3VP4 A;  2HF6 A;  2EWV A;  2ZQD A;  4EES A;  2QPN A;  3OPH A;  1SDE A;  4CLC D;  1KDW A;  1XX2 A;  2XR0 A;  1S1Z A;  2K7S A;  4MN5 A;  4KZ7 A;  3Q7V A;  4RX3 A;  3AGF A;  2WKR A;  4FUW A;  1NZU A;  2P08 A;  5CGX A;  4N1H A;  2Y2J A;  2ZQA A;  1K57 A;  4N1X A;  4OLG A;  4EQ1 A;  4IED A;  4GCZ A;  3CZD A;  4E3K A;  5G4Y A;  4ZBE A;  2QMI A;  2ZQ9 A;  4S2P A;  4IBR A;  1IKG A;  1CI9 A;  3NJA A;  3Q7V B;  4KUO A;  1AXB A;  1SHV A;  2EX8 A;  5F6A A;  2XSS A;  3OCL A;  2ZQC A;  2OWH A;  1XKZ A;  2V0W A;  3H9W A;  2R9X A;  4OKP A;  1KE3 A;  4R3B A;  4L9G A;  4Y0T A;  2NUP C;  4WZ4 A;  4LCM A;  2QJ7 A;  3PBQ A;  3PHY A;  4YOF A;  4JGQ A;  1LL5 A;  3H82 A;  1HLU P;  4MNR A;  3OC2 A;  3V39 A;  2VJW A;  4L9E A;  2P9V A;  5HAI A;  4JF6 A;  3N7W A;  4IBX A;  4NG2 A;  4OLD A;  2H28 A;  5EM1 A;  4EV4 A;  2ZLY A;  4P6Z S;  2L0W A;  3BFD A;  3NUL A;  4I39 A;  1MWS A;  3C8C A;  1YM1 A;  3NIA A;  5DTS A;  2P9V B;  3PYP A;  3VMA A;  4GS9 B;  5EFW A;  2JHE A;  4BL3 A;  4QJG A;  4MMN A;  4Y13 A;  1NRJ A;  3SS4 A;  3N8R A;  4BBU A;  3UB5 P;  4D2O A;  5KZH A;  4X53 A;  5E2E A;  1G6A A;  1Z09 A;  2ZD8 A;  3IBR A;  4UQI M;  2WGI A;  1K6S A;  1K56 D;  1SCW A;  1MBL A;  1RGY A;  4WZ5 A;  1PNE A;  3C7V A;  1BT5 A;  3N4I A;  4S2K A;  2O9C A;  3AGD A;  1XJ4 A;  4G3K A;  1L2S A;  4DRT A;  1MPL A;  5MC7 A;  2XDM A;  3TJZ C;  5GLB A;  3UPN A;  3EGD C;  4RVA A;  3VE3 A;  5FEG A;  3SH8 A;  5G4Z A;  2R9W A;  2XQZ A;  4Y2F A;  2PD8 A;  5EE8 A;  3VSK A;  5JYP A;  2Y2G A;  2GJ3 A;  3P01 A;  4Q0I A;  3S22 A;  3B33 A;  3F1N A;  2JKT M;  2WYX A;  4E3N A;  2XD1 A;  3R7W B;  4PKY G;  3ULF A;  3PAG A;  3MMH A;  3C4P A;  3CMZ A;  3C2W A;  4GZB A;  2W3E A;  1GA9 A;  1BYW A;  3UDF A;  2ZC3 B;  3IHA A;  3MSH A;  1E3U A;  2R78 A;  4ZAM A;  4GW9 A;  1NYM A;  2GZA A;  3NEC A;  2H0T A;  2OWJ A;  3F1N B;  3MQQ A;  3WS0 A;  4JF4 A;  3IF5 A;  4E3I A;  3KYQ A;  4S2L A;  3LYX A;  3ZQ5 A;  3BFC A;  4WMC A;  2ZOI A;  1OME A;  4LLO B;  4ZJ1 A;  1KGF A;  3FWL A;  3GVB A;  5TFQ A;  4DDY A;  4X25 A;  2VGK A;  3OPR A;  1HZO A;  2Y91 A;  3E4O A;  2W0N A;  1VQQ A;  4EBL A;  1L3L A;  1ZKJ A;  3UE1 A;  3CJM A;  1JWV A;  3G32 A;  2ZC5 B;  1XA7 A;  1DP6 A;  4QPR A;  3ZVT A;  2KX6 A;  3A0V A;  4L9F A;  5HWT A;  2WAF A;  1Q2Q A;  4PM6 A;  5HAP A;  3T4O A;  2Y2I A;  4IUK A;  4JXS A;  1GSW A;  3LCE A;  5G18 A;  4R23 A;  1L0G A;  4KZ3 A;  3P7N A;  1UGU A;  3ZCZ A;  3WWX A;  2B18 A;  2W1R A;  3T1R A;  5I5L A;  2IA2 A;  5EV0 A;  1YLW A;  3MXQ A;  5GHY A;  4M4X A;  1SZV A;  3BLM A;  3GTC A;  2HDQ A;  2XK1 A;  4B4X A;  1MZU A;  1BLS A;  1CJF A;  1IOU A;  1ONG A;  1F9I A;  2Y4A A;  5EVI D;  3JVV A;  1PIO A;  1GHP A;  3E4P A;  2PU2 A;  2XGN A;  4GD6 A;  1LSW A;  1FR6 A;  3VOZ A;  2WUQ A;  3DTM A;  3ZVW A;  1SDN A;  5IHV A;  1DP8 A;  2QWS A;  2IWB A;  3A3I A;  3OBF A;  4BEN A;  3HLE A;  2OAQ 1;  1FR1 A;  2I9V A;  3U4L P;  2BAS A;  4MEZ A;  4ZDX A;  4K91 A;  2PBD P;  2H10 A;  3KX0 X;  2ZL1 A;  5GLD A;  5JYO A;  4UA9 A;  1M40 A;  4EUV A;  3SW1 A;  3CIT A;  4BBV A;  4U0T A;  4I5S A;  4KG6 A;  1PZO A;  1J9M A;  3E98 A;  4Z1W A;  3W4Q A;  2XEP A;  2Z2M B;  2V8C A;  3MJQ A;  1N4O A;  4LFU A;  3LY3 A;  4WL9 A;  5TJJ A;  2RCX A;  4EET B;  3B3X A;  4WMC D;  1SKF A;  2K2N A;  4FD8 A;  4M3K A;  1PW8 A;  5FDS A;  4OPY A;  1JNU A;  5J7E A;  3KSI A;  5DVA A;  4KG5 A;  2ZL1 B;  3G2Z A;  3BLS A;  3FG8 A;  1FIK A;  2J3T C;  1IKI A;  1KE4 A;  1CQA A;  3VV4 A;  1YKD A;  2Y2H A;  3G4P A;  2Y2L A;  4R38 A;  4X1M A;  3UPO A;  4DE0 A;  4KZ8 A;  3W2Z A;  4K0W A;  3G6O A;  2ZOH A;  3VP2 A;  1XP4 A;  3NOT C;  4RA7 A;  4XUZ A;  2WK0 A;  5HDS A;  5K5B A;  4G3W A;  3H7W A;  3G30 A;  4LV3 A;  1UWN X;  5IT5 A;  3VFH A;  5FDH A;  3IH8 A;  5DF8 A;  3IWQ A;  2EXB A;  1T19 A;  4DDS A;  5FEF A;  2Y2P A;  1IYP A;  3MBZ A;  3W4O A;  3L7H A;  4NXG A;  4FTX A;  2KLI A;  2G7U A;  1FOF A;  3BM6 A;  1W8Y A;  2IWC A;  2LB5 A;  3UE3 A;  3MKE A;  5FAQ A;  3M6H A;  5TBM A;  3VP1 A;  3H7W B;  4N9K A;  3BWL A;  1SKO A;  4RQ9 A;  2M7U A;  1PZP A;  2Y2O A;  1N9N A;  4FH4 A;  4KZ5 A;  3TE8 A;  3AGE A;  2ZQ8 A;  2W3G A;  4S2N A;  3S7Q A;  4GOG A;  3V3S A;  2WKQ A;  5FQM A;  3VFF A;  2XF3 A;  1CEF A;  3MFX A;  3BYD A;  3KSG A;  1XA1 A;  4KZ4 A;  2A2L A;  5HX9 A;  1ZTU A;  2EWW A;  2YKH A;  1WE4 A;  4OQ0 A;  4QD4 A;  4KEN B;  1SKO B;  1T18 A;  3VP0 A;  2VX8 A;  4QY5 A;  2PD7 A;  1BUE A;  4OPQ A;  2ZC4 B;  3GSG A;  3BEB A;  4WF0 A;  3FV7 A;  1FSW A;  1XGI A;  2BTF P;  2O99 A;  2A49 A;  3ZG9 B;  1Y54 A;  3A3E A;  2XH9 A;  2LB9 A;  4OQH A;  4KG2 A;  4JF5 A;  2DCF A;  1G68 A;  1ERM A;  2DRW A;  4GJ4 A;  3EEA A;  5FAO A;  1STZ A;  2UWX A;  3IXD A;  4WUJ A;  5GLC A;  4K0X A;  1RCJ A;  5HW3 A;  2WKI A;  3BY9 A;  1YLT A;  3PBR A;  3UE6 A;  2XFT A;  3KSH A;  2J9P A;  4LRZ E;  5FI7 A;  3QNB A;  3K3C A;  1YLP A;  3M6B A;  5D3O A;  1BSG A;  4PMA A;  2J80 A;  1GSX A;  3WRT A;  4KZ9 A;  3RH8 B;  3KO6 A;  5FAS A;  4XUX A;  1F98 A;  4OPZ A;  4HJ3 A;  4HY8 A;  5CX7 A;  3UB9 A;  2FZ0 A;  4S2O A;  3FYZ A;  3D3O A;  3NOP C;  3C7U A;  1LSV A;  1NJ4 A;  4Y0U A;  2PT7 A;  2J8Y A;  2UV0 E;  3HBR A;  2WKP A;  1ESU A;  4KQD A;  3HLC A;  5F1G A;  2KDK A;  3CI6 A;  3OOV A;  2GNX A;  1FCN A;  3G2Y A;  5F5Y A;  1TS0 A;  3HUM A;  3D72 A;  3LID A;  4CJN A;  1BUL A;  1PRQ A;  4KQQ A;  2NUT C;  3NDG A;  1X0O A;  4OOM A;  1UWP X;  3QP1 A;  4ARZ B;  1D7E A;  1LI9 A;  1P9W A;  3MS6 A;  5J4E A;  5HWV A;  1ODV A;  5FI6 A;  2JKF A;  1L0D A;  3IHB A;  4Q8I A;  2EXA A;  3F1O A;  4JBF A;  5DJT A;  2QKP A;  5CGW A;  1VET A;  2B95 A;  5FQK A;  3N8S A;  5HWW A;  4BL2 A;  2VEA A;  5AVF A;  2QYB A;  4PM8 A;  4EBN A;  3ZNY A;  3D9Y A;  2ZM0 A;  2HZ5 A;  3I7J A;  4I3J A;  3S1Y A;  3CWF A;  2HJ9 C;  4GS9 A;  5CXW A;  4RYE A;  1GHM A;  1T1B A;  5F83 A;  3E2L A;  1K55 A;  1K4F A;  1NWZ A;  1OT6 A;  5A90 A;  3F1O B;  2B02 A;  1W5D A;  3RXX A;  3FZC A;  2EX9 A;  1A0K A;  3HLW A;  1MWU A;  2OOL A;  1OJG A;  1VET B;  4Q0J A;  3C30 A;  3M2J A;  3Q82 A;  2XA7 S;  1ZG6 A;  3PXP A;  5CEC A;  3IXB A;  5A8B A;  1HVB A;  2JKT I;  3FPW A;  3RTY A;  4YWZ A;  4WM9 A;  4O0P A;  4IJG A;  2QZ6 A;  1S66 L;  4CQH A;  4Q0H A;  1YSQ A;  1T1C A;  2HP6 A;  5EVL A;  4AFI A;  3SZT A;  2RL3 A;  3T4L A;  1C3B A;  1QMF A;  4OH0 A;  4HIA A;  5FQ9 A;  1HTZ A;  1FQG A;  4R4S A;  2WGV A;  5CED A;  1NZO A;  1PYY A;  2O0Y A;  1TS7 A;  5EEC A;  1ES4 A;  5F82 A;  1VHM A;  3LEQ A;  3JVU A;  1YLY A;  4OVD A;  4HEF A;  1O7E A;  3IWI A;  4KQO A;  3R7W A;  4HNB A;  1DY6 A;  5DFX A;  3T4T A;  3OLO A;  3KYZ A;  4NKP A;  1S6R A;  4WEJ A;  3IXG A;  1D06 A;  2YKF A;  3K3D A;  3VSL A;  2WZZ A;  4NXE A;  5FQJ A;  1K4E A;  4GB7 A;  3LIE A;  1I2W A;  2XLN A;  5CGS A;  4B88 A;  4YIN A;  4UQI S;  2JKG A;  5GLA A;  2XD5 A;  3E4Q A;  3PBO A;  2Y55 A;  3ZG5 A;  4ZJ3 A;  4GN2 A;  3GR2 A;  3V3R A;  3UO9 A;  1MKI A;  2WAE A;  2V2F F;  3KYE A;  2HJE A;  1TEM A;  2JC7 A;  5F69 A;  3CLO A;  4P85 A;  3MZD A;  2D02 A;  1F2K A;  5CHU A;  3M2K A;  1NLZ A;  4ME4 A;  4X69 A;  4S2J A;  3B47 A;  2J7V A;  2G2U A;  4JLF A;  3FKW A;  3MXR A;  4XXR A;  3RXW A;  1KGG A;  4I3I A;  4PKY A;  2V8F A;  1NY0 A;  4EXO A;  3UB8 A;  3IF6 C;  4X1L A;  2O9A A;  2VGJ A;  5KSC A;  3T4J A;  5HDC A;  4LEN A;  3QP2 A;  1IYO A;  4FSF A;  4CLC E;  3FPV A;  2ZM8 A;  1E25 A;  4U0X A;  2Z2L B;  3MF0 A;  3T4S A;  3QP8 A;  2WAD A;  4GHI A;  3O88 A;  2W27 A;  2Q9N A;  3UN7 A;  1XGJ A;  4GKU A;  1RP5 A;  5EOO A;  4MN7 A;  1IYS A;  3O3V A;  1I5Q A;  2JBF A;  5M18 A;  4QWO A;  1OJ5 A;  1PWD A;  2P7J A;  2ZMV A;  5FQI A;  3V5M A;  1W8Q A;  1GA0 A;  4KZB A;  1LHY A;  4MN6 A;  1OPX A;  2OLV A;  2Y2Q A;  3LI9 A;  4GHI B;  1EI5 A;  4UA6 A;  2V0U A;  4CPK A;  1CK3 A;  4CLC C;  4OP8 A;  4DE1 A;  1DJA A;  4Y7P A;  5E43 A;  4OOY A;  3N8L A;  3D4F A;  5DTT A;  1JWZ A;  2P04 A;  1NLY A;  2FFF B;  3FKV A;  4UHU A;  4DF6 A;  5BOH A;  1PWG A;  2V1B A;  2PR5 A;  1H0M A;  3R4K A;  1U60 A;  4DJ2 A;  2W3D A;  3RJU A;  4II7 A;  2PDR A;  3UB7 A;  3EWK A;  1CEG A;  1DJC A;  2WZX A;  1K25 A;  1P0Z A;  5AVE A;  3A0S A;  4IVK A;  3BJN A;  4MBH A;  4BMW A;  1E3U D;  4F94 A;  1D1J A;  3OPP A;  5FA7 A;  5IU1 A; 
#chains in the Genus database with same CATH homology
 3H82 A;  2O99 A;  3LIB A;  3S7N A;  3UMD A;  3OC2 A;  3VOL A;  5C5K A;  2VJW A;  4L9E A;  2VV7 A;  5J3W A;  5DFY A;  3LIA A;  3UB6 A;  4WEL A;  2VV6 A;  2LB9 A;  3GEC A;  2JKR I;  5KSH A;  2H28 A;  4BJP A;  4GJ4 A;  3EEA A;  1G28 A;  1STZ A;  4WUJ A;  4P6Z S;  4DN0 A;  2L0W A;  4ETZ A;  4JGP A;  4EEU A;  4I39 A;  3BY9 A;  3PBR A;  3T4Q A;  3UE6 A;  1OTB A;  4OOL A;  3KSH A;  4HHD A;  4LRZ E;  3NOU C;  3C8C A;  4F3L A;  4NXB A;  3CUE C;  3LIF A;  3K3C A;  2Z6C A;  2QJ5 A;  3PYP A;  2MJ6 A;  4GS9 B;  5EFW A;  2EA9 A;  2O9B A;  2JHE A;  2J80 A;  1GSX A;  1XFN A;  4HOI A;  5HD3 A;  2J3W A;  2W1T B;  1YAX A;  3HCY A;  4JGR A;  3RH8 B;  4MMN A;  3KO6 A;  1NRJ A;  3ICY A;  5HPF A;  1P97 A;  5KIZ A;  1F98 A;  4BBU A;  3S7P A;  5IU1 A;  4HJ3 A;  4HY8 A;  5CX7 A;  1S67 L;  3UB9 A;  3KSF A;  2FZ0 A;  4HH3 A;  3IBR A;  3D3O A;  3NOP C;  3T4K A;  4UQI M;  4F3L B;  1LSV A;  4KUK A;  3LFV A;  2PT7 A;  4R70 A;  4R3A A;  2WKP A;  4KQD A;  2D01 A;  3LIC A;  4HQA A;  4DMZ A;  4I38 A;  1WA9 A;  2KDK A;  2O9C A;  3CI6 A;  1XJ4 A;  3OOV A;  2GNX A;  4G3K A;  3E0Y A;  3A0R A;  5F5Y A;  1TS0 A;  4DJ3 A;  3TJZ C;  5MC7 A;  3EGX C;  1YSP A;  1Y28 A;  3D72 A;  3LID A;  3C38 A;  4G3V A;  4BBT A;  3EGD C;  2VGL M;  3BQ8 A;  4H6J A;  3VE3 A;  2VKS A;  2NUT C;  3IS2 A;  3MQ0 A;  5G4Z A;  1ZHH B;  4Y2F A;  4NEE D;  4R6L A;  2PD8 A;  1X0O A;  4OOM A;  1UWP X;  4CLC B;  4ARZ B;  1D7E A;  2GJ3 A;  3P01 A;  4Q0I A;  4B93 A;  1XJ6 A;  1P9R A;  4B9O A;  1P9W A;  5J4E A;  3B33 A;  4ZRR A;  3F1N A;  5HWV A;  1OTE A;  1ODV A;  2JKT M;  3TW8 A;  3R7W B;  5FL3 A;  4PKY G;  3ULF A;  2XRO A;  3F1O A;  3MMH A;  5DJT A;  4HJ4 A;  4H6J B;  3HJK A;  1IFQ A;  3C2W A;  4MDZ A;  2QKP A;  2W3E A;  2ZBB A;  3IS2 B;  1XFQ A;  1BYW A;  2Y8H A;  2INW A;  1TD5 A;  4GLQ A;  5HZH A;  5HWW A;  2VEA A;  5AVF A;  2QYB A;  4BWI A;  5DF9 A;  3UME A;  2R78 A;  3BY8 A;  4GW9 A;  1MC0 A;  2GZA A;  1XJ3 A;  4I3J A;  2OWJ A;  4HP4 A;  1TS6 A;  3CWF A;  2HJ9 C;  3F1N B;  3MQQ A;  4GS9 A;  3OCN A;  1T1B A;  3K2N A;  2PHY A;  2W1T A;  3KYQ A;  1NWZ A;  2CMN A;  3LYX A;  4O8G A;  3ZQ5 A;  1OT6 A;  3F1O B;  2B02 A;  2W3H A;  1TF1 A;  2ZOI A;  4LLO B;  2OOL A;  1OJG A;  4Q0J A;  3CUE A;  3C30 A;  3PBS A;  2XA7 S;  3BW6 A;  3ZYT A;  3PXP A;  2VZW A;  2V9A A;  5A8B A;  2JKT I;  3FPW A;  5HDD A;  1S4S A;  2JN7 A;  3E4O A;  4LRY C;  2W0N A;  3RTY A;  4JGO A;  4YWZ A;  4O0P A;  4IJG A;  1S66 L;  2W3F A;  4CQH A;  4Q0H A;  1YSQ A;  4UEY A;  1T1C A;  4AFI A;  1DP6 A;  4QPR A;  2KX6 A;  1XJ2 A;  3A0V A;  4L9F A;  4LPZ A;  4YOF A;  5HWT A;  3T4L A;  5HPI A;  4Y5F A;  3T4O A;  4HIA A;  3EEH A;  2HGV A;  5DKL A;  4PAU A;  1LSX A;  2PYP A;  4IUK A;  1GSW A;  2GX5 A;  4K08 A;  2HV1 A;  2O0Y A;  2VLG A;  3MQO A;  4CLC A;  3P7N A;  1TS7 A;  1UGU A;  4ARZ A;  1VHM A;  2ZMF A;  2B18 A;  2W1R A;  3JVU A;  4ETX A;  5I5L A;  2IA2 A;  4KQO A;  3EQU A;  3R7W A;  3MXQ A;  4IUH A;  5F68 A;  4HNB A;  5DFX A;  4LRX C;  4M4X A;  1F5M A;  3T4T A;  4EU0 A;  3OLO A;  3KYZ A;  3B42 A;  3GDI A;  4NKP A;  2M7V A;  1MZU A;  4WEJ A;  1S1Y A;  5DJU A;  1D06 A;  2YKF A;  3K3D A;  1H3Q A;  1IOU A;  1N9L A;  4NXE A;  1F9I A;  3JVV A;  3LIE A;  3E4P A;  2PYR A;  5HSQ A;  4L0L A;  1LT0 A;  1LSW A;  4UQI S;  2JKR M;  4EER A;  1OTD A;  4P6Z M;  3E4Q A;  2VV8 A;  1DP8 A;  3PBO A;  3BQA A;  2QWS A;  4Y3I A;  2XA7 M;  1OTI A;  2XRN A;  3OBF A;  1GSV A;  1N9O A;  2OAQ 1;  1V9Y A;  2KOI A;  2I9V A;  2BAS A;  2L4R A;  4WN5 A;  2HJE A;  5TBM B;  5F69 A;  3LR0 A;  3LR5 A;  3CLO A;  2D02 A;  4XT2 A;  3LI8 A;  3V67 A;  2K31 A;  3PBN A;  2VGL S;  3KX0 X;  1NLZ A;  3S7O A;  4IHQ A;  4I3A A;  4YNR A;  1W63 Q;  3LUQ A;  3CAX A;  4EUV A;  4ME4 A;  3SW1 A;  3CIT A;  4BBV A;  3VE4 A;  4WEK A;  3B47 A;  4I5S A;  2Y79 A;  3EOI A;  3E98 A;  3F1P A;  4Z1W A;  4PHT A;  3MJQ A;  4I3I A;  4PKY A;  4WL9 A;  3MR0 A;  5TJJ A;  4MCW A;  4EET B;  4EEP A;  1LL8 A;  4EXO A;  2OAP 1;  2K2N A;  3UB8 A;  2J3T D;  2A24 A;  2O9A A;  3HJI A;  3O5Y A;  5DKK A;  4XT2 B;  1JNU A;  5J7E A;  4HJ6 A;  3KSI A;  3T4J A;  5HDC A;  3FG8 A;  4FSF A;  2J3T C;  3FPV A;  3NHQ A;  4CLC E;  1V9Z A;  1H8M A;  3IBJ A;  1W63 M;  3VV4 A;  3H82 B;  1YKD A;  3FC7 A;  1VB6 A;  1OTA A;  3MF0 A;  5HD5 A;  4R38 A;  3F1P B;  3T4S A;  5L8M A;  1T1A A;  4GHI A;  3W2Z A;  3LR3 A;  3G6O A;  1TS8 A;  2FH5 A;  2ZOH A;  2DMW A;  4FOF A;  2W27 A;  3NOT C;  2A24 B;  4NXF A;  5HDS A;  3PR6 A;  2PR6 A;  3LR4 A;  2V1A A;  4MN7 A;  5K5B A;  4G3W A;  1DP9 A;  3H7W A;  4HH2 A;  4HP9 A;  3U2A A;  2QHK A;  1UWN X;  1KOU A;  5IT5 A;  3T50 A;  1OJ5 A;  1G6O A;  5HL6 A;  2P7J A;  5LBR A;  1T19 A;  2EWV A;  2HF6 A;  3DBA A;  2ZMV A;  4HI4 A;  4EES A;  2L1M A;  4O01 A;  4CLC D;  4MN6 A;  1S1Z A;  1OPX A;  2K7S A;  4MN5 A;  5AJG A;  4GHI B;  3LI9 A;  4NXG A;  2V0U A;  2KLI A;  2G7U A;  2WKR A;  4CLC C;  3UE3 A;  2LB5 A;  2P08 A;  5TBM A;  2P04 A;  3H7W B;  1NLY A;  3BWL A;  4EQ1 A;  4GCZ A;  4RQ9 A;  2M7U A;  1N9N A;  5G4Y A;  3TE8 A;  2V1B A;  2PR5 A;  2W3G A;  3S7Q A;  3R4K A;  4EW7 A;  1EW0 A;  3NJA A;  4DJ2 A;  5IS1 A;  3PBT A;  2WKQ A;  4KUO A;  2W3D A;  3TRC A;  4II7 A;  3MFX A;  3KSG A;  2PDR A;  3UB7 A;  2A2L A;  5F6A A;  3EWK A;  2XSS A;  3OCL A;  1ZTU A;  1MKM A;  2Z6D A;  1DRM A;  2EWW A;  1P0Z A;  2OWH A;  2YKH A;  5AVE A;  1OT9 A;  4E04 A;  3A0S A;  2M1C A;  2V0W A;  1T18 A;  3H9W A;  3RFB A;  3BJN A;  2VX8 A;  4BMW A;  1S4R A;  2PD7 A;  3EQV A;  4L9G A;  2VA0 A;  2NUP C;  4WF0 A;  2QJ7 A;  3PBQ A;  4WLA A;  3PHY A;  4JGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...