2L0ZA

Solution structure of a zinc-binding domain from the junin virus envelope glycoprotein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
41
structure length
41
Chain Sequence
PTHRHIRGEACPLPHRLNSLGGCRCGKYPNLKKPTVWRRGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoprotein G2
publication title Structure of a Zinc-binding Domain in the Junin Virus Envelope Glycoprotein.
pubmed doi rcsb
molecule tags Viral protein
total genus 4
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.180 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2l0zA00
2L0ZA
chains in the Genus database with same CATH superfamily
1LKMA 5K2ME 2JI2A 2C6BA 5DM71 2JA6L 1CAAA 3H0GL 1BQ8A 4XGHA 5GADc 5JVH1 3VPBE 1BQ9A 3PL5A 5IYDL 1LKOA 3GTML 3HOUL 1BRFA 1I6HL 4BXXL 3K35A 3GTLL 5RXNA 3HKZP 1QQTA 1FHHA 1R0HA 1H7VA 5MF6A 2NVTL 3QQCE 4WFN1 2WAQP 2E2JL 1TWFL 2A68D 1R9TL 3MPSA 1ZRPA 5GAEc 4AHZA 3PZAA 3RZ6A 1ODHA 5AI2A 1OWBA 1T9OA 5IP9L 2YU9L 2V0EA 5M5WL 4A3KL 1OWCA 1IU6A 3WWLA 3GTPL 3JR7A 3HOYL 2XJPA 3LWQB 3M3YL 4YWLA 3HOVL 1PFYA 5C4XL 2M6OA 1K83L 3PIP1 3K7AL 4B8CD 2C6AA 1DX8A 3PO3L 2AUSB 4A3GL 2XJSA 2HVYC 2RDVA 1S30A 5M5YL 3KYYA 4BBRL 5JVG1 3PKJA 2NVXL 3S2HL 2PYAA 3HJYB 4AHWA 1YK4A 3H3VM 3LWPB 5C4JL 5AN9H 4AYBP 4JAEA 1TWCL 2ERJA 1B2OA 1E8JA 1B2JA 4POGA 2ZIXA 1PFWA 1Z92B 4AR4A 2M4YA 3PIO1 2B63L 2R93L 2NYDA 4A3BL 5GAHc 1RB9A 5EIOC 5MFZA 2XJTA 3A44A 2A69D 1TWAL 2M4VA 3S17L 3M4OL 1R0IA 2CKCA 3J7Z1 5IYCL 1T9QA 1CADA 2K2DA 1RWDA 2JA5L 1PZXA 8RXNA 3LWVB 2LCQA 3GTQL 2HR5A 3WWNB 4A3EL 2R92L 3GTOL 4POFA 4BBSL 1IW7D 3PWFA 2L0ZA 1RYTA 1Y1VL 1FHMA 3RZTA 2NVQL 3LWRB 3S15L 5H1Sc 2AYJA 5MFPA 2MS3A 3LNLA 1SMWA 4UY81 4C2M1 4AR3A 3B08B 2R7ZL 1B71A 1F4LA 1WJVA 1VZGA 3I4ML 3MSUA 1YK5A 4A3CL 4AI1A 3HOZL 4TVMA 4C3IL 1IU5A 1BFYA 2H12A 2PPTA 5AI3A 2JA8L 3HOXL 1R0FA 3GTJL 1RDGA 5DM61 5C3EL 3KYUA 5EINC 2V0FA 3S1ML 4GS7D 4A3FL 1SFOL 1SMMA 2XJRA 5M5XL 1S24A 2E2HL 1YUZA 2RFKB 4BY1L 5MGNA 2Z3RB 1YUXA 4A3LL 4YWMA 2CR8A 4V196 2APOB 4A93L 2ERSA 4TPUA 6RXNA 2PMZP 2A6ED 3HOWL 3PO2L 3ZG6A 1PFVA 3I4NL 5MLC3 3NFPI 2NVYL 2Z3QB 4C3JL 1QYBA 4A3DL 2PVXA 5IY0A 2PSMC 1NXEA 1RYQA 7RXNA 1Y1WL 2PVEA 1PFUA 3S2DL 4A3ML 4LHLA 4JADA 2Y0SP 1WCML 1IROA 4JAGA 3FKIL 4AI2A 3RZOL 5IYBL 4ZN3B 1I3QL 4A3JL 1I50L 3P2AA 3S1RL 3H9CA 2QL0A 2M6PA 3KYVA 2XJVA 3HAXC 4ME3A 4G6BA 4XXBB 2GMGA 1QCVA 4Y52L 4AR5A 3PKIA 4JAFA 3S16L 1IRNA 3H9BA 1VZIA 5IP7L 3MQKB 3RYGA 4AI0A 4RXNA 3IU3I 2JA7L 4AI3A 2XJQA 2B5ID 2O5JD 1LTLA 3S14L 1TWGL 2JI1A 1T9PA 4K9FA 2KKDA 2XJUA 4BY7L 4ZN1B 1LKPA 1YV1A 2J9UB 1NNQA 3HJWB 3LPEB 1BE7A 4AR6A 3QVDA 3J7Y1 1P7PA 2VL6A 1R0JA 3S1NL 5FLML 5GAGc 5M3FL 1NXGA 3KYXA 2KN9A 1VZHA 4E6YA 1JYBA 3CQZL 1R0GA 2BE5D 1VCXA 2WB1P 5FJ8L 3GTGL 4Y7NL 4AHXA 3H97A 3S1QL 1S2ZA 3P8BA 3SS2A 2EY4E 3GTKL 2E2IL 1DVBA 1B13A 2AQCA 5M3ML 2A6HD 3B0AB 3KYWA 4AHYA 3RZDL 1SMUA 4C3HL 1TWHL 1C09A 2V3BB 4X6AL 4LHNA 1RDVA 2JI3A 4A3IL 2VUML 3LWOB 2DSXA 2CKAA 3H99A 3FDJA 5C44L 4U671 4QIWP
chains in the Genus database with same CATH topology
1LKMA 1YK4A 5K2ME 2JI2A 2C6BA 3PKIA 4JAFA 4AI1A 1IRNA 4AR5A 5DM71 5AN9H 1CAAA 4TVMA 1VZIA 1IU5A 1BFYA 4JAEA 3RYGA 2ERJA 2H12A 2PPTA 1B2OA 1BQ8A 5AI3A 1E8JA 4XGHA 5GADc 1R0FA 1B2JA 3VPBE 1BQ9A 1RDGA 4RXNA 3IU3I 4AI0A 5DM61 5JVH1 4AI3A 3KYUA 5EINC 2V0FA 4POGA 2XJQA 1LKOA 2B5ID 2ZIXA 4GS7D 1Z92B 4AR4A 2O5JD 2M4YA 3PIO1 1BRFA 2NYDA 3K35A 5GAHc 1SMMA 1RB9A 5RXNA 2XJRA 1S24A 1LTLA 1FHHA 1YUZA 5EIOC 5MFZA 5MGNA 2Z3RB 1YUXA 1R0HA 2XJTA 3A44A 1H7VA 2A69D 5MF6A 2JI1A 1T9PA 4YWMA 4K9FA 3QQCE 2CR8A 2KKDA 2XJUA 4WFN1 4V196 2M4VA 2A68D 3MPSA 4ZN1B 1R0IA 1LKPA 2CKCA 2ERSA 1ZRPA 1YV1A 4TPUA 5GAEc 3J7Z1 4AHZA 3PZAA 2J9UB 1NNQA 3LPEB 1BE7A 3RZ6A 1ODHA 4AR6A 6RXNA 5AI2A 1T9QA 1OWBA 1T9OA 3QVDA 2A6ED 1CADA 3J7Y1 2K2DA 2VL6A 1RWDA 2V0EA 3ZG6A 5MLC3 8RXNA 3NFPI 1R0JA 1OWCA 1IU6A 2Z3QB 3WWLA 2LCQA 1QYBA 5GAGc 2PVXA 5IY0A 2PSMC 1NXGA 2HR5A 1NXEA 1RYQA 3KYXA 2XJPA 3WWNB 2KN9A 7RXNA 4POFA 4YWLA 2PVEA 1VZHA 4E6YA 1IW7D 3PWFA 2L0ZA 1JYBA 1R0GA 1RYTA 2BE5D 2M6OA 4LHLA 3PIP1 1VCXA 4JADA 4B8CD 1FHMA 4AHXA 3RZTA 1IROA 1S2ZA 2C6AA 3P8BA 4JAGA 3SS2A 4AI2A 1DX8A 5H1Sc 1DVBA 1B13A 2AYJA 5MFPA 2A6HD 3B0AB 4AHYA 3KYWA 4ZN3B 2MS3A 3LNLA 2XJSA 1SMUA 1SMWA 3MSUA 2RDVA 4UY81 1S30A 1C09A 3P2AA 2V3BB 4AR3A 3KYYA 4LHNA 3B08B 1B71A 1RDVA 2QL0A 5JVG1 2M6PA 2JI3A 3PKJA 3KYVA 2XJVA 1WJVA 2PYAA 1VZGA 4G6BA 4ME3A 2DSXA 4XXBB 2CKAA 4AHWA 2GMGA 1QCVA 4U671 1YK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0Z A; 
#chains in the Genus database with same CATH topology
 1LKM A;  5K2M E;  2JI2 A;  2C6B A;  5DM7 1;  2JA6 L;  1CAA A;  3H0G L;  1BQ8 A;  4XGH A;  5GAD c;  5JVH 1;  3VPB E;  1BQ9 A;  3PL5 A;  5IYD L;  1LKO A;  3GTM L;  3HOU L;  1BRF A;  1I6H L;  4BXX L;  3K35 A;  3GTL L;  5RXN A;  3HKZ P;  1QQT A;  1FHH A;  1R0H A;  1H7V A;  5MF6 A;  2NVT L;  3QQC E;  4WFN 1;  2WAQ P;  2E2J L;  1TWF L;  2A68 D;  1R9T L;  3MPS A;  1ZRP A;  5GAE c;  4AHZ A;  3PZA A;  3RZ6 A;  1ODH A;  5AI2 A;  1OWB A;  1T9O A;  5IP9 L;  2YU9 L;  2V0E A;  5M5W L;  4A3K L;  1OWC A;  1IU6 A;  3WWL A;  3GTP L;  3JR7 A;  3HOY L;  2XJP A;  3LWQ B;  3M3Y L;  4YWL A;  3HOV L;  1PFY A;  5C4X L;  2M6O A;  1K83 L;  3PIP 1;  3K7A L;  4B8C D;  2C6A A;  1DX8 A;  3PO3 L;  2AUS B;  4A3G L;  2XJS A;  2HVY C;  2RDV A;  1S30 A;  5M5Y L;  3KYY A;  4BBR L;  5JVG 1;  3PKJ A;  2NVX L;  3S2H L;  2PYA A;  3HJY B;  4AHW A;  1YK4 A;  3H3V M;  3LWP B;  5C4J L;  5AN9 H;  4AYB P;  4JAE A;  1TWC L;  2ERJ A;  1B2O A;  1E8J A;  1B2J A;  4POG A;  2ZIX A;  1PFW A;  1Z92 B;  4AR4 A;  2M4Y A;  3PIO 1;  2B63 L;  2R93 L;  2NYD A;  4A3B L;  5GAH c;  1RB9 A;  5EIO C;  5MFZ A;  2XJT A;  3A44 A;  2A69 D;  1TWA L;  2M4V A;  3S17 L;  3M4O L;  1R0I A;  2CKC A;  3J7Z 1;  5IYC L;  1T9Q A;  1CAD A;  2K2D A;  1RWD A;  2JA5 L;  1PZX A;  8RXN A;  3LWV B;  2LCQ A;  3GTQ L;  2HR5 A;  3WWN B;  4A3E L;  2R92 L;  3GTO L;  4POF A;  4BBS L;  1IW7 D;  3PWF A;  2L0Z A;  1RYT A;  1Y1V L;  1FHM A;  3RZT A;  2NVQ L;  3LWR B;  3S15 L;  5H1S c;  2AYJ A;  5MFP A;  2MS3 A;  3LNL A;  1SMW A;  4UY8 1;  4C2M 1;  4AR3 A;  3B08 B;  2R7Z L;  1B71 A;  1F4L A;  1WJV A;  1VZG A;  3I4M L;  3MSU A;  1YK5 A;  4A3C L;  4AI1 A;  3HOZ L;  4TVM A;  4C3I L;  1IU5 A;  1BFY A;  2H12 A;  2PPT A;  5AI3 A;  2JA8 L;  3HOX L;  1R0F A;  3GTJ L;  1RDG A;  5DM6 1;  5C3E L;  3KYU A;  5EIN C;  2V0F A;  3S1M L;  4GS7 D;  4A3F L;  1SFO L;  1SMM A;  2XJR A;  5M5X L;  1S24 A;  2E2H L;  1YUZ A;  2RFK B;  4BY1 L;  5MGN A;  2Z3R B;  1YUX A;  4A3L L;  4YWM A;  2CR8 A;  4V19 6;  2APO B;  4A93 L;  2ERS A;  4TPU A;  6RXN A;  2PMZ P;  2A6E D;  3HOW L;  3PO2 L;  3ZG6 A;  1PFV A;  3I4N L;  5MLC 3;  3NFP I;  2NVY L;  2Z3Q B;  4C3J L;  1QYB A;  4A3D L;  2PVX A;  5IY0 A;  2PSM C;  1NXE A;  1RYQ A;  7RXN A;  1Y1W L;  2PVE A;  1PFU A;  3S2D L;  4A3M L;  4LHL A;  4JAD A;  2Y0S P;  1WCM L;  1IRO A;  4JAG A;  3FKI L;  4AI2 A;  3RZO L;  5IYB L;  4ZN3 B;  1I3Q L;  4A3J L;  1I50 L;  3P2A A;  3S1R L;  3H9C A;  2QL0 A;  2M6P A;  3KYV A;  2XJV A;  3HAX C;  4ME3 A;  4G6B A;  4XXB B;  2GMG A;  1QCV A;  4Y52 L;  4AR5 A;  3PKI A;  4JAF A;  3S16 L;  1IRN A;  3H9B A;  1VZI A;  5IP7 L;  3MQK B;  3RYG A;  4AI0 A;  4RXN A;  3IU3 I;  2JA7 L;  4AI3 A;  2XJQ A;  2B5I D;  2O5J D;  1LTL A;  3S14 L;  1TWG L;  2JI1 A;  1T9P A;  4K9F A;  2KKD A;  2XJU A;  4BY7 L;  4ZN1 B;  1LKP A;  1YV1 A;  2J9U B;  1NNQ A;  3HJW B;  3LPE B;  1BE7 A;  4AR6 A;  3QVD A;  3J7Y 1;  1P7P A;  2VL6 A;  1R0J A;  3S1N L;  5FLM L;  5GAG c;  5M3F L;  1NXG A;  3KYX A;  2KN9 A;  1VZH A;  4E6Y A;  1JYB A;  3CQZ L;  1R0G A;  2BE5 D;  1VCX A;  2WB1 P;  5FJ8 L;  3GTG L;  4Y7N L;  4AHX A;  3H97 A;  3S1Q L;  1S2Z A;  3P8B A;  3SS2 A;  2EY4 E;  3GTK L;  2E2I L;  1DVB A;  1B13 A;  2AQC A;  5M3M L;  2A6H D;  3B0A B;  3KYW A;  4AHY A;  3RZD L;  1SMU A;  4C3H L;  1TWH L;  1C09 A;  2V3B B;  4X6A L;  4LHN A;  1RDV A;  2JI3 A;  4A3I L;  2VUM L;  3LWO B;  2DSX A;  2CKA A;  3H99 A;  3FDJ A;  5C44 L;  4U67 1;  4QIW P; 
#chains in the Genus database with same CATH homology
 1LKM A;  1YK4 A;  5K2M E;  2JI2 A;  2C6B A;  3PKI A;  4JAF A;  4AI1 A;  1IRN A;  4AR5 A;  5DM7 1;  5AN9 H;  1CAA A;  4TVM A;  1VZI A;  1IU5 A;  1BFY A;  4JAE A;  3RYG A;  2ERJ A;  2H12 A;  2PPT A;  1B2O A;  1BQ8 A;  5AI3 A;  1E8J A;  4XGH A;  5GAD c;  1R0F A;  1B2J A;  3VPB E;  1BQ9 A;  1RDG A;  4RXN A;  3IU3 I;  4AI0 A;  5DM6 1;  5JVH 1;  4AI3 A;  3KYU A;  5EIN C;  2V0F A;  4POG A;  2XJQ A;  1LKO A;  2B5I D;  2ZIX A;  4GS7 D;  1Z92 B;  4AR4 A;  2O5J D;  2M4Y A;  3PIO 1;  1BRF A;  2NYD A;  3K35 A;  5GAH c;  1SMM A;  1RB9 A;  5RXN A;  2XJR A;  1S24 A;  1LTL A;  1FHH A;  1YUZ A;  5EIO C;  5MFZ A;  5MGN A;  2Z3R B;  1YUX A;  1R0H A;  2XJT A;  3A44 A;  1H7V A;  2A69 D;  5MF6 A;  2JI1 A;  1T9P A;  4YWM A;  4K9F A;  3QQC E;  2CR8 A;  2KKD A;  2XJU A;  4WFN 1;  4V19 6;  2M4V A;  2A68 D;  3MPS A;  4ZN1 B;  1R0I A;  1LKP A;  2CKC A;  2ERS A;  1ZRP A;  1YV1 A;  4TPU A;  5GAE c;  3J7Z 1;  4AHZ A;  3PZA A;  2J9U B;  1NNQ A;  3LPE B;  1BE7 A;  3RZ6 A;  1ODH A;  4AR6 A;  6RXN A;  5AI2 A;  1T9Q A;  1OWB A;  1T9O A;  3QVD A;  2A6E D;  1CAD A;  3J7Y 1;  2K2D A;  2VL6 A;  1RWD A;  2V0E A;  3ZG6 A;  5MLC 3;  8RXN A;  3NFP I;  1R0J A;  1OWC A;  1IU6 A;  2Z3Q B;  3WWL A;  2LCQ A;  1QYB A;  5GAG c;  2PVX A;  5IY0 A;  2PSM C;  1NXG A;  2HR5 A;  1NXE A;  1RYQ A;  3KYX A;  2XJP A;  3WWN B;  2KN9 A;  7RXN A;  4POF A;  4YWL A;  2PVE A;  1VZH A;  4E6Y A;  1IW7 D;  3PWF A;  2L0Z A;  1JYB A;  1R0G A;  1RYT A;  2BE5 D;  2M6O A;  4LHL A;  3PIP 1;  1VCX A;  4JAD A;  4B8C D;  1FHM A;  4AHX A;  3RZT A;  1IRO A;  1S2Z A;  2C6A A;  3P8B A;  4JAG A;  3SS2 A;  4AI2 A;  1DX8 A;  5H1S c;  1DVB A;  1B13 A;  2AYJ A;  5MFP A;  2A6H D;  3B0A B;  4AHY A;  3KYW A;  4ZN3 B;  2MS3 A;  3LNL A;  2XJS A;  1SMU A;  1SMW A;  3MSU A;  2RDV A;  4UY8 1;  1S30 A;  1C09 A;  3P2A A;  2V3B B;  4AR3 A;  3KYY A;  4LHN A;  3B08 B;  1B71 A;  1RDV A;  2QL0 A;  5JVG 1;  2M6P A;  2JI3 A;  3PKJ A;  3KYV A;  2XJV A;  1WJV A;  2PYA A;  1VZG A;  4G6B A;  4ME3 A;  2DSX A;  4XXB B;  2CKA A;  4AHW A;  2GMG A;  1QCV A;  4U67 1;  1YK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...