2L0ZA

Solution structure of a zinc-binding domain from the junin virus envelope glycoprotein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
41
structure length
41
Chain Sequence
b'PTHRHIRGEACPLPHRLNSLGGCRCGKYPNLKKPTVWRRGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glycoprotein G2
publication title Structure of a Zinc-binding Domain in the Junin Virus Envelope Glycoprotein.
pubmed doi rcsb
molecule tags Viral protein
total genus 4
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2010-07-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.180 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2l0zA00
2L0ZA
chains in the Genus database with same CATH superfamily
1SMMA 2C6BA 2Z3QB 1WJVA 2XJQA 3RZOL 1QQTA 5M3ML 1Y1VL 5JVH1 3J7Y1 3S2HL 4AI1A 1PZXA 2NVQL 2NYDA 1SMUA 2O5JD 3GTKL 1NXEA 5GAEc 2JI1A 1SMWA 3H0GL 5M5WL 4POGA 5IP7L 5M3FL 3RZDL 1PFUA 1Z92B 7RXNA 4AHXA 5GAGc 4A3EL 1OWCA 3MSUA 2AYJA 5K2ME 3S17L 2JI2A 4TVMA 1IROA 1FHHA 4A3JL 1YK4A 2E2IL 3HOUL 3I4ML 5MF6A 2V0EA 4AR5A 4Y7NL 4A3LL 1IW7D 2AQCA 3SS2A 2B63L 3H3VM 1S24A 1ZRPA 3P2AA 4AI3A 1I6HL 1B2JA 4GS7D 2R93L 2B5ID 3LWRB 1PFYA 4BXXL 3PIO1 2PVXA 1WCML 4YWLA 3M4OL 4ZN1B 5IYBL 4AR6A 2E2JL 1NNQA 1T9PA 3B0AB 8RXNA 1I50L 1TWAL 5EIOC 4BY7L 1DVBA 1IU6A 3GTQL 2XJSA 5FJ8L 2HVYC 5MFPA 3LWVB 2K2DA 2R92L 1R0HA 5AN9H 5GAHc 1LKMA 3CQZL 1DX8A 3NFPI 4A3BL 1E8JA 3S2DL 2L0ZA 4JAFA 1QCVA 1JYBA 2RFKB 3KYUA 1R0FA 4AHWA 3S15L 4U671 1R0JA 1C09A 2CKCA 2XJVA 2XJRA 2RDVA 3GTOL 1S2ZA 5IP9L 3GTML 5C4XL 3S1ML 5GADc 3M3YL 4A3FL 1RWDA 4X6AL 4A3ML 3PKJA 2E2HL 1VZHA 4BY1L 4YWMA 4BBRL 3KYYA 2YU9L 5AI3A 1R0GA 3HOYL 3LWQB 4G6BA 3MPSA 3HJYB 4AHZA 3FDJA 2JA8L 3LWPB 1YUZA 3B08B 1YUXA 2M4VA 2ZIXA 5MFZA 5IYCL 1RDVA 3FKIL 5MLC3 3LNLA 1LTLA 1TWGL 4XGHA 2NVYL 4TPUA 2H12A 3HKZP 3S1RL 4Y52L 5JVG1 2LCQA 3MQKB 2VL6A 1ODHA 4A3IL 3S14L 4BBSL 1CAAA 3GTPL 1K83L 1BFYA 4ZN3B 2C6AA 3S1NL 4LHLA 1FHMA 2JI3A 1T9QA 3K7AL 3GTGL 4C3JL 3QVDA 1F4LA 1BRFA 1B71A 2JA7L 2A68D 3S16L 3S1QL 2PYAA 3KYWA 4K9FA 3KYXA 4LHNA 5IY0A 4A3GL 2QL0A 1NXGA 1PFVA 2EY4E 1VCXA 3QQCE 1TWFL 4WFN1 4C3IL 5M5XL 4QIWP 2ERSA 2M4YA 4A3DL 1BQ9A 1RYTA 3GTJL 2A6ED 2M6OA 2ERJA 4AHYA 3LWOB 4XXBB 1T9OA 2APOB 2Y0SP 4ME3A 3LPEB 5AI2A 1RDGA 3H97A 4A3CL 3WWNB 4A93L 4AR3A 2JA6L 5MGNA 3H9CA 4RXNA 1YK5A 4UY81 3PL5A 4JAGA 4C3HL 4A3KL 3PKIA 3IU3I 3HOWL 1OWBA 5M5YL 1LKPA 1CADA 3WWLA 2DSXA 2JA5L 2XJUA 2WAQP 4AYBP 2Z3RB 3RZTA 3HAXC 1I3QL 2GMGA 4AI2A 2J9UB 6RXNA 2XJPA 1S30A 3PO2L 1VZGA 2M6PA 2KN9A 3A44A 1P7PA 3PWFA 5FLML 3HJWB 1IRNA 1YV1A 2MS3A 3H9BA 1H7VA 2PVEA 1B2OA 4V196 1SFOL 5EINC 2R7ZL 2V3BB 3GTLL 1B13A 4AI0A 4AR4A 3PO3L 2A69D 3RYGA 3PZAA 3JR7A 2PSMC 2NVXL 1BQ8A 1BE7A 5DM61 1QYBA 1RYQA 2NVTL 1R0IA 5C4JL 3J7Z1 5IYDL 2KKDA 3HOVL 4B8CD 3HOXL 1R9TL 1RB9A 2HR5A 3H99A 2BE5D 2PPTA 4JAEA 1Y1WL 5H1Sc 1IU5A 1LKOA 1PFWA 3P8BA 1TWHL 4C2M1 4JADA 3I4NL 4E6YA 5C44L 2A6HD 5DM71 1VZIA 2WB1P 5RXNA 1TWCL 3VPBE 2XJTA 5C3EL 3RZ6A 2V0FA 2VUML 2CKAA 2CR8A 3KYVA 3PIP1 2PMZP 3HOZL 2AUSB 4POFA 3ZG6A 3K35A
chains in the Genus database with same CATH topology
1IRNA 1SMMA 2L0ZA 2C6BA 3QVDA 2Z3QB 1WJVA 1YV1A 2MS3A 2XJQA 1H7VA 4JAFA 1QCVA 1BRFA 1JYBA 2PVEA 1B2OA 1B71A 2A68D 3KYUA 5JVH1 1R0FA 3J7Y1 4V196 4AHWA 4AI1A 2PYAA 2NYDA 1SMUA 4U671 2O5JD 3KYWA 4K9FA 1R0JA 1NXEA 5EINC 3KYXA 4LHNA 1C09A 2CKCA 2XJVA 5GAEc 2XJRA 5IY0A 2QL0A 2RDVA 2JI1A 2V3BB 1SMWA 1NXGA 1B13A 4AI0A 1VCXA 3QQCE 4AR4A 4WFN1 1S2ZA 4POGA 2A69D 3RYGA 5GADc 2ERSA 2M4YA 3PZAA 1Z92B 2PSMC 7RXNA 4AHXA 5GAGc 1RWDA 1BQ8A 1BQ9A 1RYTA 3PKJA 2A6ED 1BE7A 1OWCA 1VZHA 2ERJA 2M6OA 4YWMA 3MSUA 1QYBA 2AYJA 4AHYA 5DM61 5K2ME 1RYQA 2JI2A 4TVMA 1IROA 3KYYA 4XXBB 1R0IA 1FHHA 1T9OA 5AI3A 1R0GA 3J7Z1 1YK4A 4G6BA 4ME3A 3LPEB 5AI2A 2KKDA 1RDGA 3MPSA 4B8CD 5MF6A 4AHZA 2V0EA 4AR5A 1YUZA 1RB9A 2HR5A 1YUXA 3B08B 3WWNB 4AR3A 2M4VA 2BE5D 1IW7D 2PPTA 2ZIXA 4JAEA 5MFZA 5H1Sc 1RDVA 1IU5A 1LKOA 5MGNA 5MLC3 3LNLA 1LTLA 3SS2A 3P8BA 1S24A 1ZRPA 3P2AA 4RXNA 4AI3A 1YK5A 4UY81 1B2JA 4GS7D 4JADA 4JAGA 2B5ID 4XGHA 4E6YA 3PKIA 3IU3I 3PIO1 2A6HD 4TPUA 5DM71 1OWBA 2PVXA 1VZIA 2H12A 4YWLA 5RXNA 1LKPA 4ZN1B 5JVG1 1CADA 3WWLA 3VPBE 4AR6A 2DSXA 2XJTA 2LCQA 1NNQA 1T9PA 3B0AB 8RXNA 2VL6A 3RZ6A 2V0FA 5EIOC 1DVBA 2XJUA 1IU6A 2CKAA 1ODHA 2Z3RB 2XJSA 2CR8A 3KYVA 3RZTA 2GMGA 5MFPA 3PIP1 4AI2A 2K2DA 1CAAA 2J9UB 6RXNA 2XJPA 1BFYA 1S30A 1R0HA 4ZN3B 5AN9H 2C6AA 1VZGA 5GAHc 1LKMA 1FHMA 2M6PA 2KN9A 3A44A 3PWFA 4LHLA 2JI3A 1DX8A 3NFPI 1T9QA 4POFA 3ZG6A 3K35A 1E8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0Z A; 
#chains in the Genus database with same CATH topology
 1SMM A;  2C6B A;  2Z3Q B;  1WJV A;  2XJQ A;  3RZO L;  1QQT A;  5M3M L;  1Y1V L;  5JVH 1;  3J7Y 1;  3S2H L;  4AI1 A;  1PZX A;  2NVQ L;  2NYD A;  1SMU A;  2O5J D;  3GTK L;  1NXE A;  5GAE c;  2JI1 A;  1SMW A;  3H0G L;  5M5W L;  4POG A;  5IP7 L;  5M3F L;  3RZD L;  1PFU A;  1Z92 B;  7RXN A;  4AHX A;  5GAG c;  4A3E L;  1OWC A;  3MSU A;  2AYJ A;  5K2M E;  3S17 L;  2JI2 A;  4TVM A;  1IRO A;  1FHH A;  4A3J L;  1YK4 A;  2E2I L;  3HOU L;  3I4M L;  5MF6 A;  2V0E A;  4AR5 A;  4Y7N L;  4A3L L;  1IW7 D;  2AQC A;  3SS2 A;  2B63 L;  3H3V M;  1S24 A;  1ZRP A;  3P2A A;  4AI3 A;  1I6H L;  1B2J A;  4GS7 D;  2R93 L;  2B5I D;  3LWR B;  1PFY A;  4BXX L;  3PIO 1;  2PVX A;  1WCM L;  4YWL A;  3M4O L;  4ZN1 B;  5IYB L;  4AR6 A;  2E2J L;  1NNQ A;  1T9P A;  3B0A B;  8RXN A;  1I50 L;  1TWA L;  5EIO C;  4BY7 L;  1DVB A;  1IU6 A;  3GTQ L;  2XJS A;  5FJ8 L;  2HVY C;  5MFP A;  3LWV B;  2K2D A;  2R92 L;  1R0H A;  5AN9 H;  5GAH c;  1LKM A;  3CQZ L;  1DX8 A;  3NFP I;  4A3B L;  1E8J A;  3S2D L;  2L0Z A;  4JAF A;  1QCV A;  1JYB A;  2RFK B;  3KYU A;  1R0F A;  4AHW A;  3S15 L;  4U67 1;  1R0J A;  1C09 A;  2CKC A;  2XJV A;  2XJR A;  2RDV A;  3GTO L;  1S2Z A;  5IP9 L;  3GTM L;  5C4X L;  3S1M L;  5GAD c;  3M3Y L;  4A3F L;  1RWD A;  4X6A L;  4A3M L;  3PKJ A;  2E2H L;  1VZH A;  4BY1 L;  4YWM A;  4BBR L;  3KYY A;  2YU9 L;  5AI3 A;  1R0G A;  3HOY L;  3LWQ B;  4G6B A;  3MPS A;  3HJY B;  4AHZ A;  3FDJ A;  2JA8 L;  3LWP B;  1YUZ A;  3B08 B;  1YUX A;  2M4V A;  2ZIX A;  5MFZ A;  5IYC L;  1RDV A;  3FKI L;  5MLC 3;  3LNL A;  1LTL A;  1TWG L;  4XGH A;  2NVY L;  4TPU A;  2H12 A;  3HKZ P;  3S1R L;  4Y52 L;  5JVG 1;  2LCQ A;  3MQK B;  2VL6 A;  1ODH A;  4A3I L;  3S14 L;  4BBS L;  1CAA A;  3GTP L;  1K83 L;  1BFY A;  4ZN3 B;  2C6A A;  3S1N L;  4LHL A;  1FHM A;  2JI3 A;  1T9Q A;  3K7A L;  3GTG L;  4C3J L;  3QVD A;  1F4L A;  1BRF A;  1B71 A;  2JA7 L;  2A68 D;  3S16 L;  3S1Q L;  2PYA A;  3KYW A;  4K9F A;  3KYX A;  4LHN A;  5IY0 A;  4A3G L;  2QL0 A;  1NXG A;  1PFV A;  2EY4 E;  1VCX A;  3QQC E;  1TWF L;  4WFN 1;  4C3I L;  5M5X L;  4QIW P;  2ERS A;  2M4Y A;  4A3D L;  1BQ9 A;  1RYT A;  3GTJ L;  2A6E D;  2M6O A;  2ERJ A;  4AHY A;  3LWO B;  4XXB B;  1T9O A;  2APO B;  2Y0S P;  4ME3 A;  3LPE B;  5AI2 A;  1RDG A;  3H97 A;  4A3C L;  3WWN B;  4A93 L;  4AR3 A;  2JA6 L;  5MGN A;  3H9C A;  4RXN A;  1YK5 A;  4UY8 1;  3PL5 A;  4JAG A;  4C3H L;  4A3K L;  3PKI A;  3IU3 I;  3HOW L;  1OWB A;  5M5Y L;  1LKP A;  1CAD A;  3WWL A;  2DSX A;  2JA5 L;  2XJU A;  2WAQ P;  4AYB P;  2Z3R B;  3RZT A;  3HAX C;  1I3Q L;  2GMG A;  4AI2 A;  2J9U B;  6RXN A;  2XJP A;  1S30 A;  3PO2 L;  1VZG A;  2M6P A;  2KN9 A;  3A44 A;  1P7P A;  3PWF A;  5FLM L;  3HJW B;  1IRN A;  1YV1 A;  2MS3 A;  3H9B A;  1H7V A;  2PVE A;  1B2O A;  4V19 6;  1SFO L;  5EIN C;  2R7Z L;  2V3B B;  3GTL L;  1B13 A;  4AI0 A;  4AR4 A;  3PO3 L;  2A69 D;  3RYG A;  3PZA A;  3JR7 A;  2PSM C;  2NVX L;  1BQ8 A;  1BE7 A;  5DM6 1;  1QYB A;  1RYQ A;  2NVT L;  1R0I A;  5C4J L;  3J7Z 1;  5IYD L;  2KKD A;  3HOV L;  4B8C D;  3HOX L;  1R9T L;  1RB9 A;  2HR5 A;  3H99 A;  2BE5 D;  2PPT A;  4JAE A;  1Y1W L;  5H1S c;  1IU5 A;  1LKO A;  1PFW A;  3P8B A;  1TWH L;  4C2M 1;  4JAD A;  3I4N L;  4E6Y A;  5C44 L;  2A6H D;  5DM7 1;  1VZI A;  2WB1 P;  5RXN A;  1TWC L;  3VPB E;  2XJT A;  5C3E L;  3RZ6 A;  2V0F A;  2VUM L;  2CKA A;  2CR8 A;  3KYV A;  3PIP 1;  2PMZ P;  3HOZ L;  2AUS B;  4POF A;  3ZG6 A;  3K35 A; 
#chains in the Genus database with same CATH homology
 1IRN A;  1SMM A;  2L0Z A;  2C6B A;  3QVD A;  2Z3Q B;  1WJV A;  1YV1 A;  2MS3 A;  2XJQ A;  1H7V A;  4JAF A;  1QCV A;  1BRF A;  1JYB A;  2PVE A;  1B2O A;  1B71 A;  2A68 D;  3KYU A;  5JVH 1;  1R0F A;  3J7Y 1;  4V19 6;  4AHW A;  4AI1 A;  2PYA A;  2NYD A;  1SMU A;  4U67 1;  2O5J D;  3KYW A;  4K9F A;  1R0J A;  1NXE A;  5EIN C;  3KYX A;  4LHN A;  1C09 A;  2CKC A;  2XJV A;  5GAE c;  2XJR A;  5IY0 A;  2QL0 A;  2RDV A;  2JI1 A;  2V3B B;  1SMW A;  1NXG A;  1B13 A;  4AI0 A;  1VCX A;  3QQC E;  4AR4 A;  4WFN 1;  1S2Z A;  4POG A;  2A69 D;  3RYG A;  5GAD c;  2ERS A;  2M4Y A;  3PZA A;  1Z92 B;  2PSM C;  7RXN A;  4AHX A;  5GAG c;  1RWD A;  1BQ8 A;  1BQ9 A;  1RYT A;  3PKJ A;  2A6E D;  1BE7 A;  1OWC A;  1VZH A;  2ERJ A;  2M6O A;  4YWM A;  3MSU A;  1QYB A;  2AYJ A;  4AHY A;  5DM6 1;  5K2M E;  1RYQ A;  2JI2 A;  4TVM A;  1IRO A;  3KYY A;  4XXB B;  1R0I A;  1FHH A;  1T9O A;  5AI3 A;  1R0G A;  3J7Z 1;  1YK4 A;  4G6B A;  4ME3 A;  3LPE B;  5AI2 A;  2KKD A;  1RDG A;  3MPS A;  4B8C D;  5MF6 A;  4AHZ A;  2V0E A;  4AR5 A;  1YUZ A;  1RB9 A;  2HR5 A;  1YUX A;  3B08 B;  3WWN B;  4AR3 A;  2M4V A;  2BE5 D;  1IW7 D;  2PPT A;  2ZIX A;  4JAE A;  5MFZ A;  5H1S c;  1RDV A;  1IU5 A;  1LKO A;  5MGN A;  5MLC 3;  3LNL A;  1LTL A;  3SS2 A;  3P8B A;  1S24 A;  1ZRP A;  3P2A A;  4RXN A;  4AI3 A;  1YK5 A;  4UY8 1;  1B2J A;  4GS7 D;  4JAD A;  4JAG A;  2B5I D;  4XGH A;  4E6Y A;  3PKI A;  3IU3 I;  3PIO 1;  2A6H D;  4TPU A;  5DM7 1;  1OWB A;  2PVX A;  1VZI A;  2H12 A;  4YWL A;  5RXN A;  1LKP A;  4ZN1 B;  5JVG 1;  1CAD A;  3WWL A;  3VPB E;  4AR6 A;  2DSX A;  2XJT A;  2LCQ A;  1NNQ A;  1T9P A;  3B0A B;  8RXN A;  2VL6 A;  3RZ6 A;  2V0F A;  5EIO C;  1DVB A;  2XJU A;  1IU6 A;  2CKA A;  1ODH A;  2Z3R B;  2XJS A;  2CR8 A;  3KYV A;  3RZT A;  2GMG A;  5MFP A;  3PIP 1;  4AI2 A;  2K2D A;  1CAA A;  2J9U B;  6RXN A;  2XJP A;  1BFY A;  1S30 A;  1R0H A;  4ZN3 B;  5AN9 H;  2C6A A;  1VZG A;  5GAH c;  1LKM A;  1FHM A;  2M6P A;  2KN9 A;  3A44 A;  3PWF A;  4LHL A;  2JI3 A;  1DX8 A;  3NFP I;  1T9Q A;  4POF A;  3ZG6 A;  3K35 A;  1E8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...