2L0WA

Solution nmr structure of the n-terminal pas domain of herg potassium channel
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
135
structure length
135
Chain Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The N-Terminal Tail of hERG Contains an Amphipathic alpha-Helix That Regulates Channel Deactivation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Potassium voltage-gated channel, subfamily H (Eag-related),
total genus 28
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2l0wA01
4GW9A 2YKHA 4H6JA 1T1BA 2OWHA 3MR0A 3F1OA 2WKRA 2ZBBA 4HJ3A 4HI4A 4RQ9A 4LPZA 3UB8A 1BYWA 5HWTA 5KIZA 3LIBA 1T1CA 1S1YA 1DRMA 2J80A 3C8CA 2V1BA 2PYRA 3H7WB 5J3WA 4HJ4A 2INWA 3SW1A 4R6LA 1LSVA 5HWWA 4GHIB 2L4RA 1S4SA 3H82A 2A24A 3FG8A 1KOUA 3K3DA 3E4QA 4HJ6A 4MN6A 3T50A 3C2WA 1OTDA 2V0UA 4HOIA 4I5SA 3LI8A 1OTAA 5HSQA 1XFQA 1DP6A 1LSWA 3KX0X 3NOPC 4HY8A 4WN5A 4LRXC 1S1ZA 1OJGA 4JGOA 3UB6A 4EEPA 5J4EA 4LRYC 3CLOA 2CMNA 3LUQA 3F1PB 1XJ4A 2ZOHA 3F1OB 3K3CA 5I5LA 3LIEA 4LRZE 3LIDA 4R70A 4HHDA 5DJUA 1TS0A 2ZOIA 3A0RA 3A0SA 4XT2B 2QJ7A 2KX6A 2V1AA 3LIAA 2H28A 4HH2A 4HP9A 1OJ5A 4BBTA 2R78A 3EWKA 4B9OA 3IS2A 4KUOA 3MXQA 4M4XA 5HWVA 1T18A 3NOTC 2VEAA 4GHIA 4HQAA 1D06A 2A24B 3PHYA 4GCZA 4I38A 4I3IA 4R38A 5DJTA 3RTYA 2QWSA 4NXFA 1T19A 1T1AA 4WUJA 2B02A 3HJIA 3IBRA 3P7NA 1TS6A 2L0WA 2VV7A 3VE4A 1LSXA 1TS8A 2V0WA 5F68A 3UB9A 3F1PA 3MQOA 1OTEA 4HH3A 4L9GA 5AVFA 3VOLA 4BBUA 2EA9A 1LT0A 4GS9A 4DJ2A 1UWNX 3B33A 2KDKA 4KUKA 4I39A 3UMEA 4BBVA 4NXGA 1DP8A 4XT2A 3HJKA 5AVEA 1N9LA 1GSVA 2D01A 1VB6A 3UE6A 3IS2B 1NWZA 2VV8A 3EEHA 3ZQ5A 3VE3A 1S67L 5G4ZA 1WA9A 3OLOA 3H9WA 1V9YA 4K08A 3UMDA 3E4PA 2JN7A 1S66L 3LI9A 2QHKA 2QKPA 1XJ3A 3LIFA 4KQDA 2D02A 2PHYA 2VV6A 5IS1A 3NOUC 4GS9B 5G4YA 4EEUA 1DP9A 3CAXA 1JNUA 4JGPA 1X0OA 4WL9A 1EW0A 1Y28A 3F1NB 5F69A 1OT6A 3LYXA 4L9EA 4I3AA 4HIAA 2I9VA 1F9IA 2PD7A 4NXEA 5DKLA 4F3LB 5A8BA 3BY9A 4L9FA 1V9ZA 4E04A 2PD8A 1S4RA 2L1MA 1N9OA 2BASA 5TBMB 3G6OA 2WKQA 3E4OA 2YKFA 4R3AA 4JGQA 5DKKA 3NJAA 2PR5A 2QJ5A 4EW7A 2Z6DA 4PKYG 2PDRA 1GSWA 3BY8A 3GECA 1UGUA 3D72A 1OTIA 1G28A 5F6AA 5HZHA 2OWJA 3LICA 1P0ZA 1D7EA 1XJ2A 4H6JB 4DJ3A 1OTBA 4YWZA 5HDSA 2HV1A 4I3JA 3F1NA 2W27A 4EETB 3MQQA 1P97A 5HDDA 4F3LA 3BWLA 3ICYA 3NHQA 1UWPX 2K7SA 5HDCA 5HD5A 4JGRA 4EESA 3RH8B 2PYPA 4HP4A 2JHEA 2VLGA 2W0NA 3H7WA 5TBMA 3ULFA 2WKPA 3CWFA 4EERA 1TS7A 1XFNA 3FC7A 1N9NA 3GDIA 1GSXA 3MJQA 2OOLA 1XJ6A 2M1CA 3H82B 4HNBA 4NXBA 4PKYA 4WF0A 5EFWA 2PR6A 1ODVA 4EXOA 1LL8A 1MZUA 3MFXA 4MN5A 3UB7A 4EQ1A 1F98A 2GJ3A 2V9AA 3A0VA 1OT9A 4LLOB 4WLAA 2P7JA 3PYPA 5IU1A 5J7EA 2Z6CA 5HD3A 5F5YA
chains in the Genus database with same CATH superfamily
4OLDA 2W1TA 2DMWA 1NXYA 3PBNA 4G3KA 3H7WB 5CTMA 3LGOA 4EUVA 2BLSA 4KG2A 3E4QA 1YLWA 3LI8A 1L2SA 2Z2MB 4Y0TA 4DXBA 5AJGA 4OVDA 3ZFZA 4BLMA 3MKFA 4UA7A 1YPRA 3MZEA 3MF0A 2PU2A 1O7EA 4OQHA 4B4ZA 4WEKA 4HQAA 4IUKA 5U47A 3A3EA 2UV0E 2QWSA 2X02A 3HJIA 4GNUA 1IYPA 4JXVA 2ZMAA 4B88A 2V20A 4D2OA 2XD1A 1HLUP 3P09A 4DE0A 2E8JA 3KYZA 3LFVA 4WELA 1MKMA 1JNUA 4MBKA 4I3AA 4HIAA 4F3LB 4NXEA 2BASA 5L10A 4B4XA 3C4PA 3M2KA 4FTXA 4P6BA 4PKYG 3IX3A 1L0DA 1JVJA 2W27A 4CLCD 4OPQA 3L9KA 4ZAMA 4HP4A 2Y59A 4DKIA 1N9NA 2NUPC 4R3BA 1XJ6A 1F98A 1OT9A 4NEED 3FPVA 2Z6CA 3IXDA 4GW9A 3UY6A 1Z09A 5EPHA 3BFCA 4ZJ2A 2X01A 2B5RA 4CLCC 2J9OA 1H0MA 5FI6A 2GZAA 2Y2KA 1G5UA 3EGXC 2CMNA 1VETA 2PAVP 3IWQA 4OLGA 4Z9QA 4QY6A 2QJ7A 2KX6A 2V1AA 4MN7A 5L09A 4CPKA 4I3IA 2XSSA 2A24B 4GCZA 2MJ6A 3OPHA 3TOIA 1XX2A 1YLJA 2WGIA 4RX2A 1IEMA 3IX8A 4WYYA 1S6RA 4PM5A 3MBZA 1KE0A 3NECA 5HL1A 3SH7A 1MKIA 3EGDC 1IKGA 4PM9A 4C3QA 2VV8A 5IT5A 1AWIA 4Y17A 2JC7A 2P04A 5JYOA 1NLYA 3H9WA 4IBXA 3E4PA 2QKPA 4KZ9A 3FKVA 4CQHA 3KYQA 3NOUC 1ES2A 3DTIA 3HVFA 1BSGA 3IXHA 4CJNA 3IF6B 1MWTA 3G6OA 2W3FA 4JGQA 3IH9A 3IWIA 1JWZA 4OQIA 3BECA 1D7EA 1ERQA 5E2HA 4Z1WA 4UA9A 5F83A 1KE4A 1LL9A 1PYYA 4Y15A 4MDZA 4R23A 2JHEA 4NETA 1L3LA 1XP4A 3MMHA 2R9XA 2OOLA 3WS4A 4EXOA 4FH4A 4JF5A 4KZ8A 5J7EA 4WZ4A 4LFUA 1K4FA 4R0QA 5CRFA 3UDFA 4LV3A 3H82A 4MN6A 3Q1FA 2OLVA 4WN5A 4LRXC 5TGFA 4H8RA 3LUQA 2ZM8A 2ZLYA 1IFQA 4R70A 5DTKA 4DE2A 3KYEA 5EOOA 2WKEA 4HP9A 3HLCA 3ZG8B 1OJ5A 4X6TA 3G2YA 1D06A 1ES5A 2IWBA 1FR6A 2L0WA 4KZ5A 1KVMA 3VOLA 4IVIA 1L0GA 3Q81A 5AVEA 1MPLA 4AFIA 1NY0A 5M18A 4IVKA 4S2KA 3FPWA 3MS6A 3GR2A 3G31A 4GD6A 4LCLA 3T4QA 1GCEA 5EVEA 5DKLA 5A8BA 3B3XA 5EOEA 1V9ZA 2PD8A 2Y2LA 2H10A 3NJAA 1JWPA 2W3HA 4P6ZS 3T4TA 3ZG0A 2Y2GA 5L2FA 3E98A 2H0YA 4RVAA 1MBLA 5TBMA 5E2GA 3W4PA 3GDIA 4CLCA 1YLYA 4EUZA 4WLAA 2WUQA 4LLOB 3S7PA 5HD3A 4BL3A 2HP6A 1VM1A 3S7NA 4KZ4A 3O88A 1K25A 4RQ9A 3B47A 3FWLA 5DF9A 5HWTA 3HLBA 1MWSA 4OQ0A 5HL6A 1ESUA 1EI5A 5EVLA 1S4SA 2ZC5B 1YLZA 3EEAA 1BULA 5FASA 3KX0X 3PAEA 2B18A 4LRYC 3K3CA 3EQVA 3MZFA 3A0RA 3N4IA 4XT2B 1ES4A 3LEZA 2Y2MA 3IHBA 3UN7A 5HWVA 1Y4OA 1PIOA 4R38A 2EFUA 3T4LA 2XK1A 5EVIB 3MFDA 3F1PA 2I72A 4KUKA 3UO9A 5C5KA 1N9LA 1ZHHB 3NULA 2Y79A 4QJGA 3WS0A 5FQJA 3PTEA 3Q7VB 4KG6A 4GS9B 4JGPA 1YLPA 3BFEA 2E8IA 3SOIA 1S4RA 5DVAA 3C7VA 3UE0A 4UQIS 4N1XA 2EX2A 3WRTA 4B93A 1YM1A 1H8MA 1TVFA 2ZL1A 3ZVTA 3P01A 4JLFA 2QYBA 1KDWA 2XA7S 4Q8IA 1SKFA 4PHTA 1GSXA 3VOZA 5KSHA 1ODVA 1F2KA 5GLBA 2GJ3A 2V9AA 2QPNA 1NYMA 2JBFA 3IXGA 1K55A 4UA6A 1CF0A 1H8YA 1S1YA 2PYRA 4MBHA 2INWA 3QP6A 3OCNA 4R6LA 2OSUA 5EE8A 2V8CA 1E4DA 4HJ6A 3FG8A 4A5RA 5HSQA 3NOPC 2VZWA 1OJGA 2M7UA 1PW8A 1K6SA 5JYPA 2EFXA 4E3NA 1OMEA 3S4XA 4KENB 5FI2A 2WGWA 5EVID 4S2MA 4X68A 1TS6A 2VV7A 3TW8A 2GDNA 2J3WA 1MWUA 1U60A 4CLCE 1UWNX 3B33A 4S2OA 1NZUA 4BBVA 3N8LA 3M6HA 1VEUA 3GTCA 2XF3A 3CZDA 3HBRA 4GN2A 3T4SA 4BMWA 4RYEA 2D02A 5G4YA 2HP5A 4N92A 3F1NB 4L9EA 1W7FA 1L0EA 2W3DA 3BY9A 2O9BA 3LR3A 5I94A 1ES3A 3C38A 3PAGA 4EW7A 2Z6DA 5CGXA 3HCYA 5G18A 5F6AA 1G28A 3SH8A 1ALQA 1OTBA 1FSWA 4F3LA 4LV1A 2HJEA 2K7SA 4IEDA 2WAEA 3R4KA 3ZCZA 2W0NA 4ETZA 4KZ3A 3G35A 1XFNA 1G6OA 4GZBA 2J3TD 2Y2PA 4FCFA 5DFYA 2PU4A 1BLCA 3F1OA 2B95A 2ZQCA 1HZOA 3JYIA 1P9WA 2HPBA 4YINA 3V39A 5HWWA 1JTGA 4HOIA 3BJNA 1K54A 2Y4AA 3VV4A 3LR0A 1J3WA 4MBFA 3HLGA 2ZM0A 4BQMA 3ZG7B 3OCLA 4DN0A 4HH2A 1XA1A 5HFOA 3GRJA 3IS2A 5HARA 2EX6A 4GHIA 1FSYA 2AVXA 4MMNA 1ZC2A 2JKGA 5MC7A 3ITAA 5FDHA 1K56D 3V3SA 3A3IA 1YT4A 3HL9A 4XUZA 3AGDA 5J8XA 1O07A 1WE4A 4GD8A 1WA9A 3CPTA 4GKUA 4YOFA 5KZHA 2PHYA 3N7WA 3VP1A 4ESPA 4EBNA 3LYXA 3EOIA 2VGKA 4E04A 2WYXA 4PM6A 1N9OA 3ZHHA 2ACGA 3BYDA 4R3AA 1XA7A 5EVIC 1ZKJA 2H0TA 2QJ5A 5E2EA 3UDIA 2Y2OA 2ZC7A 4ZBEA 3GECA 5KMWA 3LICA 2Y2IA 4H6JB 4YWZA 3IF6A 1PI4A 5FAQA 2V2FF 3ZNTA 2VGLS 2Y2QA 2IA2A 4FUWA 4WF0A 1FCOA 3R7WB 4BD1A 2HJ9C 1PZOA 3S1YA 5FEFA 2FH5A 4P6ZM 4R4SA 3SS4A 3MR0A 1KVLA 1BYWA 4E3LA 2A3UA 2FFYA 2ZD8A 4HJ4A 2PBDP 2EX9A 1DJCA 1MY8A 4JGOA 1WYBA 1FOFA 3EQUA 3BEBA 1XJ4A 2WKHA 1KGEA 3QP1A 1H5XA 5EUAA 2RCXA 2WAFA 2WADA 3HLDA 4OP8A 1ZTUA 4Y0UA 3VE4A 2W3EA 1W79A 4EQIA 1VHMA 2KDKA 4QPRA 3UNWA 1CQAA 1PW1A 5AQAA 3UE6A 3CHWP 4Y2FA 1EWZA 3ZGAB 5CECA 2VJWA 2JN7A 3HLFA 4ETXA 4OQGA 3GMWA 5IS1A 3M6BA 1FCNA 3FKWA 1X0OA 4WL9A 2ZMVA 1KGGA 5AQ7A 5FQQA 2PD7A 4BD0A 2ZC3B 3P98A 4FSFA 2JKFA 1CK3A 2O0YA 3AGEA 4DMZA 4WMCA 3DWKA 2WKIA 3QP5A 2XQZA 1W8YA 2FZ0A 4UEYA 1SKOA 3ISGA 2HZ5A 4OPYA 1CEFA 4QU3A 4EQ1A 1YLTA 4O8GA 2V1ZA 4R3JA 2YKHA 4S2NA 2GNXA 4HJ3A 3LY3A 3G2ZA 2HDQA 3C8CA 4M3KA 3KSIA 1PZPA 1MWRA 3VOYA 4MLLA 2J9PA 1YSQA 1OTDA 3ZDJA 4E6XA 5L07A 3BLMA 4Y5FA 3BQ8A 4GDBA 1IYQA 2H5SA 3FV7A 1K4EA 4BBTA 3MXQA 4M4XA 3C30A 4WUJA 4E3JA 3MSHA 3DWZA 1PRQA 4S2PA 1BLPA 1TDLA 1K54C 3NBLA 3PXPA 1FQGA 1H8ZA 1YSPA 3B42A 2WGVA 5EVIA 3S22A 2HF6A 4DE1A 3U2AA 3G4PA 4EEUA 1K6RA 3IXBA 3M2JA 5KSCA 4ZDXA 3MZDA 3CUEC 2WKQA 4QWOA 1IOUA 2ZQ9A 5CTNA 4S2IA 1GHMA 4QD4A 5FI7A 5CEBA 4OPRA 5A92A 2A49A 2V8FA 3ZG5A 1W8QA 5F82A 2P7JA 3JPUA 5F5YA 2OAP1 2ZBBA 2LB9A 5FAOA 4HI4A 2K31A 3W4OA 5FQMA 4FH2A 3HLWA 4ZRRA 2DRWA 3RXXA 2IWDA 2EXBA 4E3OA 1M6KA 2O9AA 1OTAA 1XFQA 2EWVA 3NDGA 5F1GA 1E3UD 2DCFA 3OBFA 3SS3A 2Q0OA 3LIDA 1LLBA 1J9MA 4JBFA 3WRZA 5FAPA 3O5YA 4K91A 3LY4A 4KZBA 4I38A 4Q0IA 3RTYA 4PM7A 4G3VA 3OPPA 2Y2NA 3JVVA 1HTZA 3MXSA 1VETB 3MQOA 5AVFA 1OPXA 4BBUA 1LT0A 2IWCA 5CGSA 4EBLA 1I2SA 2C5WB 4NXGA 2WGWB 2ZC4B 1NWZA 2X71A 1S67L 3AGFA 3MXRA 5GHYA 4KQOA 3W8KA 3IT9A 1ESIA 3C7UA 4ARZA 3A3JA 1F9IA 1SHVA 1Q2QA 2YKFA 3UPPA 3VP4A 2M7VA 4L0LA 3BY8A 3D9YA 1CI8A 4DJ3A 2W1TB 2XR0A 4DE3A 2J3TC 5K5BA 3F1NA 3N6IA 4ZTKA 1JTDA 5FQ9A 1LL8A 1XKZA 3MFXA 2G2UA 3DTEA 3E2KA 3V50A 1KGFA 4JF6A 4O7DA 1W63M 2L4RA 4DXCA 1KOUA 3T50A 3W4QA 3PBQA 4KZAA 4WZ5A 4Y7PA 3OZHA 3QNCA 1XGIA 3F1OB 3VMAA 5HPFA 2XRNA 1YQSA 1FILA 1GHPA 4DRTA 2H28A 4B9OA 2XFSA 4D60A 1T18A 3DW0A 3PHYA 3K2NA 4LENA 4NXFA 3RJUA 3GQZA 2ZQ7A 4GB7A 4L9GA 4HH3A 2P74A 2EA9A 3PBRA 5DF7A 1DP8A 1VB6A 3EEHA 4IJGA 1V9YA 4K08A 5D3OA 1DP9A 3CAXA 1LHYA 4S2LA 3KSFA 2J8YA 4S2NC 1ERMA 4UAAA 4P87A 2P9VA 1GHIA 5DKKA 5TFQA 3CG5A 1TDGA 5GL9A 5HAPA 1P0ZA 4JXSA 1KDSA 2XFTA 3MQQA 4LV0A 5DFXA 1UWPX 1K56A 2WK0A 1Z6FA 1IYSA 3CWFA 3FC7A 4QY5A 1PI5A 3O87A 1NLZA 2HGVA 3L7HA 3W2ZA 5IU1A 3E4OA 3HUMA 4H6JA 3TRCA 4N9LA 2WKRA 2XD5A 3NY4A 1MXOA 4WBGA 3U4LP 4OONA 3VSKA 3ZVWA 5CXWA 4OOLA 2A24A 3K3DA 3R7WA 2V0UA 1BZAA 4HEFA 5CGWA 3VFHA 1CI9A 2ZOHA 5A91A 3LIEA 2O9CA 4LRZE 1AXBA 5DJUA 5HX9A 4JXGA 2R78A 2XDMA 4KUOA 1RP5A 3HUOA 3MQ0A 1N9BA 3G30A 2Y91A 2KOIA 3ITBA 3G34A 2Z2LB 1NJ4A 4XT2A 5FQIA 1PNEA 3BFFA 4X53A 1ONGA 1TEMA 3QP8A 2VKSA 3CI6A 5A93A 1OT6A 4PMAA 1ZG6A 4G3WA 4ID4A 1E25A 1IYOA 3UE1A 1E3UA 2XEPA 4XUXA 2W1RA 1RGZA 3QP2A 2QMIA 1KE3A 4NKPA 2OWJA 5E2FA 2WZZA 3A3FA 4DF6A 4HBTA 1P97A 5HDDA 5M19A 2G2WA 3RH8B 1PWGA 4NG2A 2VLGA 3ULFA 1Q2PA 4XXRA 2VX8A 2Y2JA 2PT7A 4U0XA 1YAXA 3H82B 2PR6A 2JKTI 4N1HA 3QP4A 3BW6A 3NCKA 2G7UA 2RL3A 2ZQDA 3ZYTA 2ZL1B 4NK3A 3WS1A 1SKOB 3BLSA 1BTLA 2Y8HA 4K0WA 5CEDA 2J80A 4LCMA 5FATA 4HESA 3DTMA 2DNSA 2GX5A 5L8MA 4ZJ3A 2ZC6B 3UB6A 1ACFA 1CEGA 2JCHA 5I5LA 1W5DA 1DJAA 4LGWA 3O3VA 1YMXA 3LO7A 3T4JA 4KZ7A 4O01A 4OOYA 4OP5A 3LR5A 3SS5A 1P9RA 2R9WA 5AQ9A 3P7NA 3G32A 1LSXA 5FL3A 2V0WA 2HP9A 3N8RA 3VFFA 5A90A 3HJKA 4WZ5C 4X69A 1K0KA 3T12B 5CX7A 4UQIM 4KQRA 1XJ3A 4KQDA 1TD5A 1GA0A 3A3DA 2ZM2A 4JKTA 1EW0A 3BM6A 1S0WA 2VGLM 1WYCA 2P08A 1VEUB 1IKIA 2Q9NA 3NDEA 5TBMB 5HPIA 4CLCB 4JPMA 3CJMA 2PDRA 1GSWA 3IH8A 3S7QA 1BLHA 3VSLA 1Y54A 3NI9A 1PWDA 4FD8A 5GLDA 4O0PA 4EESA 3UPOA 2PYPA 5F1FA 4X1MA 3H7WA 3IQAA 1TS7A 3MJQA 5EFWA 2BTFP 3I7JA 1T1BA 5DTTA 4K0XA 2HDSA 3BFDA 3IWOA 1YKDA 2Y55A 3NIAA 3T1XA 2NUTC 3SH9A 4C6YA 4X55A 1LSVA 4EWFA 3LCEA 1LSWA 4OOMA 1S1ZA 2LB5A 3UB5P 3IHAA 2XROA 1HD8A 4HHDA 2OV5A 4F94A 4LV2A 1JWVA 3WWXA 2PRFA 2VEAA 3MKEA 3IF6C 1T19A 4X56A 1TF1A 2PBYA 3BFGA 1TS8A 3Q7VA 5FDSA 4FOFA 4IBRA 4I39A 3UMEA 2VGJA 3IS2B 3RXWA 3WS2A 1GA9A 2JKRM 3T1QB 3VP2A 1SDNA 3T1SA 3PBTA 1NZOA 3T1RA 2ZQAA 2L1MA 4X1LA 4Y3IA 2KLIA 1BUEA 3CPTB 3FYZA 1UGUA 1OTIA 3VP0A 5GLAA 5HZHA 3D3OA 2ZMFA 4I3JA 1RGYA 3ICYA 5HDCA 4GOGA 3Q82A 1QMFA 2WKPA 4P85A 2FFFB 4GLQA 5HW3A 3D4FA 4LPZA 3V3RA 3LIBA 4YFMA 1T1CA 2OAQ1 2V1BA 1NRFA 4E6WA 5KIZA 5J4EA 1DY6A 1ZG4A 4IHQA 4HY8A 1N4OA 4EEPA 4BENA 4BWIA 1I2WA 3JVUA 3IX4A 5AQBA 4DDYA 3LEQA 5HAIA 4Q0JA 3LIAA 1F5MA 1MC0A 4ZJ1A 3EWKA 3CMZA 3NOTC 5DJTA 5BOHA 2B02A 3PR6A 1A0KA 5E43A 5EM0A 4Y0OA 1GSVA 4MEZA 4ME4A 4YNRA 2EWWA 3OLOA 3NC8A 4EU0A 1S66L 3LI9A 2QHKA 3BQAA 3LIFA 5CERA 4KG5A 3CITA 3Q07A 2UWXA 1Y28A 1FR1A 5F69A 4OKPA 2I9VA 3ZG9B 3T4KA 1NYYA 4X25A 2ZQ8A 1CJFA 5IHVA 1LL5A 1NRJA 1ONHA 1XJ2A 4MCWA 5FA7A 5HDSA 4E3IA 2W3GA 2JKRI 3OPLA 1G6AA 2P9VB 4EERA 4N9KA 2M1CA 3DAVA 4BL2A 3C4OA 5EECA 3T4OA 4QHCA 2WZXA 5TJJA 4Q0HA 4OH0A 3HLEA 4WM9A 3IBJA 1XXMA 5J3WA 5TR7A 3SW1A 2Y2HA 3LR4A 4GHIB 3N8SA 3C2WA 4I5SA 4DDSA 3DTKA 1K38A 2XA7M 2XGNA 3CLOA 3TJZC 4RX3A 3A0SA 3TE8A 3DBAA 5FSRA 1T1AA 3IBRA 3UB9A 4E3KA 1LI9A 1M40A 3QNBA 3IF5A 3KSHA 2D01A 2JKTM 4U0TA 4HBUA 3CUEA 2C6WB 5G4ZA 3UMDA 3HUNA 5EV0A 4MNRA 5GHZA 4P0MA 1EROA 2VV6A 3TSGA 3KO6A 5DF8A 4BJPA 3WS5A 5GLCA 3GV9A 1DJBA 1I5QA 1QMEA 4EBPA 2ZJ9A 1SCWA 5CHUA 2PR5A 1K57C 3S7OA 3D72A 2EXAA 4EV4A 1XGJA 2HV1A 4C75A 4GDNA 4R4RA 5CHJA 4IUHA 3E2LA 4KQQA 4JGRA 5HAQA 3QHYA 1K57A 4HNBA 5LBRA 2HDUA 4PKYA 5FQKA 1G68A 1MZUA 4MN5A 3E0YA 3UB7A 3KSGA 2QZ6A 1YMSA 3PYPA 5F68A 2XH9A 2OWHA 1L0FA 2JE5A 3UB8A 2HDRA 2CC1A 4JXWA 1DRMA 1XPBA 2A2LA 1SDEA 3V5MA 4E3MA 1PWCA 1K55C 4KZ6A 4WMCD 4JF4A 3Q7ZA 4R1GA 1STZA 2VK3A 3GSGA 1DP6A 2EX8A 3SZTA 3F1PB 2Q9MA 3PBSA 1TS0A 2ZOIA 4WEJA 3OC2A 2OLUA 4Y13A 4PPRA 5EM1A 3UE3A 1VQQA 3UDXA 4UHUA 3PBOA 3UPNA 3RFBA 2VA0A 1OTEA 1HVBA 3C5AA 4GS9A 4DJ2A 4PAUA 4GJ4A 3OOVA 3FZCA 1H3QA 4U3TA 3VP3A 3ZQ5A 3VE3A 5CHMA 4S2JA 4PM8A 2K2NA 1BLSA 3TG9A 3OPRA 5GHXA 1RCJA 1FIKA 3ZNYA 5M1AA 4RA7A 4II7A 4OPZA 4L9FA 1C3BA 2BG1A 1LI0A 2O99A 1PFLA 4QB8A 4ARZB 4EETB 1BT5A 3BWLA 3NHQA 1SZVA 2J7VA 5FEGA 3HREA 3O86A 5DTSA 3GVBA 1D1JA 5HD5A 3BRMA 4NXBA 1IELA 1W63Q 3A0VA 1FCMA 3V67A 2XLNA
chains in the Genus database with same CATH topology
2W1TA 2OAP1 1T1BA 2ZBBA 2LB9A 4HI4A 4DN0A 2K31A 2DMWA 1YKDA 4ZRRA 3PBNA 1S1YA 4G3KA 2NUTC 2PYRA 3H7WB 2INWA 4EUVA 3OCNA 4R6LA 1LSVA 4HJ6A 3FG8A 3E4QA 2O9AA 3LI8A 1OTAA 5HSQA 1XFQA 1LSWA 2EWVA 2VZWA 3NOPC 4OOMA 1S1ZA 1OJGA 2LB5A 5AJGA 2M7UA 3OBFA 2XROA 3LIDA 4HHDA 3MF0A 3O5YA 4WEKA 2VEAA 4HQAA 4IUKA 4I38A 4Q0IA 3RTYA 2QWSA 1T19A 1TF1A 4G3VA 3HJIA 1TS6A 2VV7A 3JVVA 3TW8A 1TS8A 2J3WA 3MQOA 5AVFA 4FOFA 1OPXA 4BBUA 1LT0A 4CLCE 1UWNX 3B33A 4I39A 3UMEA 4BBVA 4NXGA 3IS2B 1NWZA 1S67L 3T4SA 2JKRM 4KQOA 4BMWA 2D02A 3KYZA 3LFVA 4WELA 5G4YA 1MKMA 3PBTA 1JNUA 4ARZA 3F1NB 4L9EA 4I3AA 4HIAA 1F9IA 4F3LB 4NXEA 2W3DA 3BY9A 2O9BA 2L1MA 3LR3A 2BASA 4Y3IA 2KLIA 2YKFA 3C38A 2M7VA 4EW7A 2Z6DA 3HCYA 4L0LA 4PKYG 3BY8A 5F6AA 1UGUA 1OTIA 1G28A 5HZHA 3D3OA 4DJ3A 2W1TB 2ZMFA 1OTBA 4I3JA 2J3TC 5K5BA 3F1NA 2W27A 4CLCD 4F3LA 3ICYA 2HJEA 2K7SA 5HDCA 3R4KA 4HP4A 2W0NA 4ETZA 2WKPA 1XFNA 1N9NA 2NUPC 1G6OA 1XJ6A 2J3TD 3MFXA 1LL8A 1F98A 1OT9A 4NEED 3FPVA 2Z6CA 5DFYA 4GLQA 4GW9A 3F1OA 4LPZA 3LIBA 1T1CA 2OAQ1 2V1BA 1P9WA 4CLCC 1W63M 5HWWA 2L4RA 5KIZA 1KOUA 3T50A 4HOIA 5J4EA 2GZAA 4IHQA 4HY8A 3BJNA 3PBQA 4EEPA 3EGXC 4BWIA 2CMNA 3JVUA 3F1OB 3VV4A 5HPFA 3LR0A 2XRNA 4Q0JA 2QJ7A 2KX6A 3OCLA 2V1AA 1F5MA 1MC0A 2H28A 3LIAA 4HH2A 4MN7A 3EWKA 4B9OA 3IS2A 1T18A 3NOTC 4GHIA 4I3IA 2XSSA 2A24B 3PHYA 3K2NA 4GCZA 2MJ6A 4MMNA 5DJTA 4NXFA 2B02A 3PR6A 5MC7A 4L9GA 4HH3A 2EA9A 3PBRA 1DP8A 3EGDC 1GSVA 1VB6A 2VV8A 3EEHA 4ME4A 4YNRA 5IT5A 2EWWA 1WA9A 4IJGA 3OLOA 2P04A 1NLYA 3H9WA 1V9YA 4K08A 3E4PA 4EU0A 1S66L 3LI9A 2QHKA 2QKPA 3BQAA 3LIFA 4YOFA 4CQHA 2PHYA 3KYQA 3NOUC 3CITA 1DP9A 3CAXA 1Y28A 5F69A 3LYXA 3KSFA 3EOIA 2I9VA 3T4KA 4E04A 1N9OA 3G6OA 4R3AA 2W3FA 5DKKA 4JGQA 2QJ5A 3GECA 1NRJA 3LICA 1P0ZA 1D7EA 1XJ2A 4H6JB 4MCWA 4YWZA 5HDSA 4Z1WA 2W3GA 2JKRI 3MQQA 5DFXA 1UWPX 4MDZA 2JHEA 4EERA 3CWFA 3FC7A 2VGLS 3MMHA 2IA2A 1NLZA 2HGVA 2M1CA 2OOLA 4WF0A 3W2ZA 4EXOA 3R7WB 2HJ9C 5IU1A 3E4OA 3T4OA 5J7EA 2FH5A 4P6ZM 4H6JA 3TRCA 3MR0A 2WKRA 5TJJA 4Q0HA 1BYWA 3IBJA 5J3WA 4HJ4A 3SW1A 3LR4A 4GHIB 3H82A 4OOLA 2A24A 4MN6A 3K3DA 3R7WA 3C2WA 4I5SA 2V0UA 2XA7M 4WN5A 4LRXC 4JGOA 3CLOA 3EQUA 3LUQA 1XJ4A 2ZOHA 3TJZC 3LIEA 2O9CA 4LRZE 1IFQA 4R70A 5DJUA 3A0SA 3TE8A 3DBAA 4HP9A 1OJ5A 2R78A 4KUOA 1D06A 3MQ0A 1T1AA 1ZTUA 3IBRA 2KOIA 2L0WA 3VE4A 2W3EA 3UB9A 3VOLA 1VHMA 2KDKA 4QPRA 3KSHA 4XT2A 5AVEA 2D01A 3UE6A 2JKTM 4Y2FA 4AFIA 3CUEA 2VJWA 5G4ZA 3UMDA 2JN7A 4ETXA 3FPWA 2VKSA 2VV6A 3CI6A 5IS1A 3KO6A 4BJPA 1X0OA 4WL9A 2ZMVA 3T4QA 1OT6A 5DKLA 2PD7A 5A8BA 4G3WA 1V9ZA 2PD8A 4FSFA 2W1RA 2O0YA 3NJAA 2PR5A 4DMZA 4NKPA 3S7OA 2W3HA 3D72A 2OWJA 4P6ZS 2FZ0A 3T4TA 2HV1A 4UEYA 1P97A 5HDDA 3E98A 4IUHA 4JGRA 3RH8B 2VLGA 5TBMA 3ULFA 2VX8A 2PT7A 3GDIA 1YAXA 4HNBA 4PKYA 3H82B 5LBRA 4CLCA 2PR6A 1MZUA 2JKTI 3E0YA 4MN5A 3UB7A 3KSGA 4EQ1A 4O8GA 4WLAA 4LLOB 3BW6A 3S7PA 2G7UA 3PYPA 5F68A 5HD3A 3ZYTA 2YKHA 3S7NA 2GNXA 2OWHA 4HJ3A 4RQ9A 3B47A 3UB8A 5DF9A 5HWTA 2Y8HA 1DRMA 2J80A 3C8CA 3KSIA 5HL6A 2A2LA 1S4SA 3EEAA 1STZA 2GX5A 1YSQA 1OTDA 3KX0X 1DP6A 5L8MA 3UB6A 2B18A 4LRYC 3F1PB 4Y5FA 3K3CA 5I5LA 3BQ8A 3PBSA 3EQVA 1TS0A 2ZOIA 3A0RA 4XT2B 4BBTA 4WEJA 3T4JA 5HWVA 3OC2A 3MXQA 4M4XA 4O01A 4R38A 3T4LA 3LR5A 3UE3A 3C30A 4WUJA 1P9RA 3P7NA 3PBOA 1LSXA 5FL3A 2V0WA 3RFBA 2VA0A 3F1PA 1OTEA 4GS9A 4DJ2A 4PAUA 4GJ4A 4KUKA 3OOVA 5C5KA 1H3QA 3HJKA 1N9LA 1ZHHB 2Y79A 3ZQ5A 3VE3A 3PXPA 5CX7A 4UQIM 1YSPA 1XJ3A 3B42A 4KQDA 1TD5A 2HF6A 2K2NA 3U2AA 4GS9B 4EEUA 4JGPA 1EW0A 4II7A 2VGLM 2P08A 4L9FA 1S4RA 3CUEC 5TBMB 2WKQA 1IOUA 5HPIA 4UQIS 4CLCB 2O99A 2PDRA 1GSWA 4B93A 3S7QA 1H8MA 4ARZB 4EETB 3BWLA 3NHQA 3P01A 4O0PA 4EESA 2PYPA 2QYBA 3H7WA 2XA7S 1TS7A 4PHTA 3MJQA 1GSXA 5HD5A 4NXBA 5EFWA 5KSHA 1ODVA 1W63Q 3A0VA 2GJ3A 2V9AA 2P7JA 3V67A 5F5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GW9 A;  2YKH A;  4H6J A;  1T1B A;  2OWH A;  3MR0 A;  3F1O A;  2WKR A;  2ZBB A;  4HJ3 A;  4HI4 A;  4RQ9 A;  4LPZ A;  3UB8 A;  1BYW A;  5HWT A;  5KIZ A;  3LIB A;  1T1C A;  1S1Y A;  1DRM A;  2J80 A;  3C8C A;  2V1B A;  2PYR A;  3H7W B;  5J3W A;  4HJ4 A;  2INW A;  3SW1 A;  4R6L A;  1LSV A;  5HWW A;  4GHI B;  2L4R A;  1S4S A;  3H82 A;  2A24 A;  3FG8 A;  1KOU A;  3K3D A;  3E4Q A;  4HJ6 A;  4MN6 A;  3T50 A;  3C2W A;  1OTD A;  2V0U A;  4HOI A;  4I5S A;  3LI8 A;  1OTA A;  5HSQ A;  1XFQ A;  1DP6 A;  1LSW A;  3KX0 X;  3NOP C;  4HY8 A;  4WN5 A;  4LRX C;  1S1Z A;  1OJG A;  4JGO A;  3UB6 A;  4EEP A;  5J4E A;  4LRY C;  3CLO A;  2CMN A;  3LUQ A;  3F1P B;  1XJ4 A;  2ZOH A;  3F1O B;  3K3C A;  5I5L A;  3LIE A;  4LRZ E;  3LID A;  4R70 A;  4HHD A;  5DJU A;  1TS0 A;  2ZOI A;  3A0R A;  3A0S A;  4XT2 B;  2QJ7 A;  2KX6 A;  2V1A A;  3LIA A;  2H28 A;  4HH2 A;  4HP9 A;  1OJ5 A;  4BBT A;  2R78 A;  3EWK A;  4B9O A;  3IS2 A;  4KUO A;  3MXQ A;  4M4X A;  5HWV A;  1T18 A;  3NOT C;  2VEA A;  4GHI A;  4HQA A;  1D06 A;  2A24 B;  3PHY A;  4GCZ A;  4I38 A;  4I3I A;  4R38 A;  5DJT A;  3RTY A;  2QWS A;  4NXF A;  1T19 A;  1T1A A;  4WUJ A;  2B02 A;  3HJI A;  3IBR A;  3P7N A;  1TS6 A;  2L0W A;  2VV7 A;  3VE4 A;  1LSX A;  1TS8 A;  2V0W A;  5F68 A;  3UB9 A;  3F1P A;  3MQO A;  1OTE A;  4HH3 A;  4L9G A;  5AVF A;  3VOL A;  4BBU A;  2EA9 A;  1LT0 A;  4GS9 A;  4DJ2 A;  1UWN X;  3B33 A;  2KDK A;  4KUK A;  4I39 A;  3UME A;  4BBV A;  4NXG A;  1DP8 A;  4XT2 A;  3HJK A;  5AVE A;  1N9L A;  1GSV A;  2D01 A;  1VB6 A;  3UE6 A;  3IS2 B;  1NWZ A;  2VV8 A;  3EEH A;  3ZQ5 A;  3VE3 A;  1S67 L;  5G4Z A;  1WA9 A;  3OLO A;  3H9W A;  1V9Y A;  4K08 A;  3UMD A;  3E4P A;  2JN7 A;  1S66 L;  3LI9 A;  2QHK A;  2QKP A;  1XJ3 A;  3LIF A;  4KQD A;  2D02 A;  2PHY A;  2VV6 A;  5IS1 A;  3NOU C;  4GS9 B;  5G4Y A;  4EEU A;  1DP9 A;  3CAX A;  1JNU A;  4JGP A;  1X0O A;  4WL9 A;  1EW0 A;  1Y28 A;  3F1N B;  5F69 A;  1OT6 A;  3LYX A;  4L9E A;  4I3A A;  4HIA A;  2I9V A;  1F9I A;  2PD7 A;  4NXE A;  5DKL A;  4F3L B;  5A8B A;  3BY9 A;  4L9F A;  1V9Z A;  4E04 A;  2PD8 A;  1S4R A;  2L1M A;  1N9O A;  2BAS A;  5TBM B;  3G6O A;  2WKQ A;  3E4O A;  2YKF A;  4R3A A;  4JGQ A;  5DKK A;  3NJA A;  2PR5 A;  2QJ5 A;  4EW7 A;  2Z6D A;  4PKY G;  2PDR A;  1GSW A;  3BY8 A;  3GEC A;  1UGU A;  3D72 A;  1OTI A;  1G28 A;  5F6A A;  5HZH A;  2OWJ A;  3LIC A;  1P0Z A;  1D7E A;  1XJ2 A;  4H6J B;  4DJ3 A;  1OTB A;  4YWZ A;  5HDS A;  2HV1 A;  4I3J A;  3F1N A;  2W27 A;  4EET B;  3MQQ A;  1P97 A;  5HDD A;  4F3L A;  3BWL A;  3ICY A;  3NHQ A;  1UWP X;  2K7S A;  5HDC A;  5HD5 A;  4JGR A;  4EES A;  3RH8 B;  2PYP A;  4HP4 A;  2JHE A;  2VLG A;  2W0N A;  3H7W A;  5TBM A;  3ULF A;  2WKP A;  3CWF A;  4EER A;  1TS7 A;  1XFN A;  3FC7 A;  1N9N A;  3GDI A;  1GSX A;  3MJQ A;  2OOL A;  1XJ6 A;  2M1C A;  3H82 B;  4HNB A;  4NXB A;  4PKY A;  4WF0 A;  5EFW A;  2PR6 A;  1ODV A;  4EXO A;  1LL8 A;  1MZU A;  3MFX A;  4MN5 A;  3UB7 A;  4EQ1 A;  1F98 A;  2GJ3 A;  2V9A A;  3A0V A;  1OT9 A;  4LLO B;  4WLA A;  2P7J A;  3PYP A;  5IU1 A;  5J7E A;  2Z6C A;  5HD3 A;  5F5Y A; 
#chains in the Genus database with same CATH topology
 4OLD A;  2W1T A;  2DMW A;  1NXY A;  3PBN A;  4G3K A;  3H7W B;  5CTM A;  3LGO A;  4EUV A;  2BLS A;  4KG2 A;  3E4Q A;  1YLW A;  3LI8 A;  1L2S A;  2Z2M B;  4Y0T A;  4DXB A;  5AJG A;  4OVD A;  3ZFZ A;  4BLM A;  3MKF A;  4UA7 A;  1YPR A;  3MZE A;  3MF0 A;  2PU2 A;  1O7E A;  4OQH A;  4B4Z A;  4WEK A;  4HQA A;  4IUK A;  5U47 A;  3A3E A;  2UV0 E;  2QWS A;  2X02 A;  3HJI A;  4GNU A;  1IYP A;  4JXV A;  2ZMA A;  4B88 A;  2V20 A;  4D2O A;  2XD1 A;  1HLU P;  3P09 A;  4DE0 A;  2E8J A;  3KYZ A;  3LFV A;  4WEL A;  1MKM A;  1JNU A;  4MBK A;  4I3A A;  4HIA A;  4F3L B;  4NXE A;  2BAS A;  5L10 A;  4B4X A;  3C4P A;  3M2K A;  4FTX A;  4P6B A;  4PKY G;  3IX3 A;  1L0D A;  1JVJ A;  2W27 A;  4CLC D;  4OPQ A;  3L9K A;  4ZAM A;  4HP4 A;  2Y59 A;  4DKI A;  1N9N A;  2NUP C;  4R3B A;  1XJ6 A;  1F98 A;  1OT9 A;  4NEE D;  3FPV A;  2Z6C A;  3IXD A;  4GW9 A;  3UY6 A;  1Z09 A;  5EPH A;  3BFC A;  4ZJ2 A;  2X01 A;  2B5R A;  4CLC C;  2J9O A;  1H0M A;  5FI6 A;  2GZA A;  2Y2K A;  1G5U A;  3EGX C;  2CMN A;  1VET A;  2PAV P;  3IWQ A;  4OLG A;  4Z9Q A;  4QY6 A;  2QJ7 A;  2KX6 A;  2V1A A;  4MN7 A;  5L09 A;  4CPK A;  4I3I A;  2XSS A;  2A24 B;  4GCZ A;  2MJ6 A;  3OPH A;  3TOI A;  1XX2 A;  1YLJ A;  2WGI A;  4RX2 A;  1IEM A;  3IX8 A;  4WYY A;  1S6R A;  4PM5 A;  3MBZ A;  1KE0 A;  3NEC A;  5HL1 A;  3SH7 A;  1MKI A;  3EGD C;  1IKG A;  4PM9 A;  4C3Q A;  2VV8 A;  5IT5 A;  1AWI A;  4Y17 A;  2JC7 A;  2P04 A;  5JYO A;  1NLY A;  3H9W A;  4IBX A;  3E4P A;  2QKP A;  4KZ9 A;  3FKV A;  4CQH A;  3KYQ A;  3NOU C;  1ES2 A;  3DTI A;  3HVF A;  1BSG A;  3IXH A;  4CJN A;  3IF6 B;  1MWT A;  3G6O A;  2W3F A;  4JGQ A;  3IH9 A;  3IWI A;  1JWZ A;  4OQI A;  3BEC A;  1D7E A;  1ERQ A;  5E2H A;  4Z1W A;  4UA9 A;  5F83 A;  1KE4 A;  1LL9 A;  1PYY A;  4Y15 A;  4MDZ A;  4R23 A;  2JHE A;  4NET A;  1L3L A;  1XP4 A;  3MMH A;  2R9X A;  2OOL A;  3WS4 A;  4EXO A;  4FH4 A;  4JF5 A;  4KZ8 A;  5J7E A;  4WZ4 A;  4LFU A;  1K4F A;  4R0Q A;  5CRF A;  3UDF A;  4LV3 A;  3H82 A;  4MN6 A;  3Q1F A;  2OLV A;  4WN5 A;  4LRX C;  5TGF A;  4H8R A;  3LUQ A;  2ZM8 A;  2ZLY A;  1IFQ A;  4R70 A;  5DTK A;  4DE2 A;  3KYE A;  5EOO A;  2WKE A;  4HP9 A;  3HLC A;  3ZG8 B;  1OJ5 A;  4X6T A;  3G2Y A;  1D06 A;  1ES5 A;  2IWB A;  1FR6 A;  2L0W A;  4KZ5 A;  1KVM A;  3VOL A;  4IVI A;  1L0G A;  3Q81 A;  5AVE A;  1MPL A;  4AFI A;  1NY0 A;  5M18 A;  4IVK A;  4S2K A;  3FPW A;  3MS6 A;  3GR2 A;  3G31 A;  4GD6 A;  4LCL A;  3T4Q A;  1GCE A;  5EVE A;  5DKL A;  5A8B A;  3B3X A;  5EOE A;  1V9Z A;  2PD8 A;  2Y2L A;  2H10 A;  3NJA A;  1JWP A;  2W3H A;  4P6Z S;  3T4T A;  3ZG0 A;  2Y2G A;  5L2F A;  3E98 A;  2H0Y A;  4RVA A;  1MBL A;  5TBM A;  5E2G A;  3W4P A;  3GDI A;  4CLC A;  1YLY A;  4EUZ A;  4WLA A;  2WUQ A;  4LLO B;  3S7P A;  5HD3 A;  4BL3 A;  2HP6 A;  1VM1 A;  3S7N A;  4KZ4 A;  3O88 A;  1K25 A;  4RQ9 A;  3B47 A;  3FWL A;  5DF9 A;  5HWT A;  3HLB A;  1MWS A;  4OQ0 A;  5HL6 A;  1ESU A;  1EI5 A;  5EVL A;  1S4S A;  2ZC5 B;  1YLZ A;  3EEA A;  1BUL A;  5FAS A;  3KX0 X;  3PAE A;  2B18 A;  4LRY C;  3K3C A;  3EQV A;  3MZF A;  3A0R A;  3N4I A;  4XT2 B;  1ES4 A;  3LEZ A;  2Y2M A;  3IHB A;  3UN7 A;  5HWV A;  1Y4O A;  1PIO A;  4R38 A;  2EFU A;  3T4L A;  2XK1 A;  5EVI B;  3MFD A;  3F1P A;  2I72 A;  4KUK A;  3UO9 A;  5C5K A;  1N9L A;  1ZHH B;  3NUL A;  2Y79 A;  4QJG A;  3WS0 A;  5FQJ A;  3PTE A;  3Q7V B;  4KG6 A;  4GS9 B;  4JGP A;  1YLP A;  3BFE A;  2E8I A;  3SOI A;  1S4R A;  5DVA A;  3C7V A;  3UE0 A;  4UQI S;  4N1X A;  2EX2 A;  3WRT A;  4B93 A;  1YM1 A;  1H8M A;  1TVF A;  2ZL1 A;  3ZVT A;  3P01 A;  4JLF A;  2QYB A;  1KDW A;  2XA7 S;  4Q8I A;  1SKF A;  4PHT A;  1GSX A;  3VOZ A;  5KSH A;  1ODV A;  1F2K A;  5GLB A;  2GJ3 A;  2V9A A;  2QPN A;  1NYM A;  2JBF A;  3IXG A;  1K55 A;  4UA6 A;  1CF0 A;  1H8Y A;  1S1Y A;  2PYR A;  4MBH A;  2INW A;  3QP6 A;  3OCN A;  4R6L A;  2OSU A;  5EE8 A;  2V8C A;  1E4D A;  4HJ6 A;  3FG8 A;  4A5R A;  5HSQ A;  3NOP C;  2VZW A;  1OJG A;  2M7U A;  1PW8 A;  1K6S A;  5JYP A;  2EFX A;  4E3N A;  1OME A;  3S4X A;  4KEN B;  5FI2 A;  2WGW A;  5EVI D;  4S2M A;  4X68 A;  1TS6 A;  2VV7 A;  3TW8 A;  2GDN A;  2J3W A;  1MWU A;  1U60 A;  4CLC E;  1UWN X;  3B33 A;  4S2O A;  1NZU A;  4BBV A;  3N8L A;  3M6H A;  1VEU A;  3GTC A;  2XF3 A;  3CZD A;  3HBR A;  4GN2 A;  3T4S A;  4BMW A;  4RYE A;  2D02 A;  5G4Y A;  2HP5 A;  4N92 A;  3F1N B;  4L9E A;  1W7F A;  1L0E A;  2W3D A;  3BY9 A;  2O9B A;  3LR3 A;  5I94 A;  1ES3 A;  3C38 A;  3PAG A;  4EW7 A;  2Z6D A;  5CGX A;  3HCY A;  5G18 A;  5F6A A;  1G28 A;  3SH8 A;  1ALQ A;  1OTB A;  1FSW A;  4F3L A;  4LV1 A;  2HJE A;  2K7S A;  4IED A;  2WAE A;  3R4K A;  3ZCZ A;  2W0N A;  4ETZ A;  4KZ3 A;  3G35 A;  1XFN A;  1G6O A;  4GZB A;  2J3T D;  2Y2P A;  4FCF A;  5DFY A;  2PU4 A;  1BLC A;  3F1O A;  2B95 A;  2ZQC A;  1HZO A;  3JYI A;  1P9W A;  2HPB A;  4YIN A;  3V39 A;  5HWW A;  1JTG A;  4HOI A;  3BJN A;  1K54 A;  2Y4A A;  3VV4 A;  3LR0 A;  1J3W A;  4MBF A;  3HLG A;  2ZM0 A;  4BQM A;  3ZG7 B;  3OCL A;  4DN0 A;  4HH2 A;  1XA1 A;  5HFO A;  3GRJ A;  3IS2 A;  5HAR A;  2EX6 A;  4GHI A;  1FSY A;  2AVX A;  4MMN A;  1ZC2 A;  2JKG A;  5MC7 A;  3ITA A;  5FDH A;  1K56 D;  3V3S A;  3A3I A;  1YT4 A;  3HL9 A;  4XUZ A;  3AGD A;  5J8X A;  1O07 A;  1WE4 A;  4GD8 A;  1WA9 A;  3CPT A;  4GKU A;  4YOF A;  5KZH A;  2PHY A;  3N7W A;  3VP1 A;  4ESP A;  4EBN A;  3LYX A;  3EOI A;  2VGK A;  4E04 A;  2WYX A;  4PM6 A;  1N9O A;  3ZHH A;  2ACG A;  3BYD A;  4R3A A;  1XA7 A;  5EVI C;  1ZKJ A;  2H0T A;  2QJ5 A;  5E2E A;  3UDI A;  2Y2O A;  2ZC7 A;  4ZBE A;  3GEC A;  5KMW A;  3LIC A;  2Y2I A;  4H6J B;  4YWZ A;  3IF6 A;  1PI4 A;  5FAQ A;  2V2F F;  3ZNT A;  2VGL S;  2Y2Q A;  2IA2 A;  4FUW A;  4WF0 A;  1FCO A;  3R7W B;  4BD1 A;  2HJ9 C;  1PZO A;  3S1Y A;  5FEF A;  2FH5 A;  4P6Z M;  4R4S A;  3SS4 A;  3MR0 A;  1KVL A;  1BYW A;  4E3L A;  2A3U A;  2FFY A;  2ZD8 A;  4HJ4 A;  2PBD P;  2EX9 A;  1DJC A;  1MY8 A;  4JGO A;  1WYB A;  1FOF A;  3EQU A;  3BEB A;  1XJ4 A;  2WKH A;  1KGE A;  3QP1 A;  1H5X A;  5EUA A;  2RCX A;  2WAF A;  2WAD A;  3HLD A;  4OP8 A;  1ZTU A;  4Y0U A;  3VE4 A;  2W3E A;  1W79 A;  4EQI A;  1VHM A;  2KDK A;  4QPR A;  3UNW A;  1CQA A;  1PW1 A;  5AQA A;  3UE6 A;  3CHW P;  4Y2F A;  1EWZ A;  3ZGA B;  5CEC A;  2VJW A;  2JN7 A;  3HLF A;  4ETX A;  4OQG A;  3GMW A;  5IS1 A;  3M6B A;  1FCN A;  3FKW A;  1X0O A;  4WL9 A;  2ZMV A;  1KGG A;  5AQ7 A;  5FQQ A;  2PD7 A;  4BD0 A;  2ZC3 B;  3P98 A;  4FSF A;  2JKF A;  1CK3 A;  2O0Y A;  3AGE A;  4DMZ A;  4WMC A;  3DWK A;  2WKI A;  3QP5 A;  2XQZ A;  1W8Y A;  2FZ0 A;  4UEY A;  1SKO A;  3ISG A;  2HZ5 A;  4OPY A;  1CEF A;  4QU3 A;  4EQ1 A;  1YLT A;  4O8G A;  2V1Z A;  4R3J A;  2YKH A;  4S2N A;  2GNX A;  4HJ3 A;  3LY3 A;  3G2Z A;  2HDQ A;  3C8C A;  4M3K A;  3KSI A;  1PZP A;  1MWR A;  3VOY A;  4MLL A;  2J9P A;  1YSQ A;  1OTD A;  3ZDJ A;  4E6X A;  5L07 A;  3BLM A;  4Y5F A;  3BQ8 A;  4GDB A;  1IYQ A;  2H5S A;  3FV7 A;  1K4E A;  4BBT A;  3MXQ A;  4M4X A;  3C30 A;  4WUJ A;  4E3J A;  3MSH A;  3DWZ A;  1PRQ A;  4S2P A;  1BLP A;  1TDL A;  1K54 C;  3NBL A;  3PXP A;  1FQG A;  1H8Z A;  1YSP A;  3B42 A;  2WGV A;  5EVI A;  3S22 A;  2HF6 A;  4DE1 A;  3U2A A;  3G4P A;  4EEU A;  1K6R A;  3IXB A;  3M2J A;  5KSC A;  4ZDX A;  3MZD A;  3CUE C;  2WKQ A;  4QWO A;  1IOU A;  2ZQ9 A;  5CTN A;  4S2I A;  1GHM A;  4QD4 A;  5FI7 A;  5CEB A;  4OPR A;  5A92 A;  2A49 A;  2V8F A;  3ZG5 A;  1W8Q A;  5F82 A;  2P7J A;  3JPU A;  5F5Y A;  2OAP 1;  2ZBB A;  2LB9 A;  5FAO A;  4HI4 A;  2K31 A;  3W4O A;  5FQM A;  4FH2 A;  3HLW A;  4ZRR A;  2DRW A;  3RXX A;  2IWD A;  2EXB A;  4E3O A;  1M6K A;  2O9A A;  1OTA A;  1XFQ A;  2EWV A;  3NDG A;  5F1G A;  1E3U D;  2DCF A;  3OBF A;  3SS3 A;  2Q0O A;  3LID A;  1LLB A;  1J9M A;  4JBF A;  3WRZ A;  5FAP A;  3O5Y A;  4K91 A;  3LY4 A;  4KZB A;  4I38 A;  4Q0I A;  3RTY A;  4PM7 A;  4G3V A;  3OPP A;  2Y2N A;  3JVV A;  1HTZ A;  3MXS A;  1VET B;  3MQO A;  5AVF A;  1OPX A;  4BBU A;  1LT0 A;  2IWC A;  5CGS A;  4EBL A;  1I2S A;  2C5W B;  4NXG A;  2WGW B;  2ZC4 B;  1NWZ A;  2X71 A;  1S67 L;  3AGF A;  3MXR A;  5GHY A;  4KQO A;  3W8K A;  3IT9 A;  1ESI A;  3C7U A;  4ARZ A;  3A3J A;  1F9I A;  1SHV A;  1Q2Q A;  2YKF A;  3UPP A;  3VP4 A;  2M7V A;  4L0L A;  3BY8 A;  3D9Y A;  1CI8 A;  4DJ3 A;  2W1T B;  2XR0 A;  4DE3 A;  2J3T C;  5K5B A;  3F1N A;  3N6I A;  4ZTK A;  1JTD A;  5FQ9 A;  1LL8 A;  1XKZ A;  3MFX A;  2G2U A;  3DTE A;  3E2K A;  3V50 A;  1KGF A;  4JF6 A;  4O7D A;  1W63 M;  2L4R A;  4DXC A;  1KOU A;  3T50 A;  3W4Q A;  3PBQ A;  4KZA A;  4WZ5 A;  4Y7P A;  3OZH A;  3QNC A;  1XGI A;  3F1O B;  3VMA A;  5HPF A;  2XRN A;  1YQS A;  1FIL A;  1GHP A;  4DRT A;  2H28 A;  4B9O A;  2XFS A;  4D60 A;  1T18 A;  3DW0 A;  3PHY A;  3K2N A;  4LEN A;  4NXF A;  3RJU A;  3GQZ A;  2ZQ7 A;  4GB7 A;  4L9G A;  4HH3 A;  2P74 A;  2EA9 A;  3PBR A;  5DF7 A;  1DP8 A;  1VB6 A;  3EEH A;  4IJG A;  1V9Y A;  4K08 A;  5D3O A;  1DP9 A;  3CAX A;  1LHY A;  4S2L A;  3KSF A;  2J8Y A;  4S2N C;  1ERM A;  4UAA A;  4P87 A;  2P9V A;  1GHI A;  5DKK A;  5TFQ A;  3CG5 A;  1TDG A;  5GL9 A;  5HAP A;  1P0Z A;  4JXS A;  1KDS A;  2XFT A;  3MQQ A;  4LV0 A;  5DFX A;  1UWP X;  1K56 A;  2WK0 A;  1Z6F A;  1IYS A;  3CWF A;  3FC7 A;  4QY5 A;  1PI5 A;  3O87 A;  1NLZ A;  2HGV A;  3L7H A;  3W2Z A;  5IU1 A;  3E4O A;  3HUM A;  4H6J A;  3TRC A;  4N9L A;  2WKR A;  2XD5 A;  3NY4 A;  1MXO A;  4WBG A;  3U4L P;  4OON A;  3VSK A;  3ZVW A;  5CXW A;  4OOL A;  2A24 A;  3K3D A;  3R7W A;  2V0U A;  1BZA A;  4HEF A;  5CGW A;  3VFH A;  1CI9 A;  2ZOH A;  5A91 A;  3LIE A;  2O9C A;  4LRZ E;  1AXB A;  5DJU A;  5HX9 A;  4JXG A;  2R78 A;  2XDM A;  4KUO A;  1RP5 A;  3HUO A;  3MQ0 A;  1N9B A;  3G30 A;  2Y91 A;  2KOI A;  3ITB A;  3G34 A;  2Z2L B;  1NJ4 A;  4XT2 A;  5FQI A;  1PNE A;  3BFF A;  4X53 A;  1ONG A;  1TEM A;  3QP8 A;  2VKS A;  3CI6 A;  5A93 A;  1OT6 A;  4PMA A;  1ZG6 A;  4G3W A;  4ID4 A;  1E25 A;  1IYO A;  3UE1 A;  1E3U A;  2XEP A;  4XUX A;  2W1R A;  1RGZ A;  3QP2 A;  2QMI A;  1KE3 A;  4NKP A;  2OWJ A;  5E2F A;  2WZZ A;  3A3F A;  4DF6 A;  4HBT A;  1P97 A;  5HDD A;  5M19 A;  2G2W A;  3RH8 B;  1PWG A;  4NG2 A;  2VLG A;  3ULF A;  1Q2P A;  4XXR A;  2VX8 A;  2Y2J A;  2PT7 A;  4U0X A;  1YAX A;  3H82 B;  2PR6 A;  2JKT I;  4N1H A;  3QP4 A;  3BW6 A;  3NCK A;  2G7U A;  2RL3 A;  2ZQD A;  3ZYT A;  2ZL1 B;  4NK3 A;  3WS1 A;  1SKO B;  3BLS A;  1BTL A;  2Y8H A;  4K0W A;  5CED A;  2J80 A;  4LCM A;  5FAT A;  4HES A;  3DTM A;  2DNS A;  2GX5 A;  5L8M A;  4ZJ3 A;  2ZC6 B;  3UB6 A;  1ACF A;  1CEG A;  2JCH A;  5I5L A;  1W5D A;  1DJA A;  4LGW A;  3O3V A;  1YMX A;  3LO7 A;  3T4J A;  4KZ7 A;  4O01 A;  4OOY A;  4OP5 A;  3LR5 A;  3SS5 A;  1P9R A;  2R9W A;  5AQ9 A;  3P7N A;  3G32 A;  1LSX A;  5FL3 A;  2V0W A;  2HP9 A;  3N8R A;  3VFF A;  5A90 A;  3HJK A;  4WZ5 C;  4X69 A;  1K0K A;  3T12 B;  5CX7 A;  4UQI M;  4KQR A;  1XJ3 A;  4KQD A;  1TD5 A;  1GA0 A;  3A3D A;  2ZM2 A;  4JKT A;  1EW0 A;  3BM6 A;  1S0W A;  2VGL M;  1WYC A;  2P08 A;  1VEU B;  1IKI A;  2Q9N A;  3NDE A;  5TBM B;  5HPI A;  4CLC B;  4JPM A;  3CJM A;  2PDR A;  1GSW A;  3IH8 A;  3S7Q A;  1BLH A;  3VSL A;  1Y54 A;  3NI9 A;  1PWD A;  4FD8 A;  5GLD A;  4O0P A;  4EES A;  3UPO A;  2PYP A;  5F1F A;  4X1M A;  3H7W A;  3IQA A;  1TS7 A;  3MJQ A;  5EFW A;  2BTF P;  3I7J A;  1T1B A;  5DTT A;  4K0X A;  2HDS A;  3BFD A;  3IWO A;  1YKD A;  2Y55 A;  3NIA A;  3T1X A;  2NUT C;  3SH9 A;  4C6Y A;  4X55 A;  1LSV A;  4EWF A;  3LCE A;  1LSW A;  4OOM A;  1S1Z A;  2LB5 A;  3UB5 P;  3IHA A;  2XRO A;  1HD8 A;  4HHD A;  2OV5 A;  4F94 A;  4LV2 A;  1JWV A;  3WWX A;  2PRF A;  2VEA A;  3MKE A;  3IF6 C;  1T19 A;  4X56 A;  1TF1 A;  2PBY A;  3BFG A;  1TS8 A;  3Q7V A;  5FDS A;  4FOF A;  4IBR A;  4I39 A;  3UME A;  2VGJ A;  3IS2 B;  3RXW A;  3WS2 A;  1GA9 A;  2JKR M;  3T1Q B;  3VP2 A;  1SDN A;  3T1S A;  3PBT A;  1NZO A;  3T1R A;  2ZQA A;  2L1M A;  4X1L A;  4Y3I A;  2KLI A;  1BUE A;  3CPT B;  3FYZ A;  1UGU A;  1OTI A;  3VP0 A;  5GLA A;  5HZH A;  3D3O A;  2ZMF A;  4I3J A;  1RGY A;  3ICY A;  5HDC A;  4GOG A;  3Q82 A;  1QMF A;  2WKP A;  4P85 A;  2FFF B;  4GLQ A;  5HW3 A;  3D4F A;  4LPZ A;  3V3R A;  3LIB A;  4YFM A;  1T1C A;  2OAQ 1;  2V1B A;  1NRF A;  4E6W A;  5KIZ A;  5J4E A;  1DY6 A;  1ZG4 A;  4IHQ A;  4HY8 A;  1N4O A;  4EEP A;  4BEN A;  4BWI A;  1I2W A;  3JVU A;  3IX4 A;  5AQB A;  4DDY A;  3LEQ A;  5HAI A;  4Q0J A;  3LIA A;  1F5M A;  1MC0 A;  4ZJ1 A;  3EWK A;  3CMZ A;  3NOT C;  5DJT A;  5BOH A;  2B02 A;  3PR6 A;  1A0K A;  5E43 A;  5EM0 A;  4Y0O A;  1GSV A;  4MEZ A;  4ME4 A;  4YNR A;  2EWW A;  3OLO A;  3NC8 A;  4EU0 A;  1S66 L;  3LI9 A;  2QHK A;  3BQA A;  3LIF A;  5CER A;  4KG5 A;  3CIT A;  3Q07 A;  2UWX A;  1Y28 A;  1FR1 A;  5F69 A;  4OKP A;  2I9V A;  3ZG9 B;  3T4K A;  1NYY A;  4X25 A;  2ZQ8 A;  1CJF A;  5IHV A;  1LL5 A;  1NRJ A;  1ONH A;  1XJ2 A;  4MCW A;  5FA7 A;  5HDS A;  4E3I A;  2W3G A;  2JKR I;  3OPL A;  1G6A A;  2P9V B;  4EER A;  4N9K A;  2M1C A;  3DAV A;  4BL2 A;  3C4O A;  5EEC A;  3T4O A;  4QHC A;  2WZX A;  5TJJ A;  4Q0H A;  4OH0 A;  3HLE A;  4WM9 A;  3IBJ A;  1XXM A;  5J3W A;  5TR7 A;  3SW1 A;  2Y2H A;  3LR4 A;  4GHI B;  3N8S A;  3C2W A;  4I5S A;  4DDS A;  3DTK A;  1K38 A;  2XA7 M;  2XGN A;  3CLO A;  3TJZ C;  4RX3 A;  3A0S A;  3TE8 A;  3DBA A;  5FSR A;  1T1A A;  3IBR A;  3UB9 A;  4E3K A;  1LI9 A;  1M40 A;  3QNB A;  3IF5 A;  3KSH A;  2D01 A;  2JKT M;  4U0T A;  4HBU A;  3CUE A;  2C6W B;  5G4Z A;  3UMD A;  3HUN A;  5EV0 A;  4MNR A;  5GHZ A;  4P0M A;  1ERO A;  2VV6 A;  3TSG A;  3KO6 A;  5DF8 A;  4BJP A;  3WS5 A;  5GLC A;  3GV9 A;  1DJB A;  1I5Q A;  1QME A;  4EBP A;  2ZJ9 A;  1SCW A;  5CHU A;  2PR5 A;  1K57 C;  3S7O A;  3D72 A;  2EXA A;  4EV4 A;  1XGJ A;  2HV1 A;  4C75 A;  4GDN A;  4R4R A;  5CHJ A;  4IUH A;  3E2L A;  4KQQ A;  4JGR A;  5HAQ A;  3QHY A;  1K57 A;  4HNB A;  5LBR A;  2HDU A;  4PKY A;  5FQK A;  1G68 A;  1MZU A;  4MN5 A;  3E0Y A;  3UB7 A;  3KSG A;  2QZ6 A;  1YMS A;  3PYP A;  5F68 A;  2XH9 A;  2OWH A;  1L0F A;  2JE5 A;  3UB8 A;  2HDR A;  2CC1 A;  4JXW A;  1DRM A;  1XPB A;  2A2L A;  1SDE A;  3V5M A;  4E3M A;  1PWC A;  1K55 C;  4KZ6 A;  4WMC D;  4JF4 A;  3Q7Z A;  4R1G A;  1STZ A;  2VK3 A;  3GSG A;  1DP6 A;  2EX8 A;  3SZT A;  3F1P B;  2Q9M A;  3PBS A;  1TS0 A;  2ZOI A;  4WEJ A;  3OC2 A;  2OLU A;  4Y13 A;  4PPR A;  5EM1 A;  3UE3 A;  1VQQ A;  3UDX A;  4UHU A;  3PBO A;  3UPN A;  3RFB A;  2VA0 A;  1OTE A;  1HVB A;  3C5A A;  4GS9 A;  4DJ2 A;  4PAU A;  4GJ4 A;  3OOV A;  3FZC A;  1H3Q A;  4U3T A;  3VP3 A;  3ZQ5 A;  3VE3 A;  5CHM A;  4S2J A;  4PM8 A;  2K2N A;  1BLS A;  3TG9 A;  3OPR A;  5GHX A;  1RCJ A;  1FIK A;  3ZNY A;  5M1A A;  4RA7 A;  4II7 A;  4OPZ A;  4L9F A;  1C3B A;  2BG1 A;  1LI0 A;  2O99 A;  1PFL A;  4QB8 A;  4ARZ B;  4EET B;  1BT5 A;  3BWL A;  3NHQ A;  1SZV A;  2J7V A;  5FEG A;  3HRE A;  3O86 A;  5DTS A;  3GVB A;  1D1J A;  5HD5 A;  3BRM A;  4NXB A;  1IEL A;  1W63 Q;  3A0V A;  1FCM A;  3V67 A;  2XLN A; 
#chains in the Genus database with same CATH homology
 2W1T A;  2OAP 1;  1T1B A;  2ZBB A;  2LB9 A;  4HI4 A;  4DN0 A;  2K31 A;  2DMW A;  1YKD A;  4ZRR A;  3PBN A;  1S1Y A;  4G3K A;  2NUT C;  2PYR A;  3H7W B;  2INW A;  4EUV A;  3OCN A;  4R6L A;  1LSV A;  4HJ6 A;  3FG8 A;  3E4Q A;  2O9A A;  3LI8 A;  1OTA A;  5HSQ A;  1XFQ A;  1LSW A;  2EWV A;  2VZW A;  3NOP C;  4OOM A;  1S1Z A;  1OJG A;  2LB5 A;  5AJG A;  2M7U A;  3OBF A;  2XRO A;  3LID A;  4HHD A;  3MF0 A;  3O5Y A;  4WEK A;  2VEA A;  4HQA A;  4IUK A;  4I38 A;  4Q0I A;  3RTY A;  2QWS A;  1T19 A;  1TF1 A;  4G3V A;  3HJI A;  1TS6 A;  2VV7 A;  3JVV A;  3TW8 A;  1TS8 A;  2J3W A;  3MQO A;  5AVF A;  4FOF A;  1OPX A;  4BBU A;  1LT0 A;  4CLC E;  1UWN X;  3B33 A;  4I39 A;  3UME A;  4BBV A;  4NXG A;  3IS2 B;  1NWZ A;  1S67 L;  3T4S A;  2JKR M;  4KQO A;  4BMW A;  2D02 A;  3KYZ A;  3LFV A;  4WEL A;  5G4Y A;  1MKM A;  3PBT A;  1JNU A;  4ARZ A;  3F1N B;  4L9E A;  4I3A A;  4HIA A;  1F9I A;  4F3L B;  4NXE A;  2W3D A;  3BY9 A;  2O9B A;  2L1M A;  3LR3 A;  2BAS A;  4Y3I A;  2KLI A;  2YKF A;  3C38 A;  2M7V A;  4EW7 A;  2Z6D A;  3HCY A;  4L0L A;  4PKY G;  3BY8 A;  5F6A A;  1UGU A;  1OTI A;  1G28 A;  5HZH A;  3D3O A;  4DJ3 A;  2W1T B;  2ZMF A;  1OTB A;  4I3J A;  2J3T C;  5K5B A;  3F1N A;  2W27 A;  4CLC D;  4F3L A;  3ICY A;  2HJE A;  2K7S A;  5HDC A;  3R4K A;  4HP4 A;  2W0N A;  4ETZ A;  2WKP A;  1XFN A;  1N9N A;  2NUP C;  1G6O A;  1XJ6 A;  2J3T D;  3MFX A;  1LL8 A;  1F98 A;  1OT9 A;  4NEE D;  3FPV A;  2Z6C A;  5DFY A;  4GLQ A;  4GW9 A;  3F1O A;  4LPZ A;  3LIB A;  1T1C A;  2OAQ 1;  2V1B A;  1P9W A;  4CLC C;  1W63 M;  5HWW A;  2L4R A;  5KIZ A;  1KOU A;  3T50 A;  4HOI A;  5J4E A;  2GZA A;  4IHQ A;  4HY8 A;  3BJN A;  3PBQ A;  4EEP A;  3EGX C;  4BWI A;  2CMN A;  3JVU A;  3F1O B;  3VV4 A;  5HPF A;  3LR0 A;  2XRN A;  4Q0J A;  2QJ7 A;  2KX6 A;  3OCL A;  2V1A A;  1F5M A;  1MC0 A;  2H28 A;  3LIA A;  4HH2 A;  4MN7 A;  3EWK A;  4B9O A;  3IS2 A;  1T18 A;  3NOT C;  4GHI A;  4I3I A;  2XSS A;  2A24 B;  3PHY A;  3K2N A;  4GCZ A;  2MJ6 A;  4MMN A;  5DJT A;  4NXF A;  2B02 A;  3PR6 A;  5MC7 A;  4L9G A;  4HH3 A;  2EA9 A;  3PBR A;  1DP8 A;  3EGD C;  1GSV A;  1VB6 A;  2VV8 A;  3EEH A;  4ME4 A;  4YNR A;  5IT5 A;  2EWW A;  1WA9 A;  4IJG A;  3OLO A;  2P04 A;  1NLY A;  3H9W A;  1V9Y A;  4K08 A;  3E4P A;  4EU0 A;  1S66 L;  3LI9 A;  2QHK A;  2QKP A;  3BQA A;  3LIF A;  4YOF A;  4CQH A;  2PHY A;  3KYQ A;  3NOU C;  3CIT A;  1DP9 A;  3CAX A;  1Y28 A;  5F69 A;  3LYX A;  3KSF A;  3EOI A;  2I9V A;  3T4K A;  4E04 A;  1N9O A;  3G6O A;  4R3A A;  2W3F A;  5DKK A;  4JGQ A;  2QJ5 A;  3GEC A;  1NRJ A;  3LIC A;  1P0Z A;  1D7E A;  1XJ2 A;  4H6J B;  4MCW A;  4YWZ A;  5HDS A;  4Z1W A;  2W3G A;  2JKR I;  3MQQ A;  5DFX A;  1UWP X;  4MDZ A;  2JHE A;  4EER A;  3CWF A;  3FC7 A;  2VGL S;  3MMH A;  2IA2 A;  1NLZ A;  2HGV A;  2M1C A;  2OOL A;  4WF0 A;  3W2Z A;  4EXO A;  3R7W B;  2HJ9 C;  5IU1 A;  3E4O A;  3T4O A;  5J7E A;  2FH5 A;  4P6Z M;  4H6J A;  3TRC A;  3MR0 A;  2WKR A;  5TJJ A;  4Q0H A;  1BYW A;  3IBJ A;  5J3W A;  4HJ4 A;  3SW1 A;  3LR4 A;  4GHI B;  3H82 A;  4OOL A;  2A24 A;  4MN6 A;  3K3D A;  3R7W A;  3C2W A;  4I5S A;  2V0U A;  2XA7 M;  4WN5 A;  4LRX C;  4JGO A;  3CLO A;  3EQU A;  3LUQ A;  1XJ4 A;  2ZOH A;  3TJZ C;  3LIE A;  2O9C A;  4LRZ E;  1IFQ A;  4R70 A;  5DJU A;  3A0S A;  3TE8 A;  3DBA A;  4HP9 A;  1OJ5 A;  2R78 A;  4KUO A;  1D06 A;  3MQ0 A;  1T1A A;  1ZTU A;  3IBR A;  2KOI A;  2L0W A;  3VE4 A;  2W3E A;  3UB9 A;  3VOL A;  1VHM A;  2KDK A;  4QPR A;  3KSH A;  4XT2 A;  5AVE A;  2D01 A;  3UE6 A;  2JKT M;  4Y2F A;  4AFI A;  3CUE A;  2VJW A;  5G4Z A;  3UMD A;  2JN7 A;  4ETX A;  3FPW A;  2VKS A;  2VV6 A;  3CI6 A;  5IS1 A;  3KO6 A;  4BJP A;  1X0O A;  4WL9 A;  2ZMV A;  3T4Q A;  1OT6 A;  5DKL A;  2PD7 A;  5A8B A;  4G3W A;  1V9Z A;  2PD8 A;  4FSF A;  2W1R A;  2O0Y A;  3NJA A;  2PR5 A;  4DMZ A;  4NKP A;  3S7O A;  2W3H A;  3D72 A;  2OWJ A;  4P6Z S;  2FZ0 A;  3T4T A;  2HV1 A;  4UEY A;  1P97 A;  5HDD A;  3E98 A;  4IUH A;  4JGR A;  3RH8 B;  2VLG A;  5TBM A;  3ULF A;  2VX8 A;  2PT7 A;  3GDI A;  1YAX A;  4HNB A;  4PKY A;  3H82 B;  5LBR A;  4CLC A;  2PR6 A;  1MZU A;  2JKT I;  3E0Y A;  4MN5 A;  3UB7 A;  3KSG A;  4EQ1 A;  4O8G A;  4WLA A;  4LLO B;  3BW6 A;  3S7P A;  2G7U A;  3PYP A;  5F68 A;  5HD3 A;  3ZYT A;  2YKH A;  3S7N A;  2GNX A;  2OWH A;  4HJ3 A;  4RQ9 A;  3B47 A;  3UB8 A;  5DF9 A;  5HWT A;  2Y8H A;  1DRM A;  2J80 A;  3C8C A;  3KSI A;  5HL6 A;  2A2L A;  1S4S A;  3EEA A;  1STZ A;  2GX5 A;  1YSQ A;  1OTD A;  3KX0 X;  1DP6 A;  5L8M A;  3UB6 A;  2B18 A;  4LRY C;  3F1P B;  4Y5F A;  3K3C A;  5I5L A;  3BQ8 A;  3PBS A;  3EQV A;  1TS0 A;  2ZOI A;  3A0R A;  4XT2 B;  4BBT A;  4WEJ A;  3T4J A;  5HWV A;  3OC2 A;  3MXQ A;  4M4X A;  4O01 A;  4R38 A;  3T4L A;  3LR5 A;  3UE3 A;  3C30 A;  4WUJ A;  1P9R A;  3P7N A;  3PBO A;  1LSX A;  5FL3 A;  2V0W A;  3RFB A;  2VA0 A;  3F1P A;  1OTE A;  4GS9 A;  4DJ2 A;  4PAU A;  4GJ4 A;  4KUK A;  3OOV A;  5C5K A;  1H3Q A;  3HJK A;  1N9L A;  1ZHH B;  2Y79 A;  3ZQ5 A;  3VE3 A;  3PXP A;  5CX7 A;  4UQI M;  1YSP A;  1XJ3 A;  3B42 A;  4KQD A;  1TD5 A;  2HF6 A;  2K2N A;  3U2A A;  4GS9 B;  4EEU A;  4JGP A;  1EW0 A;  4II7 A;  2VGL M;  2P08 A;  4L9F A;  1S4R A;  3CUE C;  5TBM B;  2WKQ A;  1IOU A;  5HPI A;  4UQI S;  4CLC B;  2O99 A;  2PDR A;  1GSW A;  4B93 A;  3S7Q A;  1H8M A;  4ARZ B;  4EET B;  3BWL A;  3NHQ A;  3P01 A;  4O0P A;  4EES A;  2PYP A;  2QYB A;  3H7W A;  2XA7 S;  1TS7 A;  4PHT A;  3MJQ A;  1GSX A;  5HD5 A;  4NXB A;  5EFW A;  5KSH A;  1ODV A;  1W63 Q;  3A0V A;  2GJ3 A;  2V9A A;  2P7J A;  3V67 A;  5F5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...